2M1KB

Interaction of human s100a6 (c3s) with v domain of receptor for advanced glycation end products (rage)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
ASPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein S100-A6
publication title Interaction of the S100A6 mutant (C3S) with the V domain of the receptor for advanced glycation end products (RAGE).
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 89
sequence length 89
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m1kB00
1ZMZA 4YI9A 2JTZA 1QX2A 1Y0VH 3DF0A 1LINA 3BOWB 1PSBA 1IG5A 1XFUO 1U5IB 4MZJA 2L5XB 1QS7A 1MR8A 3FWBA 3QRXA 1J55A 3EK7A 2K7BA 2LUXA 1BF5A 4YBHB 4QJ4B 3JTDC 1Y6WA 4L9MA 3FS7A 1W7JB 2JT8A 3VRQA 1GQMA 1WY9A 1ZOTB 1DGUA 1BJFA 1J1EA 2KFHA 1UHKA 1M63B 2K61A 2H61C 1MHOA 1BU3A 5HLVA 3I5HC 2K8MB 5I8NA 3O4YA 1B9AA 5I2LA 3WXAA 1BR4B 1WLMA 1CDLA 1NWDA 1QLKA 4N5XA 3M0WA 2JC2A 1EL4A 2D8NA 1QVIZ 1TCFA 1OZSA 2ZNEA 4GUKA 2M1KB 1CDPA 1N2DA 2G9BA 1MWNA 3BUNB 4AOMA 1FPWA 5KSZA 2KAXA 5AFPA 3DD4A 1MXLC 2WNDA 2OTGB 5PALA 3TZ1A 4OCIA 1QV1A 2WC8A 1CMGA 1H4BA 1A29A 5I2QA 1WDCB 2KOTA 3LK1A 1DTLA 3AAKA 3KPXA 3MSEB 3PALA 4N1GA 3WHUB 1OMVA 1NUBA 5JOLA 2BKIB 1SMGA 4PHMA 1RK9A 4PE4A 2LP2A 1UUSA 1XO5A 1IH0A 4PE7A 1CDNA 1SCMB 1SW8A 4I5LB 5AANA 2M29A 1M45A 3D0YA 1DJWA 2BCAA 3CTNA 2H2KA 1JF0A 1XK4C 1M39A 2M49B 3HCMA 5IBWA 3TS5C 2HQWA 2NLNA 2EC6B 4I5KA 4I5NB 1N0YA 1Y1UA 1BR1B 4PHNA 4CFRA 4TNCA 5J3XA 1CLBA 1F70A 1JFKA 4MSPA 1WRLA 2KQYA 3SG2A 1G4YR 1KK7Z 1XFYO 2KBIA 1DMOA 3O2PA 5CSJA 2F33A 3FWCA 2WORA 4OV2A 2LAPA 3AKAA 4DUQA 3RM1A 1F4QA 4JWQA 2JOJA 1SY9A 2ZN8A 2HPSA 4NDCA 2LMVA 2KI6D 3NSLA 5AERA 2CTNA 2PRUA 3NXAA 3BQ3A 4WRIA 2JTTA 1QASA 1A03A 1UWOA 3OB2B 3I5HB 2KI6C 1IJ6A 1KSMA 3OHMB 1DF0A 3KEVA 1UHHA 1S26D 2ISDA 2Y1NA 2BKHB 1DJIA 2LV7A 1L2OB 1K93D 3NSOA 1BG1A 2JZIA 3A8RA 3IF7A 2BCXA 4E68A 1B7TY 3AAJA 2PASA 1SL8A 1UHJA 3CR5X 1Y1AA 4C0JA 2EHBA 1A75B 3KO0A 4MZKA 5G08A 1ODBA 3C1VA 5ER4X 3TDZA 1IWQA 1KFXL 1HT9A 1IQ5A 1Q80A 2K0JA 2LUCA 2V53A 2F3ZA 1HQVA 4MN0A 4U8DA 1H8BA 1N65A 2LLTA 4YGDB 2KSPA 1KWOC 2HF5A 2MBXA 1OQPA 1TNPA 1RJVA 2ZKMX 2L98A 2MRDA 2PALA 2IS9A 1KQMB 4DRWA 1EH2A 1KK8C 1IQ3A 5CSFA 1KFXS 4YGCB 3DVEA 1WLZA 1NSHA 2MLEC 1CTRA 2CXJA 3TUYB 1CM1A 2L50A 4GGFC 1IKUA 3PFVA 1PK0D 1RROA 1QV0A 3WNXB 3IQQA 1LA3A 1MQ1A 2ZN9A 3IQOA 3PSRA 3CZTX 3BOWA 3D10A 3HX4A 1C07A 3PLFB 4DCKA 3OP0A 3LL8B 1U5IA 2L0PA 3PN7C 2PMYA 3JVTC 4M2OA 3SG6A 1G8IA 3I5GC 4MRXA 2Y5IA 1ALVA 1NX2A 4YGEB 4ZCUA 4OR9B 2FCEA 1K96A 1PRWA 3E3RA 3ICBA 5HKWA 4DIRA 3SJSA 5ER5A 2L4IA 1YUTA 2LNKA 5CSNA 4ORAB 3SG3A 4AQIA 2G2BA 5CSIA 2LMUA 2OS8C 3EK4A 4CFQA 2LVIA 3BXKA 1SR6C 4ORCB 1TTXA 1NCYA 2WCBA 1JBAA 2R2IA 1UHIA 4MRYA 1NX1A 4CIDA 1S5GY 4YRUA 3LCPC 1B1GA 2CBLA 1NX0A 2M9GA 2KYCA 4BY4A 2KBMA 1YVLA 2MAZA 3DVMA 1BODA 2NCOA 4GFTA 1KCYA 3CGAA 1PALA 2F2OA 2JNFA 2KAYA 4HREE 4MZLA 1CFCA 1SK6D 3CLNA 2KI4C 1QX7A 1R6PA 1YRTB 3VROA 1RTP1 1BMOA 1F55A 1QIVA 2BL0B 2BBNA 3I5FC 3LK0A 2JT3A 1QX5B 3GOFA 1MF8B 2AAOA 4FTGA 2LM5A 3DVJA 1CFFA 2LLUA 2M7LA 2FCDA 5KTYA 4JPZB 1XFVO 3I5IB 4XYNA 4CLNA 1NPQA 2KQ6A 2COLB 2P6BB 2BECA 4ORBB 2K7DA 1CLMA 3CR2A 1AJ4A 2BE6A 1SL9A 2CNPA 2LC5A 1EXRA 1V1FA 1F71A 4HRHA 1DVIA 1MXEA 3JTDB 2BCBA 2BE4A 3KF9A 2QPTA 1TNWA 1C7VA 2TN4A 2WCFA 1BT6A 2JULA 4MEWA 4BY5A 4D1EA 1SBJA 1SRAA 2Q91A 1SNLA 1OE9B 1CM4A 1UURA 1OMDA 2LCPA 1S36A 5B8IB 2KGBC 2JU0A 4GBAA 1UP5A 2B1UA 4A4BA 4YI8A 1LA0A 2O60A 2ZRTA 3NSIA 1YURA 1K9PA 5D7FA 4HRGA 1XFWO 3TDUA 1B47A 1K94A 1SR6B 2KFGA 1PSRA 2FJUB 2NZ0A 4YGAA 1B8RA 1J7QA 4MVFA 4Q04A 1LKJA 3SIAA 2O5GA 1XYDA 1DGVA 1KFUL 1S6IA 3LLEA 3ZWHA 1ZFSA 1SPYA 1A75A 1TIZA 2LVVA 1FI6A 2KNEA 3BUWB 4I5JA 3OX5A 1K9KA 1YUSA 1FW4A 2OTGC 4PALA 1DJZA 2KDHA 1M31A 1QXPA 1YRUB 1CKKA 1WDCC 4USLA 1K90D 2F3YA 1GGWA 2KFFA 1IRJA 2ZNDA 1FI5A 1ALWA 4WQ2A 4XJKB 1CMFA 2E30A 4JQ0D 1KFUS 1E8AA 4CPVA 1PVAA 2M3WA 1WRKA 5GQQC 1BLQA 4NQGA 2JT0A 1OOJA 1S1EA 2LVJA 2M0RA 1QVIY 1JUOA 3EVRA 3SG5A 3BUXB 4C0KA 4F0ZB 3O6BA 1CNPA 3BUMB 3EVVA 3BUOB 1YX7A 1YTZC 1PVBA 3DF0B 4IL1A 3TS5B 1PULA 3ZNIA 1SCVA 5AXIA 1B7TZ 4OKHA 1RFJA 2M8UA 3BYAA 2EC6C 1G33A 2I7AA 1K8UA 5HYDA 1J7OA 1XK4A 3WHTB 2LVKA 1XA5A 3DVKA 2LP3A 1K2HA 1OZOA 5CPVA 3TDIA 1AJ5A 3VRRA 3O78A 5JJGA 1F4OA 3GK4X 1S6CA 1JF2A 1JFJA 3AKBA 1JC2A 4P2YB 5HKZA 1J7RA 2L51A 4QJ5B 2NCPA 2RGIA 4WQ3A 2MHHA 1YX8A 5AEQA 3VGOA 1Y1XA 1K9UA 1NCXA 1KQVA 4ICBA 2FOTA 2NXQA 1CLLA 2DOQA 1AP4A 4MLWA 2ZRSA 1DJYA 1TNXA 2GGZA 1L2OC 1DJGA 1UHNA 4QJ3B 1MUXA 2KHNA 5DKNA 4PHJA 5BPJA 1RWYA 1WRZA 2Q4UA 4N1FA 4P5OE 1BOCA 2CCMA 4GAOA 1IJ5A 1LXFC 2BBMA 4OVNF 1IGVA 1KK7Y 4PDZA 5I2OA 1K95A 2KAVA 1NX3A 2LE9B 2E6WA 2VRGA 4PHKA 5HKYA 1TNQA 2AMIA 3H4SE 2L4HA 4MBEA 1S3PA 1KWOB 3EVUA 1NCZA 2F2PA 2MJWB 2SASA 3EKHA 1VRKA 1KK8B 1SYMA 1KQMC 1EG4A 4GNKB 1D1OA 4C0LA 1TRFA 2OPOA 2PVBA 3F45A 1AUIB 4PE0A 2AUCA 1ZUZA 2LLSA 2JWWA 3D0YB 5FYXA 5KU1A 2JXLA 1YVHA 4M2QA 2A4JA 4A4CA 3TUYC 1S5GZ 5TNCA 4FQOA 2MLFC 2LANA 2MA2A 2WCEA 3SIBA 3SG7A 1RECA 3VRPA 1JSAA 2SCPA 1M46A 5HLOA 4NDDA 2K2AA 5F6TA 3PN7B 1W7IB 3JVTB 4GGFA 1J7PA 1YUUA 1SL7A 3I5GB 3SG4A 2QACA 1R2UA 1F8HA 2M7NA 3GK1A 1SKTA 3NSKA 1GGZA 3K21A 2PSRA 3OB1B 4YGBB 3CWGA 1CFPA 1JWDA 1C7WA 1DJHA 2H61A 1YR5A 2K7CA 1AK8A 2EGDA 3CR4X 4NDBA 1J1DA 2OS8B 2LHLA 4HSZA 4DS7A 1A2XA 4PCWA 3CS1A 2JNXA 1DF0B 1B4CA 3GK2A 1TN4A 4UPGA 1QJTA 1FF1A 1NP8A 1EG3A 1OMRA 1V1GA 3FIAA 1CFDA 1QLSA 1NIWA 2Y4QA 3PATA 1CDMA 2M97A 5DKRA 5K89A 1XVJA 3VRNA 1ZACA 2GGMA 1F54A 1XFZO 1B8CA 2LHIA 4AQJA 2K7OA 1B8LA 4ZCVA 1TCOB 2CT9A 2LMTA 2Y1MA 2ZFDA 2I94A 4GPLB 1OSAA 2JQ6A 2KI4B 1EJ3A 3PM8A 4ETOA 2K2FA 4PE1A 1XFXO 2HETA 2JRFA 1DJXA 1QTXA 2M1UA 1DT7B 2I2RE 1QIWA 2BL0C 4M2PA 3I5FB 3A4UB 3OX6A 2GV5A 2JXCA 3KHEA 1FBVA 2F8PA 2KGRA 5DKQA 1S6JA 2WOSA 4GGNA 1CB1A 4XJKA 1AHRA 3RLZA 1SCMC 2KYFA 5D69A 1LVCD 3EKJA 4R1EA 1KSOA 1L7ZA 3EK8A 2JPTA 3I5IC 1QATA 2L2EA 1TOPA 1NYAA 1A4PA 1GJYA 1AVSA 2HQ8A 1X02A 2I18A
chains in the Genus database with same CATH superfamily
1ZMZA 4YI9A 2JTZA 1QX2A 3CZ2A 1Y0VH 3DF0A 1LINA 3BOWB 1PSBA 1IG5A 1XFUO 2L2CA 1U5IB 4MZJA 2L5XB 1QS7A 1MR8A 3FWBA 3QRXA 3R1VA 1J55A 3EK7A 2K7BA 2LUXA 1BF5A 4YBHB 4QJ4B 3JTDC 1Y6WA 4L9MA 3FS7A 1W7JB 2JT8A 3VRQA 1GQMA 1WY9A 1ZOTB 1OOGA 1DGUA 1BJFA 1J1EA 2KFHA 1UHKA 1M63B 2K61A 2H61C 1MHOA 1BU3A 3BJHA 3CZ0A 5HLVA 3SS5A 3I5HC 2K8MB 1IIOA 5I8NA 3O4YA 1B9AA 5I2LA 3WXAA 1BR4B 1WLMA 3OBVA 1CDLA 3UO9A 1NWDA 1QLKA 3B86A 4N5XA 3M0WA 2JC2A 1EL4A 2D8NA 1QVIZ 1Z4HA 1TCFA 1OZSA 2QDIA 2ZNEA 4GUKA 2M1KB 3NHIA 1CDPA 3DYEA 2WC5A 1N2DA 2G9BA 1MWNA 3BUNB 4AOMA 1FPWA 5KSZA 2KAXA 5AFPA 3DD4A 1MXLC 2WNDA 2OTGB 5PALA 3TZ1A 4OCIA 1QV1A 2WC8A 1CMGA 1H4BA 1A29A 5I2QA 3R72A 1WDCB 2KOTA 3LK1A 1DTLA 3AAKA 3KPXA 3MSEB 3PALA 4N1GA 3WHUB 1OMVA 1NUBA 5JOLA 2BKIB 1SMGA 3R1OA 4PHMA 1RK9A 2WCHA 4PE4A 2LP2A 1UUSA 3SS3A 1XO5A 1IH0A 4PE7A 1CDNA 1SCMB 1SW8A 4I5LB 5AANA 2M29A 1M45A 3D0YA 1DJWA 2BCAA 3CTNA 2H2KA 1JF0A 1XK4C 1M39A 2M49B 3HCMA 1TUZA 5IBWA 3TS5C 2HQWA 2NLNA 2EC6B 4I5KA 4I5NB 1N0YA 1Y1UA 1BR1B 4PHNA 4CFRA 4TNCA 5J3XA 3Q8IA 1CLBA 1F70A 1JFKA 2PQLA 4MSPA 1WRLA 2KQYA 3SG2A 1G4YR 1KK7Z 1XFYO 3IVTA 2KBIA 3NGVA 3O2PA 5CSJA 2F33A 1DMOA 3FWCA 2WORA 4OV2A 2LAPA 3AKAA 4DUQA 2QEOA 3RM1A 1F4QA 4JWQA 2JOJA 1SY9A 2ZN8A 2HPSA 4NDCA 2LMVA 2KI6D 3NSLA 5AERA 2CTNA 2PRUA 3NXAA 3BQ3A 4WRIA 2JTTA 1QASA 1A03A 1UWOA 3OB2B 3I5HB 2KI6C 1IJ6A 2KLEA 1KSMA 3OHMB 1DF0A 3KEVA 1UHHA 1S26D 2ISDA 2Y1NA 1DJIA 2BKHB 2LV7A 1L2OB 1K93D 3NSOA 1BG1A 2JZIA 3A8RA 3IF7A 2BCXA 2WCJA 4E68A 1B7TY 3AAJA 2PASA 1SL8A 1UHJA 3L4AA 3CR5X 1Y1AA 5FI6A 4C0JA 2EHBA 1A75B 3KO0A 4MZKA 5G08A 1ODBA 3C1VA 5ER4X 3TDZA 1IWQA 1KFXL 1HT9A 3CYZA 1IQ5A 5HL1A 1Q80A 2K0JA 2LUCA 3SS4A 2QEVA 2V53A 3BFHA 2F3ZA 1HQVA 4MN0A 4U8DA 1H8BA 1DELA 1N65A 2LLTA 4YGDB 2KSPA 1KWOC 2HF5A 2MBXA 1OQPA 1TNPA 1RJVA 1OOHA 2L98A 2MRDA 2PALA 2IS9A 1KQMB 2ZKMX 4DRWA 1DQEA 1EH2A 3PM2A 1KK8C 1IQ3A 5CSFA 1KFXS 4YGCB 3DVEA 1WLZA 2BAPA 1NSHA 2MLEC 1CTRA 2CXJA 3TUYB 1CM1A 2L50A 4GGFC 1IKUA 3PFVA 1PK0D 1DEKA 1RROA 1QV0A 3WNXB 3IQQA 1LA3A 1MQ1A 2ZN9A 3IQOA 3PSRA 3CZTX 3BOWA 3D10A 3HX4A 3S0EA 3PLFB 1C07A 4DCKA 3OP0A 3LL8B 1U5IA 2L0PA 3PN7C 2PMYA 3JVTC 4M2OA 3SG6A 1G8IA 3I5GC 4MRXA 2Y5IA 1ALVA 2YGUA 1NX2A 4YGEB 4ZCUA 4OR9B 2FCEA 1K96A 1PRWA 3E3RA 3ICBA 5HKWA 4DIRA 3SJSA 5ER5A 2L4IA 4JKTA 1YUTA 2LNKA 1DC1A 5CSNA 4ORAB 3SG3A 4AQIA 2G2BA 3VB1A 5CSIA 2LMUA 3D74A 2OS8C 3EK4A 4CFQA 2LVIA 3BXKA 5FI7A 1SR6C 3D78A 4ORCB 1TTXA 1NCYA 2WCBA 1JBAA 2R2IA 1OOIX 1UHIA 2WCLA 4MRYA 1NX1A 4CIDA 1S5GY 4YRUA 3LCPC 1B1GA 2CBLA 1NX0A 2M9GA 2KYCA 1TWOA 4BY4A 2KBMA 1YVLA 2MAZA 3DVMA 4JD9A 2NCOA 1BODA 3S0BA 4GFTA 1KCYA 3CGAA 1PALA 2F2OA 2JNFA 2KAYA 4HREE 4KYNA 4MZLA 1CFCA 1SK6D 3CLNA 2KI4C 1QX7A 1R6PA 1YRTB 3VROA 1RTP1 1BMOA 1F55A 1QIVA 2BL0B 3N7HA 3EG5B 2JPOA 2BBNA 3FE8A 3I5FC 3B6XA 3LK0A 2P70A 2JT3A 1QX5B 3GOFA 1MF8B 2AAOA 4FTGA 2LM5A 3DVJA 1CFFA 2LLUA 2M7LA 2FCDA 5KTYA 4JPZB 1XFVO 3I5IB 4XYNA 4CLNA 3OGNA 1NPQA 2P71A 2KQ6A 2COLB 2P6BB 2BECA 2KLDA 3B7AA 4ORBB 2K7DA 1CLMA 3CR2A 1AJ4A 2BE6A 1SL9A 3O4XA 2CNPA 1OOFA 2LC5A 1EXRA 1V1FA 1F71A 4HRHA 3S0GA 1DVIA 1MXEA 3JTDB 2BCBA 2BE4A 3KF9A 2QPTA 1TNWA 2H8VA 1C7VA 2TN4A 2WCFA 1BT6A 2JULA 4MEWA 4BY5A 4D1EA 1SBJA 1SRAA 2BNXA 2Q91A 1SNLA 1OE9B 1CM4A 1UURA 1OMDA 2LCPA 1S36A 5B8IB 2KGBC 2JU0A 4GBAA 1UP5A 2B1UA 4A4BA 2KPHA 4YI8A 1LA0A 2O60A 2ZRTA 3NSIA 1YURA 1K9PA 2GTEA 3CABA 5D7FA 4HRGA 1XFWO 3TDUA 3B88A 1B47A 1K94A 1SR6B 2KFGA 1PSRA 2FJUB 2NZ0A 4YGAA 1B8RA 2K60A 1J7QA 4MVFA 4Q04A 1LKJA 3SIAA 2O5GA 1XYDA 1DGVA 1KFUL 1S6IA 1SSEB 3DZTA 3LLEA 3ZWHA 1ZFSA 1SPYA 1A75A 1TIZA 2LVVA 1FI6A 2KNEA 3BUWB 4I5JA 5DICA 3OX5A 1K9KA 1OW4A 1FW4A 1YUSA 2OTGC 3L4LA 4PALA 1DJZA 2KDHA 1M31A 1QXPA 1YRUB 1CKKA 1WDCC 4USLA 1K90D 2F3YA 1GGWA 2KFFA 1IRJA 2ZNDA 3NHTA 1FI5A 1ALWA 4WQ2A 4XJKB 1CMFA 2E30A 4JQ0D 1KFUS 1E8AA 4CPVA 1PVAA 2M3WA 1WRKA 3DY9A 5GQQC 3V2LA 1BLQA 4NQGA 2JT0A 1OOJA 1S1EA 1XFRA 2LVJA 2M0RA 1QVIY 1JUOA 3EVRA 3SG5A 3BUXB 4C0KA 4OZDA 4F0ZB 3O6BA 3DXLA 1CNPA 3BUMB 3EVVA 3BUOB 1YX7A 1YTZC 1PVBA 3DF0B 4IL1A 3TS5B 1PULA 3ZNIA 1SCVA 5AXIA 1B7TZ 4OKHA 1RFJA 2M8UA 3BYAA 2EC6C 1G33A 2I7AA 1ORGA 1K8UA 5HYDA 1J7OA 1XK4A 3WHTB 2FJYA 2PYQA 2LVKA 1XA5A 3DVKA 2LP3A 1K2HA 1OZOA 5CPVA 3TDIA 1AJ5A 3VRRA 3O78A 5JJGA 1F4OA 3CZ1A 3GK4X 1S6CA 1JF2A 1JFJA 3AKBA 3D73A 1JC2A 4P2YB 3QMEA 5HKZA 1J7RA 2L51A 4QJ5B 2NCPA 2RGIA 4WQ3A 1C3ZA 3D75A 2MHHA 1YX8A 5AEQA 3VGOA 1Y1XA 1K9UA 1NCXA 3S0FA 1KQVA 3B87A 2FOTA 2NXQA 4ICBA 1CLLA 2DOQA 1AP4A 2WC6A 4MLWA 1T14A 2ZRSA 1DJYA 1TNXA 3D76A 2GGZA 1L2OC 1DJGA 1UHNA 4QJ3B 1MUXA 3RZSA 2KHNA 5DKNA 4PHJA 5BPJA 1RWYA 1WRZA 2Q4UA 3PJIA 4N1FA 4P5OE 1BOCA 2CCMA 4GAOA 1IJ5A 1LXFC 3CDNA 2BBMA 4OVNF 1IGVA 1KK7Y 4PDZA 5I2OA 1K95A 1LS8A 2KAVA 1NX3A 2LE9B 2E6WA 2VRGA 4PHKA 5HKYA 1TNQA 3FE6A 2AMIA 3H4SE 2L4HA 4MBEA 1S3PA 1KWOB 3EVUA 1NCZA 2F2PA 2MJWB 2SASA 2QEBA 3EKHA 1VRKA 1KK8B 1SYMA 1KQMC 4PT1A 1EG4A 4GNKB 1D1OA 4C0LA 1TRFA 2OPOA 2PVBA 3F45A 1AUIB 4PE0A 2AUCA 4F7FA 1C3YA 1ZUZA 2LLSA 2JWWA 2WCMA 3D0YB 5FYXA 5KU1A 2JXLA 1YVHA 5I94A 4M2QA 2A4JA 4A4CA 3TUYC 1S5GZ 5TNCA 4FQOA 2MLFC 2LANA 2MA2A 3D77A 1W9ZA 2WCEA 3SIBA 3SG7A 1RECA 3VRPA 1JSAA 2SCPA 1M46A 4IJ7A 5HLOA 3FE9A 4NDDA 3L47A 3UNWA 2K2AA 5F6TA 3PN7B 1W7IB 3JVTB 4GGFA 1J7PA 1YUUA 1SL7A 3I5GB 3SG4A 2QACA 1R2UA 2QEHA 1F8HA 2M7NA 3GK1A 1SKTA 3NSKA 5D3OA 1GGZA 3K21A 2PSRA 3OB1B 3K1EA 4YGBB 3CWGA 1CFPA 1JWDA 1C7WA 3BFAA 1DJHA 2H61A 1YR5A 2K7CA 2ERBA 1AK8A 2EGDA 3CR4X 4NDBA 1J1DA 3BFBA 4INWA 2OS8B 2LHLA 4HSZA 4DS7A 1A2XA 4PCWA 3CS1A 2JNXA 1DF0B 1B4CA 3GK2A 1TN4A 4UPGA 1QJTA 5EL2A 1FF1A 1NP8A 1EG3A 1OMRA 1V1GA 3FIAA 1CFDA 1QLSA 1NIWA 2Y4QA 3PATA 1CDMA 2M97A 3R1PA 4FQTA 1XVJA 5DKRA 2L5YA 1ZACA 3VRNA 5K89A 1QWVA 2GGMA 1F54A 1XFZO 1B8CA 2LHIA 4AQJA 2K7OA 1B8LA 4ZCVA 1TCOB 2CT9A 3S0DA 1TUJA 3S0AA 2LMTA 2Y1MA 2ZFDA 2I94A 4GPLB 1GM0A 1OSAA 2JQ6A 2KI4B 1EJ3A 3PM8A 4ETOA 2K2FA 4PE1A 1XFXO 1Z2CB 2HETA 2JRFA 1DJXA 1QTXA 2M1UA 1DT7B 2I2RE 1QIWA 2BL0C 4M2PA 3I5FB 3A4UB 3OX6A 2GV5A 4INXA 2JXCA 3KHEA 1FBVA 2F8PA 1P28A 2KGRA 5DKQA 1S6JA 2WOSA 4GGNA 1CB1A 4XJKA 1AHRA 3RLZA 1SCMC 2KYFA 5D69A 1LVCD 3EKJA 4R1EA 1KSOA 1L7ZA 3EK8A 2JPTA 3I5IC 1QATA 2L2EA 2WCKA 1TOPA 5FI2A 1NYAA 1A4PA 1GJYA 1AVSA 2HQ8A 1X02A 2I18A
chains in the Genus database with same CATH topology
1ZMZA 4YI9A 2JTZA 1QX2A 1Y0VH 3DF0A 1LINA 3BOWB 1PSBA 1IG5A 1XFUO 1U5IB 4MZJA 2L5XB 1QS7A 1MR8A 3FWBA 3QRXA 1J55A 3EK7A 2K7BA 2LUXA 1BF5A 4YBHB 4QJ4B 3JTDC 1Y6WA 4L9MA 3FS7A 1W7JB 2JT8A 3VRQA 1GQMA 1WY9A 1ZOTB 1DGUA 1BJFA 1J1EA 2KFHA 1UHKA 1M63B 2K61A 2H61C 1MHOA 1BU3A 5HLVA 3I5HC 2K8MB 5I8NA 3O4YA 1B9AA 5I2LA 3WXAA 1BR4B 1WLMA 1CDLA 1NWDA 1QLKA 4N5XA 3M0WA 2JC2A 1EL4A 2D8NA 1QVIZ 1TCFA 1OZSA 2ZNEA 4GUKA 2M1KB 1CDPA 1N2DA 2G9BA 1MWNA 3BUNB 4AOMA 1FPWA 5KSZA 2KAXA 5AFPA 3DD4A 1MXLC 2WNDA 2OTGB 5PALA 3TZ1A 4OCIA 1QV1A 2WC8A 1CMGA 1H4BA 1A29A 5I2QA 1WDCB 2KOTA 3LK1A 1DTLA 3AAKA 3KPXA 3MSEB 3PALA 4N1GA 3WHUB 1OMVA 1NUBA 5JOLA 2BKIB 1SMGA 4PHMA 1RK9A 4PE4A 2LP2A 1UUSA 1XO5A 1IH0A 4PE7A 1CDNA 1SCMB 1SW8A 4I5LB 5AANA 2M29A 1M45A 3D0YA 1DJWA 2BCAA 3CTNA 2H2KA 1JF0A 1XK4C 1M39A 2M49B 3HCMA 5IBWA 3TS5C 2HQWA 2NLNA 2EC6B 4I5KA 4I5NB 1N0YA 1Y1UA 1BR1B 4PHNA 4CFRA 4TNCA 5J3XA 1CLBA 1F70A 1JFKA 4MSPA 1WRLA 2KQYA 3SG2A 1G4YR 1KK7Z 1XFYO 2KBIA 1DMOA 3O2PA 5CSJA 2F33A 3FWCA 2WORA 4OV2A 2LAPA 3AKAA 4DUQA 3RM1A 1F4QA 4JWQA 2JOJA 1SY9A 2ZN8A 2HPSA 4NDCA 2LMVA 2KI6D 3NSLA 5AERA 2CTNA 2PRUA 3NXAA 3BQ3A 4WRIA 2JTTA 1QASA 1A03A 1UWOA 3OB2B 3I5HB 2KI6C 1IJ6A 1KSMA 3OHMB 1DF0A 3KEVA 1UHHA 1S26D 2ISDA 2Y1NA 2BKHB 1DJIA 2LV7A 1L2OB 1K93D 3NSOA 1BG1A 2JZIA 3A8RA 3IF7A 2BCXA 4E68A 1B7TY 3AAJA 2PASA 1SL8A 1UHJA 3CR5X 1Y1AA 4C0JA 2EHBA 1A75B 3KO0A 4MZKA 5G08A 1ODBA 3C1VA 5ER4X 3TDZA 1IWQA 1KFXL 1HT9A 1IQ5A 1Q80A 2K0JA 2LUCA 2V53A 2F3ZA 1HQVA 4MN0A 4U8DA 1H8BA 1N65A 2LLTA 4YGDB 2KSPA 1KWOC 2HF5A 2MBXA 1OQPA 1TNPA 1RJVA 2ZKMX 2L98A 2MRDA 2PALA 2IS9A 1KQMB 4DRWA 1EH2A 1KK8C 1IQ3A 5CSFA 1KFXS 4YGCB 3DVEA 1WLZA 1NSHA 2MLEC 1CTRA 2CXJA 3TUYB 1CM1A 2L50A 4GGFC 1IKUA 3PFVA 1PK0D 1RROA 1QV0A 3WNXB 3IQQA 1LA3A 1MQ1A 2ZN9A 3IQOA 3PSRA 3CZTX 3BOWA 3D10A 3HX4A 1C07A 3PLFB 4DCKA 3OP0A 3LL8B 1U5IA 2L0PA 3PN7C 2PMYA 3JVTC 4M2OA 3SG6A 1G8IA 3I5GC 4MRXA 2Y5IA 1ALVA 1NX2A 4YGEB 4ZCUA 4OR9B 2FCEA 1K96A 1PRWA 3E3RA 3ICBA 5HKWA 4DIRA 3SJSA 5ER5A 2L4IA 1YUTA 2LNKA 5CSNA 4ORAB 3SG3A 4AQIA 2G2BA 5CSIA 2LMUA 2OS8C 3EK4A 4CFQA 2LVIA 3BXKA 1SR6C 4ORCB 1TTXA 1NCYA 2WCBA 1JBAA 2R2IA 1UHIA 4MRYA 1NX1A 4CIDA 1S5GY 4YRUA 3LCPC 1B1GA 2CBLA 1NX0A 2M9GA 2KYCA 4BY4A 2KBMA 1YVLA 2MAZA 3DVMA 1BODA 2NCOA 4GFTA 1KCYA 3CGAA 1PALA 2F2OA 2JNFA 2KAYA 4HREE 4MZLA 1CFCA 1SK6D 3CLNA 2KI4C 1QX7A 1R6PA 1YRTB 3VROA 1RTP1 1BMOA 1F55A 1QIVA 2BL0B 2BBNA 3I5FC 3LK0A 2JT3A 1QX5B 3GOFA 1MF8B 2AAOA 4FTGA 2LM5A 3DVJA 1CFFA 2LLUA 2M7LA 2FCDA 5KTYA 4JPZB 1XFVO 3I5IB 4XYNA 4CLNA 1NPQA 2KQ6A 2COLB 2P6BB 2BECA 4ORBB 2K7DA 1CLMA 3CR2A 1AJ4A 2BE6A 1SL9A 2CNPA 2LC5A 1EXRA 1V1FA 1F71A 4HRHA 1DVIA 1MXEA 3JTDB 2BCBA 2BE4A 3KF9A 2QPTA 1TNWA 1C7VA 2TN4A 2WCFA 1BT6A 2JULA 4MEWA 4BY5A 4D1EA 1SBJA 1SRAA 2Q91A 1SNLA 1OE9B 1CM4A 1UURA 1OMDA 2LCPA 1S36A 5B8IB 2KGBC 2JU0A 4GBAA 1UP5A 2B1UA 4A4BA 4YI8A 1LA0A 2O60A 2ZRTA 3NSIA 1YURA 1K9PA 5D7FA 4HRGA 1XFWO 3TDUA 1B47A 1K94A 1SR6B 2KFGA 1PSRA 2FJUB 2NZ0A 4YGAA 1B8RA 1J7QA 4MVFA 4Q04A 1LKJA 3SIAA 2O5GA 1XYDA 1DGVA 1KFUL 1S6IA 3LLEA 3ZWHA 1ZFSA 1SPYA 1A75A 1TIZA 2LVVA 1FI6A 2KNEA 3BUWB 4I5JA 3OX5A 1K9KA 1YUSA 1FW4A 2OTGC 4PALA 1DJZA 2KDHA 1M31A 1QXPA 1YRUB 1CKKA 1WDCC 4USLA 1K90D 2F3YA 1GGWA 2KFFA 1IRJA 2ZNDA 1FI5A 1ALWA 4WQ2A 4XJKB 1CMFA 2E30A 4JQ0D 1KFUS 1E8AA 4CPVA 1PVAA 2M3WA 1WRKA 5GQQC 1BLQA 4NQGA 2JT0A 1OOJA 1S1EA 2LVJA 2M0RA 1QVIY 1JUOA 3EVRA 3SG5A 3BUXB 4C0KA 4F0ZB 3O6BA 1CNPA 3BUMB 3EVVA 3BUOB 1YX7A 1YTZC 1PVBA 3DF0B 4IL1A 3TS5B 1PULA 3ZNIA 1SCVA 5AXIA 1B7TZ 4OKHA 1RFJA 2M8UA 3BYAA 2EC6C 1G33A 2I7AA 1K8UA 5HYDA 1J7OA 1XK4A 3WHTB 2LVKA 1XA5A 3DVKA 2LP3A 1K2HA 1OZOA 5CPVA 3TDIA 1AJ5A 3VRRA 3O78A 5JJGA 1F4OA 3GK4X 1S6CA 1JF2A 1JFJA 3AKBA 1JC2A 4P2YB 5HKZA 1J7RA 2L51A 4QJ5B 2NCPA 2RGIA 4WQ3A 2MHHA 1YX8A 5AEQA 3VGOA 1Y1XA 1K9UA 1NCXA 1KQVA 4ICBA 2FOTA 2NXQA 1CLLA 2DOQA 1AP4A 4MLWA 2ZRSA 1DJYA 1TNXA 2GGZA 1L2OC 1DJGA 1UHNA 4QJ3B 1MUXA 2KHNA 5DKNA 4PHJA 5BPJA 1RWYA 1WRZA 2Q4UA 4N1FA 4P5OE 1BOCA 2CCMA 4GAOA 1IJ5A 1LXFC 2BBMA 4OVNF 1IGVA 1KK7Y 4PDZA 5I2OA 1K95A 2KAVA 1NX3A 2LE9B 2E6WA 2VRGA 4PHKA 5HKYA 1TNQA 2AMIA 3H4SE 2L4HA 4MBEA 1S3PA 1KWOB 3EVUA 1NCZA 2F2PA 2MJWB 2SASA 3EKHA 1VRKA 1KK8B 1SYMA 1KQMC 1EG4A 4GNKB 1D1OA 4C0LA 1TRFA 2OPOA 2PVBA 3F45A 1AUIB 4PE0A 2AUCA 1ZUZA 2LLSA 2JWWA 3D0YB 5FYXA 5KU1A 2JXLA 1YVHA 4M2QA 2A4JA 4A4CA 3TUYC 1S5GZ 5TNCA 4FQOA 2MLFC 2LANA 2MA2A 2WCEA 3SIBA 3SG7A 1RECA 3VRPA 1JSAA 2SCPA 1M46A 5HLOA 4NDDA 2K2AA 5F6TA 3PN7B 1W7IB 3JVTB 4GGFA 1J7PA 1YUUA 1SL7A 3I5GB 3SG4A 2QACA 1R2UA 1F8HA 2M7NA 3GK1A 1SKTA 3NSKA 1GGZA 3K21A 2PSRA 3OB1B 4YGBB 3CWGA 1CFPA 1JWDA 1C7WA 1DJHA 2H61A 1YR5A 2K7CA 1AK8A 2EGDA 3CR4X 4NDBA 1J1DA 2OS8B 2LHLA 4HSZA 4DS7A 1A2XA 4PCWA 3CS1A 2JNXA 1DF0B 1B4CA 3GK2A 1TN4A 4UPGA 1QJTA 1FF1A 1NP8A 1EG3A 1OMRA 1V1GA 3FIAA 1CFDA 1QLSA 1NIWA 2Y4QA 3PATA 1CDMA 2M97A 5DKRA 5K89A 1XVJA 3VRNA 1ZACA 2GGMA 1F54A 1XFZO 1B8CA 2LHIA 4AQJA 2K7OA 1B8LA 4ZCVA 1TCOB 2CT9A 2LMTA 2Y1MA 2ZFDA 2I94A 4GPLB 1OSAA 2JQ6A 2KI4B 1EJ3A 3PM8A 4ETOA 2K2FA 4PE1A 1XFXO 2HETA 2JRFA 1DJXA 1QTXA 2M1UA 1DT7B 2I2RE 1QIWA 2BL0C 4M2PA 3I5FB 3A4UB 3OX6A 2GV5A 2JXCA 3KHEA 1FBVA 2F8PA 2KGRA 5DKQA 1S6JA 2WOSA 4GGNA 1CB1A 4XJKA 1AHRA 3RLZA 1SCMC 2KYFA 5D69A 1LVCD 3EKJA 4R1EA 1KSOA 1L7ZA 3EK8A 2JPTA 3I5IC 1QATA 2L2EA 1TOPA 1NYAA 1A4PA 1GJYA 1AVSA 2HQ8A 1X02A 2I18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMZ A;  4YI9 A;  2JTZ A;  1QX2 A;  1Y0V H;  3DF0 A;  1LIN A;  3BOW B;  1PSB A;  1IG5 A;  1XFU O;  1U5I B;  4MZJ A;  2L5X B;  1QS7 A;  1MR8 A;  3FWB A;  3QRX A;  1J55 A;  3EK7 A;  2K7B A;  2LUX A;  1BF5 A;  4YBH B;  4QJ4 B;  3JTD C;  1Y6W A;  4L9M A;  3FS7 A;  1W7J B;  2JT8 A;  3VRQ A;  1GQM A;  1WY9 A;  1ZOT B;  1DGU A;  1BJF A;  1J1E A;  2KFH A;  1UHK A;  1M63 B;  2K61 A;  2H61 C;  1MHO A;  1BU3 A;  5HLV A;  3I5H C;  2K8M B;  5I8N A;  3O4Y A;  1B9A A;  5I2L A;  3WXA A;  1BR4 B;  1WLM A;  1CDL A;  1NWD A;  1QLK A;  4N5X A;  3M0W A;  2JC2 A;  1EL4 A;  2D8N A;  1QVI Z;  1TCF A;  1OZS A;  2ZNE A;  4GUK A;  2M1K B;  1CDP A;  1N2D A;  2G9B A;  1MWN A;  3BUN B;  4AOM A;  1FPW A;  5KSZ A;  2KAX A;  5AFP A;  3DD4 A;  1MXL C;  2WND A;  2OTG B;  5PAL A;  3TZ1 A;  4OCI A;  1QV1 A;  2WC8 A;  1CMG A;  1H4B A;  1A29 A;  5I2Q A;  1WDC B;  2KOT A;  3LK1 A;  1DTL A;  3AAK A;  3KPX A;  3MSE B;  3PAL A;  4N1G A;  3WHU B;  1OMV A;  1NUB A;  5JOL A;  2BKI B;  1SMG A;  4PHM A;  1RK9 A;  4PE4 A;  2LP2 A;  1UUS A;  1XO5 A;  1IH0 A;  4PE7 A;  1CDN A;  1SCM B;  1SW8 A;  4I5L B;  5AAN A;  2M29 A;  1M45 A;  3D0Y A;  1DJW A;  2BCA A;  3CTN A;  2H2K A;  1JF0 A;  1XK4 C;  1M39 A;  2M49 B;  3HCM A;  5IBW A;  3TS5 C;  2HQW A;  2NLN A;  2EC6 B;  4I5K A;  4I5N B;  1N0Y A;  1Y1U A;  1BR1 B;  4PHN A;  4CFR A;  4TNC A;  5J3X A;  1CLB A;  1F70 A;  1JFK A;  4MSP A;  1WRL A;  2KQY A;  3SG2 A;  1G4Y R;  1KK7 Z;  1XFY O;  2KBI A;  1DMO A;  3O2P A;  5CSJ A;  2F33 A;  3FWC A;  2WOR A;  4OV2 A;  2LAP A;  3AKA A;  4DUQ A;  3RM1 A;  1F4Q A;  4JWQ A;  2JOJ A;  1SY9 A;  2ZN8 A;  2HPS A;  4NDC A;  2LMV A;  2KI6 D;  3NSL A;  5AER A;  2CTN A;  2PRU A;  3NXA A;  3BQ3 A;  4WRI A;  2JTT A;  1QAS A;  1A03 A;  1UWO A;  3OB2 B;  3I5H B;  2KI6 C;  1IJ6 A;  1KSM A;  3OHM B;  1DF0 A;  3KEV A;  1UHH A;  1S26 D;  2ISD A;  2Y1N A;  2BKH B;  1DJI A;  2LV7 A;  1L2O B;  1K93 D;  3NSO A;  1BG1 A;  2JZI A;  3A8R A;  3IF7 A;  2BCX A;  4E68 A;  1B7T Y;  3AAJ A;  2PAS A;  1SL8 A;  1UHJ A;  3CR5 X;  1Y1A A;  4C0J A;  2EHB A;  1A75 B;  3KO0 A;  4MZK A;  5G08 A;  1ODB A;  3C1V A;  5ER4 X;  3TDZ A;  1IWQ A;  1KFX L;  1HT9 A;  1IQ5 A;  1Q80 A;  2K0J A;  2LUC A;  2V53 A;  2F3Z A;  1HQV A;  4MN0 A;  4U8D A;  1H8B A;  1N65 A;  2LLT A;  4YGD B;  2KSP A;  1KWO C;  2HF5 A;  2MBX A;  1OQP A;  1TNP A;  1RJV A;  2ZKM X;  2L98 A;  2MRD A;  2PAL A;  2IS9 A;  1KQM B;  4DRW A;  1EH2 A;  1KK8 C;  1IQ3 A;  5CSF A;  1KFX S;  4YGC B;  3DVE A;  1WLZ A;  1NSH A;  2MLE C;  1CTR A;  2CXJ A;  3TUY B;  1CM1 A;  2L50 A;  4GGF C;  1IKU A;  3PFV A;  1PK0 D;  1RRO A;  1QV0 A;  3WNX B;  3IQQ A;  1LA3 A;  1MQ1 A;  2ZN9 A;  3IQO A;  3PSR A;  3CZT X;  3BOW A;  3D10 A;  3HX4 A;  1C07 A;  3PLF B;  4DCK A;  3OP0 A;  3LL8 B;  1U5I A;  2L0P A;  3PN7 C;  2PMY A;  3JVT C;  4M2O A;  3SG6 A;  1G8I A;  3I5G C;  4MRX A;  2Y5I A;  1ALV A;  1NX2 A;  4YGE B;  4ZCU A;  4OR9 B;  2FCE A;  1K96 A;  1PRW A;  3E3R A;  3ICB A;  5HKW A;  4DIR A;  3SJS A;  5ER5 A;  2L4I A;  1YUT A;  2LNK A;  5CSN A;  4ORA B;  3SG3 A;  4AQI A;  2G2B A;  5CSI A;  2LMU A;  2OS8 C;  3EK4 A;  4CFQ A;  2LVI A;  3BXK A;  1SR6 C;  4ORC B;  1TTX A;  1NCY A;  2WCB A;  1JBA A;  2R2I A;  1UHI A;  4MRY A;  1NX1 A;  4CID A;  1S5G Y;  4YRU A;  3LCP C;  1B1G A;  2CBL A;  1NX0 A;  2M9G A;  2KYC A;  4BY4 A;  2KBM A;  1YVL A;  2MAZ A;  3DVM A;  1BOD A;  2NCO A;  4GFT A;  1KCY A;  3CGA A;  1PAL A;  2F2O A;  2JNF A;  2KAY A;  4HRE E;  4MZL A;  1CFC A;  1SK6 D;  3CLN A;  2KI4 C;  1QX7 A;  1R6P A;  1YRT B;  3VRO A;  1RTP 1;  1BMO A;  1F55 A;  1QIV A;  2BL0 B;  2BBN A;  3I5F C;  3LK0 A;  2JT3 A;  1QX5 B;  3GOF A;  1MF8 B;  2AAO A;  4FTG A;  2LM5 A;  3DVJ A;  1CFF A;  2LLU A;  2M7L A;  2FCD A;  5KTY A;  4JPZ B;  1XFV O;  3I5I B;  4XYN A;  4CLN A;  1NPQ A;  2KQ6 A;  2COL B;  2P6B B;  2BEC A;  4ORB B;  2K7D A;  1CLM A;  3CR2 A;  1AJ4 A;  2BE6 A;  1SL9 A;  2CNP A;  2LC5 A;  1EXR A;  1V1F A;  1F71 A;  4HRH A;  1DVI A;  1MXE A;  3JTD B;  2BCB A;  2BE4 A;  3KF9 A;  2QPT A;  1TNW A;  1C7V A;  2TN4 A;  2WCF A;  1BT6 A;  2JUL A;  4MEW A;  4BY5 A;  4D1E A;  1SBJ A;  1SRA A;  2Q91 A;  1SNL A;  1OE9 B;  1CM4 A;  1UUR A;  1OMD A;  2LCP A;  1S36 A;  5B8I B;  2KGB C;  2JU0 A;  4GBA A;  1UP5 A;  2B1U A;  4A4B A;  4YI8 A;  1LA0 A;  2O60 A;  2ZRT A;  3NSI A;  1YUR A;  1K9P A;  5D7F A;  4HRG A;  1XFW O;  3TDU A;  1B47 A;  1K94 A;  1SR6 B;  2KFG A;  1PSR A;  2FJU B;  2NZ0 A;  4YGA A;  1B8R A;  1J7Q A;  4MVF A;  4Q04 A;  1LKJ A;  3SIA A;  2O5G A;  1XYD A;  1DGV A;  1KFU L;  1S6I A;  3LLE A;  3ZWH A;  1ZFS A;  1SPY A;  1A75 A;  1TIZ A;  2LVV A;  1FI6 A;  2KNE A;  3BUW B;  4I5J A;  3OX5 A;  1K9K A;  1YUS A;  1FW4 A;  2OTG C;  4PAL A;  1DJZ A;  2KDH A;  1M31 A;  1QXP A;  1YRU B;  1CKK A;  1WDC C;  4USL A;  1K90 D;  2F3Y A;  1GGW A;  2KFF A;  1IRJ A;  2ZND A;  1FI5 A;  1ALW A;  4WQ2 A;  4XJK B;  1CMF A;  2E30 A;  4JQ0 D;  1KFU S;  1E8A A;  4CPV A;  1PVA A;  2M3W A;  1WRK A;  5GQQ C;  1BLQ A;  4NQG A;  2JT0 A;  1OOJ A;  1S1E A;  2LVJ A;  2M0R A;  1QVI Y;  1JUO A;  3EVR A;  3SG5 A;  3BUX B;  4C0K A;  4F0Z B;  3O6B A;  1CNP A;  3BUM B;  3EVV A;  3BUO B;  1YX7 A;  1YTZ C;  1PVB A;  3DF0 B;  4IL1 A;  3TS5 B;  1PUL A;  3ZNI A;  1SCV A;  5AXI A;  1B7T Z;  4OKH A;  1RFJ A;  2M8U A;  3BYA A;  2EC6 C;  1G33 A;  2I7A A;  1K8U A;  5HYD A;  1J7O A;  1XK4 A;  3WHT B;  2LVK A;  1XA5 A;  3DVK A;  2LP3 A;  1K2H A;  1OZO A;  5CPV A;  3TDI A;  1AJ5 A;  3VRR A;  3O78 A;  5JJG A;  1F4O A;  3GK4 X;  1S6C A;  1JF2 A;  1JFJ A;  3AKB A;  1JC2 A;  4P2Y B;  5HKZ A;  1J7R A;  2L51 A;  4QJ5 B;  2NCP A;  2RGI A;  4WQ3 A;  2MHH A;  1YX8 A;  5AEQ A;  3VGO A;  1Y1X A;  1K9U A;  1NCX A;  1KQV A;  4ICB A;  2FOT A;  2NXQ A;  1CLL A;  2DOQ A;  1AP4 A;  4MLW A;  2ZRS A;  1DJY A;  1TNX A;  2GGZ A;  1L2O C;  1DJG A;  1UHN A;  4QJ3 B;  1MUX A;  2KHN A;  5DKN A;  4PHJ A;  5BPJ A;  1RWY A;  1WRZ A;  2Q4U A;  4N1F A;  4P5O E;  1BOC A;  2CCM A;  4GAO A;  1IJ5 A;  1LXF C;  2BBM A;  4OVN F;  1IGV A;  1KK7 Y;  4PDZ A;  5I2O A;  1K95 A;  2KAV A;  1NX3 A;  2LE9 B;  2E6W A;  2VRG A;  4PHK A;  5HKY A;  1TNQ A;  2AMI A;  3H4S E;  2L4H A;  4MBE A;  1S3P A;  1KWO B;  3EVU A;  1NCZ A;  2F2P A;  2MJW B;  2SAS A;  3EKH A;  1VRK A;  1KK8 B;  1SYM A;  1KQM C;  1EG4 A;  4GNK B;  1D1O A;  4C0L A;  1TRF A;  2OPO A;  2PVB A;  3F45 A;  1AUI B;  4PE0 A;  2AUC A;  1ZUZ A;  2LLS A;  2JWW A;  3D0Y B;  5FYX A;  5KU1 A;  2JXL A;  1YVH A;  4M2Q A;  2A4J A;  4A4C A;  3TUY C;  1S5G Z;  5TNC A;  4FQO A;  2MLF C;  2LAN A;  2MA2 A;  2WCE A;  3SIB A;  3SG7 A;  1REC A;  3VRP A;  1JSA A;  2SCP A;  1M46 A;  5HLO A;  4NDD A;  2K2A A;  5F6T A;  3PN7 B;  1W7I B;  3JVT B;  4GGF A;  1J7P A;  1YUU A;  1SL7 A;  3I5G B;  3SG4 A;  2QAC A;  1R2U A;  1F8H A;  2M7N A;  3GK1 A;  1SKT A;  3NSK A;  1GGZ A;  3K21 A;  2PSR A;  3OB1 B;  4YGB B;  3CWG A;  1CFP A;  1JWD A;  1C7W A;  1DJH A;  2H61 A;  1YR5 A;  2K7C A;  1AK8 A;  2EGD A;  3CR4 X;  4NDB A;  1J1D A;  2OS8 B;  2LHL A;  4HSZ A;  4DS7 A;  1A2X A;  4PCW A;  3CS1 A;  2JNX A;  1DF0 B;  1B4C A;  3GK2 A;  1TN4 A;  4UPG A;  1QJT A;  1FF1 A;  1NP8 A;  1EG3 A;  1OMR A;  1V1G A;  3FIA A;  1CFD A;  1QLS A;  1NIW A;  2Y4Q A;  3PAT A;  1CDM A;  2M97 A;  5DKR A;  5K89 A;  1XVJ A;  3VRN A;  1ZAC A;  2GGM A;  1F54 A;  1XFZ O;  1B8C A;  2LHI A;  4AQJ A;  2K7O A;  1B8L A;  4ZCV A;  1TCO B;  2CT9 A;  2LMT A;  2Y1M A;  2ZFD A;  2I94 A;  4GPL B;  1OSA A;  2JQ6 A;  2KI4 B;  1EJ3 A;  3PM8 A;  4ETO A;  2K2F A;  4PE1 A;  1XFX O;  2HET A;  2JRF A;  1DJX A;  1QTX A;  2M1U A;  1DT7 B;  2I2R E;  1QIW A;  2BL0 C;  4M2P A;  3I5F B;  3A4U B;  3OX6 A;  2GV5 A;  2JXC A;  3KHE A;  1FBV A;  2F8P A;  2KGR A;  5DKQ A;  1S6J A;  2WOS A;  4GGN A;  1CB1 A;  4XJK A;  1AHR A;  3RLZ A;  1SCM C;  2KYF A;  5D69 A;  1LVC D;  3EKJ A;  4R1E A;  1KSO A;  1L7Z A;  3EK8 A;  2JPT A;  3I5I C;  1QAT A;  2L2E A;  1TOP A;  1NYA A;  1A4P A;  1GJY A;  1AVS A;  2HQ8 A;  1X02 A;  2I18 A; 
#chains in the Genus database with same CATH topology
 1ZMZ A;  4YI9 A;  2JTZ A;  1QX2 A;  3CZ2 A;  1Y0V H;  3DF0 A;  1LIN A;  3BOW B;  1PSB A;  1IG5 A;  1XFU O;  2L2C A;  1U5I B;  4MZJ A;  2L5X B;  1QS7 A;  1MR8 A;  3FWB A;  3QRX A;  3R1V A;  1J55 A;  3EK7 A;  2K7B A;  2LUX A;  1BF5 A;  4YBH B;  4QJ4 B;  3JTD C;  1Y6W A;  4L9M A;  3FS7 A;  1W7J B;  2JT8 A;  3VRQ A;  1GQM A;  1WY9 A;  1ZOT B;  1OOG A;  1DGU A;  1BJF A;  1J1E A;  2KFH A;  1UHK A;  1M63 B;  2K61 A;  2H61 C;  1MHO A;  1BU3 A;  3BJH A;  3CZ0 A;  5HLV A;  3SS5 A;  3I5H C;  2K8M B;  1IIO A;  5I8N A;  3O4Y A;  1B9A A;  5I2L A;  3WXA A;  1BR4 B;  1WLM A;  3OBV A;  1CDL A;  3UO9 A;  1NWD A;  1QLK A;  3B86 A;  4N5X A;  3M0W A;  2JC2 A;  1EL4 A;  2D8N A;  1QVI Z;  1Z4H A;  1TCF A;  1OZS A;  2QDI A;  2ZNE A;  4GUK A;  2M1K B;  3NHI A;  1CDP A;  3DYE A;  2WC5 A;  1N2D A;  2G9B A;  1MWN A;  3BUN B;  4AOM A;  1FPW A;  5KSZ A;  2KAX A;  5AFP A;  3DD4 A;  1MXL C;  2WND A;  2OTG B;  5PAL A;  3TZ1 A;  4OCI A;  1QV1 A;  2WC8 A;  1CMG A;  1H4B A;  1A29 A;  5I2Q A;  3R72 A;  1WDC B;  2KOT A;  3LK1 A;  1DTL A;  3AAK A;  3KPX A;  3MSE B;  3PAL A;  4N1G A;  3WHU B;  1OMV A;  1NUB A;  5JOL A;  2BKI B;  1SMG A;  3R1O A;  4PHM A;  1RK9 A;  2WCH A;  4PE4 A;  2LP2 A;  1UUS A;  3SS3 A;  1XO5 A;  1IH0 A;  4PE7 A;  1CDN A;  1SCM B;  1SW8 A;  4I5L B;  5AAN A;  2M29 A;  1M45 A;  3D0Y A;  1DJW A;  2BCA A;  3CTN A;  2H2K A;  1JF0 A;  1XK4 C;  1M39 A;  2M49 B;  3HCM A;  1TUZ A;  5IBW A;  3TS5 C;  2HQW A;  2NLN A;  2EC6 B;  4I5K A;  4I5N B;  1N0Y A;  1Y1U A;  1BR1 B;  4PHN A;  4CFR A;  4TNC A;  5J3X A;  3Q8I A;  1CLB A;  1F70 A;  1JFK A;  2PQL A;  4MSP A;  1WRL A;  2KQY A;  3SG2 A;  1G4Y R;  1KK7 Z;  1XFY O;  3IVT A;  2KBI A;  3NGV A;  3O2P A;  5CSJ A;  2F33 A;  1DMO A;  3FWC A;  2WOR A;  4OV2 A;  2LAP A;  3AKA A;  4DUQ A;  2QEO A;  3RM1 A;  1F4Q A;  4JWQ A;  2JOJ A;  1SY9 A;  2ZN8 A;  2HPS A;  4NDC A;  2LMV A;  2KI6 D;  3NSL A;  5AER A;  2CTN A;  2PRU A;  3NXA A;  3BQ3 A;  4WRI A;  2JTT A;  1QAS A;  1A03 A;  1UWO A;  3OB2 B;  3I5H B;  2KI6 C;  1IJ6 A;  2KLE A;  1KSM A;  3OHM B;  1DF0 A;  3KEV A;  1UHH A;  1S26 D;  2ISD A;  2Y1N A;  1DJI A;  2BKH B;  2LV7 A;  1L2O B;  1K93 D;  3NSO A;  1BG1 A;  2JZI A;  3A8R A;  3IF7 A;  2BCX A;  2WCJ A;  4E68 A;  1B7T Y;  3AAJ A;  2PAS A;  1SL8 A;  1UHJ A;  3L4A A;  3CR5 X;  1Y1A A;  5FI6 A;  4C0J A;  2EHB A;  1A75 B;  3KO0 A;  4MZK A;  5G08 A;  1ODB A;  3C1V A;  5ER4 X;  3TDZ A;  1IWQ A;  1KFX L;  1HT9 A;  3CYZ A;  1IQ5 A;  5HL1 A;  1Q80 A;  2K0J A;  2LUC A;  3SS4 A;  2QEV A;  2V53 A;  3BFH A;  2F3Z A;  1HQV A;  4MN0 A;  4U8D A;  1H8B A;  1DEL A;  1N65 A;  2LLT A;  4YGD B;  2KSP A;  1KWO C;  2HF5 A;  2MBX A;  1OQP A;  1TNP A;  1RJV A;  1OOH A;  2L98 A;  2MRD A;  2PAL A;  2IS9 A;  1KQM B;  2ZKM X;  4DRW A;  1DQE A;  1EH2 A;  3PM2 A;  1KK8 C;  1IQ3 A;  5CSF A;  1KFX S;  4YGC B;  3DVE A;  1WLZ A;  2BAP A;  1NSH A;  2MLE C;  1CTR A;  2CXJ A;  3TUY B;  1CM1 A;  2L50 A;  4GGF C;  1IKU A;  3PFV A;  1PK0 D;  1DEK A;  1RRO A;  1QV0 A;  3WNX B;  3IQQ A;  1LA3 A;  1MQ1 A;  2ZN9 A;  3IQO A;  3PSR A;  3CZT X;  3BOW A;  3D10 A;  3HX4 A;  3S0E A;  3PLF B;  1C07 A;  4DCK A;  3OP0 A;  3LL8 B;  1U5I A;  2L0P A;  3PN7 C;  2PMY A;  3JVT C;  4M2O A;  3SG6 A;  1G8I A;  3I5G C;  4MRX A;  2Y5I A;  1ALV A;  2YGU A;  1NX2 A;  4YGE B;  4ZCU A;  4OR9 B;  2FCE A;  1K96 A;  1PRW A;  3E3R A;  3ICB A;  5HKW A;  4DIR A;  3SJS A;  5ER5 A;  2L4I A;  4JKT A;  1YUT A;  2LNK A;  1DC1 A;  5CSN A;  4ORA B;  3SG3 A;  4AQI A;  2G2B A;  3VB1 A;  5CSI A;  2LMU A;  3D74 A;  2OS8 C;  3EK4 A;  4CFQ A;  2LVI A;  3BXK A;  5FI7 A;  1SR6 C;  3D78 A;  4ORC B;  1TTX A;  1NCY A;  2WCB A;  1JBA A;  2R2I A;  1OOI X;  1UHI A;  2WCL A;  4MRY A;  1NX1 A;  4CID A;  1S5G Y;  4YRU A;  3LCP C;  1B1G A;  2CBL A;  1NX0 A;  2M9G A;  2KYC A;  1TWO A;  4BY4 A;  2KBM A;  1YVL A;  2MAZ A;  3DVM A;  4JD9 A;  2NCO A;  1BOD A;  3S0B A;  4GFT A;  1KCY A;  3CGA A;  1PAL A;  2F2O A;  2JNF A;  2KAY A;  4HRE E;  4KYN A;  4MZL A;  1CFC A;  1SK6 D;  3CLN A;  2KI4 C;  1QX7 A;  1R6P A;  1YRT B;  3VRO A;  1RTP 1;  1BMO A;  1F55 A;  1QIV A;  2BL0 B;  3N7H A;  3EG5 B;  2JPO A;  2BBN A;  3FE8 A;  3I5F C;  3B6X A;  3LK0 A;  2P70 A;  2JT3 A;  1QX5 B;  3GOF A;  1MF8 B;  2AAO A;  4FTG A;  2LM5 A;  3DVJ A;  1CFF A;  2LLU A;  2M7L A;  2FCD A;  5KTY A;  4JPZ B;  1XFV O;  3I5I B;  4XYN A;  4CLN A;  3OGN A;  1NPQ A;  2P71 A;  2KQ6 A;  2COL B;  2P6B B;  2BEC A;  2KLD A;  3B7A A;  4ORB B;  2K7D A;  1CLM A;  3CR2 A;  1AJ4 A;  2BE6 A;  1SL9 A;  3O4X A;  2CNP A;  1OOF A;  2LC5 A;  1EXR A;  1V1F A;  1F71 A;  4HRH A;  3S0G A;  1DVI A;  1MXE A;  3JTD B;  2BCB A;  2BE4 A;  3KF9 A;  2QPT A;  1TNW A;  2H8V A;  1C7V A;  2TN4 A;  2WCF A;  1BT6 A;  2JUL A;  4MEW A;  4BY5 A;  4D1E A;  1SBJ A;  1SRA A;  2BNX A;  2Q91 A;  1SNL A;  1OE9 B;  1CM4 A;  1UUR A;  1OMD A;  2LCP A;  1S36 A;  5B8I B;  2KGB C;  2JU0 A;  4GBA A;  1UP5 A;  2B1U A;  4A4B A;  2KPH A;  4YI8 A;  1LA0 A;  2O60 A;  2ZRT A;  3NSI A;  1YUR A;  1K9P A;  2GTE A;  3CAB A;  5D7F A;  4HRG A;  1XFW O;  3TDU A;  3B88 A;  1B47 A;  1K94 A;  1SR6 B;  2KFG A;  1PSR A;  2FJU B;  2NZ0 A;  4YGA A;  1B8R A;  2K60 A;  1J7Q A;  4MVF A;  4Q04 A;  1LKJ A;  3SIA A;  2O5G A;  1XYD A;  1DGV A;  1KFU L;  1S6I A;  1SSE B;  3DZT A;  3LLE A;  3ZWH A;  1ZFS A;  1SPY A;  1A75 A;  1TIZ A;  2LVV A;  1FI6 A;  2KNE A;  3BUW B;  4I5J A;  5DIC A;  3OX5 A;  1K9K A;  1OW4 A;  1FW4 A;  1YUS A;  2OTG C;  3L4L A;  4PAL A;  1DJZ A;  2KDH A;  1M31 A;  1QXP A;  1YRU B;  1CKK A;  1WDC C;  4USL A;  1K90 D;  2F3Y A;  1GGW A;  2KFF A;  1IRJ A;  2ZND A;  3NHT A;  1FI5 A;  1ALW A;  4WQ2 A;  4XJK B;  1CMF A;  2E30 A;  4JQ0 D;  1KFU S;  1E8A A;  4CPV A;  1PVA A;  2M3W A;  1WRK A;  3DY9 A;  5GQQ C;  3V2L A;  1BLQ A;  4NQG A;  2JT0 A;  1OOJ A;  1S1E A;  1XFR A;  2LVJ A;  2M0R A;  1QVI Y;  1JUO A;  3EVR A;  3SG5 A;  3BUX B;  4C0K A;  4OZD A;  4F0Z B;  3O6B A;  3DXL A;  1CNP A;  3BUM B;  3EVV A;  3BUO B;  1YX7 A;  1YTZ C;  1PVB A;  3DF0 B;  4IL1 A;  3TS5 B;  1PUL A;  3ZNI A;  1SCV A;  5AXI A;  1B7T Z;  4OKH A;  1RFJ A;  2M8U A;  3BYA A;  2EC6 C;  1G33 A;  2I7A A;  1ORG A;  1K8U A;  5HYD A;  1J7O A;  1XK4 A;  3WHT B;  2FJY A;  2PYQ A;  2LVK A;  1XA5 A;  3DVK A;  2LP3 A;  1K2H A;  1OZO A;  5CPV A;  3TDI A;  1AJ5 A;  3VRR A;  3O78 A;  5JJG A;  1F4O A;  3CZ1 A;  3GK4 X;  1S6C A;  1JF2 A;  1JFJ A;  3AKB A;  3D73 A;  1JC2 A;  4P2Y B;  3QME A;  5HKZ A;  1J7R A;  2L51 A;  4QJ5 B;  2NCP A;  2RGI A;  4WQ3 A;  1C3Z A;  3D75 A;  2MHH A;  1YX8 A;  5AEQ A;  3VGO A;  1Y1X A;  1K9U A;  1NCX A;  3S0F A;  1KQV A;  3B87 A;  2FOT A;  2NXQ A;  4ICB A;  1CLL A;  2DOQ A;  1AP4 A;  2WC6 A;  4MLW A;  1T14 A;  2ZRS A;  1DJY A;  1TNX A;  3D76 A;  2GGZ A;  1L2O C;  1DJG A;  1UHN A;  4QJ3 B;  1MUX A;  3RZS A;  2KHN A;  5DKN A;  4PHJ A;  5BPJ A;  1RWY A;  1WRZ A;  2Q4U A;  3PJI A;  4N1F A;  4P5O E;  1BOC A;  2CCM A;  4GAO A;  1IJ5 A;  1LXF C;  3CDN A;  2BBM A;  4OVN F;  1IGV A;  1KK7 Y;  4PDZ A;  5I2O A;  1K95 A;  1LS8 A;  2KAV A;  1NX3 A;  2LE9 B;  2E6W A;  2VRG A;  4PHK A;  5HKY A;  1TNQ A;  3FE6 A;  2AMI A;  3H4S E;  2L4H A;  4MBE A;  1S3P A;  1KWO B;  3EVU A;  1NCZ A;  2F2P A;  2MJW B;  2SAS A;  2QEB A;  3EKH A;  1VRK A;  1KK8 B;  1SYM A;  1KQM C;  4PT1 A;  1EG4 A;  4GNK B;  1D1O A;  4C0L A;  1TRF A;  2OPO A;  2PVB A;  3F45 A;  1AUI B;  4PE0 A;  2AUC A;  4F7F A;  1C3Y A;  1ZUZ A;  2LLS A;  2JWW A;  2WCM A;  3D0Y B;  5FYX A;  5KU1 A;  2JXL A;  1YVH A;  5I94 A;  4M2Q A;  2A4J A;  4A4C A;  3TUY C;  1S5G Z;  5TNC A;  4FQO A;  2MLF C;  2LAN A;  2MA2 A;  3D77 A;  1W9Z A;  2WCE A;  3SIB A;  3SG7 A;  1REC A;  3VRP A;  1JSA A;  2SCP A;  1M46 A;  4IJ7 A;  5HLO A;  3FE9 A;  4NDD A;  3L47 A;  3UNW A;  2K2A A;  5F6T A;  3PN7 B;  1W7I B;  3JVT B;  4GGF A;  1J7P A;  1YUU A;  1SL7 A;  3I5G B;  3SG4 A;  2QAC A;  1R2U A;  2QEH A;  1F8H A;  2M7N A;  3GK1 A;  1SKT A;  3NSK A;  5D3O A;  1GGZ A;  3K21 A;  2PSR A;  3OB1 B;  3K1E A;  4YGB B;  3CWG A;  1CFP A;  1JWD A;  1C7W A;  3BFA A;  1DJH A;  2H61 A;  1YR5 A;  2K7C A;  2ERB A;  1AK8 A;  2EGD A;  3CR4 X;  4NDB A;  1J1D A;  3BFB A;  4INW A;  2OS8 B;  2LHL A;  4HSZ A;  4DS7 A;  1A2X A;  4PCW A;  3CS1 A;  2JNX A;  1DF0 B;  1B4C A;  3GK2 A;  1TN4 A;  4UPG A;  1QJT A;  5EL2 A;  1FF1 A;  1NP8 A;  1EG3 A;  1OMR A;  1V1G A;  3FIA A;  1CFD A;  1QLS A;  1NIW A;  2Y4Q A;  3PAT A;  1CDM A;  2M97 A;  3R1P A;  4FQT A;  1XVJ A;  5DKR A;  2L5Y A;  1ZAC A;  3VRN A;  5K89 A;  1QWV A;  2GGM A;  1F54 A;  1XFZ O;  1B8C A;  2LHI A;  4AQJ A;  2K7O A;  1B8L A;  4ZCV A;  1TCO B;  2CT9 A;  3S0D A;  1TUJ A;  3S0A A;  2LMT A;  2Y1M A;  2ZFD A;  2I94 A;  4GPL B;  1GM0 A;  1OSA A;  2JQ6 A;  2KI4 B;  1EJ3 A;  3PM8 A;  4ETO A;  2K2F A;  4PE1 A;  1XFX O;  1Z2C B;  2HET A;  2JRF A;  1DJX A;  1QTX A;  2M1U A;  1DT7 B;  2I2R E;  1QIW A;  2BL0 C;  4M2P A;  3I5F B;  3A4U B;  3OX6 A;  2GV5 A;  4INX A;  2JXC A;  3KHE A;  1FBV A;  2F8P A;  1P28 A;  2KGR A;  5DKQ A;  1S6J A;  2WOS A;  4GGN A;  1CB1 A;  4XJK A;  1AHR A;  3RLZ A;  1SCM C;  2KYF A;  5D69 A;  1LVC D;  3EKJ A;  4R1E A;  1KSO A;  1L7Z A;  3EK8 A;  2JPT A;  3I5I C;  1QAT A;  2L2E A;  2WCK A;  1TOP A;  5FI2 A;  1NYA A;  1A4P A;  1GJY A;  1AVS A;  2HQ8 A;  1X02 A;  2I18 A; 
#chains in the Genus database with same CATH homology
 1ZMZ A;  4YI9 A;  2JTZ A;  1QX2 A;  1Y0V H;  3DF0 A;  1LIN A;  3BOW B;  1PSB A;  1IG5 A;  1XFU O;  1U5I B;  4MZJ A;  2L5X B;  1QS7 A;  1MR8 A;  3FWB A;  3QRX A;  1J55 A;  3EK7 A;  2K7B A;  2LUX A;  1BF5 A;  4YBH B;  4QJ4 B;  3JTD C;  1Y6W A;  4L9M A;  3FS7 A;  1W7J B;  2JT8 A;  3VRQ A;  1GQM A;  1WY9 A;  1ZOT B;  1DGU A;  1BJF A;  1J1E A;  2KFH A;  1UHK A;  1M63 B;  2K61 A;  2H61 C;  1MHO A;  1BU3 A;  5HLV A;  3I5H C;  2K8M B;  5I8N A;  3O4Y A;  1B9A A;  5I2L A;  3WXA A;  1BR4 B;  1WLM A;  1CDL A;  1NWD A;  1QLK A;  4N5X A;  3M0W A;  2JC2 A;  1EL4 A;  2D8N A;  1QVI Z;  1TCF A;  1OZS A;  2ZNE A;  4GUK A;  2M1K B;  1CDP A;  1N2D A;  2G9B A;  1MWN A;  3BUN B;  4AOM A;  1FPW A;  5KSZ A;  2KAX A;  5AFP A;  3DD4 A;  1MXL C;  2WND A;  2OTG B;  5PAL A;  3TZ1 A;  4OCI A;  1QV1 A;  2WC8 A;  1CMG A;  1H4B A;  1A29 A;  5I2Q A;  1WDC B;  2KOT A;  3LK1 A;  1DTL A;  3AAK A;  3KPX A;  3MSE B;  3PAL A;  4N1G A;  3WHU B;  1OMV A;  1NUB A;  5JOL A;  2BKI B;  1SMG A;  4PHM A;  1RK9 A;  4PE4 A;  2LP2 A;  1UUS A;  1XO5 A;  1IH0 A;  4PE7 A;  1CDN A;  1SCM B;  1SW8 A;  4I5L B;  5AAN A;  2M29 A;  1M45 A;  3D0Y A;  1DJW A;  2BCA A;  3CTN A;  2H2K A;  1JF0 A;  1XK4 C;  1M39 A;  2M49 B;  3HCM A;  5IBW A;  3TS5 C;  2HQW A;  2NLN A;  2EC6 B;  4I5K A;  4I5N B;  1N0Y A;  1Y1U A;  1BR1 B;  4PHN A;  4CFR A;  4TNC A;  5J3X A;  1CLB A;  1F70 A;  1JFK A;  4MSP A;  1WRL A;  2KQY A;  3SG2 A;  1G4Y R;  1KK7 Z;  1XFY O;  2KBI A;  1DMO A;  3O2P A;  5CSJ A;  2F33 A;  3FWC A;  2WOR A;  4OV2 A;  2LAP A;  3AKA A;  4DUQ A;  3RM1 A;  1F4Q A;  4JWQ A;  2JOJ A;  1SY9 A;  2ZN8 A;  2HPS A;  4NDC A;  2LMV A;  2KI6 D;  3NSL A;  5AER A;  2CTN A;  2PRU A;  3NXA A;  3BQ3 A;  4WRI A;  2JTT A;  1QAS A;  1A03 A;  1UWO A;  3OB2 B;  3I5H B;  2KI6 C;  1IJ6 A;  1KSM A;  3OHM B;  1DF0 A;  3KEV A;  1UHH A;  1S26 D;  2ISD A;  2Y1N A;  2BKH B;  1DJI A;  2LV7 A;  1L2O B;  1K93 D;  3NSO A;  1BG1 A;  2JZI A;  3A8R A;  3IF7 A;  2BCX A;  4E68 A;  1B7T Y;  3AAJ A;  2PAS A;  1SL8 A;  1UHJ A;  3CR5 X;  1Y1A A;  4C0J A;  2EHB A;  1A75 B;  3KO0 A;  4MZK A;  5G08 A;  1ODB A;  3C1V A;  5ER4 X;  3TDZ A;  1IWQ A;  1KFX L;  1HT9 A;  1IQ5 A;  1Q80 A;  2K0J A;  2LUC A;  2V53 A;  2F3Z A;  1HQV A;  4MN0 A;  4U8D A;  1H8B A;  1N65 A;  2LLT A;  4YGD B;  2KSP A;  1KWO C;  2HF5 A;  2MBX A;  1OQP A;  1TNP A;  1RJV A;  2ZKM X;  2L98 A;  2MRD A;  2PAL A;  2IS9 A;  1KQM B;  4DRW A;  1EH2 A;  1KK8 C;  1IQ3 A;  5CSF A;  1KFX S;  4YGC B;  3DVE A;  1WLZ A;  1NSH A;  2MLE C;  1CTR A;  2CXJ A;  3TUY B;  1CM1 A;  2L50 A;  4GGF C;  1IKU A;  3PFV A;  1PK0 D;  1RRO A;  1QV0 A;  3WNX B;  3IQQ A;  1LA3 A;  1MQ1 A;  2ZN9 A;  3IQO A;  3PSR A;  3CZT X;  3BOW A;  3D10 A;  3HX4 A;  1C07 A;  3PLF B;  4DCK A;  3OP0 A;  3LL8 B;  1U5I A;  2L0P A;  3PN7 C;  2PMY A;  3JVT C;  4M2O A;  3SG6 A;  1G8I A;  3I5G C;  4MRX A;  2Y5I A;  1ALV A;  1NX2 A;  4YGE B;  4ZCU A;  4OR9 B;  2FCE A;  1K96 A;  1PRW A;  3E3R A;  3ICB A;  5HKW A;  4DIR A;  3SJS A;  5ER5 A;  2L4I A;  1YUT A;  2LNK A;  5CSN A;  4ORA B;  3SG3 A;  4AQI A;  2G2B A;  5CSI A;  2LMU A;  2OS8 C;  3EK4 A;  4CFQ A;  2LVI A;  3BXK A;  1SR6 C;  4ORC B;  1TTX A;  1NCY A;  2WCB A;  1JBA A;  2R2I A;  1UHI A;  4MRY A;  1NX1 A;  4CID A;  1S5G Y;  4YRU A;  3LCP C;  1B1G A;  2CBL A;  1NX0 A;  2M9G A;  2KYC A;  4BY4 A;  2KBM A;  1YVL A;  2MAZ A;  3DVM A;  1BOD A;  2NCO A;  4GFT A;  1KCY A;  3CGA A;  1PAL A;  2F2O A;  2JNF A;  2KAY A;  4HRE E;  4MZL A;  1CFC A;  1SK6 D;  3CLN A;  2KI4 C;  1QX7 A;  1R6P A;  1YRT B;  3VRO A;  1RTP 1;  1BMO A;  1F55 A;  1QIV A;  2BL0 B;  2BBN A;  3I5F C;  3LK0 A;  2JT3 A;  1QX5 B;  3GOF A;  1MF8 B;  2AAO A;  4FTG A;  2LM5 A;  3DVJ A;  1CFF A;  2LLU A;  2M7L A;  2FCD A;  5KTY A;  4JPZ B;  1XFV O;  3I5I B;  4XYN A;  4CLN A;  1NPQ A;  2KQ6 A;  2COL B;  2P6B B;  2BEC A;  4ORB B;  2K7D A;  1CLM A;  3CR2 A;  1AJ4 A;  2BE6 A;  1SL9 A;  2CNP A;  2LC5 A;  1EXR A;  1V1F A;  1F71 A;  4HRH A;  1DVI A;  1MXE A;  3JTD B;  2BCB A;  2BE4 A;  3KF9 A;  2QPT A;  1TNW A;  1C7V A;  2TN4 A;  2WCF A;  1BT6 A;  2JUL A;  4MEW A;  4BY5 A;  4D1E A;  1SBJ A;  1SRA A;  2Q91 A;  1SNL A;  1OE9 B;  1CM4 A;  1UUR A;  1OMD A;  2LCP A;  1S36 A;  5B8I B;  2KGB C;  2JU0 A;  4GBA A;  1UP5 A;  2B1U A;  4A4B A;  4YI8 A;  1LA0 A;  2O60 A;  2ZRT A;  3NSI A;  1YUR A;  1K9P A;  5D7F A;  4HRG A;  1XFW O;  3TDU A;  1B47 A;  1K94 A;  1SR6 B;  2KFG A;  1PSR A;  2FJU B;  2NZ0 A;  4YGA A;  1B8R A;  1J7Q A;  4MVF A;  4Q04 A;  1LKJ A;  3SIA A;  2O5G A;  1XYD A;  1DGV A;  1KFU L;  1S6I A;  3LLE A;  3ZWH A;  1ZFS A;  1SPY A;  1A75 A;  1TIZ A;  2LVV A;  1FI6 A;  2KNE A;  3BUW B;  4I5J A;  3OX5 A;  1K9K A;  1YUS A;  1FW4 A;  2OTG C;  4PAL A;  1DJZ A;  2KDH A;  1M31 A;  1QXP A;  1YRU B;  1CKK A;  1WDC C;  4USL A;  1K90 D;  2F3Y A;  1GGW A;  2KFF A;  1IRJ A;  2ZND A;  1FI5 A;  1ALW A;  4WQ2 A;  4XJK B;  1CMF A;  2E30 A;  4JQ0 D;  1KFU S;  1E8A A;  4CPV A;  1PVA A;  2M3W A;  1WRK A;  5GQQ C;  1BLQ A;  4NQG A;  2JT0 A;  1OOJ A;  1S1E A;  2LVJ A;  2M0R A;  1QVI Y;  1JUO A;  3EVR A;  3SG5 A;  3BUX B;  4C0K A;  4F0Z B;  3O6B A;  1CNP A;  3BUM B;  3EVV A;  3BUO B;  1YX7 A;  1YTZ C;  1PVB A;  3DF0 B;  4IL1 A;  3TS5 B;  1PUL A;  3ZNI A;  1SCV A;  5AXI A;  1B7T Z;  4OKH A;  1RFJ A;  2M8U A;  3BYA A;  2EC6 C;  1G33 A;  2I7A A;  1K8U A;  5HYD A;  1J7O A;  1XK4 A;  3WHT B;  2LVK A;  1XA5 A;  3DVK A;  2LP3 A;  1K2H A;  1OZO A;  5CPV A;  3TDI A;  1AJ5 A;  3VRR A;  3O78 A;  5JJG A;  1F4O A;  3GK4 X;  1S6C A;  1JF2 A;  1JFJ A;  3AKB A;  1JC2 A;  4P2Y B;  5HKZ A;  1J7R A;  2L51 A;  4QJ5 B;  2NCP A;  2RGI A;  4WQ3 A;  2MHH A;  1YX8 A;  5AEQ A;  3VGO A;  1Y1X A;  1K9U A;  1NCX A;  1KQV A;  4ICB A;  2FOT A;  2NXQ A;  1CLL A;  2DOQ A;  1AP4 A;  4MLW A;  2ZRS A;  1DJY A;  1TNX A;  2GGZ A;  1L2O C;  1DJG A;  1UHN A;  4QJ3 B;  1MUX A;  2KHN A;  5DKN A;  4PHJ A;  5BPJ A;  1RWY A;  1WRZ A;  2Q4U A;  4N1F A;  4P5O E;  1BOC A;  2CCM A;  4GAO A;  1IJ5 A;  1LXF C;  2BBM A;  4OVN F;  1IGV A;  1KK7 Y;  4PDZ A;  5I2O A;  1K95 A;  2KAV A;  1NX3 A;  2LE9 B;  2E6W A;  2VRG A;  4PHK A;  5HKY A;  1TNQ A;  2AMI A;  3H4S E;  2L4H A;  4MBE A;  1S3P A;  1KWO B;  3EVU A;  1NCZ A;  2F2P A;  2MJW B;  2SAS A;  3EKH A;  1VRK A;  1KK8 B;  1SYM A;  1KQM C;  1EG4 A;  4GNK B;  1D1O A;  4C0L A;  1TRF A;  2OPO A;  2PVB A;  3F45 A;  1AUI B;  4PE0 A;  2AUC A;  1ZUZ A;  2LLS A;  2JWW A;  3D0Y B;  5FYX A;  5KU1 A;  2JXL A;  1YVH A;  4M2Q A;  2A4J A;  4A4C A;  3TUY C;  1S5G Z;  5TNC A;  4FQO A;  2MLF C;  2LAN A;  2MA2 A;  2WCE A;  3SIB A;  3SG7 A;  1REC A;  3VRP A;  1JSA A;  2SCP A;  1M46 A;  5HLO A;  4NDD A;  2K2A A;  5F6T A;  3PN7 B;  1W7I B;  3JVT B;  4GGF A;  1J7P A;  1YUU A;  1SL7 A;  3I5G B;  3SG4 A;  2QAC A;  1R2U A;  1F8H A;  2M7N A;  3GK1 A;  1SKT A;  3NSK A;  1GGZ A;  3K21 A;  2PSR A;  3OB1 B;  4YGB B;  3CWG A;  1CFP A;  1JWD A;  1C7W A;  1DJH A;  2H61 A;  1YR5 A;  2K7C A;  1AK8 A;  2EGD A;  3CR4 X;  4NDB A;  1J1D A;  2OS8 B;  2LHL A;  4HSZ A;  4DS7 A;  1A2X A;  4PCW A;  3CS1 A;  2JNX A;  1DF0 B;  1B4C A;  3GK2 A;  1TN4 A;  4UPG A;  1QJT A;  1FF1 A;  1NP8 A;  1EG3 A;  1OMR A;  1V1G A;  3FIA A;  1CFD A;  1QLS A;  1NIW A;  2Y4Q A;  3PAT A;  1CDM A;  2M97 A;  5DKR A;  5K89 A;  1XVJ A;  3VRN A;  1ZAC A;  2GGM A;  1F54 A;  1XFZ O;  1B8C A;  2LHI A;  4AQJ A;  2K7O A;  1B8L A;  4ZCV A;  1TCO B;  2CT9 A;  2LMT A;  2Y1M A;  2ZFD A;  2I94 A;  4GPL B;  1OSA A;  2JQ6 A;  2KI4 B;  1EJ3 A;  3PM8 A;  4ETO A;  2K2F A;  4PE1 A;  1XFX O;  2HET A;  2JRF A;  1DJX A;  1QTX A;  2M1U A;  1DT7 B;  2I2R E;  1QIW A;  2BL0 C;  4M2P A;  3I5F B;  3A4U B;  3OX6 A;  2GV5 A;  2JXC A;  3KHE A;  1FBV A;  2F8P A;  2KGR A;  5DKQ A;  1S6J A;  2WOS A;  4GGN A;  1CB1 A;  4XJK A;  1AHR A;  3RLZ A;  1SCM C;  2KYF A;  5D69 A;  1LVC D;  3EKJ A;  4R1E A;  1KSO A;  1L7Z A;  3EK8 A;  2JPT A;  3I5I C;  1QAT A;  2L2E A;  1TOP A;  1NYA A;  1A4P A;  1GJY A;  1AVS A;  2HQ8 A;  1X02 A;  2I18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...