4N5XA

Crystal structure of n-terminal calmodulin-like calcium sensor of human mitochondrial atp-mg/pi carrier scamc1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
155
Chain Sequence
TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
publication title A Self-Sequestered Calmodulin-like Ca(2+) Sensor of Mitochondrial SCaMC Carrier and Its Implication to Ca(2+)-Dependent ATP-Mg/Pi Transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 59
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n5xA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n5xA02
3HX4A 1H4BA 1Y0VH 1QLKA 4DS7A 1QXPA 2CCMA 1UP5A 2KBMA 1QASA 2KFHA 1OMRA 2LP3A 3TS5C 1CMFA 2M1UA 3GK2A 4ORAB 1DF0B 3NSIA 1NPQA 1OMVA 1CNPA 2LLUA 4BY5A 1AJ5A 4FQOA 1IGVA 1L7ZA 4DCKA 3DF0A 4PHMA 1GJYA 1XFXO 2Y1MA 1KSMA 1YUTA 1TCOB 1KFUS 1NCZA 4MRXA 3IQOA 2L0PA 5PALA 3SG6A 1OOJA 3D0YA 4AQJA 2LVIA 1TCFA 1YUSA 1KCYA 1MUXA 3DVKA 1IQ5A 1QX2A 1QVIZ 2I2RE 2JTTA 3I5HB 1MXEA 3HCMA 4C0KA 1M46A 5CSNA 3BUNB 2EC6B 3ICBA 3EVVA 3EVUA 2L5XB 1WY9A 1XK4A 1F70A 3WXAA 1OQPA 1KK7Z 2F3YA 1BF5A 1SCMC 1ZACA 3OB2B 5G08A 3CTNA 1KSOA 2LAPA 1CDPA 1PSRA 1F4OA 3O2PA 4MZKA 5ER5A 3SG2A 2SCPA 1EXRA 1KK8B 1SMGA 3PATA 1CDLA 4YGBB 1J55A 2K61A 2L4HA 1L2OC 3M0WA 2M49B 2OPOA 2ZN8A 2V53A 2K7DA 2M29A 4PALA 4Q04A 5HYDA 1JC2A 4CFRA 2BKHB 4CLNA 1WRKA 2H61A 1BMOA 2ZFDA 1YR5A 4R1EA 2HPSA 1F71A 1SL7A 3SG3A 1SL8A 1F55A 4P2YB 2PVBA 4XJKA 2K7OA 4N1FA 5DKRA 4I5LB 5J3XA 1KQVA 1TRFA 4MZJA 1A75B 1EJ3A 1SL9A 1AK8A 2HETA 4MVFA 2L50A 3VRNA 4PCWA 2BL0B 1WLZA 2HF5A 2D8NA 3GK4X 1UHKA 3PN7C 4GBAA 2K8MB 1NX3A 4ZCUA 1KQMB 2JNXA 1EG3A 2NCPA 1QLSA 4YGDB 1A2XA 1J7PA 1SRAA 2OS8C 1AP4A 4CIDA 5I2QA 2GGMA 1BODA 2JQ6A 3NSLA 4PE0A 1RJVA 4N5XA 2DOQA 2H2KA 1JSAA 1E8AA 2F2OA 4XYNA 1JFKA 2M7LA 2EGDA 5K89A 2ZNDA 1Y1UA 1QV0A 1M31A 1ZUZA 4MEWA 1G8IA 3PLFB 1CTRA 3AKBA 1KFXS 1JWDA 1BR1B 2Y1NA 2LMTA 1FW4A 2HQWA 2LLSA 1SW8A 2Y4QA 2JRFA 1SBJA 2Q91A 3AAKA 1QIVA 2F3ZA 4C0LA 5AFPA 2GV5A 2KI4B 1LXFC 1CLLA 3EVRA 4PE7A 2CTNA 3LL8B 4ORCB 1RROA 5HLOA 2COLB 2R2IA 4QJ3B 2F8PA 4TNCA 1SKTA 5CSFA 3QRXA 1R2UA 3AAJA 2P6BB 3PFVA 1XO5A 3A8RA 3EK4A 1U5IA 2JXLA 1PSBA 3VRQA 2GGZA 3SIBA 2MHHA 2JT3A 4OR9B 4PE1A 4P5OE 2PMYA 1ALWA 3IF7A 1UWOA 2PSRA 3BXKA 2K7CA 3KF9A 3JTDC 2ZKMX 4YGAA 2LCPA 1BT6A 1QATA 3CR4X 4MZLA 5AANA 2E30A 1LA0A 1S6JA 1UUSA 2ZRTA 3O6BA 4YI9A 4HSZA 2H61C 5DKQA 1H8BA 4HRHA 1F4QA 2JWWA 1EG4A 2MA2A 1F54A 1F8HA 4M2QA 3KO0A 3EK7A 2KFGA 3TDIA 2KNEA 2L2EA 1J1DA 2BBMA 5F6TA 5TNCA 1S6IA 3I5IC 2L4IA 3LCPC 4ICBA 3I5FC 3FS7A 3OHMB 4A4BA 2WORA 5KSZA 1IH0A 3BUOB 3NSOA 1Y1XA 4PHKA 2LHIA 1BG1A 1KWOB 2KQ6A 1PRWA 5AERA 1XYDA 1K8UA 2Q4UA 1SNLA 1QX7A 3BUWB 2JZIA 1RWYA 2CT9A 4L9MA 3SG4A 3WHTB 1SR6B 4MN0A 4NDDA 1B7TY 2BKIB 3OP0A 1D1OA 1UHHA 1YVLA 1PVAA 1XVJA 5CSIA 2NCOA 3JVTC 1K90D 1BU3A 1LA3A 1N0YA 1SPYA 5HKYA 2LVVA 2WOSA 1S3PA 1Q80A 4GGFC 3VGOA 3E3RA 3VRPA 1RFJA 1CM1A 2FCDA 2FCEA 5JOLA 2BECA 3FIAA 2L51A 1ZFSA 4MLWA 1QV1A 1MHOA 1WDCC 4M2OA 4AOMA 1S5GZ 2CNPA 3CR5X 1CLBA 1PVBA 1SCMB 4GGNA 1DGUA 1S1EA 2EC6C 1YTZC 1FI6A 1EL4A 2LMVA 4OVNF 1CDMA 3KHEA 1DMOA 2MAZA 1G4YR 5CSJA 1N65A 1XA5A 4I5JA 1BJFA 3BOWA 3I5GB 2KFFA 1K9PA 5CPVA 2K7BA 1DJIA 5KU1A 4OKHA 1MWNA 2M97A 1X02A 1QS7A 4HRGA 1Y1AA 1DTLA 3MSEB 4PHNA 4NDCA 3WNXB 1KK7Y 1MQ1A 1ZOTB 2NZ0A 3GOFA 1CFFA 2KHNA 1M63B 1NX0A 3NSKA 4C0JA 2K0JA 2BE6A 1DJYA 1XFYO 2MBXA 1IQ3A 1S26D 4QJ4B 4PHJA 5I2LA 3SJSA 3VRRA 1CKKA 2FOTA 2ZNEA 4WRIA 3K21A 2KSPA 1J1EA 1TNQA 1JF2A 1DF0A 1A29A 4OCIA 2F2PA 5D69A 2BBNA 2AUCA 2LNKA 3LK0A 3PSRA 3KPXA 1BR4B 1XFZO 2EHBA 1NSHA 4GFTA 1CDNA 1UURA 4IL1A 1CFDA 4QJ5B 1R6PA 1K9KA 5DKNA 4GGFA 3RLZA 2B1UA 1B8LA 1FF1A 3LLEA 4GPLB 3DF0B 2PALA 5D7FA 1DT7B 2LUCA 2M7NA 2WC8A 1K96A 1AVSA 2WCFA 1W7IB 4PE4A 1DJZA 1IWQA 2BCAA 3D0YB 1AHRA 2LVKA 2JU0A 3A4UB 4A4CA 2QACA 4U8DA 2NLNA 1SK6D 4GAOA 3TUYC 4OV2A 2AAOA 2JOJA 3FWBA 1J7OA 1B1GA 2OTGB 3TZ1A 1FPWA 1DJHA 1DJWA 1A03A 1NIWA 1C07A 1JFJA 1K9UA 1B8RA 1QTXA 2KQYA 3EKHA 3JTDB 1OZOA 2SASA 2KYCA 2JTZA 1WRLA 2G2BA 2NXQA 2ISDA 2JT8A 2Y5IA 1BOCA 1LKJA 1IKUA 1OMDA 1NWDA 1DVIA 5BPJA 1A75A 2O60A 1NYAA 3SIAA 1FBVA 1MF8B 2MRDA 5HKWA 1N2DA 2WCEA 1NCXA 1MXLC 4XJKB 2M1KB 3TS5B 2BCXA 3KEVA 4CPVA 1J7QA 3DVMA 3BUXB 2WCBA 3I5IB 1TTXA 1SCVA 2JT0A 4F0ZB 1W7JB 1ALVA 3CLNA 3VROA 5I2OA 1B7TZ 2K2AA 3PALA 1V1GA 3CR2A 4MBEA 4MRYA 1YUUA 2F33A 5JJGA 2KAVA 5GQQC 1SY9A 1HT9A 4FTGA 2LLTA 4MSPA 2LVJA 5IBWA 3AKAA 3SG5A 1KWOC 1ODBA 1NUBA 5B8IB 2KGBC 1NX2A 1J7RA 4JPZB 1BLQA 3JVTB 1WLMA 2AMIA 1KFXL 1PK0D 2JC2A 3I5HC 1GGZA 1OE9B 1DJGA 1SR6C 1C7WA 2JNFA 4BY4A 2JULA 1YX7A 2LC5A 5ER4X 1PULA 1JF0A 1XFVO 1WDCB 3CS1A 2M0RA 3LK1A 1DJXA 1TNXA 1QVIY 1L2OB 2ZN9A 2LHLA 2TN4A 2K2FA 1CMGA 4YRUA 3C1VA 4UPGA 1KK8C 2PRUA 4YGEB 1GGWA 3ZWHA 3BUMB 3CGAA 2KI6C 1Y6WA 1VRKA 2KI6D 3F45A 4ETOA 5KTYA 3O78A 1IJ6A 1CFCA 2VRGA 1HQVA 1CM4A 3FWCA 4YBHB 2KBIA 3TDUA 1K95A 1U5IB 1LVCD 2LM5A 4YI8A 1B8CA 1AUIB 3ZNIA 3OB1B 4HREE 2LP2A 4D1EA 1LINA 3I5GC 1S5GY 1IJ5A 1PALA 4AQIA 1YRUB 4N1GA 3NXAA 2M8UA 2LANA 2I7AA 3BYAA 1XFWO 1YRTB 2MLFC 3EK8A 1ZMZA 3BQ3A 1K93D 4GUKA 3PN7B 1TNPA 2ZRSA 2RGIA 1B4CA 4PDZA 2KYFA 2JPTA 3DD4A 3OX5A 2OS8B 1RK9A 3OX6A 2BL0C 4ZCVA 1GQMA 1JBAA 1CLMA 1NP8A 4E68A 4I5KA 1AJ4A 1KQMC 2IS9A 1B47A 2G9BA 2M3WA 1QX5B 2M9GA 1IRJA 4JQ0D 2LMUA 1TN4A 2LUXA 2I18A 1MR8A 3CZTX 1M45A 1KFUL 4YGCB 4ORBB 5HKZA 1TNWA 1UHNA 1IG5A 1RTP1 2LE9B 1C7VA 3WHUB 1OSAA 1YURA 1YX8A 4USLA 3DVJA 3DVEA 1WRZA 2PASA 1G33A 4WQ2A 1UHIA 1DGVA 2CBLA 1V1FA 1A4PA 1B9AA 1NX1A 1QJTA 2KI4C 5AEQA 4DIRA 2O5GA 2QPTA 3TUYB 2KDHA 3O4YA 1NCYA 2WNDA 4JWQA 2KAYA 1M39A 3CWGA 2KGRA 2L98A 4DRWA 1TIZA 4NDBA 1EH2A 4NQGA 1FI5A 3SG7A 1XK4C 1UHJA 2JXCA 4I5NB 1K2HA 1CFPA 2OTGC 4M2PA 3IQQA 4DUQA 5HLVA 5AXIA 3BOWB 3TDZA 4GNKB 4CFQA 1YVHA 3PM8A 1K94A 1S6CA 5I8NA 2MJWB 1JUOA 2BE4A 2FJUB 5FYXA 1S36A 3D10A 1OZSA 1XFUO 1RECA 2BCBA 2E6WA 2CXJA 3RM1A 2MLEC 3H4SE 2A4JA 1TOPA 3GK1A 4WQ3A 2KOTA 1QIWA 3EKJA 2LV7A 2HQ8A 2I94A 3I5FB 1CB1A 1SYMA 2KAXA
chains in the Genus database with same CATH superfamily
1W9ZA 1OW4A 3HX4A 1H4BA 1Y0VH 1QLKA 4DS7A 1QXPA 2CCMA 1UP5A 2KBMA 1QASA 2KFHA 3B87A 3Q8IA 1OMRA 2LP3A 3N7HA 3TS5C 1CMFA 2M1UA 3GK2A 4ORAB 1DF0B 3NSIA 1NPQA 1OMVA 1CNPA 2LLUA 4BY5A 1AJ5A 4FQOA 1IGVA 1L7ZA 4DCKA 3DF0A 4PHMA 1GJYA 1XFXO 2Y1MA 1KSMA 1YUTA 1TCOB 1KFUS 1NCZA 4MRXA 3IQOA 2L0PA 5PALA 3SG6A 1OOJA 3D0YA 5DICA 4AQJA 2LVIA 1TCFA 1YUSA 1KCYA 1MUXA 3S0BA 3DVKA 1IQ5A 1QX2A 1QVIZ 2I2RE 2JTTA 3I5HB 1MXEA 1OOFA 3HCMA 4IJ7A 4C0KA 3CZ2A 1M46A 5CSNA 3BUNB 2EC6B 3ICBA 3EVVA 3EVUA 1ORGA 2L5XB 1WY9A 5FI6A 1XK4A 1F70A 3D75A 3WXAA 1OQPA 1KK7Z 2F3YA 5FI7A 1BF5A 4JD9A 1SCMC 1ZACA 3OB2B 5G08A 3CTNA 1KSOA 2LAPA 1CDPA 1PSRA 1F4OA 3O2PA 4MZKA 5ER5A 1OOHA 3SG2A 2SCPA 1EXRA 1KK8B 1SMGA 3PATA 1C3YA 1CDLA 4YGBB 1J55A 2K61A 3B86A 2L4HA 1L2OC 3SS3A 3M0WA 2M49B 2OPOA 2ZN8A 2V53A 2K7DA 2M29A 4PALA 4Q04A 5HYDA 2QEOA 1JC2A 4CFRA 2BKHB 4CLNA 1WRKA 2H61A 1BMOA 2ZFDA 3CABA 1YR5A 4R1EA 2HPSA 1F71A 1SL7A 3SG3A 1SL8A 1F55A 4P2YB 3CZ0A 3NGVA 2PVBA 4XJKA 2K7OA 4N1FA 5DKRA 3B7AA 4I5LB 5J3XA 1KQVA 1TRFA 5HL1A 4MZJA 1A75B 1EJ3A 5FI2A 1SL9A 1AK8A 2HETA 4MVFA 2L50A 3BFHA 3VRNA 4PCWA 2BL0B 1WLZA 2HF5A 2D8NA 3GK4X 1UHKA 3PN7C 4GBAA 2K8MB 1NX3A 4ZCUA 1KQMB 2JNXA 1EG3A 2NCPA 1QLSA 4YGDB 1A2XA 1J7PA 1SRAA 2OS8C 1AP4A 4CIDA 4FQTA 5I2QA 2GGMA 1BODA 2JQ6A 3NSLA 4PE0A 1RJVA 4N5XA 2DOQA 2H2KA 1JSAA 1E8AA 2F2OA 4XYNA 1JFKA 2M7LA 1DQEA 2EGDA 2WCHA 5K89A 2ZNDA 1Y1UA 1QV0A 2GTEA 1M31A 1ZUZA 4MEWA 5I94A 1G8IA 3PLFB 1CTRA 3AKBA 1KFXS 1JWDA 1BR1B 2Y1NA 2LMTA 2QEBA 1FW4A 2HQWA 2LLSA 1SW8A 3PM2A 3VB1A 2Y4QA 2JRFA 1SBJA 2Q91A 3AAKA 1QIVA 1GM0A 2F3ZA 4C0LA 5AFPA 2GV5A 2KI4B 4PT1A 1LXFC 1CLLA 3V2LA 3EVRA 4PE7A 2CTNA 1Z2CB 3LL8B 4ORCB 1RROA 5HLOA 2COLB 2R2IA 4QJ3B 2F8PA 4TNCA 1SKTA 5CSFA 3QRXA 1R2UA 2KLEA 2P6BB 3AAJA 3PFVA 1XO5A 3A8RA 3EK4A 1U5IA 2JXLA 1PSBA 3VRQA 2GGZA 1DEKA 3SIBA 2MHHA 2JT3A 4OR9B 4PE1A 4P5OE 2PMYA 1ALWA 3IF7A 1UWOA 2PSRA 3BXKA 2K7CA 3KF9A 3JTDC 2ZKMX 3DZTA 4YGAA 2LCPA 1BT6A 1QATA 3CR4X 4MZLA 5AANA 2E30A 1LA0A 1S6JA 1UUSA 2ZRTA 3O6BA 4YI9A 4HSZA 2H61C 5DKQA 1H8BA 4HRHA 1F4QA 3BFAA 2JWWA 2K60A 1EG4A 2MA2A 1F54A 1F8HA 4M2QA 3KO0A 3EK7A 2KFGA 3TDIA 2KNEA 2L2EA 1J1DA 2BBMA 3CZ1A 5F6TA 5TNCA 1DC1A 1S6IA 3I5IC 2L4IA 3LCPC 4ICBA 4JKTA 3L4LA 3I5FC 3FS7A 3OHMB 4A4BA 2WORA 5KSZA 1IH0A 3BUOB 3NSOA 1Y1XA 4PHKA 2LHIA 1BG1A 1T14A 1KWOB 2KQ6A 1PRWA 5AERA 1XYDA 3SS4A 3S0AA 1K8UA 3L47A 2Q4UA 1SNLA 1QX7A 3BUWB 2JZIA 1RWYA 2CT9A 4L9MA 2BNXA 3SG4A 3WHTB 1SR6B 4MN0A 4NDDA 1B7TY 2BKIB 3OP0A 1D1OA 3DXLA 1UHHA 1YVLA 1PVAA 1XVJA 5CSIA 2NCOA 3JVTC 1K90D 1BU3A 1LA3A 1N0YA 1SPYA 5HKYA 2LVVA 2WOSA 1S3PA 1Q80A 4GGFC 3VGOA 3E3RA 3VRPA 1RFJA 1CM1A 2FCDA 2FCEA 5JOLA 3UO9A 2BECA 3FIAA 2L51A 1ZFSA 4MLWA 1QV1A 4KYNA 1MHOA 1WDCC 4M2OA 4AOMA 1S5GZ 2CNPA 3CR5X 1CLBA 1PVBA 1SCMB 4GGNA 1DGUA 1S1EA 2EC6C 2KPHA 1YTZC 1FI6A 1EL4A 2LMVA 4OVNF 1CDMA 3KHEA 1DMOA 2MAZA 1G4YR 5CSJA 1N65A 1XA5A 4I5JA 1BJFA 3BOWA 3S0FA 3I5GB 2KFFA 1K9PA 5CPVA 2K7BA 1DJIA 5KU1A 4OKHA 1MWNA 2M97A 5D3OA 1X02A 3DYEA 1TUJA 1QS7A 4HRGA 1Y1AA 1DTLA 3MSEB 4PHNA 3NHTA 4NDCA 3WNXB 1J7QA 1KK7Y 1MQ1A 1ZOTB 2NZ0A 3GOFA 1CFFA 2KHNA 1M63B 1NX0A 3NSKA 4C0JA 2K0JA 2P71A 2BE6A 1DJYA 1XFYO 2MBXA 1IQ3A 1S26D 4QJ4B 4PHJA 5I2LA 3SJSA 3VRRA 1CKKA 2FOTA 2ZNEA 4WRIA 3K21A 2KSPA 1J1EA 4F7FA 1TNQA 1JF2A 1DF0A 1A29A 4OCIA 2F2PA 2WC5A 5D69A 2BBNA 2AUCA 2LNKA 3D74A 3LK0A 3EG5B 1TWOA 3PSRA 3KPXA 1BR4B 1XFZO 2EHBA 1NSHA 4GFTA 3UNWA 1CDNA 3OGNA 1UURA 3S0GA 4IL1A 1CFDA 4QJ5B 1R6PA 1K9KA 5DKNA 4GGFA 3RLZA 2B1UA 1B8LA 1FF1A 3FE6A 3LLEA 4GPLB 3DF0B 2PALA 5D7FA 1DT7B 2LUCA 2M7NA 2WC8A 1K96A 1AVSA 2WCFA 1W7IB 1TUZA 4PE4A 1DJZA 1IWQA 2BCAA 3D0YB 1AHRA 2H8VA 2LVKA 2JU0A 3A4UB 3OBVA 4A4CA 1XFRA 2PQLA 2QACA 4U8DA 2NLNA 1SK6D 4GAOA 3TUYC 4OV2A 2AAOA 2JOJA 3FWBA 1J7OA 3B6XA 1B1GA 2OTGB 3TZ1A 1FPWA 3RZSA 1DJHA 3R1PA 2WCKA 1Z4HA 1DJWA 1P28A 1A03A 1NIWA 1C07A 1JFJA 1K9UA 1B8RA 1QTXA 2KQYA 3EKHA 3JTDB 1OZOA 2SASA 2KYCA 3DY9A 2JTZA 1WRLA 2G2BA 2NXQA 2ISDA 2JT8A 2Y5IA 1BOCA 2BAPA 1LKJA 1IKUA 1OMDA 1NWDA 1DELA 1QWVA 3PJIA 3R1OA 2WCLA 1DVIA 3K1EA 1A75A 5BPJA 2O60A 1NYAA 3SIAA 1FBVA 1MF8B 2MRDA 5HKWA 1N2DA 2WCEA 1NCXA 1MXLC 3FE8A 2M1KB 4XJKB 2BCXA 3KEVA 3TS5B 4CPVA 3DVMA 3BUXB 2WCMA 2WCBA 3I5IB 1TTXA 1SCVA 2JT0A 4F0ZB 1W7JB 1ALVA 3CLNA 3VROA 5I2OA 1B7TZ 2K2AA 3PALA 1V1GA 3CR2A 4MBEA 4MRYA 1YUUA 2F33A 5JJGA 2WC6A 2KAVA 3BJHA 5GQQC 1SY9A 1HT9A 4FTGA 3D73A 2LLTA 2P70A 3O4XA 4MSPA 2FJYA 2LVJA 5IBWA 3AKAA 3SG5A 1KWOC 1ODBA 1NUBA 5B8IB 2KGBC 1NX2A 1J7RA 4JPZB 1BLQA 2JPOA 3JVTB 1WLMA 2AMIA 3CYZA 1KFXL 1PK0D 2JC2A 3I5HC 1GGZA 3L4AA 1OE9B 1DJGA 1SR6C 1C7WA 2JNFA 4BY4A 2WCJA 1LS8A 2JULA 1YX7A 2LC5A 5ER4X 1C3ZA 1PULA 1JF0A 1XFVO 1WDCB 3CS1A 2M0RA 3LK1A 1DJXA 1TNXA 1QVIY 1L2OB 2ZN9A 2LHLA 2TN4A 2K2FA 1CMGA 4YRUA 3C1VA 4UPGA 1KK8C 2PRUA 3IVTA 4YGEB 1GGWA 2QEHA 3ZWHA 3BUMB 3CGAA 2KI6C 1Y6WA 1VRKA 2KI6D 3F45A 4ETOA 4OZDA 3O78A 5KTYA 1IJ6A 1CFCA 2VRGA 1HQVA 1CM4A 3B88A 3FWCA 2KBIA 4YBHB 3TDUA 1K95A 1U5IB 1LVCD 2LM5A 4INWA 4YI8A 1B8CA 1AUIB 2QEVA 3ZNIA 3OB1B 4HREE 2LP2A 4D1EA 1LINA 3I5GC 1S5GY 5EL2A 1IJ5A 3FE9A 1PALA 1IIOA 4AQIA 1YRUB 4N1GA 3NXAA 2M8UA 2LANA 2I7AA 3BYAA 1XFWO 2QDIA 1YRTB 2MLFC 3EK8A 1ZMZA 3BQ3A 1K93D 3SS5A 3S0DA 4GUKA 3PN7B 1TNPA 2ZRSA 2L5YA 2RGIA 4PDZA 2KYFA 2JPTA 1B4CA 3DD4A 3OX5A 2OS8B 1RK9A 3OX6A 2BL0C 4ZCVA 1GQMA 1JBAA 1CLMA 1NP8A 4E68A 4I5KA 1AJ4A 1KQMC 2IS9A 1B47A 2G9BA 2M3WA 1QX5B 2M9GA 1IRJA 4JQ0D 2LMUA 1TN4A 2LUXA 2I18A 1MR8A 2L2CA 3CZTX 1M45A 1KFUL 3R72A 4YGCB 4ORBB 5HKZA 1TNWA 1UHNA 1IG5A 1RTP1 3R1VA 2LE9B 1C7VA 3WHUB 1OSAA 1YURA 2KLDA 1YX8A 3QMEA 4USLA 3DVJA 3DVEA 1WRZA 2PASA 1G33A 3NHIA 4WQ2A 1UHIA 1DGVA 2CBLA 1V1FA 1A4PA 1B9AA 1NX1A 1QJTA 2KI4C 5AEQA 4DIRA 2O5GA 2QPTA 3TUYB 2KDHA 3O4YA 1NCYA 1OOIX 2WNDA 3D78A 4JWQA 2KAYA 1M39A 3CWGA 2KGRA 1OOGA 2L98A 4INXA 3S0EA 4DRWA 1TIZA 3D77A 4NDBA 1EH2A 4NQGA 1FI5A 3SG7A 1XK4C 1UHJA 2JXCA 4I5NB 1K2HA 1CFPA 2OTGC 4M2PA 3IQQA 4DUQA 5HLVA 5AXIA 3BOWB 3TDZA 4GNKB 4CFQA 1YVHA 3PM8A 1K94A 1S6CA 2YGUA 3BFBA 5I8NA 2MJWB 1JUOA 1SSEB 2BE4A 2FJUB 3D76A 5FYXA 1S36A 3D10A 1OZSA 1XFUO 2ERBA 1RECA 2BCBA 2E6WA 2CXJA 3RM1A 2MLEC 3H4SE 2A4JA 1TOPA 2PYQA 3GK1A 4WQ3A 2KOTA 1QIWA 3EKJA 2LV7A 2HQ8A 2I94A 3I5FB 1CB1A 1SYMA 3CDNA 2KAXA
chains in the Genus database with same CATH topology
3HX4A 1H4BA 1Y0VH 1QLKA 4DS7A 1QXPA 2CCMA 1UP5A 2KBMA 1QASA 2KFHA 1OMRA 2LP3A 3TS5C 1CMFA 2M1UA 3GK2A 4ORAB 1DF0B 3NSIA 1NPQA 1OMVA 1CNPA 2LLUA 4BY5A 1AJ5A 4FQOA 1IGVA 1L7ZA 4DCKA 3DF0A 4PHMA 1GJYA 1XFXO 2Y1MA 1KSMA 1YUTA 1TCOB 1KFUS 1NCZA 4MRXA 3IQOA 2L0PA 5PALA 3SG6A 1OOJA 3D0YA 4AQJA 2LVIA 1TCFA 1YUSA 1KCYA 1MUXA 3DVKA 1IQ5A 1QX2A 1QVIZ 2I2RE 2JTTA 3I5HB 1MXEA 3HCMA 4C0KA 1M46A 5CSNA 3BUNB 2EC6B 3ICBA 3EVVA 3EVUA 2L5XB 1WY9A 1XK4A 1F70A 3WXAA 1OQPA 1KK7Z 2F3YA 1BF5A 1SCMC 1ZACA 3OB2B 5G08A 3CTNA 1KSOA 2LAPA 1CDPA 1PSRA 1F4OA 3O2PA 4MZKA 5ER5A 3SG2A 2SCPA 1EXRA 1KK8B 1SMGA 3PATA 1CDLA 4YGBB 1J55A 2K61A 2L4HA 1L2OC 3M0WA 2M49B 2OPOA 2ZN8A 2V53A 2K7DA 2M29A 4PALA 4Q04A 5HYDA 1JC2A 4CFRA 2BKHB 4CLNA 1WRKA 2H61A 1BMOA 2ZFDA 1YR5A 4R1EA 2HPSA 1F71A 1SL7A 3SG3A 1SL8A 1F55A 4P2YB 2PVBA 4XJKA 2K7OA 4N1FA 5DKRA 4I5LB 5J3XA 1KQVA 1TRFA 4MZJA 1A75B 1EJ3A 1SL9A 1AK8A 2HETA 4MVFA 2L50A 3VRNA 4PCWA 2BL0B 1WLZA 2HF5A 2D8NA 3GK4X 1UHKA 3PN7C 4GBAA 2K8MB 1NX3A 4ZCUA 1KQMB 2JNXA 1EG3A 2NCPA 1QLSA 4YGDB 1A2XA 1J7PA 1SRAA 2OS8C 1AP4A 4CIDA 5I2QA 2GGMA 1BODA 2JQ6A 3NSLA 4PE0A 1RJVA 4N5XA 2DOQA 2H2KA 1JSAA 1E8AA 2F2OA 4XYNA 1JFKA 2M7LA 2EGDA 5K89A 2ZNDA 1Y1UA 1QV0A 1M31A 1ZUZA 4MEWA 1G8IA 3PLFB 1CTRA 3AKBA 1KFXS 1JWDA 1BR1B 2Y1NA 2LMTA 1FW4A 2HQWA 2LLSA 1SW8A 2Y4QA 2JRFA 1SBJA 2Q91A 3AAKA 1QIVA 2F3ZA 4C0LA 5AFPA 2GV5A 2KI4B 1LXFC 1CLLA 3EVRA 4PE7A 2CTNA 3LL8B 4ORCB 1RROA 5HLOA 2COLB 2R2IA 4QJ3B 2F8PA 4TNCA 1SKTA 5CSFA 3QRXA 1R2UA 3AAJA 2P6BB 3PFVA 1XO5A 3A8RA 3EK4A 1U5IA 2JXLA 1PSBA 3VRQA 2GGZA 3SIBA 2MHHA 2JT3A 4OR9B 4PE1A 4P5OE 2PMYA 1ALWA 3IF7A 1UWOA 2PSRA 3BXKA 2K7CA 3KF9A 3JTDC 2ZKMX 4YGAA 2LCPA 1BT6A 1QATA 3CR4X 4MZLA 5AANA 2E30A 1LA0A 1S6JA 1UUSA 2ZRTA 3O6BA 4YI9A 4HSZA 2H61C 5DKQA 1H8BA 4HRHA 1F4QA 2JWWA 1EG4A 2MA2A 1F54A 1F8HA 4M2QA 3KO0A 3EK7A 2KFGA 3TDIA 2KNEA 2L2EA 1J1DA 2BBMA 5F6TA 5TNCA 1S6IA 3I5IC 2L4IA 3LCPC 4ICBA 3I5FC 3FS7A 3OHMB 4A4BA 2WORA 5KSZA 1IH0A 3BUOB 3NSOA 1Y1XA 4PHKA 2LHIA 1BG1A 1KWOB 2KQ6A 1PRWA 5AERA 1XYDA 1K8UA 2Q4UA 1SNLA 1QX7A 3BUWB 2JZIA 1RWYA 2CT9A 4L9MA 3SG4A 3WHTB 1SR6B 4MN0A 4NDDA 1B7TY 2BKIB 3OP0A 1D1OA 1UHHA 1YVLA 1PVAA 1XVJA 5CSIA 2NCOA 3JVTC 1K90D 1BU3A 1LA3A 1N0YA 1SPYA 5HKYA 2LVVA 2WOSA 1S3PA 1Q80A 4GGFC 3VGOA 3E3RA 3VRPA 1RFJA 1CM1A 2FCDA 2FCEA 5JOLA 2BECA 3FIAA 2L51A 1ZFSA 4MLWA 1QV1A 1MHOA 1WDCC 4M2OA 4AOMA 1S5GZ 2CNPA 3CR5X 1CLBA 1PVBA 1SCMB 4GGNA 1DGUA 1S1EA 2EC6C 1YTZC 1FI6A 1EL4A 2LMVA 4OVNF 1CDMA 3KHEA 1DMOA 2MAZA 1G4YR 5CSJA 1N65A 1XA5A 4I5JA 1BJFA 3BOWA 3I5GB 2KFFA 1K9PA 5CPVA 2K7BA 1DJIA 5KU1A 4OKHA 1MWNA 2M97A 1X02A 1QS7A 4HRGA 1Y1AA 1DTLA 3MSEB 4PHNA 4NDCA 3WNXB 1KK7Y 1MQ1A 1ZOTB 2NZ0A 3GOFA 1CFFA 2KHNA 1M63B 1NX0A 3NSKA 4C0JA 2K0JA 2BE6A 1DJYA 1XFYO 2MBXA 1IQ3A 1S26D 4QJ4B 4PHJA 5I2LA 3SJSA 3VRRA 1CKKA 2FOTA 2ZNEA 4WRIA 3K21A 2KSPA 1J1EA 1TNQA 1JF2A 1DF0A 1A29A 4OCIA 2F2PA 5D69A 2BBNA 2AUCA 2LNKA 3LK0A 3PSRA 3KPXA 1BR4B 1XFZO 2EHBA 1NSHA 4GFTA 1CDNA 1UURA 4IL1A 1CFDA 4QJ5B 1R6PA 1K9KA 5DKNA 4GGFA 3RLZA 2B1UA 1B8LA 1FF1A 3LLEA 4GPLB 3DF0B 2PALA 5D7FA 1DT7B 2LUCA 2M7NA 2WC8A 1K96A 1AVSA 2WCFA 1W7IB 4PE4A 1DJZA 1IWQA 2BCAA 3D0YB 1AHRA 2LVKA 2JU0A 3A4UB 4A4CA 2QACA 4U8DA 2NLNA 1SK6D 4GAOA 3TUYC 4OV2A 2AAOA 2JOJA 3FWBA 1J7OA 1B1GA 2OTGB 3TZ1A 1FPWA 1DJHA 1DJWA 1A03A 1NIWA 1C07A 1JFJA 1K9UA 1B8RA 1QTXA 2KQYA 3EKHA 3JTDB 1OZOA 2SASA 2KYCA 2JTZA 1WRLA 2G2BA 2NXQA 2ISDA 2JT8A 2Y5IA 1BOCA 1LKJA 1IKUA 1OMDA 1NWDA 1DVIA 5BPJA 1A75A 2O60A 1NYAA 3SIAA 1FBVA 1MF8B 2MRDA 5HKWA 1N2DA 2WCEA 1NCXA 1MXLC 4XJKB 2M1KB 3TS5B 2BCXA 3KEVA 4CPVA 1J7QA 3DVMA 3BUXB 2WCBA 3I5IB 1TTXA 1SCVA 2JT0A 4F0ZB 1W7JB 1ALVA 3CLNA 3VROA 5I2OA 1B7TZ 2K2AA 3PALA 1V1GA 3CR2A 4MBEA 4MRYA 1YUUA 2F33A 5JJGA 2KAVA 5GQQC 1SY9A 1HT9A 4FTGA 2LLTA 4MSPA 2LVJA 5IBWA 3AKAA 3SG5A 1KWOC 1ODBA 1NUBA 5B8IB 2KGBC 1NX2A 1J7RA 4JPZB 1BLQA 3JVTB 1WLMA 2AMIA 1KFXL 1PK0D 2JC2A 3I5HC 1GGZA 1OE9B 1DJGA 1SR6C 1C7WA 2JNFA 4BY4A 2JULA 1YX7A 2LC5A 5ER4X 1PULA 1JF0A 1XFVO 1WDCB 3CS1A 2M0RA 3LK1A 1DJXA 1TNXA 1QVIY 1L2OB 2ZN9A 2LHLA 2TN4A 2K2FA 1CMGA 4YRUA 3C1VA 4UPGA 1KK8C 2PRUA 4YGEB 1GGWA 3ZWHA 3BUMB 3CGAA 2KI6C 1Y6WA 1VRKA 2KI6D 3F45A 4ETOA 5KTYA 3O78A 1IJ6A 1CFCA 2VRGA 1HQVA 1CM4A 3FWCA 4YBHB 2KBIA 3TDUA 1K95A 1U5IB 1LVCD 2LM5A 4YI8A 1B8CA 1AUIB 3ZNIA 3OB1B 4HREE 2LP2A 4D1EA 1LINA 3I5GC 1S5GY 1IJ5A 1PALA 4AQIA 1YRUB 4N1GA 3NXAA 2M8UA 2LANA 2I7AA 3BYAA 1XFWO 1YRTB 2MLFC 3EK8A 1ZMZA 3BQ3A 1K93D 4GUKA 3PN7B 1TNPA 2ZRSA 2RGIA 1B4CA 4PDZA 2KYFA 2JPTA 3DD4A 3OX5A 2OS8B 1RK9A 3OX6A 2BL0C 4ZCVA 1GQMA 1JBAA 1CLMA 1NP8A 4E68A 4I5KA 1AJ4A 1KQMC 2IS9A 1B47A 2G9BA 2M3WA 1QX5B 2M9GA 1IRJA 4JQ0D 2LMUA 1TN4A 2LUXA 2I18A 1MR8A 3CZTX 1M45A 1KFUL 4YGCB 4ORBB 5HKZA 1TNWA 1UHNA 1IG5A 1RTP1 2LE9B 1C7VA 3WHUB 1OSAA 1YURA 1YX8A 4USLA 3DVJA 3DVEA 1WRZA 2PASA 1G33A 4WQ2A 1UHIA 1DGVA 2CBLA 1V1FA 1A4PA 1B9AA 1NX1A 1QJTA 2KI4C 5AEQA 4DIRA 2O5GA 2QPTA 3TUYB 2KDHA 3O4YA 1NCYA 2WNDA 4JWQA 2KAYA 1M39A 3CWGA 2KGRA 2L98A 4DRWA 1TIZA 4NDBA 1EH2A 4NQGA 1FI5A 3SG7A 1XK4C 1UHJA 2JXCA 4I5NB 1K2HA 1CFPA 2OTGC 4M2PA 3IQQA 4DUQA 5HLVA 5AXIA 3BOWB 3TDZA 4GNKB 4CFQA 1YVHA 3PM8A 1K94A 1S6CA 5I8NA 2MJWB 1JUOA 2BE4A 2FJUB 5FYXA 1S36A 3D10A 1OZSA 1XFUO 1RECA 2BCBA 2E6WA 2CXJA 3RM1A 2MLEC 3H4SE 2A4JA 1TOPA 3GK1A 4WQ3A 2KOTA 1QIWA 3EKJA 2LV7A 2HQ8A 2I94A 3I5FB 1CB1A 1SYMA 2KAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX4 A;  1H4B A;  1Y0V H;  1QLK A;  4DS7 A;  1QXP A;  2CCM A;  1UP5 A;  2KBM A;  1QAS A;  2KFH A;  1OMR A;  2LP3 A;  3TS5 C;  1CMF A;  2M1U A;  3GK2 A;  4ORA B;  1DF0 B;  3NSI A;  1NPQ A;  1OMV A;  1CNP A;  2LLU A;  4BY5 A;  1AJ5 A;  4FQO A;  1IGV A;  1L7Z A;  4DCK A;  3DF0 A;  4PHM A;  1GJY A;  1XFX O;  2Y1M A;  1KSM A;  1YUT A;  1TCO B;  1KFU S;  1NCZ A;  4MRX A;  3IQO A;  2L0P A;  5PAL A;  3SG6 A;  1OOJ A;  3D0Y A;  4AQJ A;  2LVI A;  1TCF A;  1YUS A;  1KCY A;  1MUX A;  3DVK A;  1IQ5 A;  1QX2 A;  1QVI Z;  2I2R E;  2JTT A;  3I5H B;  1MXE A;  3HCM A;  4C0K A;  1M46 A;  5CSN A;  3BUN B;  2EC6 B;  3ICB A;  3EVV A;  3EVU A;  2L5X B;  1WY9 A;  1XK4 A;  1F70 A;  3WXA A;  1OQP A;  1KK7 Z;  2F3Y A;  1BF5 A;  1SCM C;  1ZAC A;  3OB2 B;  5G08 A;  3CTN A;  1KSO A;  2LAP A;  1CDP A;  1PSR A;  1F4O A;  3O2P A;  4MZK A;  5ER5 A;  3SG2 A;  2SCP A;  1EXR A;  1KK8 B;  1SMG A;  3PAT A;  1CDL A;  4YGB B;  1J55 A;  2K61 A;  2L4H A;  1L2O C;  3M0W A;  2M49 B;  2OPO A;  2ZN8 A;  2V53 A;  2K7D A;  2M29 A;  4PAL A;  4Q04 A;  5HYD A;  1JC2 A;  4CFR A;  2BKH B;  4CLN A;  1WRK A;  2H61 A;  1BMO A;  2ZFD A;  1YR5 A;  4R1E A;  2HPS A;  1F71 A;  1SL7 A;  3SG3 A;  1SL8 A;  1F55 A;  4P2Y B;  2PVB A;  4XJK A;  2K7O A;  4N1F A;  5DKR A;  4I5L B;  5J3X A;  1KQV A;  1TRF A;  4MZJ A;  1A75 B;  1EJ3 A;  1SL9 A;  1AK8 A;  2HET A;  4MVF A;  2L50 A;  3VRN A;  4PCW A;  2BL0 B;  1WLZ A;  2HF5 A;  2D8N A;  3GK4 X;  1UHK A;  3PN7 C;  4GBA A;  2K8M B;  1NX3 A;  4ZCU A;  1KQM B;  2JNX A;  1EG3 A;  2NCP A;  1QLS A;  4YGD B;  1A2X A;  1J7P A;  1SRA A;  2OS8 C;  1AP4 A;  4CID A;  5I2Q A;  2GGM A;  1BOD A;  2JQ6 A;  3NSL A;  4PE0 A;  1RJV A;  4N5X A;  2DOQ A;  2H2K A;  1JSA A;  1E8A A;  2F2O A;  4XYN A;  1JFK A;  2M7L A;  2EGD A;  5K89 A;  2ZND A;  1Y1U A;  1QV0 A;  1M31 A;  1ZUZ A;  4MEW A;  1G8I A;  3PLF B;  1CTR A;  3AKB A;  1KFX S;  1JWD A;  1BR1 B;  2Y1N A;  2LMT A;  1FW4 A;  2HQW A;  2LLS A;  1SW8 A;  2Y4Q A;  2JRF A;  1SBJ A;  2Q91 A;  3AAK A;  1QIV A;  2F3Z A;  4C0L A;  5AFP A;  2GV5 A;  2KI4 B;  1LXF C;  1CLL A;  3EVR A;  4PE7 A;  2CTN A;  3LL8 B;  4ORC B;  1RRO A;  5HLO A;  2COL B;  2R2I A;  4QJ3 B;  2F8P A;  4TNC A;  1SKT A;  5CSF A;  3QRX A;  1R2U A;  3AAJ A;  2P6B B;  3PFV A;  1XO5 A;  3A8R A;  3EK4 A;  1U5I A;  2JXL A;  1PSB A;  3VRQ A;  2GGZ A;  3SIB A;  2MHH A;  2JT3 A;  4OR9 B;  4PE1 A;  4P5O E;  2PMY A;  1ALW A;  3IF7 A;  1UWO A;  2PSR A;  3BXK A;  2K7C A;  3KF9 A;  3JTD C;  2ZKM X;  4YGA A;  2LCP A;  1BT6 A;  1QAT A;  3CR4 X;  4MZL A;  5AAN A;  2E30 A;  1LA0 A;  1S6J A;  1UUS A;  2ZRT A;  3O6B A;  4YI9 A;  4HSZ A;  2H61 C;  5DKQ A;  1H8B A;  4HRH A;  1F4Q A;  2JWW A;  1EG4 A;  2MA2 A;  1F54 A;  1F8H A;  4M2Q A;  3KO0 A;  3EK7 A;  2KFG A;  3TDI A;  2KNE A;  2L2E A;  1J1D A;  2BBM A;  5F6T A;  5TNC A;  1S6I A;  3I5I C;  2L4I A;  3LCP C;  4ICB A;  3I5F C;  3FS7 A;  3OHM B;  4A4B A;  2WOR A;  5KSZ A;  1IH0 A;  3BUO B;  3NSO A;  1Y1X A;  4PHK A;  2LHI A;  1BG1 A;  1KWO B;  2KQ6 A;  1PRW A;  5AER A;  1XYD A;  1K8U A;  2Q4U A;  1SNL A;  1QX7 A;  3BUW B;  2JZI A;  1RWY A;  2CT9 A;  4L9M A;  3SG4 A;  3WHT B;  1SR6 B;  4MN0 A;  4NDD A;  1B7T Y;  2BKI B;  3OP0 A;  1D1O A;  1UHH A;  1YVL A;  1PVA A;  1XVJ A;  5CSI A;  2NCO A;  3JVT C;  1K90 D;  1BU3 A;  1LA3 A;  1N0Y A;  1SPY A;  5HKY A;  2LVV A;  2WOS A;  1S3P A;  1Q80 A;  4GGF C;  3VGO A;  3E3R A;  3VRP A;  1RFJ A;  1CM1 A;  2FCD A;  2FCE A;  5JOL A;  2BEC A;  3FIA A;  2L51 A;  1ZFS A;  4MLW A;  1QV1 A;  1MHO A;  1WDC C;  4M2O A;  4AOM A;  1S5G Z;  2CNP A;  3CR5 X;  1CLB A;  1PVB A;  1SCM B;  4GGN A;  1DGU A;  1S1E A;  2EC6 C;  1YTZ C;  1FI6 A;  1EL4 A;  2LMV A;  4OVN F;  1CDM A;  3KHE A;  1DMO A;  2MAZ A;  1G4Y R;  5CSJ A;  1N65 A;  1XA5 A;  4I5J A;  1BJF A;  3BOW A;  3I5G B;  2KFF A;  1K9P A;  5CPV A;  2K7B A;  1DJI A;  5KU1 A;  4OKH A;  1MWN A;  2M97 A;  1X02 A;  1QS7 A;  4HRG A;  1Y1A A;  1DTL A;  3MSE B;  4PHN A;  4NDC A;  3WNX B;  1KK7 Y;  1MQ1 A;  1ZOT B;  2NZ0 A;  3GOF A;  1CFF A;  2KHN A;  1M63 B;  1NX0 A;  3NSK A;  4C0J A;  2K0J A;  2BE6 A;  1DJY A;  1XFY O;  2MBX A;  1IQ3 A;  1S26 D;  4QJ4 B;  4PHJ A;  5I2L A;  3SJS A;  3VRR A;  1CKK A;  2FOT A;  2ZNE A;  4WRI A;  3K21 A;  2KSP A;  1J1E A;  1TNQ A;  1JF2 A;  1DF0 A;  1A29 A;  4OCI A;  2F2P A;  5D69 A;  2BBN A;  2AUC A;  2LNK A;  3LK0 A;  3PSR A;  3KPX A;  1BR4 B;  1XFZ O;  2EHB A;  1NSH A;  4GFT A;  1CDN A;  1UUR A;  4IL1 A;  1CFD A;  4QJ5 B;  1R6P A;  1K9K A;  5DKN A;  4GGF A;  3RLZ A;  2B1U A;  1B8L A;  1FF1 A;  3LLE A;  4GPL B;  3DF0 B;  2PAL A;  5D7F A;  1DT7 B;  2LUC A;  2M7N A;  2WC8 A;  1K96 A;  1AVS A;  2WCF A;  1W7I B;  4PE4 A;  1DJZ A;  1IWQ A;  2BCA A;  3D0Y B;  1AHR A;  2LVK A;  2JU0 A;  3A4U B;  4A4C A;  2QAC A;  4U8D A;  2NLN A;  1SK6 D;  4GAO A;  3TUY C;  4OV2 A;  2AAO A;  2JOJ A;  3FWB A;  1J7O A;  1B1G A;  2OTG B;  3TZ1 A;  1FPW A;  1DJH A;  1DJW A;  1A03 A;  1NIW A;  1C07 A;  1JFJ A;  1K9U A;  1B8R A;  1QTX A;  2KQY A;  3EKH A;  3JTD B;  1OZO A;  2SAS A;  2KYC A;  2JTZ A;  1WRL A;  2G2B A;  2NXQ A;  2ISD A;  2JT8 A;  2Y5I A;  1BOC A;  1LKJ A;  1IKU A;  1OMD A;  1NWD A;  1DVI A;  5BPJ A;  1A75 A;  2O60 A;  1NYA A;  3SIA A;  1FBV A;  1MF8 B;  2MRD A;  5HKW A;  1N2D A;  2WCE A;  1NCX A;  1MXL C;  4XJK B;  2M1K B;  3TS5 B;  2BCX A;  3KEV A;  4CPV A;  1J7Q A;  3DVM A;  3BUX B;  2WCB A;  3I5I B;  1TTX A;  1SCV A;  2JT0 A;  4F0Z B;  1W7J B;  1ALV A;  3CLN A;  3VRO A;  5I2O A;  1B7T Z;  2K2A A;  3PAL A;  1V1G A;  3CR2 A;  4MBE A;  4MRY A;  1YUU A;  2F33 A;  5JJG A;  2KAV A;  5GQQ C;  1SY9 A;  1HT9 A;  4FTG A;  2LLT A;  4MSP A;  2LVJ A;  5IBW A;  3AKA A;  3SG5 A;  1KWO C;  1ODB A;  1NUB A;  5B8I B;  2KGB C;  1NX2 A;  1J7R A;  4JPZ B;  1BLQ A;  3JVT B;  1WLM A;  2AMI A;  1KFX L;  1PK0 D;  2JC2 A;  3I5H C;  1GGZ A;  1OE9 B;  1DJG A;  1SR6 C;  1C7W A;  2JNF A;  4BY4 A;  2JUL A;  1YX7 A;  2LC5 A;  5ER4 X;  1PUL A;  1JF0 A;  1XFV O;  1WDC B;  3CS1 A;  2M0R A;  3LK1 A;  1DJX A;  1TNX A;  1QVI Y;  1L2O B;  2ZN9 A;  2LHL A;  2TN4 A;  2K2F A;  1CMG A;  4YRU A;  3C1V A;  4UPG A;  1KK8 C;  2PRU A;  4YGE B;  1GGW A;  3ZWH A;  3BUM B;  3CGA A;  2KI6 C;  1Y6W A;  1VRK A;  2KI6 D;  3F45 A;  4ETO A;  5KTY A;  3O78 A;  1IJ6 A;  1CFC A;  2VRG A;  1HQV A;  1CM4 A;  3FWC A;  4YBH B;  2KBI A;  3TDU A;  1K95 A;  1U5I B;  1LVC D;  2LM5 A;  4YI8 A;  1B8C A;  1AUI B;  3ZNI A;  3OB1 B;  4HRE E;  2LP2 A;  4D1E A;  1LIN A;  3I5G C;  1S5G Y;  1IJ5 A;  1PAL A;  4AQI A;  1YRU B;  4N1G A;  3NXA A;  2M8U A;  2LAN A;  2I7A A;  3BYA A;  1XFW O;  1YRT B;  2MLF C;  3EK8 A;  1ZMZ A;  3BQ3 A;  1K93 D;  4GUK A;  3PN7 B;  1TNP A;  2ZRS A;  2RGI A;  1B4C A;  4PDZ A;  2KYF A;  2JPT A;  3DD4 A;  3OX5 A;  2OS8 B;  1RK9 A;  3OX6 A;  2BL0 C;  4ZCV A;  1GQM A;  1JBA A;  1CLM A;  1NP8 A;  4E68 A;  4I5K A;  1AJ4 A;  1KQM C;  2IS9 A;  1B47 A;  2G9B A;  2M3W A;  1QX5 B;  2M9G A;  1IRJ A;  4JQ0 D;  2LMU A;  1TN4 A;  2LUX A;  2I18 A;  1MR8 A;  3CZT X;  1M45 A;  1KFU L;  4YGC B;  4ORB B;  5HKZ A;  1TNW A;  1UHN A;  1IG5 A;  1RTP 1;  2LE9 B;  1C7V A;  3WHU B;  1OSA A;  1YUR A;  1YX8 A;  4USL A;  3DVJ A;  3DVE A;  1WRZ A;  2PAS A;  1G33 A;  4WQ2 A;  1UHI A;  1DGV A;  2CBL A;  1V1F A;  1A4P A;  1B9A A;  1NX1 A;  1QJT A;  2KI4 C;  5AEQ A;  4DIR A;  2O5G A;  2QPT A;  3TUY B;  2KDH A;  3O4Y A;  1NCY A;  2WND A;  4JWQ A;  2KAY A;  1M39 A;  3CWG A;  2KGR A;  2L98 A;  4DRW A;  1TIZ A;  4NDB A;  1EH2 A;  4NQG A;  1FI5 A;  3SG7 A;  1XK4 C;  1UHJ A;  2JXC A;  4I5N B;  1K2H A;  1CFP A;  2OTG C;  4M2P A;  3IQQ A;  4DUQ A;  5HLV A;  5AXI A;  3BOW B;  3TDZ A;  4GNK B;  4CFQ A;  1YVH A;  3PM8 A;  1K94 A;  1S6C A;  5I8N A;  2MJW B;  1JUO A;  2BE4 A;  2FJU B;  5FYX A;  1S36 A;  3D10 A;  1OZS A;  1XFU O;  1REC A;  2BCB A;  2E6W A;  2CXJ A;  3RM1 A;  2MLE C;  3H4S E;  2A4J A;  1TOP A;  3GK1 A;  4WQ3 A;  2KOT A;  1QIW A;  3EKJ A;  2LV7 A;  2HQ8 A;  2I94 A;  3I5F B;  1CB1 A;  1SYM A;  2KAX A; 
#chains in the Genus database with same CATH topology
 1W9Z A;  1OW4 A;  3HX4 A;  1H4B A;  1Y0V H;  1QLK A;  4DS7 A;  1QXP A;  2CCM A;  1UP5 A;  2KBM A;  1QAS A;  2KFH A;  3B87 A;  3Q8I A;  1OMR A;  2LP3 A;  3N7H A;  3TS5 C;  1CMF A;  2M1U A;  3GK2 A;  4ORA B;  1DF0 B;  3NSI A;  1NPQ A;  1OMV A;  1CNP A;  2LLU A;  4BY5 A;  1AJ5 A;  4FQO A;  1IGV A;  1L7Z A;  4DCK A;  3DF0 A;  4PHM A;  1GJY A;  1XFX O;  2Y1M A;  1KSM A;  1YUT A;  1TCO B;  1KFU S;  1NCZ A;  4MRX A;  3IQO A;  2L0P A;  5PAL A;  3SG6 A;  1OOJ A;  3D0Y A;  5DIC A;  4AQJ A;  2LVI A;  1TCF A;  1YUS A;  1KCY A;  1MUX A;  3S0B A;  3DVK A;  1IQ5 A;  1QX2 A;  1QVI Z;  2I2R E;  2JTT A;  3I5H B;  1MXE A;  1OOF A;  3HCM A;  4IJ7 A;  4C0K A;  3CZ2 A;  1M46 A;  5CSN A;  3BUN B;  2EC6 B;  3ICB A;  3EVV A;  3EVU A;  1ORG A;  2L5X B;  1WY9 A;  5FI6 A;  1XK4 A;  1F70 A;  3D75 A;  3WXA A;  1OQP A;  1KK7 Z;  2F3Y A;  5FI7 A;  1BF5 A;  4JD9 A;  1SCM C;  1ZAC A;  3OB2 B;  5G08 A;  3CTN A;  1KSO A;  2LAP A;  1CDP A;  1PSR A;  1F4O A;  3O2P A;  4MZK A;  5ER5 A;  1OOH A;  3SG2 A;  2SCP A;  1EXR A;  1KK8 B;  1SMG A;  3PAT A;  1C3Y A;  1CDL A;  4YGB B;  1J55 A;  2K61 A;  3B86 A;  2L4H A;  1L2O C;  3SS3 A;  3M0W A;  2M49 B;  2OPO A;  2ZN8 A;  2V53 A;  2K7D A;  2M29 A;  4PAL A;  4Q04 A;  5HYD A;  2QEO A;  1JC2 A;  4CFR A;  2BKH B;  4CLN A;  1WRK A;  2H61 A;  1BMO A;  2ZFD A;  3CAB A;  1YR5 A;  4R1E A;  2HPS A;  1F71 A;  1SL7 A;  3SG3 A;  1SL8 A;  1F55 A;  4P2Y B;  3CZ0 A;  3NGV A;  2PVB A;  4XJK A;  2K7O A;  4N1F A;  5DKR A;  3B7A A;  4I5L B;  5J3X A;  1KQV A;  1TRF A;  5HL1 A;  4MZJ A;  1A75 B;  1EJ3 A;  5FI2 A;  1SL9 A;  1AK8 A;  2HET A;  4MVF A;  2L50 A;  3BFH A;  3VRN A;  4PCW A;  2BL0 B;  1WLZ A;  2HF5 A;  2D8N A;  3GK4 X;  1UHK A;  3PN7 C;  4GBA A;  2K8M B;  1NX3 A;  4ZCU A;  1KQM B;  2JNX A;  1EG3 A;  2NCP A;  1QLS A;  4YGD B;  1A2X A;  1J7P A;  1SRA A;  2OS8 C;  1AP4 A;  4CID A;  4FQT A;  5I2Q A;  2GGM A;  1BOD A;  2JQ6 A;  3NSL A;  4PE0 A;  1RJV A;  4N5X A;  2DOQ A;  2H2K A;  1JSA A;  1E8A A;  2F2O A;  4XYN A;  1JFK A;  2M7L A;  1DQE A;  2EGD A;  2WCH A;  5K89 A;  2ZND A;  1Y1U A;  1QV0 A;  2GTE A;  1M31 A;  1ZUZ A;  4MEW A;  5I94 A;  1G8I A;  3PLF B;  1CTR A;  3AKB A;  1KFX S;  1JWD A;  1BR1 B;  2Y1N A;  2LMT A;  2QEB A;  1FW4 A;  2HQW A;  2LLS A;  1SW8 A;  3PM2 A;  3VB1 A;  2Y4Q A;  2JRF A;  1SBJ A;  2Q91 A;  3AAK A;  1QIV A;  1GM0 A;  2F3Z A;  4C0L A;  5AFP A;  2GV5 A;  2KI4 B;  4PT1 A;  1LXF C;  1CLL A;  3V2L A;  3EVR A;  4PE7 A;  2CTN A;  1Z2C B;  3LL8 B;  4ORC B;  1RRO A;  5HLO A;  2COL B;  2R2I A;  4QJ3 B;  2F8P A;  4TNC A;  1SKT A;  5CSF A;  3QRX A;  1R2U A;  2KLE A;  2P6B B;  3AAJ A;  3PFV A;  1XO5 A;  3A8R A;  3EK4 A;  1U5I A;  2JXL A;  1PSB A;  3VRQ A;  2GGZ A;  1DEK A;  3SIB A;  2MHH A;  2JT3 A;  4OR9 B;  4PE1 A;  4P5O E;  2PMY A;  1ALW A;  3IF7 A;  1UWO A;  2PSR A;  3BXK A;  2K7C A;  3KF9 A;  3JTD C;  2ZKM X;  3DZT A;  4YGA A;  2LCP A;  1BT6 A;  1QAT A;  3CR4 X;  4MZL A;  5AAN A;  2E30 A;  1LA0 A;  1S6J A;  1UUS A;  2ZRT A;  3O6B A;  4YI9 A;  4HSZ A;  2H61 C;  5DKQ A;  1H8B A;  4HRH A;  1F4Q A;  3BFA A;  2JWW A;  2K60 A;  1EG4 A;  2MA2 A;  1F54 A;  1F8H A;  4M2Q A;  3KO0 A;  3EK7 A;  2KFG A;  3TDI A;  2KNE A;  2L2E A;  1J1D A;  2BBM A;  3CZ1 A;  5F6T A;  5TNC A;  1DC1 A;  1S6I A;  3I5I C;  2L4I A;  3LCP C;  4ICB A;  4JKT A;  3L4L A;  3I5F C;  3FS7 A;  3OHM B;  4A4B A;  2WOR A;  5KSZ A;  1IH0 A;  3BUO B;  3NSO A;  1Y1X A;  4PHK A;  2LHI A;  1BG1 A;  1T14 A;  1KWO B;  2KQ6 A;  1PRW A;  5AER A;  1XYD A;  3SS4 A;  3S0A A;  1K8U A;  3L47 A;  2Q4U A;  1SNL A;  1QX7 A;  3BUW B;  2JZI A;  1RWY A;  2CT9 A;  4L9M A;  2BNX A;  3SG4 A;  3WHT B;  1SR6 B;  4MN0 A;  4NDD A;  1B7T Y;  2BKI B;  3OP0 A;  1D1O A;  3DXL A;  1UHH A;  1YVL A;  1PVA A;  1XVJ A;  5CSI A;  2NCO A;  3JVT C;  1K90 D;  1BU3 A;  1LA3 A;  1N0Y A;  1SPY A;  5HKY A;  2LVV A;  2WOS A;  1S3P A;  1Q80 A;  4GGF C;  3VGO A;  3E3R A;  3VRP A;  1RFJ A;  1CM1 A;  2FCD A;  2FCE A;  5JOL A;  3UO9 A;  2BEC A;  3FIA A;  2L51 A;  1ZFS A;  4MLW A;  1QV1 A;  4KYN A;  1MHO A;  1WDC C;  4M2O A;  4AOM A;  1S5G Z;  2CNP A;  3CR5 X;  1CLB A;  1PVB A;  1SCM B;  4GGN A;  1DGU A;  1S1E A;  2EC6 C;  2KPH A;  1YTZ C;  1FI6 A;  1EL4 A;  2LMV A;  4OVN F;  1CDM A;  3KHE A;  1DMO A;  2MAZ A;  1G4Y R;  5CSJ A;  1N65 A;  1XA5 A;  4I5J A;  1BJF A;  3BOW A;  3S0F A;  3I5G B;  2KFF A;  1K9P A;  5CPV A;  2K7B A;  1DJI A;  5KU1 A;  4OKH A;  1MWN A;  2M97 A;  5D3O A;  1X02 A;  3DYE A;  1TUJ A;  1QS7 A;  4HRG A;  1Y1A A;  1DTL A;  3MSE B;  4PHN A;  3NHT A;  4NDC A;  3WNX B;  1J7Q A;  1KK7 Y;  1MQ1 A;  1ZOT B;  2NZ0 A;  3GOF A;  1CFF A;  2KHN A;  1M63 B;  1NX0 A;  3NSK A;  4C0J A;  2K0J A;  2P71 A;  2BE6 A;  1DJY A;  1XFY O;  2MBX A;  1IQ3 A;  1S26 D;  4QJ4 B;  4PHJ A;  5I2L A;  3SJS A;  3VRR A;  1CKK A;  2FOT A;  2ZNE A;  4WRI A;  3K21 A;  2KSP A;  1J1E A;  4F7F A;  1TNQ A;  1JF2 A;  1DF0 A;  1A29 A;  4OCI A;  2F2P A;  2WC5 A;  5D69 A;  2BBN A;  2AUC A;  2LNK A;  3D74 A;  3LK0 A;  3EG5 B;  1TWO A;  3PSR A;  3KPX A;  1BR4 B;  1XFZ O;  2EHB A;  1NSH A;  4GFT A;  3UNW A;  1CDN A;  3OGN A;  1UUR A;  3S0G A;  4IL1 A;  1CFD A;  4QJ5 B;  1R6P A;  1K9K A;  5DKN A;  4GGF A;  3RLZ A;  2B1U A;  1B8L A;  1FF1 A;  3FE6 A;  3LLE A;  4GPL B;  3DF0 B;  2PAL A;  5D7F A;  1DT7 B;  2LUC A;  2M7N A;  2WC8 A;  1K96 A;  1AVS A;  2WCF A;  1W7I B;  1TUZ A;  4PE4 A;  1DJZ A;  1IWQ A;  2BCA A;  3D0Y B;  1AHR A;  2H8V A;  2LVK A;  2JU0 A;  3A4U B;  3OBV A;  4A4C A;  1XFR A;  2PQL A;  2QAC A;  4U8D A;  2NLN A;  1SK6 D;  4GAO A;  3TUY C;  4OV2 A;  2AAO A;  2JOJ A;  3FWB A;  1J7O A;  3B6X A;  1B1G A;  2OTG B;  3TZ1 A;  1FPW A;  3RZS A;  1DJH A;  3R1P A;  2WCK A;  1Z4H A;  1DJW A;  1P28 A;  1A03 A;  1NIW A;  1C07 A;  1JFJ A;  1K9U A;  1B8R A;  1QTX A;  2KQY A;  3EKH A;  3JTD B;  1OZO A;  2SAS A;  2KYC A;  3DY9 A;  2JTZ A;  1WRL A;  2G2B A;  2NXQ A;  2ISD A;  2JT8 A;  2Y5I A;  1BOC A;  2BAP A;  1LKJ A;  1IKU A;  1OMD A;  1NWD A;  1DEL A;  1QWV A;  3PJI A;  3R1O A;  2WCL A;  1DVI A;  3K1E A;  1A75 A;  5BPJ A;  2O60 A;  1NYA A;  3SIA A;  1FBV A;  1MF8 B;  2MRD A;  5HKW A;  1N2D A;  2WCE A;  1NCX A;  1MXL C;  3FE8 A;  2M1K B;  4XJK B;  2BCX A;  3KEV A;  3TS5 B;  4CPV A;  3DVM A;  3BUX B;  2WCM A;  2WCB A;  3I5I B;  1TTX A;  1SCV A;  2JT0 A;  4F0Z B;  1W7J B;  1ALV A;  3CLN A;  3VRO A;  5I2O A;  1B7T Z;  2K2A A;  3PAL A;  1V1G A;  3CR2 A;  4MBE A;  4MRY A;  1YUU A;  2F33 A;  5JJG A;  2WC6 A;  2KAV A;  3BJH A;  5GQQ C;  1SY9 A;  1HT9 A;  4FTG A;  3D73 A;  2LLT A;  2P70 A;  3O4X A;  4MSP A;  2FJY A;  2LVJ A;  5IBW A;  3AKA A;  3SG5 A;  1KWO C;  1ODB A;  1NUB A;  5B8I B;  2KGB C;  1NX2 A;  1J7R A;  4JPZ B;  1BLQ A;  2JPO A;  3JVT B;  1WLM A;  2AMI A;  3CYZ A;  1KFX L;  1PK0 D;  2JC2 A;  3I5H C;  1GGZ A;  3L4A A;  1OE9 B;  1DJG A;  1SR6 C;  1C7W A;  2JNF A;  4BY4 A;  2WCJ A;  1LS8 A;  2JUL A;  1YX7 A;  2LC5 A;  5ER4 X;  1C3Z A;  1PUL A;  1JF0 A;  1XFV O;  1WDC B;  3CS1 A;  2M0R A;  3LK1 A;  1DJX A;  1TNX A;  1QVI Y;  1L2O B;  2ZN9 A;  2LHL A;  2TN4 A;  2K2F A;  1CMG A;  4YRU A;  3C1V A;  4UPG A;  1KK8 C;  2PRU A;  3IVT A;  4YGE B;  1GGW A;  2QEH A;  3ZWH A;  3BUM B;  3CGA A;  2KI6 C;  1Y6W A;  1VRK A;  2KI6 D;  3F45 A;  4ETO A;  4OZD A;  3O78 A;  5KTY A;  1IJ6 A;  1CFC A;  2VRG A;  1HQV A;  1CM4 A;  3B88 A;  3FWC A;  2KBI A;  4YBH B;  3TDU A;  1K95 A;  1U5I B;  1LVC D;  2LM5 A;  4INW A;  4YI8 A;  1B8C A;  1AUI B;  2QEV A;  3ZNI A;  3OB1 B;  4HRE E;  2LP2 A;  4D1E A;  1LIN A;  3I5G C;  1S5G Y;  5EL2 A;  1IJ5 A;  3FE9 A;  1PAL A;  1IIO A;  4AQI A;  1YRU B;  4N1G A;  3NXA A;  2M8U A;  2LAN A;  2I7A A;  3BYA A;  1XFW O;  2QDI A;  1YRT B;  2MLF C;  3EK8 A;  1ZMZ A;  3BQ3 A;  1K93 D;  3SS5 A;  3S0D A;  4GUK A;  3PN7 B;  1TNP A;  2ZRS A;  2L5Y A;  2RGI A;  4PDZ A;  2KYF A;  2JPT A;  1B4C A;  3DD4 A;  3OX5 A;  2OS8 B;  1RK9 A;  3OX6 A;  2BL0 C;  4ZCV A;  1GQM A;  1JBA A;  1CLM A;  1NP8 A;  4E68 A;  4I5K A;  1AJ4 A;  1KQM C;  2IS9 A;  1B47 A;  2G9B A;  2M3W A;  1QX5 B;  2M9G A;  1IRJ A;  4JQ0 D;  2LMU A;  1TN4 A;  2LUX A;  2I18 A;  1MR8 A;  2L2C A;  3CZT X;  1M45 A;  1KFU L;  3R72 A;  4YGC B;  4ORB B;  5HKZ A;  1TNW A;  1UHN A;  1IG5 A;  1RTP 1;  3R1V A;  2LE9 B;  1C7V A;  3WHU B;  1OSA A;  1YUR A;  2KLD A;  1YX8 A;  3QME A;  4USL A;  3DVJ A;  3DVE A;  1WRZ A;  2PAS A;  1G33 A;  3NHI A;  4WQ2 A;  1UHI A;  1DGV A;  2CBL A;  1V1F A;  1A4P A;  1B9A A;  1NX1 A;  1QJT A;  2KI4 C;  5AEQ A;  4DIR A;  2O5G A;  2QPT A;  3TUY B;  2KDH A;  3O4Y A;  1NCY A;  1OOI X;  2WND A;  3D78 A;  4JWQ A;  2KAY A;  1M39 A;  3CWG A;  2KGR A;  1OOG A;  2L98 A;  4INX A;  3S0E A;  4DRW A;  1TIZ A;  3D77 A;  4NDB A;  1EH2 A;  4NQG A;  1FI5 A;  3SG7 A;  1XK4 C;  1UHJ A;  2JXC A;  4I5N B;  1K2H A;  1CFP A;  2OTG C;  4M2P A;  3IQQ A;  4DUQ A;  5HLV A;  5AXI A;  3BOW B;  3TDZ A;  4GNK B;  4CFQ A;  1YVH A;  3PM8 A;  1K94 A;  1S6C A;  2YGU A;  3BFB A;  5I8N A;  2MJW B;  1JUO A;  1SSE B;  2BE4 A;  2FJU B;  3D76 A;  5FYX A;  1S36 A;  3D10 A;  1OZS A;  1XFU O;  2ERB A;  1REC A;  2BCB A;  2E6W A;  2CXJ A;  3RM1 A;  2MLE C;  3H4S E;  2A4J A;  1TOP A;  2PYQ A;  3GK1 A;  4WQ3 A;  2KOT A;  1QIW A;  3EKJ A;  2LV7 A;  2HQ8 A;  2I94 A;  3I5F B;  1CB1 A;  1SYM A;  3CDN A;  2KAX A; 
#chains in the Genus database with same CATH homology
 3HX4 A;  1H4B A;  1Y0V H;  1QLK A;  4DS7 A;  1QXP A;  2CCM A;  1UP5 A;  2KBM A;  1QAS A;  2KFH A;  1OMR A;  2LP3 A;  3TS5 C;  1CMF A;  2M1U A;  3GK2 A;  4ORA B;  1DF0 B;  3NSI A;  1NPQ A;  1OMV A;  1CNP A;  2LLU A;  4BY5 A;  1AJ5 A;  4FQO A;  1IGV A;  1L7Z A;  4DCK A;  3DF0 A;  4PHM A;  1GJY A;  1XFX O;  2Y1M A;  1KSM A;  1YUT A;  1TCO B;  1KFU S;  1NCZ A;  4MRX A;  3IQO A;  2L0P A;  5PAL A;  3SG6 A;  1OOJ A;  3D0Y A;  4AQJ A;  2LVI A;  1TCF A;  1YUS A;  1KCY A;  1MUX A;  3DVK A;  1IQ5 A;  1QX2 A;  1QVI Z;  2I2R E;  2JTT A;  3I5H B;  1MXE A;  3HCM A;  4C0K A;  1M46 A;  5CSN A;  3BUN B;  2EC6 B;  3ICB A;  3EVV A;  3EVU A;  2L5X B;  1WY9 A;  1XK4 A;  1F70 A;  3WXA A;  1OQP A;  1KK7 Z;  2F3Y A;  1BF5 A;  1SCM C;  1ZAC A;  3OB2 B;  5G08 A;  3CTN A;  1KSO A;  2LAP A;  1CDP A;  1PSR A;  1F4O A;  3O2P A;  4MZK A;  5ER5 A;  3SG2 A;  2SCP A;  1EXR A;  1KK8 B;  1SMG A;  3PAT A;  1CDL A;  4YGB B;  1J55 A;  2K61 A;  2L4H A;  1L2O C;  3M0W A;  2M49 B;  2OPO A;  2ZN8 A;  2V53 A;  2K7D A;  2M29 A;  4PAL A;  4Q04 A;  5HYD A;  1JC2 A;  4CFR A;  2BKH B;  4CLN A;  1WRK A;  2H61 A;  1BMO A;  2ZFD A;  1YR5 A;  4R1E A;  2HPS A;  1F71 A;  1SL7 A;  3SG3 A;  1SL8 A;  1F55 A;  4P2Y B;  2PVB A;  4XJK A;  2K7O A;  4N1F A;  5DKR A;  4I5L B;  5J3X A;  1KQV A;  1TRF A;  4MZJ A;  1A75 B;  1EJ3 A;  1SL9 A;  1AK8 A;  2HET A;  4MVF A;  2L50 A;  3VRN A;  4PCW A;  2BL0 B;  1WLZ A;  2HF5 A;  2D8N A;  3GK4 X;  1UHK A;  3PN7 C;  4GBA A;  2K8M B;  1NX3 A;  4ZCU A;  1KQM B;  2JNX A;  1EG3 A;  2NCP A;  1QLS A;  4YGD B;  1A2X A;  1J7P A;  1SRA A;  2OS8 C;  1AP4 A;  4CID A;  5I2Q A;  2GGM A;  1BOD A;  2JQ6 A;  3NSL A;  4PE0 A;  1RJV A;  4N5X A;  2DOQ A;  2H2K A;  1JSA A;  1E8A A;  2F2O A;  4XYN A;  1JFK A;  2M7L A;  2EGD A;  5K89 A;  2ZND A;  1Y1U A;  1QV0 A;  1M31 A;  1ZUZ A;  4MEW A;  1G8I A;  3PLF B;  1CTR A;  3AKB A;  1KFX S;  1JWD A;  1BR1 B;  2Y1N A;  2LMT A;  1FW4 A;  2HQW A;  2LLS A;  1SW8 A;  2Y4Q A;  2JRF A;  1SBJ A;  2Q91 A;  3AAK A;  1QIV A;  2F3Z A;  4C0L A;  5AFP A;  2GV5 A;  2KI4 B;  1LXF C;  1CLL A;  3EVR A;  4PE7 A;  2CTN A;  3LL8 B;  4ORC B;  1RRO A;  5HLO A;  2COL B;  2R2I A;  4QJ3 B;  2F8P A;  4TNC A;  1SKT A;  5CSF A;  3QRX A;  1R2U A;  3AAJ A;  2P6B B;  3PFV A;  1XO5 A;  3A8R A;  3EK4 A;  1U5I A;  2JXL A;  1PSB A;  3VRQ A;  2GGZ A;  3SIB A;  2MHH A;  2JT3 A;  4OR9 B;  4PE1 A;  4P5O E;  2PMY A;  1ALW A;  3IF7 A;  1UWO A;  2PSR A;  3BXK A;  2K7C A;  3KF9 A;  3JTD C;  2ZKM X;  4YGA A;  2LCP A;  1BT6 A;  1QAT A;  3CR4 X;  4MZL A;  5AAN A;  2E30 A;  1LA0 A;  1S6J A;  1UUS A;  2ZRT A;  3O6B A;  4YI9 A;  4HSZ A;  2H61 C;  5DKQ A;  1H8B A;  4HRH A;  1F4Q A;  2JWW A;  1EG4 A;  2MA2 A;  1F54 A;  1F8H A;  4M2Q A;  3KO0 A;  3EK7 A;  2KFG A;  3TDI A;  2KNE A;  2L2E A;  1J1D A;  2BBM A;  5F6T A;  5TNC A;  1S6I A;  3I5I C;  2L4I A;  3LCP C;  4ICB A;  3I5F C;  3FS7 A;  3OHM B;  4A4B A;  2WOR A;  5KSZ A;  1IH0 A;  3BUO B;  3NSO A;  1Y1X A;  4PHK A;  2LHI A;  1BG1 A;  1KWO B;  2KQ6 A;  1PRW A;  5AER A;  1XYD A;  1K8U A;  2Q4U A;  1SNL A;  1QX7 A;  3BUW B;  2JZI A;  1RWY A;  2CT9 A;  4L9M A;  3SG4 A;  3WHT B;  1SR6 B;  4MN0 A;  4NDD A;  1B7T Y;  2BKI B;  3OP0 A;  1D1O A;  1UHH A;  1YVL A;  1PVA A;  1XVJ A;  5CSI A;  2NCO A;  3JVT C;  1K90 D;  1BU3 A;  1LA3 A;  1N0Y A;  1SPY A;  5HKY A;  2LVV A;  2WOS A;  1S3P A;  1Q80 A;  4GGF C;  3VGO A;  3E3R A;  3VRP A;  1RFJ A;  1CM1 A;  2FCD A;  2FCE A;  5JOL A;  2BEC A;  3FIA A;  2L51 A;  1ZFS A;  4MLW A;  1QV1 A;  1MHO A;  1WDC C;  4M2O A;  4AOM A;  1S5G Z;  2CNP A;  3CR5 X;  1CLB A;  1PVB A;  1SCM B;  4GGN A;  1DGU A;  1S1E A;  2EC6 C;  1YTZ C;  1FI6 A;  1EL4 A;  2LMV A;  4OVN F;  1CDM A;  3KHE A;  1DMO A;  2MAZ A;  1G4Y R;  5CSJ A;  1N65 A;  1XA5 A;  4I5J A;  1BJF A;  3BOW A;  3I5G B;  2KFF A;  1K9P A;  5CPV A;  2K7B A;  1DJI A;  5KU1 A;  4OKH A;  1MWN A;  2M97 A;  1X02 A;  1QS7 A;  4HRG A;  1Y1A A;  1DTL A;  3MSE B;  4PHN A;  4NDC A;  3WNX B;  1KK7 Y;  1MQ1 A;  1ZOT B;  2NZ0 A;  3GOF A;  1CFF A;  2KHN A;  1M63 B;  1NX0 A;  3NSK A;  4C0J A;  2K0J A;  2BE6 A;  1DJY A;  1XFY O;  2MBX A;  1IQ3 A;  1S26 D;  4QJ4 B;  4PHJ A;  5I2L A;  3SJS A;  3VRR A;  1CKK A;  2FOT A;  2ZNE A;  4WRI A;  3K21 A;  2KSP A;  1J1E A;  1TNQ A;  1JF2 A;  1DF0 A;  1A29 A;  4OCI A;  2F2P A;  5D69 A;  2BBN A;  2AUC A;  2LNK A;  3LK0 A;  3PSR A;  3KPX A;  1BR4 B;  1XFZ O;  2EHB A;  1NSH A;  4GFT A;  1CDN A;  1UUR A;  4IL1 A;  1CFD A;  4QJ5 B;  1R6P A;  1K9K A;  5DKN A;  4GGF A;  3RLZ A;  2B1U A;  1B8L A;  1FF1 A;  3LLE A;  4GPL B;  3DF0 B;  2PAL A;  5D7F A;  1DT7 B;  2LUC A;  2M7N A;  2WC8 A;  1K96 A;  1AVS A;  2WCF A;  1W7I B;  4PE4 A;  1DJZ A;  1IWQ A;  2BCA A;  3D0Y B;  1AHR A;  2LVK A;  2JU0 A;  3A4U B;  4A4C A;  2QAC A;  4U8D A;  2NLN A;  1SK6 D;  4GAO A;  3TUY C;  4OV2 A;  2AAO A;  2JOJ A;  3FWB A;  1J7O A;  1B1G A;  2OTG B;  3TZ1 A;  1FPW A;  1DJH A;  1DJW A;  1A03 A;  1NIW A;  1C07 A;  1JFJ A;  1K9U A;  1B8R A;  1QTX A;  2KQY A;  3EKH A;  3JTD B;  1OZO A;  2SAS A;  2KYC A;  2JTZ A;  1WRL A;  2G2B A;  2NXQ A;  2ISD A;  2JT8 A;  2Y5I A;  1BOC A;  1LKJ A;  1IKU A;  1OMD A;  1NWD A;  1DVI A;  5BPJ A;  1A75 A;  2O60 A;  1NYA A;  3SIA A;  1FBV A;  1MF8 B;  2MRD A;  5HKW A;  1N2D A;  2WCE A;  1NCX A;  1MXL C;  4XJK B;  2M1K B;  3TS5 B;  2BCX A;  3KEV A;  4CPV A;  1J7Q A;  3DVM A;  3BUX B;  2WCB A;  3I5I B;  1TTX A;  1SCV A;  2JT0 A;  4F0Z B;  1W7J B;  1ALV A;  3CLN A;  3VRO A;  5I2O A;  1B7T Z;  2K2A A;  3PAL A;  1V1G A;  3CR2 A;  4MBE A;  4MRY A;  1YUU A;  2F33 A;  5JJG A;  2KAV A;  5GQQ C;  1SY9 A;  1HT9 A;  4FTG A;  2LLT A;  4MSP A;  2LVJ A;  5IBW A;  3AKA A;  3SG5 A;  1KWO C;  1ODB A;  1NUB A;  5B8I B;  2KGB C;  1NX2 A;  1J7R A;  4JPZ B;  1BLQ A;  3JVT B;  1WLM A;  2AMI A;  1KFX L;  1PK0 D;  2JC2 A;  3I5H C;  1GGZ A;  1OE9 B;  1DJG A;  1SR6 C;  1C7W A;  2JNF A;  4BY4 A;  2JUL A;  1YX7 A;  2LC5 A;  5ER4 X;  1PUL A;  1JF0 A;  1XFV O;  1WDC B;  3CS1 A;  2M0R A;  3LK1 A;  1DJX A;  1TNX A;  1QVI Y;  1L2O B;  2ZN9 A;  2LHL A;  2TN4 A;  2K2F A;  1CMG A;  4YRU A;  3C1V A;  4UPG A;  1KK8 C;  2PRU A;  4YGE B;  1GGW A;  3ZWH A;  3BUM B;  3CGA A;  2KI6 C;  1Y6W A;  1VRK A;  2KI6 D;  3F45 A;  4ETO A;  5KTY A;  3O78 A;  1IJ6 A;  1CFC A;  2VRG A;  1HQV A;  1CM4 A;  3FWC A;  4YBH B;  2KBI A;  3TDU A;  1K95 A;  1U5I B;  1LVC D;  2LM5 A;  4YI8 A;  1B8C A;  1AUI B;  3ZNI A;  3OB1 B;  4HRE E;  2LP2 A;  4D1E A;  1LIN A;  3I5G C;  1S5G Y;  1IJ5 A;  1PAL A;  4AQI A;  1YRU B;  4N1G A;  3NXA A;  2M8U A;  2LAN A;  2I7A A;  3BYA A;  1XFW O;  1YRT B;  2MLF C;  3EK8 A;  1ZMZ A;  3BQ3 A;  1K93 D;  4GUK A;  3PN7 B;  1TNP A;  2ZRS A;  2RGI A;  1B4C A;  4PDZ A;  2KYF A;  2JPT A;  3DD4 A;  3OX5 A;  2OS8 B;  1RK9 A;  3OX6 A;  2BL0 C;  4ZCV A;  1GQM A;  1JBA A;  1CLM A;  1NP8 A;  4E68 A;  4I5K A;  1AJ4 A;  1KQM C;  2IS9 A;  1B47 A;  2G9B A;  2M3W A;  1QX5 B;  2M9G A;  1IRJ A;  4JQ0 D;  2LMU A;  1TN4 A;  2LUX A;  2I18 A;  1MR8 A;  3CZT X;  1M45 A;  1KFU L;  4YGC B;  4ORB B;  5HKZ A;  1TNW A;  1UHN A;  1IG5 A;  1RTP 1;  2LE9 B;  1C7V A;  3WHU B;  1OSA A;  1YUR A;  1YX8 A;  4USL A;  3DVJ A;  3DVE A;  1WRZ A;  2PAS A;  1G33 A;  4WQ2 A;  1UHI A;  1DGV A;  2CBL A;  1V1F A;  1A4P A;  1B9A A;  1NX1 A;  1QJT A;  2KI4 C;  5AEQ A;  4DIR A;  2O5G A;  2QPT A;  3TUY B;  2KDH A;  3O4Y A;  1NCY A;  2WND A;  4JWQ A;  2KAY A;  1M39 A;  3CWG A;  2KGR A;  2L98 A;  4DRW A;  1TIZ A;  4NDB A;  1EH2 A;  4NQG A;  1FI5 A;  3SG7 A;  1XK4 C;  1UHJ A;  2JXC A;  4I5N B;  1K2H A;  1CFP A;  2OTG C;  4M2P A;  3IQQ A;  4DUQ A;  5HLV A;  5AXI A;  3BOW B;  3TDZ A;  4GNK B;  4CFQ A;  1YVH A;  3PM8 A;  1K94 A;  1S6C A;  5I8N A;  2MJW B;  1JUO A;  2BE4 A;  2FJU B;  5FYX A;  1S36 A;  3D10 A;  1OZS A;  1XFU O;  1REC A;  2BCB A;  2E6W A;  2CXJ A;  3RM1 A;  2MLE C;  3H4S E;  2A4J A;  1TOP A;  3GK1 A;  4WQ3 A;  2KOT A;  1QIW A;  3EKJ A;  2LV7 A;  2HQ8 A;  2I94 A;  3I5F B;  1CB1 A;  1SYM A;  2KAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...