4N5XA

Crystal structure of n-terminal calmodulin-like calcium sensor of human mitochondrial atp-mg/pi carrier scamc1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
155
Chain Sequence
TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
publication title A Self-Sequestered Calmodulin-like Ca(2+) Sensor of Mitochondrial SCaMC Carrier and Its Implication to Ca(2+)-Dependent ATP-Mg/Pi Transport.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n5xA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n5xA02
1C7VA 1K95A 1B8RA 2LLTA 1F8HA 1ODBA 2HETA 2KDHA 3A8RA 1TRFA 1IWQA 2FCDA 2Y1MA 3O6BA 4AQIA 3AKAA 1A75A 2CCMA 2LMTA 5I8NA 4N1GA 1PVBA 1KCYA 1JUOA 1KFXL 3BOWA 2COLB 1NUBA 2BL0C 1KQVA 2IS9A 5G08A 1SNLA 3AAJA 4A4CA 2KBIA 1EXRA 2GGZA 2NLNA 3LK0A 4XYNA 4GNKB 5D7FA 5DKRA 5HLOA 2K8MB 2LE9B 3CWGA 4GBAA 1XO5A 1QJTA 2MBXA 2LNKA 1KWOC 1AVSA 1NCYA 2M3WA 1L2OB 4OVNF 1B4CA 2BKIB 4PE7A 2JTZA 1A29A 5KU1A 1EG4A 2HF5A 2K61A 5HYDA 1QXPA 4GAOA 1S5GZ 2M49B 4I5JA 2PMYA 2O5GA 2ZNDA 2LMVA 2K0JA 1WLZA 1DF0A 1B47A 3BUXB 1EG3A 2HQ8A 2BE4A 3NSKA 2ZKMX 3NSIA 1S6IA 1XFVO 1JFKA 2WCFA 3I5FC 1FF1A 2HPSA 3WHUB 4HRGA 1OOJA 2M1UA 3JVTB 4OKHA 1IQ3A 2LVJA 1YTZC 1NX3A 1NX0A 5AERA 4CLNA 1XFZO 1CMGA 3JTDB 1U5IB 2BE6A 4YGCB 1LKJA 4I5NB 2LLUA 5IBWA 1G4YR 1OZOA 2L51A 1DJHA 1LXFC 2LAPA 1Y0VH 4JWQA 4YGAA 2M1KB 1FPWA 3IQOA 5FYXA 4XJKA 3CR2A 4JPZB 1OSAA 1MHOA 1KFXS 3DF0A 3VGOA 1CTRA 2KGRA 3DVKA 1K96A 1A2XA 1NYAA 1JWDA 1UUSA 3GK2A 2ZFDA 1E8AA 1YX8A 2JULA 3KPXA 2LVVA 3TDZA 2KFHA 1Y1AA 5ER5A 1LA3A 1SK6D 2OTGC 2M8UA 2MHHA 1DVIA 2L4HA 2JT0A 4GUKA 2WCEA 2M7LA 3IQQA 1K9PA 2MRDA 5HKYA 3SIBA 1SMGA 1JC2A 1KQMB 1SBJA 4I5LB 4Q04A 3VRPA 3EK4A 4AOMA 1WDCB 3E3RA 1A75B 4P2YB 1XYDA 1WLMA 2KQYA 3TS5C 3SG7A 3TDUA 3CS1A 3BOWB 4L9MA 1OMDA 2O60A 1SKTA 1SCMB 2JTTA 3VRNA 4MZLA 3OB1B 3D0YB 1QASA 3EKJA 4YGEB 3FS7A 4PALA 5J3XA 1TOPA 1PVAA 1MXLC 3OX5A 3LCPC 1OQPA 4HRHA 5HKWA 2RGIA 3I5HB 2G9BA 3WXAA 1JSAA 1QIWA 3BUOB 4C0LA 2H61A 2A4JA 1YVHA 3PN7B 2KYFA 1PULA 4MZKA 4ORCB 2BCBA 1W7IB 4U8DA 3GOFA 3BQ3A 3PSRA 2F8PA 1QLSA 3MSEB 4YBHB 2ZRTA 1CB1A 2JT3A 1S1EA 1RJVA 4D1EA 1IH0A 1QV0A 2KFFA 4WQ2A 2KI4B 3RLZA 2L4IA 3SG4A 4QJ4B 1Y1XA 5CSFA 3SJSA 4PHNA 1YUSA 4NDCA 2CTNA 1LVCD 2Q91A 2BBMA 1DJZA 2MLFC 4FQOA 2CNPA 1K8UA 1TN4A 4GFTA 3DVMA 2Q4UA 1S36A 1NX2A 1XA5A 2KBMA 2KHNA 3VROA 1CFCA 3GK4X 1RTP1 1Q80A 1QVIY 3TZ1A 4DUQA 3KO0A 5BPJA 2OS8C 5K89A 3CTNA 1L2OC 1GGZA 1YVLA 2CBLA 1YUUA 2EHBA 1SL9A 3A4UB 1TNPA 2FJUB 4YRUA 3EK8A 3NXAA 4N1FA 2CT9A 1AP4A 1CDPA 4N5XA 1KFUL 2I18A 4NQGA 2OPOA 3EK7A 1J7QA 1TCOB 1V1FA 3PFVA 1AJ5A 3PLFB 2LP3A 2VRGA 3DVJA 3FWBA 3PM8A 5AANA 1B8CA 1TIZA 2JXLA 1XFYO 3OX6A 4PDZA 1N0YA 2L50A 3JVTC 2JC2A 4MRXA 1YRUB 3HCMA 2F3ZA 1UHIA 2PVBA 1QS7A 1PSRA 2LUCA 2KSPA 1BJFA 4PE1A 2EC6C 1BU3A 3DD4A 2M9GA 5D69A 4ETOA 1YRTB 1TTXA 2MAZA 1FW4A 3RM1A 2BL0B 4NDBA 2LM5A 5I2OA 1A4PA 4MVFA 4USLA 2JU0A 1CDNA 3KEVA 1DT7B 1MWNA 1KK7Y 3CR4X 1NCZA 4MZJA 1J55A 5DKNA 1CM1A 4QJ5B 1WRZA 1JBAA 1PALA 1RECA 2KOTA 3H4SE 4PCWA 1K2HA 4YI8A 1C07A 1B7TY 3CZTX 3HX4A 1C7WA 1H8BA 2M97A 2B1UA 2K2FA 5CPVA 1DJIA 2LP2A 1X02A 1SW8A 4PHJA 1H4BA 1DGVA 1CFDA 4F0ZB 1GQMA 2I2RE 1S26D 3M0WA 4ORBB 1MR8A 3QRXA 3I5FB 5HKZA 1FI6A 2JNXA 3I5GB 2JRFA 1MUXA 3WHTB 2Y5IA 2P6BB 1A03A 1IG5A 4GPLB 4DRWA 2ZNEA 3O2PA 5I2QA 1V1GA 2AMIA 1FBVA 2G2BA 2FCEA 2PALA 1EL4A 1ZOTB 1M45A 5CSIA 4HSZA 2LMUA 2BKHB 5CSNA 3CGAA 1CLLA 2WOSA 2KAXA 2D8NA 1OMRA 5PALA 1GGWA 5HLVA 1SR6B 1KK8C 2JOJA 5GQQC 4PHKA 1S6JA 5B8IB 1WRLA 1BOCA 1NPQA 1MXEA 2MJWB 2KYCA 2ZRSA 1S5GY 3BYAA 1QTXA 2OTGB 2KQ6A 1M46A 5CSJA 4C0JA 3OP0A 2L0PA 1RFJA 1SPYA 2LHIA 3LL8B 3BUMB 2LCPA 5AXIA 3VRQA 1YR5A 2F3YA 2K7DA 4OCIA 1XFUO 2AAOA 2K7OA 1DF0B 1K93D 2K2AA 3ZNIA 4P5OE 1ZMZA 3I5IB 4NDDA 2L2EA 2F2PA 2WC8A 1OZSA 2BBNA 5TNCA 1DJWA 2Y4QA 3KF9A 1TCFA 1J7OA 1FI5A 2JPTA 3SG3A 3F45A 4PE4A 1L7ZA 4PHMA 1TNWA 2KAVA 1QATA 2JT8A 1WRKA 1SL8A 1XK4C 4MEWA 4MBEA 1QV1A 1D1OA 1LINA 1J7RA 2ZN8A 4OR9B 1F70A 4IL1A 1BT6A 3TUYB 4XJKB 5I2LA 1J1DA 4TNCA 4GGNA 1B9AA 3DF0B 1DGUA 4GGFC 2I94A 3SG6A 2NZ0A 2WORA 4CIDA 1BR1B 2WCBA 3O78A 4CFQA 4C0KA 1AUIB 1UHNA 1N2DA 1RROA 4MN0A 1B1GA 3KHEA 1RWYA 1MF8B 1Y1UA 1YUTA 2QACA 3PALA 1PSBA 1K9UA 2ZN9A 1TNXA 1IKUA 2E6WA 4BY4A 3WNXB 1HQVA 2QPTA 3AAKA 3O4YA 1BR4B 2M0RA 4AQJA 1QLKA 3D0YA 2CXJA 3ZWHA 1B8LA 3JTDC 2F2OA 4DCKA 1PK0D 1JFJA 1HT9A 3EVVA 1IQ5A 1OMVA 2MLEC 1VRKA 1ZFSA 3NSOA 2LLSA 2OS8B 4CPVA 2AUCA 1M63B 1SCVA 1CM4A 3NSLA 2R2IA 2H61C 3BUWB 1NIWA 1R2UA 1GJYA 3FIAA 4FTGA 3GK1A 4MLWA 2JXCA 4YGDB 4UPGA 1CMFA 1IGVA 1IJ6A 1DJXA 2KGBC 3ICBA 2DOQA 3IF7A 1QIVA 2Y1NA 1CFPA 1QX5B 1KWOB 3LLEA 5ER4X 1JF2A 3C1VA 2JZIA 1S6CA 1XFXO 4I5KA 4ZCUA 2BECA 4YGBB 1XVJA 1F71A 1MQ1A 1OE9B 4M2OA 1AJ4A 1KSMA 3I5GC 1QX2A 2NXQA 1UHJA 2NCOA 2LANA 4ZCVA 2M7NA 1DTLA 3FWCA 1CNPA 1Y6WA 1KQMC 3LK1A 1BMOA 2I7AA 1SYMA 1WDCC 3K21A 1K9KA 5F6TA 3OB2B 1ALWA 4JQ0D 3D10A 2EC6B 1G8IA 1KFUS 2V53A 2KI6D 2LHLA 5AEQA 2SCPA 4YI9A 1NP8A 4ORAB 1IJ5A 1N65A 1SCMC 4QJ3B 1BODA 2L98A 1QVIZ 2BCAA 1PRWA 1DMOA 1K90D 3AKBA 1YURA 2PASA 2LVKA 1ZACA 2KAYA 2L5XB 2KFGA 1J7PA 5AFPA 1SR6C 3BUNB 1AK8A 3EVUA 1R6PA 2KNEA 1NSHA 1UHKA 1XK4A 1NCXA 3VRRA 1F55A 2JNFA 3SG2A 3I5HC 1M39A 2WNDA 4ICBA 3PN7C 1ALVA 2E30A 2LV7A 1SRAA 1DJGA 1EJ3A 1RK9A 2GGMA 2H2KA 3BXKA 4GGFA 4BY5A 3CR5X 2GV5A 4E68A 2JQ6A 2ISDA 1F54A 4CFRA 2SASA 1WY9A 5JOLA 4DS7A 1SY9A 4WRIA 1F4OA 1EH2A 1XFWO 5JJGA 2MA2A 1F4QA 3I5IC 1S3PA 1CLMA 3OHMB 4HREE 1M31A 1NWDA 1SL7A 3EVRA 2KI4C 4DIRA 1BF5A 2LVIA 2K7BA 1DJYA 1CLBA 2FOTA 1BLQA 1K94A 3SG5A 2NCPA 3CLNA 1CFFA 2TN4A 1J1EA 1U5IA 1UURA 3SIAA 4M2PA 3TS5B 2BCXA 3TDIA 1KK7Z 1CDMA 5KTYA 2LUXA 3DVEA 4MSPA 4WQ3A 1KSOA 4MRYA 1CDLA 1IRJA 3PATA 5DKQA 1BG1A 4OV2A 1AHRA 3TUYC 1UWOA 2PRUA 2LC5A 2KI6C 2F33A 1KK8B 1NX1A 1B7TZ 1UHHA 5KSZA 4R1EA 1TNQA 2PSRA 4M2QA 4A4BA 3EKHA 1W7JB 4PE0A 2HQWA 1CKKA 2M29A 1ZUZA 1G33A 2EGDA 1YX7A 1LA0A 1JF0A 2JWWA 2K7CA 1QX7A 1UP5A
chains in the Genus database with same CATH superfamily
1C7VA 1K95A 1B8RA 2LLTA 1F8HA 1ODBA 2HETA 2KDHA 3A8RA 1TRFA 1IWQA 2FCDA 2Y1MA 3O6BA 4AQIA 3B7AA 3AKAA 1A75A 2CCMA 2LMTA 5I8NA 4N1GA 4PT1A 1PVBA 1KCYA 5DICA 1JUOA 1KFXL 3BOWA 2COLB 1NUBA 1T14A 2BL0C 1KQVA 2IS9A 5G08A 1SNLA 3AAJA 4A4CA 2KBIA 3CZ1A 1EXRA 2GGZA 2NLNA 3LK0A 4XYNA 4GNKB 1ORGA 5D7FA 5DKRA 5HLOA 2K8MB 3PJIA 2LE9B 3CWGA 4GBAA 1XO5A 1QJTA 2MBXA 2LNKA 1KWOC 1AVSA 1NCYA 2K60A 2M3WA 3N7HA 1L2OB 4OVNF 1B4CA 2BKIB 4PE7A 2JTZA 1A29A 5KU1A 1EG4A 1QWVA 2HF5A 2K61A 5HYDA 1QXPA 4GAOA 1S5GZ 2M49B 1XFRA 2PMYA 2O5GA 2ZNDA 2LMVA 4I5JA 2K0JA 1WLZA 1DF0A 1Z2CB 1B47A 3BUXB 3S0BA 1EG3A 2HQ8A 2BE4A 2PYQA 3NSKA 2ZKMX 3NSIA 1S6IA 1XFVO 1JFKA 2WCFA 3I5FC 1FF1A 2HPSA 1W9ZA 3WHUB 4HRGA 1OOJA 2M1UA 3CABA 3NHIA 3JVTB 4OKHA 1IQ3A 2QEBA 2LVJA 4IJ7A 1YTZC 1NX3A 1NX0A 3SS5A 5EL2A 5AERA 3S0DA 4CLNA 1XFZO 1CMGA 3JTDB 1U5IB 2BE6A 4YGCB 1LKJA 4I5NB 2LLUA 5IBWA 1G4YR 1OZOA 2L51A 1DJHA 1LXFC 2LAPA 1Y0VH 4JWQA 5HL1A 4YGAA 5D3OA 2M1KB 1C3ZA 3IQOA 1FPWA 5FYXA 3R72A 4XJKA 3CR2A 4JPZB 1OSAA 1MHOA 1KFXS 3DF0A 3L47A 1CTRA 2KGRA 3DVKA 3VGOA 1K96A 1A2XA 1NYAA 2JPOA 1UUSA 1JWDA 3GK2A 1OW4A 2ZFDA 1E8AA 1YX8A 2JULA 3KPXA 3D78A 2LVVA 3TDZA 2KFHA 2QEHA 1Y1AA 5ER5A 1LA3A 1SK6D 2OTGC 2M8UA 2MHHA 1DVIA 2L4HA 2JT0A 4GUKA 2WCEA 4INWA 2M7LA 3IQQA 1K9PA 2MRDA 5HKYA 3SIBA 1SMGA 1JC2A 1KQMB 1SBJA 4I5LB 3FE8A 4Q04A 2FJYA 3EK4A 3VRPA 1WDCB 3E3RA 4AOMA 1A75B 4P2YB 1XYDA 1WLMA 2KQYA 3TS5C 1OOGA 3SG7A 3TDUA 3CS1A 3BOWB 4L9MA 1OMDA 2O60A 1SKTA 1SCMB 2JTTA 1OOHA 3OBVA 3VRNA 4MZLA 3OB1B 3D0YB 1QASA 3EKJA 4YGEB 3FS7A 3RZSA 4PALA 5J3XA 1TOPA 1PVAA 1MXLC 3OX5A 3LCPC 1OQPA 4HRHA 5HKWA 2RGIA 3I5HB 2G9BA 3WXAA 1JSAA 1QIWA 2KPHA 3BUOB 4C0LA 2H61A 2A4JA 1YVHA 3PN7B 2WCKA 2KYFA 1PULA 4MZKA 4ORCB 2BCBA 3D77A 1W7IB 4U8DA 3GOFA 3BQ3A 3PSRA 2F8PA 1QLSA 3MSEB 4INXA 4YBHB 2BNXA 2ZRTA 1CB1A 2JT3A 1S1EA 3DXLA 1RJVA 4D1EA 1IH0A 1QV0A 2KFFA 2L2CA 4WQ2A 2KI4B 3RLZA 2L4IA 3SG4A 4QJ4B 1Y1XA 3K1EA 5CSFA 3SJSA 4PHNA 1YUSA 4NDCA 2CTNA 1LVCD 2Q91A 2BBMA 2P71A 1DJZA 2MLFC 4FQOA 2CNPA 1K8UA 1TN4A 4GFTA 3DVMA 2Q4UA 1S36A 1NX2A 1XA5A 2KBMA 2KHNA 3VROA 1CFCA 3GK4X 1RTP1 1Q80A 1QVIY 3TZ1A 4DUQA 3KO0A 5BPJA 2OS8C 5K89A 5FI7A 3CTNA 1L2OC 1GGZA 1YVLA 2CBLA 1YUUA 2EHBA 1SL9A 3A4UB 1TNPA 2FJUB 4YRUA 3EK8A 3NXAA 4N1FA 2CT9A 2ERBA 1AP4A 1CDPA 4N5XA 1KFUL 2I18A 4NQGA 2OPOA 3EK7A 1J7QA 1TCOB 2P70A 3D76A 1V1FA 3PFVA 3DY9A 4AQJA 1AJ5A 3PLFB 2LP3A 2VRGA 3B6XA 3DVJA 3FWBA 3PM8A 3QMEA 5AANA 1B8CA 1DELA 1TIZA 2JXLA 1TUJA 1XFYO 3OX6A 4PDZA 1N0YA 2QEVA 2L50A 3JVTC 2JC2A 3L4AA 1YRUB 2KLDA 3HCMA 3NHTA 4MRXA 2F3ZA 1UHIA 5FI6A 2PVBA 1QS7A 1PSRA 2LUCA 2KSPA 1BJFA 4PE1A 2EC6C 1BU3A 3DD4A 2M9GA 5D69A 4ETOA 1YRTB 1TTXA 3BFAA 2MAZA 1FW4A 3R1OA 2BL0B 4NDBA 3RM1A 2LM5A 5I2OA 1A4PA 4MVFA 4USLA 2JU0A 1CDNA 3KEVA 1DT7B 1DEKA 1MWNA 1KK7Y 3CR4X 1NCZA 4MZJA 1J55A 5DKNA 1P28A 1CM1A 3PM2A 4QJ5B 1WRZA 1JBAA 1PALA 1RECA 2KOTA 3H4SE 4PCWA 1K2HA 4YI8A 1C07A 1B7TY 3CZTX 3HX4A 1C7WA 1H8BA 2M97A 2B1UA 2QEOA 2K2FA 5CPVA 1DJIA 4F7FA 2LP2A 3UNWA 1X02A 1SW8A 4PHJA 4KYNA 3B88A 1H4BA 1DGVA 1CFDA 4F0ZB 1DC1A 1GQMA 2I2RE 1S26D 3M0WA 3SS4A 4ORBB 1MR8A 1TWOA 3QRXA 3I5FB 5HKZA 1FI6A 2JNXA 3I5GB 2JRFA 1MUXA 3WHTB 2Y5IA 2P6BB 3D75A 1A03A 3NGVA 1IG5A 4GPLB 4DRWA 2ZNEA 3O2PA 5I2QA 3EG5B 1V1GA 2AMIA 1FBVA 2G2BA 2FCEA 2PALA 1EL4A 1ZOTB 1M45A 5CSIA 4HSZA 2LMUA 3BFHA 2BKHB 5CSNA 3CGAA 1CLLA 2WOSA 2KAXA 2D8NA 1OMRA 1DQEA 3CZ0A 5HLVA 5PALA 1GGWA 1SR6B 1KK8C 2JOJA 5GQQC 4PHKA 3BFBA 1S6JA 5B8IB 1WRLA 1BOCA 1NPQA 3DZTA 1MXEA 2MJWB 2KYCA 2ZRSA 1S5GY 3BYAA 1QTXA 2OTGB 2KQ6A 1M46A 5CSJA 4C0JA 3OP0A 2L0PA 1RFJA 1SPYA 2LHIA 3IVTA 3LL8B 3BUMB 2LCPA 5AXIA 3VRQA 1YR5A 2F3YA 2K7DA 4OCIA 1XFUO 2AAOA 2K7OA 1DF0B 1K93D 2K2AA 3ZNIA 4P5OE 1ZMZA 3I5IB 4NDDA 2L2EA 2F2PA 2WC8A 1OZSA 2BBNA 5TNCA 1DJWA 2Y4QA 3KF9A 1TCFA 1J7OA 1FI5A 2JPTA 3SG3A 3F45A 2WC6A 4PE4A 1L7ZA 4PHMA 1TNWA 3B87A 2KAVA 1QATA 2JT8A 1WRKA 1SL8A 1XK4C 4MEWA 4MBEA 1QV1A 1D1OA 1LINA 1J7RA 2ZN8A 4OR9B 1F70A 2WCJA 4IL1A 1BT6A 3TUYB 4XJKB 5I2LA 1J1DA 4TNCA 4GGNA 1B9AA 3DF0B 1DGUA 4GGFC 2I94A 3SG6A 2NZ0A 2WORA 3DYEA 4CIDA 2WCLA 1BR1B 2WCBA 3O78A 4CFQA 4C0KA 1AUIB 1UHNA 1N2DA 1RROA 4MN0A 1B1GA 3KHEA 1RWYA 1MF8B 1Y1UA 1YUTA 2QACA 3FE6A 3PALA 1PSBA 1K9UA 2H8VA 1TNXA 2ZN9A 1IKUA 2E6WA 4BY4A 3WNXB 1HQVA 2QPTA 3AAKA 3O4YA 1BR4B 1TUZA 2M0RA 1QLKA 3D0YA 2CXJA 3ZWHA 1B8LA 3JTDC 2F2OA 4DCKA 1PK0D 1JFJA 1HT9A 1C3YA 3EVVA 1IQ5A 1OMVA 1Z4HA 3O4XA 2MLEC 3V2LA 1VRKA 1ZFSA 3NSOA 2LLSA 2OS8B 4CPVA 2AUCA 3S0EA 1M63B 1SCVA 1CM4A 3NSLA 3OGNA 2R2IA 2H61C 3BUWB 1NIWA 1R2UA 1GJYA 3FIAA 3L4LA 3GK1A 4FTGA 2JXCA 4MLWA 4YGDB 3B86A 4UPGA 1IGVA 1CMFA 1GM0A 1IJ6A 1DJXA 2KGBC 3ICBA 2DOQA 3IF7A 1QIVA 2Y1NA 1CFPA 1QX5B 1KWOB 3LLEA 5ER4X 1JF2A 1LS8A 3C1VA 2JZIA 1S6CA 1XFXO 4I5KA 4ZCUA 4OZDA 2BECA 4YGBB 1XVJA 1OOFA 1MQ1A 3CDNA 1F71A 3CZ2A 1OE9B 4M2OA 1AJ4A 1KSMA 3I5GC 1QX2A 2NXQA 1UHJA 2NCOA 2LANA 4ZCVA 2M7NA 3R1PA 1DTLA 3FWCA 1CNPA 1Y6WA 1KQMC 3LK1A 1BMOA 2I7AA 1SYMA 1WDCC 3K21A 1K9KA 5F6TA 3OB2B 1ALWA 4JQ0D 3D10A 2EC6B 1G8IA 1KFUS 2V53A 2KI6D 2LHLA 5AEQA 3CYZA 1OOIX 2SCPA 3R1VA 3UO9A 5FI2A 4YI9A 1NP8A 4ORAB 1IJ5A 1N65A 1SCMC 4QJ3B 1BODA 2L98A 2WC5A 1QVIZ 2BCAA 1PRWA 1DMOA 1K90D 4JD9A 3AKBA 1YURA 2PASA 2LVKA 1ZACA 2KAYA 2L5XB 2KFGA 1J7PA 5AFPA 1SR6C 3BUNB 1AK8A 3EVUA 1R6PA 2KNEA 1NSHA 1IIOA 1UHKA 1XK4A 1NCXA 3VRRA 1F55A 2JNFA 3SG2A 3I5HC 1M39A 2WNDA 3D73A 2WCHA 4ICBA 3PN7C 1ALVA 3Q8IA 2E30A 2LV7A 1SRAA 1DJGA 1EJ3A 1RK9A 2GGMA 2H2KA 3BXKA 4GGFA 4BY5A 3CR5X 2GV5A 4E68A 2JQ6A 2ISDA 3S0AA 2WCMA 2SASA 1WY9A 5JOLA 4CFRA 1F54A 4DS7A 1SY9A 4WRIA 1F4OA 4JKTA 1EH2A 1XFWO 5JJGA 2MA2A 1F4QA 3I5IC 4FQTA 1S3PA 1CLMA 3OHMB 2PQLA 4HREE 1M31A 1NWDA 1SL7A 3EVRA 2KI4C 4DIRA 1BF5A 2LVIA 2K7BA 1DJYA 2YGUA 1CLBA 2FOTA 1BLQA 1K94A 3SG5A 2NCPA 3CLNA 1CFFA 2QDIA 2TN4A 1J1EA 1U5IA 1UURA 3SIAA 2L5YA 3VB1A 4M2PA 3TS5B 2BCXA 3TDIA 3S0FA 1KK7Z 3SS3A 1CDMA 3BJHA 5KTYA 2LUXA 2GTEA 3DVEA 4MSPA 4WQ3A 1KSOA 4MRYA 1CDLA 1IRJA 3PATA 5DKQA 3S0GA 1BG1A 4OV2A 1AHRA 3TUYC 3FE9A 1UWOA 2PRUA 2LC5A 2KI6C 2F33A 1KK8B 1NX1A 1B7TZ 1UHHA 5KSZA 4R1EA 1TNQA 2KLEA 1SSEB 2PSRA 4M2QA 3EKHA 4A4BA 1W7JB 4PE0A 2HQWA 1CKKA 2M29A 1ZUZA 2BAPA 1G33A 2EGDA 1YX7A 1LA0A 1JF0A 2JWWA 2K7CA 1QX7A 3D74A 1UP5A 5I94A
chains in the Genus database with same CATH topology
1C7VA 1K95A 1B8RA 2LLTA 1F8HA 1ODBA 2HETA 2KDHA 3A8RA 1TRFA 1IWQA 2FCDA 2Y1MA 3O6BA 4AQIA 3AKAA 1A75A 2CCMA 2LMTA 5I8NA 4N1GA 1PVBA 1KCYA 1JUOA 1KFXL 3BOWA 2COLB 1NUBA 2BL0C 1KQVA 2IS9A 5G08A 1SNLA 3AAJA 4A4CA 2KBIA 1EXRA 2GGZA 2NLNA 3LK0A 4XYNA 4GNKB 5D7FA 5DKRA 5HLOA 2K8MB 2LE9B 3CWGA 4GBAA 1XO5A 1QJTA 2MBXA 2LNKA 1KWOC 1AVSA 1NCYA 2M3WA 1L2OB 4OVNF 1B4CA 2BKIB 4PE7A 2JTZA 1A29A 5KU1A 1EG4A 2HF5A 2K61A 5HYDA 1QXPA 4GAOA 1S5GZ 2M49B 4I5JA 2PMYA 2O5GA 2ZNDA 2LMVA 2K0JA 1WLZA 1DF0A 1B47A 3BUXB 1EG3A 2HQ8A 2BE4A 3NSKA 2ZKMX 3NSIA 1S6IA 1XFVO 1JFKA 2WCFA 3I5FC 1FF1A 2HPSA 3WHUB 4HRGA 1OOJA 2M1UA 3JVTB 4OKHA 1IQ3A 2LVJA 1YTZC 1NX3A 1NX0A 5AERA 4CLNA 1XFZO 1CMGA 3JTDB 1U5IB 2BE6A 4YGCB 1LKJA 4I5NB 2LLUA 5IBWA 1G4YR 1OZOA 2L51A 1DJHA 1LXFC 2LAPA 1Y0VH 4JWQA 4YGAA 2M1KB 1FPWA 3IQOA 5FYXA 4XJKA 3CR2A 4JPZB 1OSAA 1MHOA 1KFXS 3DF0A 3VGOA 1CTRA 2KGRA 3DVKA 1K96A 1A2XA 1NYAA 1JWDA 1UUSA 3GK2A 2ZFDA 1E8AA 1YX8A 2JULA 3KPXA 2LVVA 3TDZA 2KFHA 1Y1AA 5ER5A 1LA3A 1SK6D 2OTGC 2M8UA 2MHHA 1DVIA 2L4HA 2JT0A 4GUKA 2WCEA 2M7LA 3IQQA 1K9PA 2MRDA 5HKYA 3SIBA 1SMGA 1JC2A 1KQMB 1SBJA 4I5LB 4Q04A 3VRPA 3EK4A 4AOMA 1WDCB 3E3RA 1A75B 4P2YB 1XYDA 1WLMA 2KQYA 3TS5C 3SG7A 3TDUA 3CS1A 3BOWB 4L9MA 1OMDA 2O60A 1SKTA 1SCMB 2JTTA 3VRNA 4MZLA 3OB1B 3D0YB 1QASA 3EKJA 4YGEB 3FS7A 4PALA 5J3XA 1TOPA 1PVAA 1MXLC 3OX5A 3LCPC 1OQPA 4HRHA 5HKWA 2RGIA 3I5HB 2G9BA 3WXAA 1JSAA 1QIWA 3BUOB 4C0LA 2H61A 2A4JA 1YVHA 3PN7B 2KYFA 1PULA 4MZKA 4ORCB 2BCBA 1W7IB 4U8DA 3GOFA 3BQ3A 3PSRA 2F8PA 1QLSA 3MSEB 4YBHB 2ZRTA 1CB1A 2JT3A 1S1EA 1RJVA 4D1EA 1IH0A 1QV0A 2KFFA 4WQ2A 2KI4B 3RLZA 2L4IA 3SG4A 4QJ4B 1Y1XA 5CSFA 3SJSA 4PHNA 1YUSA 4NDCA 2CTNA 1LVCD 2Q91A 2BBMA 1DJZA 2MLFC 4FQOA 2CNPA 1K8UA 1TN4A 4GFTA 3DVMA 2Q4UA 1S36A 1NX2A 1XA5A 2KBMA 2KHNA 3VROA 1CFCA 3GK4X 1RTP1 1Q80A 1QVIY 3TZ1A 4DUQA 3KO0A 5BPJA 2OS8C 5K89A 3CTNA 1L2OC 1GGZA 1YVLA 2CBLA 1YUUA 2EHBA 1SL9A 3A4UB 1TNPA 2FJUB 4YRUA 3EK8A 3NXAA 4N1FA 2CT9A 1AP4A 1CDPA 4N5XA 1KFUL 2I18A 4NQGA 2OPOA 3EK7A 1J7QA 1TCOB 1V1FA 3PFVA 1AJ5A 3PLFB 2LP3A 2VRGA 3DVJA 3FWBA 3PM8A 5AANA 1B8CA 1TIZA 2JXLA 1XFYO 3OX6A 4PDZA 1N0YA 2L50A 3JVTC 2JC2A 4MRXA 1YRUB 3HCMA 2F3ZA 1UHIA 2PVBA 1QS7A 1PSRA 2LUCA 2KSPA 1BJFA 4PE1A 2EC6C 1BU3A 3DD4A 2M9GA 5D69A 4ETOA 1YRTB 1TTXA 2MAZA 1FW4A 3RM1A 2BL0B 4NDBA 2LM5A 5I2OA 1A4PA 4MVFA 4USLA 2JU0A 1CDNA 3KEVA 1DT7B 1MWNA 1KK7Y 3CR4X 1NCZA 4MZJA 1J55A 5DKNA 1CM1A 4QJ5B 1WRZA 1JBAA 1PALA 1RECA 2KOTA 3H4SE 4PCWA 1K2HA 4YI8A 1C07A 1B7TY 3CZTX 3HX4A 1C7WA 1H8BA 2M97A 2B1UA 2K2FA 5CPVA 1DJIA 2LP2A 1X02A 1SW8A 4PHJA 1H4BA 1DGVA 1CFDA 4F0ZB 1GQMA 2I2RE 1S26D 3M0WA 4ORBB 1MR8A 3QRXA 3I5FB 5HKZA 1FI6A 2JNXA 3I5GB 2JRFA 1MUXA 3WHTB 2Y5IA 2P6BB 1A03A 1IG5A 4GPLB 4DRWA 2ZNEA 3O2PA 5I2QA 1V1GA 2AMIA 1FBVA 2G2BA 2FCEA 2PALA 1EL4A 1ZOTB 1M45A 5CSIA 4HSZA 2LMUA 2BKHB 5CSNA 3CGAA 1CLLA 2WOSA 2KAXA 2D8NA 1OMRA 5PALA 1GGWA 5HLVA 1SR6B 1KK8C 2JOJA 5GQQC 4PHKA 1S6JA 5B8IB 1WRLA 1BOCA 1NPQA 1MXEA 2MJWB 2KYCA 2ZRSA 1S5GY 3BYAA 1QTXA 2OTGB 2KQ6A 1M46A 5CSJA 4C0JA 3OP0A 2L0PA 1RFJA 1SPYA 2LHIA 3LL8B 3BUMB 2LCPA 5AXIA 3VRQA 1YR5A 2F3YA 2K7DA 4OCIA 1XFUO 2AAOA 2K7OA 1DF0B 1K93D 2K2AA 3ZNIA 4P5OE 1ZMZA 3I5IB 4NDDA 2L2EA 2F2PA 2WC8A 1OZSA 2BBNA 5TNCA 1DJWA 2Y4QA 3KF9A 1TCFA 1J7OA 1FI5A 2JPTA 3SG3A 3F45A 4PE4A 1L7ZA 4PHMA 1TNWA 2KAVA 1QATA 2JT8A 1WRKA 1SL8A 1XK4C 4MEWA 4MBEA 1QV1A 1D1OA 1LINA 1J7RA 2ZN8A 4OR9B 1F70A 4IL1A 1BT6A 3TUYB 4XJKB 5I2LA 1J1DA 4TNCA 4GGNA 1B9AA 3DF0B 1DGUA 4GGFC 2I94A 3SG6A 2NZ0A 2WORA 4CIDA 1BR1B 2WCBA 3O78A 4CFQA 4C0KA 1AUIB 1UHNA 1N2DA 1RROA 4MN0A 1B1GA 3KHEA 1RWYA 1MF8B 1Y1UA 1YUTA 2QACA 3PALA 1PSBA 1K9UA 2ZN9A 1TNXA 1IKUA 2E6WA 4BY4A 3WNXB 1HQVA 2QPTA 3AAKA 3O4YA 1BR4B 2M0RA 4AQJA 1QLKA 3D0YA 2CXJA 3ZWHA 1B8LA 3JTDC 2F2OA 4DCKA 1PK0D 1JFJA 1HT9A 3EVVA 1IQ5A 1OMVA 2MLEC 1VRKA 1ZFSA 3NSOA 2LLSA 2OS8B 4CPVA 2AUCA 1M63B 1SCVA 1CM4A 3NSLA 2R2IA 2H61C 3BUWB 1NIWA 1R2UA 1GJYA 3FIAA 4FTGA 3GK1A 4MLWA 2JXCA 4YGDB 4UPGA 1CMFA 1IGVA 1IJ6A 1DJXA 2KGBC 3ICBA 2DOQA 3IF7A 1QIVA 2Y1NA 1CFPA 1QX5B 1KWOB 3LLEA 5ER4X 1JF2A 3C1VA 2JZIA 1S6CA 1XFXO 4I5KA 4ZCUA 2BECA 4YGBB 1XVJA 1F71A 1MQ1A 1OE9B 4M2OA 1AJ4A 1KSMA 3I5GC 1QX2A 2NXQA 1UHJA 2NCOA 2LANA 4ZCVA 2M7NA 1DTLA 3FWCA 1CNPA 1Y6WA 1KQMC 3LK1A 1BMOA 2I7AA 1SYMA 1WDCC 3K21A 1K9KA 5F6TA 3OB2B 1ALWA 4JQ0D 3D10A 2EC6B 1G8IA 1KFUS 2V53A 2KI6D 2LHLA 5AEQA 2SCPA 4YI9A 1NP8A 4ORAB 1IJ5A 1N65A 1SCMC 4QJ3B 1BODA 2L98A 1QVIZ 2BCAA 1PRWA 1DMOA 1K90D 3AKBA 1YURA 2PASA 2LVKA 1ZACA 2KAYA 2L5XB 2KFGA 1J7PA 5AFPA 1SR6C 3BUNB 1AK8A 3EVUA 1R6PA 2KNEA 1NSHA 1UHKA 1XK4A 1NCXA 3VRRA 1F55A 2JNFA 3SG2A 3I5HC 1M39A 2WNDA 4ICBA 3PN7C 1ALVA 2E30A 2LV7A 1SRAA 1DJGA 1EJ3A 1RK9A 2GGMA 2H2KA 3BXKA 4GGFA 4BY5A 3CR5X 2GV5A 4E68A 2JQ6A 2ISDA 1F54A 4CFRA 2SASA 1WY9A 5JOLA 4DS7A 1SY9A 4WRIA 1F4OA 1EH2A 1XFWO 5JJGA 2MA2A 1F4QA 3I5IC 1S3PA 1CLMA 3OHMB 4HREE 1M31A 1NWDA 1SL7A 3EVRA 2KI4C 4DIRA 1BF5A 2LVIA 2K7BA 1DJYA 1CLBA 2FOTA 1BLQA 1K94A 3SG5A 2NCPA 3CLNA 1CFFA 2TN4A 1J1EA 1U5IA 1UURA 3SIAA 4M2PA 3TS5B 2BCXA 3TDIA 1KK7Z 1CDMA 5KTYA 2LUXA 3DVEA 4MSPA 4WQ3A 1KSOA 4MRYA 1CDLA 1IRJA 3PATA 5DKQA 1BG1A 4OV2A 1AHRA 3TUYC 1UWOA 2PRUA 2LC5A 2KI6C 2F33A 1KK8B 1NX1A 1B7TZ 1UHHA 5KSZA 4R1EA 1TNQA 2PSRA 4M2QA 4A4BA 3EKHA 1W7JB 4PE0A 2HQWA 1CKKA 2M29A 1ZUZA 1G33A 2EGDA 1YX7A 1LA0A 1JF0A 2JWWA 2K7CA 1QX7A 1UP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7V A;  1K95 A;  1B8R A;  2LLT A;  1F8H A;  1ODB A;  2HET A;  2KDH A;  3A8R A;  1TRF A;  1IWQ A;  2FCD A;  2Y1M A;  3O6B A;  4AQI A;  3AKA A;  1A75 A;  2CCM A;  2LMT A;  5I8N A;  4N1G A;  1PVB A;  1KCY A;  1JUO A;  1KFX L;  3BOW A;  2COL B;  1NUB A;  2BL0 C;  1KQV A;  2IS9 A;  5G08 A;  1SNL A;  3AAJ A;  4A4C A;  2KBI A;  1EXR A;  2GGZ A;  2NLN A;  3LK0 A;  4XYN A;  4GNK B;  5D7F A;  5DKR A;  5HLO A;  2K8M B;  2LE9 B;  3CWG A;  4GBA A;  1XO5 A;  1QJT A;  2MBX A;  2LNK A;  1KWO C;  1AVS A;  1NCY A;  2M3W A;  1L2O B;  4OVN F;  1B4C A;  2BKI B;  4PE7 A;  2JTZ A;  1A29 A;  5KU1 A;  1EG4 A;  2HF5 A;  2K61 A;  5HYD A;  1QXP A;  4GAO A;  1S5G Z;  2M49 B;  4I5J A;  2PMY A;  2O5G A;  2ZND A;  2LMV A;  2K0J A;  1WLZ A;  1DF0 A;  1B47 A;  3BUX B;  1EG3 A;  2HQ8 A;  2BE4 A;  3NSK A;  2ZKM X;  3NSI A;  1S6I A;  1XFV O;  1JFK A;  2WCF A;  3I5F C;  1FF1 A;  2HPS A;  3WHU B;  4HRG A;  1OOJ A;  2M1U A;  3JVT B;  4OKH A;  1IQ3 A;  2LVJ A;  1YTZ C;  1NX3 A;  1NX0 A;  5AER A;  4CLN A;  1XFZ O;  1CMG A;  3JTD B;  1U5I B;  2BE6 A;  4YGC B;  1LKJ A;  4I5N B;  2LLU A;  5IBW A;  1G4Y R;  1OZO A;  2L51 A;  1DJH A;  1LXF C;  2LAP A;  1Y0V H;  4JWQ A;  4YGA A;  2M1K B;  1FPW A;  3IQO A;  5FYX A;  4XJK A;  3CR2 A;  4JPZ B;  1OSA A;  1MHO A;  1KFX S;  3DF0 A;  3VGO A;  1CTR A;  2KGR A;  3DVK A;  1K96 A;  1A2X A;  1NYA A;  1JWD A;  1UUS A;  3GK2 A;  2ZFD A;  1E8A A;  1YX8 A;  2JUL A;  3KPX A;  2LVV A;  3TDZ A;  2KFH A;  1Y1A A;  5ER5 A;  1LA3 A;  1SK6 D;  2OTG C;  2M8U A;  2MHH A;  1DVI A;  2L4H A;  2JT0 A;  4GUK A;  2WCE A;  2M7L A;  3IQQ A;  1K9P A;  2MRD A;  5HKY A;  3SIB A;  1SMG A;  1JC2 A;  1KQM B;  1SBJ A;  4I5L B;  4Q04 A;  3VRP A;  3EK4 A;  4AOM A;  1WDC B;  3E3R A;  1A75 B;  4P2Y B;  1XYD A;  1WLM A;  2KQY A;  3TS5 C;  3SG7 A;  3TDU A;  3CS1 A;  3BOW B;  4L9M A;  1OMD A;  2O60 A;  1SKT A;  1SCM B;  2JTT A;  3VRN A;  4MZL A;  3OB1 B;  3D0Y B;  1QAS A;  3EKJ A;  4YGE B;  3FS7 A;  4PAL A;  5J3X A;  1TOP A;  1PVA A;  1MXL C;  3OX5 A;  3LCP C;  1OQP A;  4HRH A;  5HKW A;  2RGI A;  3I5H B;  2G9B A;  3WXA A;  1JSA A;  1QIW A;  3BUO B;  4C0L A;  2H61 A;  2A4J A;  1YVH A;  3PN7 B;  2KYF A;  1PUL A;  4MZK A;  4ORC B;  2BCB A;  1W7I B;  4U8D A;  3GOF A;  3BQ3 A;  3PSR A;  2F8P A;  1QLS A;  3MSE B;  4YBH B;  2ZRT A;  1CB1 A;  2JT3 A;  1S1E A;  1RJV A;  4D1E A;  1IH0 A;  1QV0 A;  2KFF A;  4WQ2 A;  2KI4 B;  3RLZ A;  2L4I A;  3SG4 A;  4QJ4 B;  1Y1X A;  5CSF A;  3SJS A;  4PHN A;  1YUS A;  4NDC A;  2CTN A;  1LVC D;  2Q91 A;  2BBM A;  1DJZ A;  2MLF C;  4FQO A;  2CNP A;  1K8U A;  1TN4 A;  4GFT A;  3DVM A;  2Q4U A;  1S36 A;  1NX2 A;  1XA5 A;  2KBM A;  2KHN A;  3VRO A;  1CFC A;  3GK4 X;  1RTP 1;  1Q80 A;  1QVI Y;  3TZ1 A;  4DUQ A;  3KO0 A;  5BPJ A;  2OS8 C;  5K89 A;  3CTN A;  1L2O C;  1GGZ A;  1YVL A;  2CBL A;  1YUU A;  2EHB A;  1SL9 A;  3A4U B;  1TNP A;  2FJU B;  4YRU A;  3EK8 A;  3NXA A;  4N1F A;  2CT9 A;  1AP4 A;  1CDP A;  4N5X A;  1KFU L;  2I18 A;  4NQG A;  2OPO A;  3EK7 A;  1J7Q A;  1TCO B;  1V1F A;  3PFV A;  1AJ5 A;  3PLF B;  2LP3 A;  2VRG A;  3DVJ A;  3FWB A;  3PM8 A;  5AAN A;  1B8C A;  1TIZ A;  2JXL A;  1XFY O;  3OX6 A;  4PDZ A;  1N0Y A;  2L50 A;  3JVT C;  2JC2 A;  4MRX A;  1YRU B;  3HCM A;  2F3Z A;  1UHI A;  2PVB A;  1QS7 A;  1PSR A;  2LUC A;  2KSP A;  1BJF A;  4PE1 A;  2EC6 C;  1BU3 A;  3DD4 A;  2M9G A;  5D69 A;  4ETO A;  1YRT B;  1TTX A;  2MAZ A;  1FW4 A;  3RM1 A;  2BL0 B;  4NDB A;  2LM5 A;  5I2O A;  1A4P A;  4MVF A;  4USL A;  2JU0 A;  1CDN A;  3KEV A;  1DT7 B;  1MWN A;  1KK7 Y;  3CR4 X;  1NCZ A;  4MZJ A;  1J55 A;  5DKN A;  1CM1 A;  4QJ5 B;  1WRZ A;  1JBA A;  1PAL A;  1REC A;  2KOT A;  3H4S E;  4PCW A;  1K2H A;  4YI8 A;  1C07 A;  1B7T Y;  3CZT X;  3HX4 A;  1C7W A;  1H8B A;  2M97 A;  2B1U A;  2K2F A;  5CPV A;  1DJI A;  2LP2 A;  1X02 A;  1SW8 A;  4PHJ A;  1H4B A;  1DGV A;  1CFD A;  4F0Z B;  1GQM A;  2I2R E;  1S26 D;  3M0W A;  4ORB B;  1MR8 A;  3QRX A;  3I5F B;  5HKZ A;  1FI6 A;  2JNX A;  3I5G B;  2JRF A;  1MUX A;  3WHT B;  2Y5I A;  2P6B B;  1A03 A;  1IG5 A;  4GPL B;  4DRW A;  2ZNE A;  3O2P A;  5I2Q A;  1V1G A;  2AMI A;  1FBV A;  2G2B A;  2FCE A;  2PAL A;  1EL4 A;  1ZOT B;  1M45 A;  5CSI A;  4HSZ A;  2LMU A;  2BKH B;  5CSN A;  3CGA A;  1CLL A;  2WOS A;  2KAX A;  2D8N A;  1OMR A;  5PAL A;  1GGW A;  5HLV A;  1SR6 B;  1KK8 C;  2JOJ A;  5GQQ C;  4PHK A;  1S6J A;  5B8I B;  1WRL A;  1BOC A;  1NPQ A;  1MXE A;  2MJW B;  2KYC A;  2ZRS A;  1S5G Y;  3BYA A;  1QTX A;  2OTG B;  2KQ6 A;  1M46 A;  5CSJ A;  4C0J A;  3OP0 A;  2L0P A;  1RFJ A;  1SPY A;  2LHI A;  3LL8 B;  3BUM B;  2LCP A;  5AXI A;  3VRQ A;  1YR5 A;  2F3Y A;  2K7D A;  4OCI A;  1XFU O;  2AAO A;  2K7O A;  1DF0 B;  1K93 D;  2K2A A;  3ZNI A;  4P5O E;  1ZMZ A;  3I5I B;  4NDD A;  2L2E A;  2F2P A;  2WC8 A;  1OZS A;  2BBN A;  5TNC A;  1DJW A;  2Y4Q A;  3KF9 A;  1TCF A;  1J7O A;  1FI5 A;  2JPT A;  3SG3 A;  3F45 A;  4PE4 A;  1L7Z A;  4PHM A;  1TNW A;  2KAV A;  1QAT A;  2JT8 A;  1WRK A;  1SL8 A;  1XK4 C;  4MEW A;  4MBE A;  1QV1 A;  1D1O A;  1LIN A;  1J7R A;  2ZN8 A;  4OR9 B;  1F70 A;  4IL1 A;  1BT6 A;  3TUY B;  4XJK B;  5I2L A;  1J1D A;  4TNC A;  4GGN A;  1B9A A;  3DF0 B;  1DGU A;  4GGF C;  2I94 A;  3SG6 A;  2NZ0 A;  2WOR A;  4CID A;  1BR1 B;  2WCB A;  3O78 A;  4CFQ A;  4C0K A;  1AUI B;  1UHN A;  1N2D A;  1RRO A;  4MN0 A;  1B1G A;  3KHE A;  1RWY A;  1MF8 B;  1Y1U A;  1YUT A;  2QAC A;  3PAL A;  1PSB A;  1K9U A;  2ZN9 A;  1TNX A;  1IKU A;  2E6W A;  4BY4 A;  3WNX B;  1HQV A;  2QPT A;  3AAK A;  3O4Y A;  1BR4 B;  2M0R A;  4AQJ A;  1QLK A;  3D0Y A;  2CXJ A;  3ZWH A;  1B8L A;  3JTD C;  2F2O A;  4DCK A;  1PK0 D;  1JFJ A;  1HT9 A;  3EVV A;  1IQ5 A;  1OMV A;  2MLE C;  1VRK A;  1ZFS A;  3NSO A;  2LLS A;  2OS8 B;  4CPV A;  2AUC A;  1M63 B;  1SCV A;  1CM4 A;  3NSL A;  2R2I A;  2H61 C;  3BUW B;  1NIW A;  1R2U A;  1GJY A;  3FIA A;  4FTG A;  3GK1 A;  4MLW A;  2JXC A;  4YGD B;  4UPG A;  1CMF A;  1IGV A;  1IJ6 A;  1DJX A;  2KGB C;  3ICB A;  2DOQ A;  3IF7 A;  1QIV A;  2Y1N A;  1CFP A;  1QX5 B;  1KWO B;  3LLE A;  5ER4 X;  1JF2 A;  3C1V A;  2JZI A;  1S6C A;  1XFX O;  4I5K A;  4ZCU A;  2BEC A;  4YGB B;  1XVJ A;  1F71 A;  1MQ1 A;  1OE9 B;  4M2O A;  1AJ4 A;  1KSM A;  3I5G C;  1QX2 A;  2NXQ A;  1UHJ A;  2NCO A;  2LAN A;  4ZCV A;  2M7N A;  1DTL A;  3FWC A;  1CNP A;  1Y6W A;  1KQM C;  3LK1 A;  1BMO A;  2I7A A;  1SYM A;  1WDC C;  3K21 A;  1K9K A;  5F6T A;  3OB2 B;  1ALW A;  4JQ0 D;  3D10 A;  2EC6 B;  1G8I A;  1KFU S;  2V53 A;  2KI6 D;  2LHL A;  5AEQ A;  2SCP A;  4YI9 A;  1NP8 A;  4ORA B;  1IJ5 A;  1N65 A;  1SCM C;  4QJ3 B;  1BOD A;  2L98 A;  1QVI Z;  2BCA A;  1PRW A;  1DMO A;  1K90 D;  3AKB A;  1YUR A;  2PAS A;  2LVK A;  1ZAC A;  2KAY A;  2L5X B;  2KFG A;  1J7P A;  5AFP A;  1SR6 C;  3BUN B;  1AK8 A;  3EVU A;  1R6P A;  2KNE A;  1NSH A;  1UHK A;  1XK4 A;  1NCX A;  3VRR A;  1F55 A;  2JNF A;  3SG2 A;  3I5H C;  1M39 A;  2WND A;  4ICB A;  3PN7 C;  1ALV A;  2E30 A;  2LV7 A;  1SRA A;  1DJG A;  1EJ3 A;  1RK9 A;  2GGM A;  2H2K A;  3BXK A;  4GGF A;  4BY5 A;  3CR5 X;  2GV5 A;  4E68 A;  2JQ6 A;  2ISD A;  1F54 A;  4CFR A;  2SAS A;  1WY9 A;  5JOL A;  4DS7 A;  1SY9 A;  4WRI A;  1F4O A;  1EH2 A;  1XFW O;  5JJG A;  2MA2 A;  1F4Q A;  3I5I C;  1S3P A;  1CLM A;  3OHM B;  4HRE E;  1M31 A;  1NWD A;  1SL7 A;  3EVR A;  2KI4 C;  4DIR A;  1BF5 A;  2LVI A;  2K7B A;  1DJY A;  1CLB A;  2FOT A;  1BLQ A;  1K94 A;  3SG5 A;  2NCP A;  3CLN A;  1CFF A;  2TN4 A;  1J1E A;  1U5I A;  1UUR A;  3SIA A;  4M2P A;  3TS5 B;  2BCX A;  3TDI A;  1KK7 Z;  1CDM A;  5KTY A;  2LUX A;  3DVE A;  4MSP A;  4WQ3 A;  1KSO A;  4MRY A;  1CDL A;  1IRJ A;  3PAT A;  5DKQ A;  1BG1 A;  4OV2 A;  1AHR A;  3TUY C;  1UWO A;  2PRU A;  2LC5 A;  2KI6 C;  2F33 A;  1KK8 B;  1NX1 A;  1B7T Z;  1UHH A;  5KSZ A;  4R1E A;  1TNQ A;  2PSR A;  4M2Q A;  4A4B A;  3EKH A;  1W7J B;  4PE0 A;  2HQW A;  1CKK A;  2M29 A;  1ZUZ A;  1G33 A;  2EGD A;  1YX7 A;  1LA0 A;  1JF0 A;  2JWW A;  2K7C A;  1QX7 A;  1UP5 A; 
#chains in the Genus database with same CATH topology
 1C7V A;  1K95 A;  1B8R A;  2LLT A;  1F8H A;  1ODB A;  2HET A;  2KDH A;  3A8R A;  1TRF A;  1IWQ A;  2FCD A;  2Y1M A;  3O6B A;  4AQI A;  3B7A A;  3AKA A;  1A75 A;  2CCM A;  2LMT A;  5I8N A;  4N1G A;  4PT1 A;  1PVB A;  1KCY A;  5DIC A;  1JUO A;  1KFX L;  3BOW A;  2COL B;  1NUB A;  1T14 A;  2BL0 C;  1KQV A;  2IS9 A;  5G08 A;  1SNL A;  3AAJ A;  4A4C A;  2KBI A;  3CZ1 A;  1EXR A;  2GGZ A;  2NLN A;  3LK0 A;  4XYN A;  4GNK B;  1ORG A;  5D7F A;  5DKR A;  5HLO A;  2K8M B;  3PJI A;  2LE9 B;  3CWG A;  4GBA A;  1XO5 A;  1QJT A;  2MBX A;  2LNK A;  1KWO C;  1AVS A;  1NCY A;  2K60 A;  2M3W A;  3N7H A;  1L2O B;  4OVN F;  1B4C A;  2BKI B;  4PE7 A;  2JTZ A;  1A29 A;  5KU1 A;  1EG4 A;  1QWV A;  2HF5 A;  2K61 A;  5HYD A;  1QXP A;  4GAO A;  1S5G Z;  2M49 B;  1XFR A;  2PMY A;  2O5G A;  2ZND A;  2LMV A;  4I5J A;  2K0J A;  1WLZ A;  1DF0 A;  1Z2C B;  1B47 A;  3BUX B;  3S0B A;  1EG3 A;  2HQ8 A;  2BE4 A;  2PYQ A;  3NSK A;  2ZKM X;  3NSI A;  1S6I A;  1XFV O;  1JFK A;  2WCF A;  3I5F C;  1FF1 A;  2HPS A;  1W9Z A;  3WHU B;  4HRG A;  1OOJ A;  2M1U A;  3CAB A;  3NHI A;  3JVT B;  4OKH A;  1IQ3 A;  2QEB A;  2LVJ A;  4IJ7 A;  1YTZ C;  1NX3 A;  1NX0 A;  3SS5 A;  5EL2 A;  5AER A;  3S0D A;  4CLN A;  1XFZ O;  1CMG A;  3JTD B;  1U5I B;  2BE6 A;  4YGC B;  1LKJ A;  4I5N B;  2LLU A;  5IBW A;  1G4Y R;  1OZO A;  2L51 A;  1DJH A;  1LXF C;  2LAP A;  1Y0V H;  4JWQ A;  5HL1 A;  4YGA A;  5D3O A;  2M1K B;  1C3Z A;  3IQO A;  1FPW A;  5FYX A;  3R72 A;  4XJK A;  3CR2 A;  4JPZ B;  1OSA A;  1MHO A;  1KFX S;  3DF0 A;  3L47 A;  1CTR A;  2KGR A;  3DVK A;  3VGO A;  1K96 A;  1A2X A;  1NYA A;  2JPO A;  1UUS A;  1JWD A;  3GK2 A;  1OW4 A;  2ZFD A;  1E8A A;  1YX8 A;  2JUL A;  3KPX A;  3D78 A;  2LVV A;  3TDZ A;  2KFH A;  2QEH A;  1Y1A A;  5ER5 A;  1LA3 A;  1SK6 D;  2OTG C;  2M8U A;  2MHH A;  1DVI A;  2L4H A;  2JT0 A;  4GUK A;  2WCE A;  4INW A;  2M7L A;  3IQQ A;  1K9P A;  2MRD A;  5HKY A;  3SIB A;  1SMG A;  1JC2 A;  1KQM B;  1SBJ A;  4I5L B;  3FE8 A;  4Q04 A;  2FJY A;  3EK4 A;  3VRP A;  1WDC B;  3E3R A;  4AOM A;  1A75 B;  4P2Y B;  1XYD A;  1WLM A;  2KQY A;  3TS5 C;  1OOG A;  3SG7 A;  3TDU A;  3CS1 A;  3BOW B;  4L9M A;  1OMD A;  2O60 A;  1SKT A;  1SCM B;  2JTT A;  1OOH A;  3OBV A;  3VRN A;  4MZL A;  3OB1 B;  3D0Y B;  1QAS A;  3EKJ A;  4YGE B;  3FS7 A;  3RZS A;  4PAL A;  5J3X A;  1TOP A;  1PVA A;  1MXL C;  3OX5 A;  3LCP C;  1OQP A;  4HRH A;  5HKW A;  2RGI A;  3I5H B;  2G9B A;  3WXA A;  1JSA A;  1QIW A;  2KPH A;  3BUO B;  4C0L A;  2H61 A;  2A4J A;  1YVH A;  3PN7 B;  2WCK A;  2KYF A;  1PUL A;  4MZK A;  4ORC B;  2BCB A;  3D77 A;  1W7I B;  4U8D A;  3GOF A;  3BQ3 A;  3PSR A;  2F8P A;  1QLS A;  3MSE B;  4INX A;  4YBH B;  2BNX A;  2ZRT A;  1CB1 A;  2JT3 A;  1S1E A;  3DXL A;  1RJV A;  4D1E A;  1IH0 A;  1QV0 A;  2KFF A;  2L2C A;  4WQ2 A;  2KI4 B;  3RLZ A;  2L4I A;  3SG4 A;  4QJ4 B;  1Y1X A;  3K1E A;  5CSF A;  3SJS A;  4PHN A;  1YUS A;  4NDC A;  2CTN A;  1LVC D;  2Q91 A;  2BBM A;  2P71 A;  1DJZ A;  2MLF C;  4FQO A;  2CNP A;  1K8U A;  1TN4 A;  4GFT A;  3DVM A;  2Q4U A;  1S36 A;  1NX2 A;  1XA5 A;  2KBM A;  2KHN A;  3VRO A;  1CFC A;  3GK4 X;  1RTP 1;  1Q80 A;  1QVI Y;  3TZ1 A;  4DUQ A;  3KO0 A;  5BPJ A;  2OS8 C;  5K89 A;  5FI7 A;  3CTN A;  1L2O C;  1GGZ A;  1YVL A;  2CBL A;  1YUU A;  2EHB A;  1SL9 A;  3A4U B;  1TNP A;  2FJU B;  4YRU A;  3EK8 A;  3NXA A;  4N1F A;  2CT9 A;  2ERB A;  1AP4 A;  1CDP A;  4N5X A;  1KFU L;  2I18 A;  4NQG A;  2OPO A;  3EK7 A;  1J7Q A;  1TCO B;  2P70 A;  3D76 A;  1V1F A;  3PFV A;  3DY9 A;  4AQJ A;  1AJ5 A;  3PLF B;  2LP3 A;  2VRG A;  3B6X A;  3DVJ A;  3FWB A;  3PM8 A;  3QME A;  5AAN A;  1B8C A;  1DEL A;  1TIZ A;  2JXL A;  1TUJ A;  1XFY O;  3OX6 A;  4PDZ A;  1N0Y A;  2QEV A;  2L50 A;  3JVT C;  2JC2 A;  3L4A A;  1YRU B;  2KLD A;  3HCM A;  3NHT A;  4MRX A;  2F3Z A;  1UHI A;  5FI6 A;  2PVB A;  1QS7 A;  1PSR A;  2LUC A;  2KSP A;  1BJF A;  4PE1 A;  2EC6 C;  1BU3 A;  3DD4 A;  2M9G A;  5D69 A;  4ETO A;  1YRT B;  1TTX A;  3BFA A;  2MAZ A;  1FW4 A;  3R1O A;  2BL0 B;  4NDB A;  3RM1 A;  2LM5 A;  5I2O A;  1A4P A;  4MVF A;  4USL A;  2JU0 A;  1CDN A;  3KEV A;  1DT7 B;  1DEK A;  1MWN A;  1KK7 Y;  3CR4 X;  1NCZ A;  4MZJ A;  1J55 A;  5DKN A;  1P28 A;  1CM1 A;  3PM2 A;  4QJ5 B;  1WRZ A;  1JBA A;  1PAL A;  1REC A;  2KOT A;  3H4S E;  4PCW A;  1K2H A;  4YI8 A;  1C07 A;  1B7T Y;  3CZT X;  3HX4 A;  1C7W A;  1H8B A;  2M97 A;  2B1U A;  2QEO A;  2K2F A;  5CPV A;  1DJI A;  4F7F A;  2LP2 A;  3UNW A;  1X02 A;  1SW8 A;  4PHJ A;  4KYN A;  3B88 A;  1H4B A;  1DGV A;  1CFD A;  4F0Z B;  1DC1 A;  1GQM A;  2I2R E;  1S26 D;  3M0W A;  3SS4 A;  4ORB B;  1MR8 A;  1TWO A;  3QRX A;  3I5F B;  5HKZ A;  1FI6 A;  2JNX A;  3I5G B;  2JRF A;  1MUX A;  3WHT B;  2Y5I A;  2P6B B;  3D75 A;  1A03 A;  3NGV A;  1IG5 A;  4GPL B;  4DRW A;  2ZNE A;  3O2P A;  5I2Q A;  3EG5 B;  1V1G A;  2AMI A;  1FBV A;  2G2B A;  2FCE A;  2PAL A;  1EL4 A;  1ZOT B;  1M45 A;  5CSI A;  4HSZ A;  2LMU A;  3BFH A;  2BKH B;  5CSN A;  3CGA A;  1CLL A;  2WOS A;  2KAX A;  2D8N A;  1OMR A;  1DQE A;  3CZ0 A;  5HLV A;  5PAL A;  1GGW A;  1SR6 B;  1KK8 C;  2JOJ A;  5GQQ C;  4PHK A;  3BFB A;  1S6J A;  5B8I B;  1WRL A;  1BOC A;  1NPQ A;  3DZT A;  1MXE A;  2MJW B;  2KYC A;  2ZRS A;  1S5G Y;  3BYA A;  1QTX A;  2OTG B;  2KQ6 A;  1M46 A;  5CSJ A;  4C0J A;  3OP0 A;  2L0P A;  1RFJ A;  1SPY A;  2LHI A;  3IVT A;  3LL8 B;  3BUM B;  2LCP A;  5AXI A;  3VRQ A;  1YR5 A;  2F3Y A;  2K7D A;  4OCI A;  1XFU O;  2AAO A;  2K7O A;  1DF0 B;  1K93 D;  2K2A A;  3ZNI A;  4P5O E;  1ZMZ A;  3I5I B;  4NDD A;  2L2E A;  2F2P A;  2WC8 A;  1OZS A;  2BBN A;  5TNC A;  1DJW A;  2Y4Q A;  3KF9 A;  1TCF A;  1J7O A;  1FI5 A;  2JPT A;  3SG3 A;  3F45 A;  2WC6 A;  4PE4 A;  1L7Z A;  4PHM A;  1TNW A;  3B87 A;  2KAV A;  1QAT A;  2JT8 A;  1WRK A;  1SL8 A;  1XK4 C;  4MEW A;  4MBE A;  1QV1 A;  1D1O A;  1LIN A;  1J7R A;  2ZN8 A;  4OR9 B;  1F70 A;  2WCJ A;  4IL1 A;  1BT6 A;  3TUY B;  4XJK B;  5I2L A;  1J1D A;  4TNC A;  4GGN A;  1B9A A;  3DF0 B;  1DGU A;  4GGF C;  2I94 A;  3SG6 A;  2NZ0 A;  2WOR A;  3DYE A;  4CID A;  2WCL A;  1BR1 B;  2WCB A;  3O78 A;  4CFQ A;  4C0K A;  1AUI B;  1UHN A;  1N2D A;  1RRO A;  4MN0 A;  1B1G A;  3KHE A;  1RWY A;  1MF8 B;  1Y1U A;  1YUT A;  2QAC A;  3FE6 A;  3PAL A;  1PSB A;  1K9U A;  2H8V A;  1TNX A;  2ZN9 A;  1IKU A;  2E6W A;  4BY4 A;  3WNX B;  1HQV A;  2QPT A;  3AAK A;  3O4Y A;  1BR4 B;  1TUZ A;  2M0R A;  1QLK A;  3D0Y A;  2CXJ A;  3ZWH A;  1B8L A;  3JTD C;  2F2O A;  4DCK A;  1PK0 D;  1JFJ A;  1HT9 A;  1C3Y A;  3EVV A;  1IQ5 A;  1OMV A;  1Z4H A;  3O4X A;  2MLE C;  3V2L A;  1VRK A;  1ZFS A;  3NSO A;  2LLS A;  2OS8 B;  4CPV A;  2AUC A;  3S0E A;  1M63 B;  1SCV A;  1CM4 A;  3NSL A;  3OGN A;  2R2I A;  2H61 C;  3BUW B;  1NIW A;  1R2U A;  1GJY A;  3FIA A;  3L4L A;  3GK1 A;  4FTG A;  2JXC A;  4MLW A;  4YGD B;  3B86 A;  4UPG A;  1IGV A;  1CMF A;  1GM0 A;  1IJ6 A;  1DJX A;  2KGB C;  3ICB A;  2DOQ A;  3IF7 A;  1QIV A;  2Y1N A;  1CFP A;  1QX5 B;  1KWO B;  3LLE A;  5ER4 X;  1JF2 A;  1LS8 A;  3C1V A;  2JZI A;  1S6C A;  1XFX O;  4I5K A;  4ZCU A;  4OZD A;  2BEC A;  4YGB B;  1XVJ A;  1OOF A;  1MQ1 A;  3CDN A;  1F71 A;  3CZ2 A;  1OE9 B;  4M2O A;  1AJ4 A;  1KSM A;  3I5G C;  1QX2 A;  2NXQ A;  1UHJ A;  2NCO A;  2LAN A;  4ZCV A;  2M7N A;  3R1P A;  1DTL A;  3FWC A;  1CNP A;  1Y6W A;  1KQM C;  3LK1 A;  1BMO A;  2I7A A;  1SYM A;  1WDC C;  3K21 A;  1K9K A;  5F6T A;  3OB2 B;  1ALW A;  4JQ0 D;  3D10 A;  2EC6 B;  1G8I A;  1KFU S;  2V53 A;  2KI6 D;  2LHL A;  5AEQ A;  3CYZ A;  1OOI X;  2SCP A;  3R1V A;  3UO9 A;  5FI2 A;  4YI9 A;  1NP8 A;  4ORA B;  1IJ5 A;  1N65 A;  1SCM C;  4QJ3 B;  1BOD A;  2L98 A;  2WC5 A;  1QVI Z;  2BCA A;  1PRW A;  1DMO A;  1K90 D;  4JD9 A;  3AKB A;  1YUR A;  2PAS A;  2LVK A;  1ZAC A;  2KAY A;  2L5X B;  2KFG A;  1J7P A;  5AFP A;  1SR6 C;  3BUN B;  1AK8 A;  3EVU A;  1R6P A;  2KNE A;  1NSH A;  1IIO A;  1UHK A;  1XK4 A;  1NCX A;  3VRR A;  1F55 A;  2JNF A;  3SG2 A;  3I5H C;  1M39 A;  2WND A;  3D73 A;  2WCH A;  4ICB A;  3PN7 C;  1ALV A;  3Q8I A;  2E30 A;  2LV7 A;  1SRA A;  1DJG A;  1EJ3 A;  1RK9 A;  2GGM A;  2H2K A;  3BXK A;  4GGF A;  4BY5 A;  3CR5 X;  2GV5 A;  4E68 A;  2JQ6 A;  2ISD A;  3S0A A;  2WCM A;  2SAS A;  1WY9 A;  5JOL A;  4CFR A;  1F54 A;  4DS7 A;  1SY9 A;  4WRI A;  1F4O A;  4JKT A;  1EH2 A;  1XFW O;  5JJG A;  2MA2 A;  1F4Q A;  3I5I C;  4FQT A;  1S3P A;  1CLM A;  3OHM B;  2PQL A;  4HRE E;  1M31 A;  1NWD A;  1SL7 A;  3EVR A;  2KI4 C;  4DIR A;  1BF5 A;  2LVI A;  2K7B A;  1DJY A;  2YGU A;  1CLB A;  2FOT A;  1BLQ A;  1K94 A;  3SG5 A;  2NCP A;  3CLN A;  1CFF A;  2QDI A;  2TN4 A;  1J1E A;  1U5I A;  1UUR A;  3SIA A;  2L5Y A;  3VB1 A;  4M2P A;  3TS5 B;  2BCX A;  3TDI A;  3S0F A;  1KK7 Z;  3SS3 A;  1CDM A;  3BJH A;  5KTY A;  2LUX A;  2GTE A;  3DVE A;  4MSP A;  4WQ3 A;  1KSO A;  4MRY A;  1CDL A;  1IRJ A;  3PAT A;  5DKQ A;  3S0G A;  1BG1 A;  4OV2 A;  1AHR A;  3TUY C;  3FE9 A;  1UWO A;  2PRU A;  2LC5 A;  2KI6 C;  2F33 A;  1KK8 B;  1NX1 A;  1B7T Z;  1UHH A;  5KSZ A;  4R1E A;  1TNQ A;  2KLE A;  1SSE B;  2PSR A;  4M2Q A;  3EKH A;  4A4B A;  1W7J B;  4PE0 A;  2HQW A;  1CKK A;  2M29 A;  1ZUZ A;  2BAP A;  1G33 A;  2EGD A;  1YX7 A;  1LA0 A;  1JF0 A;  2JWW A;  2K7C A;  1QX7 A;  3D74 A;  1UP5 A;  5I94 A; 
#chains in the Genus database with same CATH homology
 1C7V A;  1K95 A;  1B8R A;  2LLT A;  1F8H A;  1ODB A;  2HET A;  2KDH A;  3A8R A;  1TRF A;  1IWQ A;  2FCD A;  2Y1M A;  3O6B A;  4AQI A;  3AKA A;  1A75 A;  2CCM A;  2LMT A;  5I8N A;  4N1G A;  1PVB A;  1KCY A;  1JUO A;  1KFX L;  3BOW A;  2COL B;  1NUB A;  2BL0 C;  1KQV A;  2IS9 A;  5G08 A;  1SNL A;  3AAJ A;  4A4C A;  2KBI A;  1EXR A;  2GGZ A;  2NLN A;  3LK0 A;  4XYN A;  4GNK B;  5D7F A;  5DKR A;  5HLO A;  2K8M B;  2LE9 B;  3CWG A;  4GBA A;  1XO5 A;  1QJT A;  2MBX A;  2LNK A;  1KWO C;  1AVS A;  1NCY A;  2M3W A;  1L2O B;  4OVN F;  1B4C A;  2BKI B;  4PE7 A;  2JTZ A;  1A29 A;  5KU1 A;  1EG4 A;  2HF5 A;  2K61 A;  5HYD A;  1QXP A;  4GAO A;  1S5G Z;  2M49 B;  4I5J A;  2PMY A;  2O5G A;  2ZND A;  2LMV A;  2K0J A;  1WLZ A;  1DF0 A;  1B47 A;  3BUX B;  1EG3 A;  2HQ8 A;  2BE4 A;  3NSK A;  2ZKM X;  3NSI A;  1S6I A;  1XFV O;  1JFK A;  2WCF A;  3I5F C;  1FF1 A;  2HPS A;  3WHU B;  4HRG A;  1OOJ A;  2M1U A;  3JVT B;  4OKH A;  1IQ3 A;  2LVJ A;  1YTZ C;  1NX3 A;  1NX0 A;  5AER A;  4CLN A;  1XFZ O;  1CMG A;  3JTD B;  1U5I B;  2BE6 A;  4YGC B;  1LKJ A;  4I5N B;  2LLU A;  5IBW A;  1G4Y R;  1OZO A;  2L51 A;  1DJH A;  1LXF C;  2LAP A;  1Y0V H;  4JWQ A;  4YGA A;  2M1K B;  1FPW A;  3IQO A;  5FYX A;  4XJK A;  3CR2 A;  4JPZ B;  1OSA A;  1MHO A;  1KFX S;  3DF0 A;  3VGO A;  1CTR A;  2KGR A;  3DVK A;  1K96 A;  1A2X A;  1NYA A;  1JWD A;  1UUS A;  3GK2 A;  2ZFD A;  1E8A A;  1YX8 A;  2JUL A;  3KPX A;  2LVV A;  3TDZ A;  2KFH A;  1Y1A A;  5ER5 A;  1LA3 A;  1SK6 D;  2OTG C;  2M8U A;  2MHH A;  1DVI A;  2L4H A;  2JT0 A;  4GUK A;  2WCE A;  2M7L A;  3IQQ A;  1K9P A;  2MRD A;  5HKY A;  3SIB A;  1SMG A;  1JC2 A;  1KQM B;  1SBJ A;  4I5L B;  4Q04 A;  3VRP A;  3EK4 A;  4AOM A;  1WDC B;  3E3R A;  1A75 B;  4P2Y B;  1XYD A;  1WLM A;  2KQY A;  3TS5 C;  3SG7 A;  3TDU A;  3CS1 A;  3BOW B;  4L9M A;  1OMD A;  2O60 A;  1SKT A;  1SCM B;  2JTT A;  3VRN A;  4MZL A;  3OB1 B;  3D0Y B;  1QAS A;  3EKJ A;  4YGE B;  3FS7 A;  4PAL A;  5J3X A;  1TOP A;  1PVA A;  1MXL C;  3OX5 A;  3LCP C;  1OQP A;  4HRH A;  5HKW A;  2RGI A;  3I5H B;  2G9B A;  3WXA A;  1JSA A;  1QIW A;  3BUO B;  4C0L A;  2H61 A;  2A4J A;  1YVH A;  3PN7 B;  2KYF A;  1PUL A;  4MZK A;  4ORC B;  2BCB A;  1W7I B;  4U8D A;  3GOF A;  3BQ3 A;  3PSR A;  2F8P A;  1QLS A;  3MSE B;  4YBH B;  2ZRT A;  1CB1 A;  2JT3 A;  1S1E A;  1RJV A;  4D1E A;  1IH0 A;  1QV0 A;  2KFF A;  4WQ2 A;  2KI4 B;  3RLZ A;  2L4I A;  3SG4 A;  4QJ4 B;  1Y1X A;  5CSF A;  3SJS A;  4PHN A;  1YUS A;  4NDC A;  2CTN A;  1LVC D;  2Q91 A;  2BBM A;  1DJZ A;  2MLF C;  4FQO A;  2CNP A;  1K8U A;  1TN4 A;  4GFT A;  3DVM A;  2Q4U A;  1S36 A;  1NX2 A;  1XA5 A;  2KBM A;  2KHN A;  3VRO A;  1CFC A;  3GK4 X;  1RTP 1;  1Q80 A;  1QVI Y;  3TZ1 A;  4DUQ A;  3KO0 A;  5BPJ A;  2OS8 C;  5K89 A;  3CTN A;  1L2O C;  1GGZ A;  1YVL A;  2CBL A;  1YUU A;  2EHB A;  1SL9 A;  3A4U B;  1TNP A;  2FJU B;  4YRU A;  3EK8 A;  3NXA A;  4N1F A;  2CT9 A;  1AP4 A;  1CDP A;  4N5X A;  1KFU L;  2I18 A;  4NQG A;  2OPO A;  3EK7 A;  1J7Q A;  1TCO B;  1V1F A;  3PFV A;  1AJ5 A;  3PLF B;  2LP3 A;  2VRG A;  3DVJ A;  3FWB A;  3PM8 A;  5AAN A;  1B8C A;  1TIZ A;  2JXL A;  1XFY O;  3OX6 A;  4PDZ A;  1N0Y A;  2L50 A;  3JVT C;  2JC2 A;  4MRX A;  1YRU B;  3HCM A;  2F3Z A;  1UHI A;  2PVB A;  1QS7 A;  1PSR A;  2LUC A;  2KSP A;  1BJF A;  4PE1 A;  2EC6 C;  1BU3 A;  3DD4 A;  2M9G A;  5D69 A;  4ETO A;  1YRT B;  1TTX A;  2MAZ A;  1FW4 A;  3RM1 A;  2BL0 B;  4NDB A;  2LM5 A;  5I2O A;  1A4P A;  4MVF A;  4USL A;  2JU0 A;  1CDN A;  3KEV A;  1DT7 B;  1MWN A;  1KK7 Y;  3CR4 X;  1NCZ A;  4MZJ A;  1J55 A;  5DKN A;  1CM1 A;  4QJ5 B;  1WRZ A;  1JBA A;  1PAL A;  1REC A;  2KOT A;  3H4S E;  4PCW A;  1K2H A;  4YI8 A;  1C07 A;  1B7T Y;  3CZT X;  3HX4 A;  1C7W A;  1H8B A;  2M97 A;  2B1U A;  2K2F A;  5CPV A;  1DJI A;  2LP2 A;  1X02 A;  1SW8 A;  4PHJ A;  1H4B A;  1DGV A;  1CFD A;  4F0Z B;  1GQM A;  2I2R E;  1S26 D;  3M0W A;  4ORB B;  1MR8 A;  3QRX A;  3I5F B;  5HKZ A;  1FI6 A;  2JNX A;  3I5G B;  2JRF A;  1MUX A;  3WHT B;  2Y5I A;  2P6B B;  1A03 A;  1IG5 A;  4GPL B;  4DRW A;  2ZNE A;  3O2P A;  5I2Q A;  1V1G A;  2AMI A;  1FBV A;  2G2B A;  2FCE A;  2PAL A;  1EL4 A;  1ZOT B;  1M45 A;  5CSI A;  4HSZ A;  2LMU A;  2BKH B;  5CSN A;  3CGA A;  1CLL A;  2WOS A;  2KAX A;  2D8N A;  1OMR A;  5PAL A;  1GGW A;  5HLV A;  1SR6 B;  1KK8 C;  2JOJ A;  5GQQ C;  4PHK A;  1S6J A;  5B8I B;  1WRL A;  1BOC A;  1NPQ A;  1MXE A;  2MJW B;  2KYC A;  2ZRS A;  1S5G Y;  3BYA A;  1QTX A;  2OTG B;  2KQ6 A;  1M46 A;  5CSJ A;  4C0J A;  3OP0 A;  2L0P A;  1RFJ A;  1SPY A;  2LHI A;  3LL8 B;  3BUM B;  2LCP A;  5AXI A;  3VRQ A;  1YR5 A;  2F3Y A;  2K7D A;  4OCI A;  1XFU O;  2AAO A;  2K7O A;  1DF0 B;  1K93 D;  2K2A A;  3ZNI A;  4P5O E;  1ZMZ A;  3I5I B;  4NDD A;  2L2E A;  2F2P A;  2WC8 A;  1OZS A;  2BBN A;  5TNC A;  1DJW A;  2Y4Q A;  3KF9 A;  1TCF A;  1J7O A;  1FI5 A;  2JPT A;  3SG3 A;  3F45 A;  4PE4 A;  1L7Z A;  4PHM A;  1TNW A;  2KAV A;  1QAT A;  2JT8 A;  1WRK A;  1SL8 A;  1XK4 C;  4MEW A;  4MBE A;  1QV1 A;  1D1O A;  1LIN A;  1J7R A;  2ZN8 A;  4OR9 B;  1F70 A;  4IL1 A;  1BT6 A;  3TUY B;  4XJK B;  5I2L A;  1J1D A;  4TNC A;  4GGN A;  1B9A A;  3DF0 B;  1DGU A;  4GGF C;  2I94 A;  3SG6 A;  2NZ0 A;  2WOR A;  4CID A;  1BR1 B;  2WCB A;  3O78 A;  4CFQ A;  4C0K A;  1AUI B;  1UHN A;  1N2D A;  1RRO A;  4MN0 A;  1B1G A;  3KHE A;  1RWY A;  1MF8 B;  1Y1U A;  1YUT A;  2QAC A;  3PAL A;  1PSB A;  1K9U A;  2ZN9 A;  1TNX A;  1IKU A;  2E6W A;  4BY4 A;  3WNX B;  1HQV A;  2QPT A;  3AAK A;  3O4Y A;  1BR4 B;  2M0R A;  4AQJ A;  1QLK A;  3D0Y A;  2CXJ A;  3ZWH A;  1B8L A;  3JTD C;  2F2O A;  4DCK A;  1PK0 D;  1JFJ A;  1HT9 A;  3EVV A;  1IQ5 A;  1OMV A;  2MLE C;  1VRK A;  1ZFS A;  3NSO A;  2LLS A;  2OS8 B;  4CPV A;  2AUC A;  1M63 B;  1SCV A;  1CM4 A;  3NSL A;  2R2I A;  2H61 C;  3BUW B;  1NIW A;  1R2U A;  1GJY A;  3FIA A;  4FTG A;  3GK1 A;  4MLW A;  2JXC A;  4YGD B;  4UPG A;  1CMF A;  1IGV A;  1IJ6 A;  1DJX A;  2KGB C;  3ICB A;  2DOQ A;  3IF7 A;  1QIV A;  2Y1N A;  1CFP A;  1QX5 B;  1KWO B;  3LLE A;  5ER4 X;  1JF2 A;  3C1V A;  2JZI A;  1S6C A;  1XFX O;  4I5K A;  4ZCU A;  2BEC A;  4YGB B;  1XVJ A;  1F71 A;  1MQ1 A;  1OE9 B;  4M2O A;  1AJ4 A;  1KSM A;  3I5G C;  1QX2 A;  2NXQ A;  1UHJ A;  2NCO A;  2LAN A;  4ZCV A;  2M7N A;  1DTL A;  3FWC A;  1CNP A;  1Y6W A;  1KQM C;  3LK1 A;  1BMO A;  2I7A A;  1SYM A;  1WDC C;  3K21 A;  1K9K A;  5F6T A;  3OB2 B;  1ALW A;  4JQ0 D;  3D10 A;  2EC6 B;  1G8I A;  1KFU S;  2V53 A;  2KI6 D;  2LHL A;  5AEQ A;  2SCP A;  4YI9 A;  1NP8 A;  4ORA B;  1IJ5 A;  1N65 A;  1SCM C;  4QJ3 B;  1BOD A;  2L98 A;  1QVI Z;  2BCA A;  1PRW A;  1DMO A;  1K90 D;  3AKB A;  1YUR A;  2PAS A;  2LVK A;  1ZAC A;  2KAY A;  2L5X B;  2KFG A;  1J7P A;  5AFP A;  1SR6 C;  3BUN B;  1AK8 A;  3EVU A;  1R6P A;  2KNE A;  1NSH A;  1UHK A;  1XK4 A;  1NCX A;  3VRR A;  1F55 A;  2JNF A;  3SG2 A;  3I5H C;  1M39 A;  2WND A;  4ICB A;  3PN7 C;  1ALV A;  2E30 A;  2LV7 A;  1SRA A;  1DJG A;  1EJ3 A;  1RK9 A;  2GGM A;  2H2K A;  3BXK A;  4GGF A;  4BY5 A;  3CR5 X;  2GV5 A;  4E68 A;  2JQ6 A;  2ISD A;  1F54 A;  4CFR A;  2SAS A;  1WY9 A;  5JOL A;  4DS7 A;  1SY9 A;  4WRI A;  1F4O A;  1EH2 A;  1XFW O;  5JJG A;  2MA2 A;  1F4Q A;  3I5I C;  1S3P A;  1CLM A;  3OHM B;  4HRE E;  1M31 A;  1NWD A;  1SL7 A;  3EVR A;  2KI4 C;  4DIR A;  1BF5 A;  2LVI A;  2K7B A;  1DJY A;  1CLB A;  2FOT A;  1BLQ A;  1K94 A;  3SG5 A;  2NCP A;  3CLN A;  1CFF A;  2TN4 A;  1J1E A;  1U5I A;  1UUR A;  3SIA A;  4M2P A;  3TS5 B;  2BCX A;  3TDI A;  1KK7 Z;  1CDM A;  5KTY A;  2LUX A;  3DVE A;  4MSP A;  4WQ3 A;  1KSO A;  4MRY A;  1CDL A;  1IRJ A;  3PAT A;  5DKQ A;  1BG1 A;  4OV2 A;  1AHR A;  3TUY C;  1UWO A;  2PRU A;  2LC5 A;  2KI6 C;  2F33 A;  1KK8 B;  1NX1 A;  1B7T Z;  1UHH A;  5KSZ A;  4R1E A;  1TNQ A;  2PSR A;  4M2Q A;  4A4B A;  3EKH A;  1W7J B;  4PE0 A;  2HQW A;  1CKK A;  2M29 A;  1ZUZ A;  1G33 A;  2EGD A;  1YX7 A;  1LA0 A;  1JF0 A;  2JWW A;  2K7C A;  1QX7 A;  1UP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...