2M1KB

Interaction of human s100a6 (c3s) with v domain of receptor for advanced glycation end products (rage)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
ASPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of the S100A6 mutant (C3S) with the V domain of the receptor for advanced glycation end products (RAGE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein S100-A6
total genus 33
structure length 89
sequence length 89
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m1kB00
2FOTA 1J7RA 1YRTB 3SG3A 1CDPA 5B8IB 1AUIB 1UP5A 2GGMA 1MQ1A 1QVIZ 1NUBA 1SL8A 1UHNA 1XK4A 1Q80A 1SW8A 4WQ2A 1KQMC 2M97A 4YGCB 3MSEB 1K8UA 1V1GA 1DF0B 2VRGA 2JOJA 1QX7A 1TCOB 2LM5A 1SBJA 4MZKA 4GUKA 1EG4A 1A75A 3I5HB 4I5LB 2BECA 2OTGC 1OMVA 1K96A 2M1UA 1ODBA 1YVLA 1RJVA 3BYAA 4USLA 5DKNA 1JWDA 2AAOA 2F8PA 2JXLA 3TZ1A 3RLZA 2GGZA 3EVUA 2LANA 1SK6D 3D0YB 5CSNA 4NDBA 3DF0A 2AUCA 5AEQA 2ZNEA 3CGAA 2Y4QA 1A75B 1K9UA 4BY5A 2G2BA 1XO5A 1IGVA 1XK4C 1S26D 3CTNA 3TUYC 1WLZA 3DVKA 1CLMA 2MJWB 1RTP1 2CTNA 1XFZO 1NWDA 2K61A 1BR4B 1CLLA 1RK9A 3M0WA 1L2OC 2BBNA 2PASA 1IQ3A 3AKAA 1F70A 2NXQA 1UHKA 4PHJA 3I5FC 1LXFC 5DKQA 4CFRA 1QXPA 1QATA 3BOWB 4CLNA 3O6BA 5K89A 1UHIA 4YI9A 1D1OA 2ISDA 1R6PA 4FTGA 2K7BA 3PN7C 5CSJA 2KQYA 1QX5B 2LE9B 1AK8A 2KDHA 1AP4A 2KI6C 1IJ6A 1PSBA 3PN7B 4MN0A 4MRYA 3SIAA 4GFTA 1BT6A 1K95A 2KFGA 1KK7Y 1NX0A 4HREE 4M2QA 1AJ4A 3I5FB 1AJ5A 1DGUA 2K7CA 2M29A 2EHBA 4DUQA 3PALA 1SCMB 2ZN8A 2MBXA 1CTRA 3NSIA 1E8AA 1AHRA 1DJWA 4R1EA 1FPWA 3DVMA 1EL4A 1F4QA 1QASA 2ZN9A 1CDNA 2JT8A 5D7FA 1TRFA 1U5IB 3BUWB 3VROA 1K90D 3SG2A 1PVBA 2MLEC 1A03A 3SG6A 1BMOA 1UHHA 1SR6B 3EK4A 2L4IA 2RGIA 4YGDB 1NYAA 5HLOA 4ORCB 1JF0A 4PALA 4NQGA 5F6TA 3D10A 3GK4X 2L4HA 1KFXL 1F4OA 3CR4X 3I5GB 1C07A 1SY9A 3I5HC 2M3WA 1FBVA 3CS1A 3TS5B 4YGAA 2HF5A 3ZNIA 3LK1A 2DOQA 4GAOA 1DGVA 1IJ5A 2BL0C 1X02A 1PRWA 2OS8B 3PATA 1BU3A 1RWYA 4OCIA 2CNPA 2HQ8A 1AVSA 2MLFC 4OVNF 2H2KA 1KFUL 1S5GY 2JTTA 1N2DA 4MZLA 4YGEB 2KNEA 1IQ5A 3BUOB 4I5JA 2K2AA 1UUSA 1G8IA 2I18A 1DJGA 5IBWA 2BBMA 4QJ3B 2F33A 1QTXA 1SPYA 4FQOA 5HKWA 1OZOA 1RECA 3C1VA 4JWQA 2NZ0A 2I2RE 1SL7A 1A29A 1DT7B 2LCPA 1ZFSA 2LLSA 2OS8C 2WCBA 5HYDA 2D8NA 1Y1UA 4OR9B 2KGRA 1M31A 1BLQA 2FCEA 1S36A 1WLMA 4PCWA 3O4YA 4PE0A 5KTYA 2HPSA 1J7PA 2KBMA 1XFWO 3CWGA 2K2FA 5HKZA 1CLBA 2WCEA 1DMOA 2O5GA 3QRXA 1Y1XA 5HKYA 1DJXA 2Y1NA 1CFFA 1QLKA 2QPTA 3OB1B 4MVFA 1KFUS 1G33A 1PULA 1ALWA 1EXRA 2CT9A 3I5IB 2LV7A 1B8RA 3BOWA 4CIDA 1KSOA 2WC8A 3PLFB 4GBAA 2LNKA 2PMYA 1IWQA 4N5XA 4DRWA 1CMGA 1BODA 2SASA 1B8CA 1YX8A 1L7ZA 2WCFA 3OHMB 2OTGB 2AMIA 1BR1B 1KK8B 2SCPA 1FI5A 2F2PA 3SG5A 2F3YA 3ZWHA 4N1GA 4NDDA 4D1EA 1CDLA 1EJ3A 1F54A 3KO0A 1CM4A 3NSKA 3WHUB 3VGOA 1A4PA 1UWOA 4GGNA 2LHIA 2KOTA 1M39A 1N65A 1WY9A 1YTZC 2V53A 3IF7A 2H61C 3TDZA 1BOCA 1ZUZA 4ZCVA 2L98A 3D0YA 3ICBA 3RM1A 3CR2A 2LLTA 1WDCC 3DF0B 4MZJA 2PRUA 5DKRA 1SKTA 2M49B 1HT9A 1ZACA 1U5IA 1NX2A 2LVVA 3F45A 1SMGA 3LK0A 4F0ZB 2LMUA 2JNXA 2G9BA 2KYCA 3AAKA 4NDCA 2LLUA 2A4JA 2LMTA 3EKHA 1RFJA 3EK8A 4BY4A 2MA2A 4JPZB 1FF1A 2PSRA 5AFPA 1JBAA 1YX7A 4WRIA 3WNXB 2LVJA 2I94A 1KSMA 1MUXA 3EKJA 1B7TZ 1CNPA 1KWOC 3VRQA 5HLVA 1KK8C 2BKHB 2KSPA 2LUCA 1KCYA 1S6CA 4MEWA 3I5GC 1JSAA 1TNQA 2JT0A 5I2LA 2LUXA 5CPVA 2F2OA 3CR5X 4M2OA 2I7AA 3SJSA 1J7OA 1KFXS 2LC5A 1ALVA 3LCPC 5KSZA 2H61A 3OX5A 2M9GA 1CFDA 2EGDA 1NX1A 1K2HA 3GK1A 1YUSA 4C0KA 2LHLA 1NIWA 1QS7A 2BCXA 4UPGA 2M7NA 2BCAA 4WQ3A 1OQPA 3EK7A 2Y1MA 1RROA 3SG4A 1B1GA 1M46A 1QV0A 2COLB 1F71A 2FCDA 3GK2A 1DTLA 2KAXA 1MXLC 3BUMB 2Q4UA 1SCMC 1MXEA 1SL9A 2KAYA 1TTXA 4YRUA 1KQMB 2O60A 1K93D 2BKIB 1Y6WA 4CFQA 3HCMA 3NSLA 1OOJA 3DVJA 4MLWA 4ZCUA 1A2XA 4CPVA 4JQ0D 5I8NA 2K7DA 2KI4C 4ETOA 5J3XA 2NLNA 3K21A 4P2YB 1K9KA 2JNFA 2CBLA 3AKBA 3FWCA 1OSAA 2JC2A 4C0JA 4PHMA 4XJKB 2K8MB 2PALA 4I5NB 4PE7A 5I2QA 1BG1A 5AERA 1H8BA 1XFYO 1IH0A 3BQ3A 2IS9A 4YI8A 5JJGA 1YUUA 1F8HA 3OP0A 4L9MA 3SIBA 2KAVA 2K0JA 2WOSA 3KEVA 1B8LA 5JOLA 3GOFA 3TS5C 2LP3A 4AQIA 2LVKA 2L51A 1GGZA 5PALA 1JFJA 4XJKA 1W7JB 4QJ5B 1CB1A 4OV2A 1JFKA 1PALA 4TNCA 3A4UB 3JVTC 4MBEA 1PSRA 3FWBA 1LA0A 4DCKA 1DJIA 1SR6C 3FIAA 1GGWA 1YR5A 3JVTB 4PHKA 1JUOA 2KI6D 1FI6A 1CFCA 4A4CA 5G08A 1SNLA 1MWNA 1J7QA 3VRNA 4DIRA 2LAPA 2KGBC 3PSRA 2FJUB 3NSOA 1NP8A 5FYXA 1XFUO 1G4YR 2KQ6A 2Y5IA 3WXAA 1UHJA 1JF2A 1K9PA 2JT3A 1W7IB 2L50A 1NPQA 1QIVA 1OZSA 1WRLA 1J1EA 1WRZA 1XFXO 2WNDA 1DJHA 1KK7Z 4P5OE 4GPLB 4IL1A 1S6IA 1XVJA 2B1UA 3VRRA 1MF8B 4DS7A 1OE9B 4Q04A 2ZFDA 2JPTA 2E30A 3IQQA 3EVVA 1QV1A 1B9AA 1NCXA 2M1KB 3PFVA 3BUXB 5D69A 1TNPA 2M0RA 1Y0VH 2R2IA 4I5KA 1ZMZA 1SYMA 1FW4A 3PM8A 3AAJA 1XFVO 1N0YA 2JTZA 1H4BA 3DVEA 1QLSA 2EC6C 2BE4A 4PE4A 2K7OA 4AQJA 2BL0B 2NCOA 2L2EA 4HRGA 4E68A 3E3RA 1V1FA 3FS7A 2MRDA 4M2PA 1B47A 1SCVA 1F55A 1YURA 3CLNA 2M7LA 1TN4A 2BCBA 4HSZA 1QJTA 4GGFC 4A4BA 1R2UA 1MHOA 3KF9A 3BUNB 2MHHA 1LA3A 2EC6B 4QJ4B 1BF5A 1XA5A 3JTDC 5CSIA 1YUTA 3LLEA 1BJFA 1J55A 2LVIA 1TCFA 2WORA 1M45A 4HRHA 2PVBA 2TN4A 1YVHA 1CMFA 3NXAA 2ZNDA 2MAZA 5ER5A 4AOMA 1DVIA 1TNXA 4GNKB 4ORBB 1S5GZ 2L5XB 2BE6A 1GJYA 1IG5A 1LKJA 5BPJA 1WRKA 2E6WA 2LP2A 3IQOA 1EH2A 2M8UA 2JU0A 1CM1A 2HETA 1TIZA 1ZOTB 4ORAB 2JZIA 3CZTX 5GQQC 3A8RA 4OKHA 1MR8A 1QX2A 2NCPA 1JC2A 4XYNA 2Q91A 1QVIY 3HX4A 1CDMA 1NX3A 1OMDA 5KU1A 3H4SE 4PDZA 4GGFA 2KHNA 1DJZA 3TUYB 2L0PA 1S1EA 1SRAA 1K94A 2GV5A 1C7WA 1TOPA 1NCZA 3OB2B 5ER4X 1NCYA 4PHNA 5I2OA 5CSFA 2JQ6A 1QIWA 3O2PA 1WDCB 2JULA 5TNCA 1NSHA 2KFHA 3JTDB 3TDUA 3EVRA 1DJYA 3BXKA 3TDIA 1LVCD 4PE1A 2OPOA 5AANA 4ICBA 3KPXA 2ZRTA 4MRXA 3WHTB 3DD4A 1IKUA 2HQWA 3KHEA 5AXIA 2JXCA 1L2OB 2CCMA 4MSPA 1DF0A 1KWOB 2F3ZA 1IRJA 1HQVA 1OMRA 2ZRSA 3VRPA 2ZKMX 4YGBB 1Y1AA 1LINA 2KFFA 1B7TY 2KYFA 1EG3A 1UURA 4YBHB 1PVAA 1CFPA 1XYDA 2JWWA 2CXJA 3OX6A 3SG7A 2P6BB 1VRKA 4N1FA 4C0LA 3LL8B 2LMVA 2QACA 3I5IC 3O78A 1KQVA 2JRFA 1YRUB 1J1DA 2KI4B 1PK0D 1GQMA 1S6JA 1B4CA 1CKKA 1S3PA 4U8DA 1M63B 1C7VA 1TNWA 2KBIA
chains in the Genus database with same CATH superfamily
2FOTA 3SS3A 1J7RA 1YRTB 3SG3A 1CDPA 5B8IB 1AUIB 1UP5A 2P71A 2GGMA 1MQ1A 1QVIZ 1NUBA 1SL8A 1UHNA 1XK4A 1Q80A 1SW8A 4WQ2A 1KQMC 2M97A 4YGCB 3MSEB 4INXA 1K8UA 3R72A 1V1GA 4KYNA 1DF0B 2VRGA 2JOJA 2WCMA 1QX7A 1TCOB 2LM5A 1SBJA 4MZKA 4GUKA 1EG4A 1A75A 3I5HB 2PQLA 4I5LB 2BECA 2OTGC 1OMVA 3UO9A 1K96A 2M1UA 1ODBA 1YVLA 1RJVA 3BYAA 3CABA 4USLA 5DKNA 1JWDA 2AAOA 2F8PA 2JXLA 3TZ1A 3B88A 3RLZA 2GGZA 3EVUA 2LANA 1SK6D 3D0YB 1OOIX 4IJ7A 5CSNA 4NDBA 3DF0A 2AUCA 5AEQA 2ZNEA 4JKTA 3CGAA 2Y4QA 1A75B 1K9UA 4BY5A 2G2BA 1XO5A 1IGVA 1XK4C 1S26D 3CTNA 3CZ1A 1WLZA 3TUYC 3DVKA 1CLMA 2MJWB 1RTP1 1SSEB 1XFZO 1NWDA 2CTNA 2K61A 1BR4B 1CLLA 2KLDA 1RK9A 3M0WA 1L2OC 2BBNA 1TUZA 2PASA 1IQ3A 3AKAA 1F70A 2NXQA 1OOHA 1UHKA 4PHJA 3I5FC 1LXFC 5DKQA 4CFRA 1QXPA 3R1OA 1QATA 3BOWB 4CLNA 3O6BA 5K89A 1UHIA 4YI9A 2QEBA 1D1OA 2ISDA 1R6PA 4FTGA 2K7BA 3PN7C 5CSJA 2KQYA 1QX5B 2LE9B 1AK8A 3L4AA 2KDHA 3BFBA 2KI6C 1AP4A 1IJ6A 1PSBA 3PN7B 5EL2A 4MN0A 1QWVA 4MRYA 4GFTA 3SIAA 1BT6A 1K95A 2KFGA 1KK7Y 1NX0A 4HREE 4M2QA 1AJ4A 3I5FB 1AJ5A 1DGUA 2K7CA 2M29A 2EHBA 4DUQA 3PALA 1SCMB 2ZN8A 2MBXA 1CTRA 3NSIA 1E8AA 1AHRA 1DJWA 4R1EA 1FPWA 3DVMA 1EL4A 1W9ZA 1F4QA 3QMEA 1QASA 2ZN9A 3N7HA 1CDNA 2JT8A 5D7FA 1TRFA 1U5IB 3DYEA 3BUWB 3VROA 1K90D 3SG2A 1PVBA 2MLEC 5FI6A 2YGUA 1A03A 3SG6A 1BMOA 1UHHA 1SR6B 3S0GA 3EK4A 2L4IA 2RGIA 4YGDB 1NYAA 5HLOA 4ORCB 1JF0A 4PALA 4NQGA 5F6TA 3D10A 3GK4X 2L4HA 1KFXL 1F4OA 2BAPA 3CR4X 3I5GB 1DC1A 1C07A 1SY9A 3I5HC 2M3WA 1FBVA 1C3YA 3CS1A 3TS5B 4YGAA 2HF5A 3ZNIA 1P28A 2DOQA 3LK1A 4GAOA 1DGVA 3BFAA 1IJ5A 2BL0C 1X02A 1PRWA 2OS8B 3PATA 1BU3A 1RWYA 4OCIA 2CNPA 2HQ8A 1AVSA 2MLFC 4OVNF 2H2KA 1KFUL 1S5GY 2JTTA 1N2DA 4MZLA 4YGEB 2KNEA 1IQ5A 3BUOB 4I5JA 2K2AA 1UUSA 3D73A 1G8IA 2I18A 1DJGA 5IBWA 2BBMA 4QJ3B 2F33A 1QTXA 1SPYA 4FQOA 5HKWA 1OZOA 1RECA 3C1VA 4JWQA 2NZ0A 2I2RE 1SL7A 1A29A 1DT7B 3RZSA 2LCPA 1ZFSA 2LLSA 2OS8C 2WCBA 5HYDA 2D8NA 1Y1UA 2QEOA 4OR9B 2KGRA 1M31A 5I94A 1BLQA 2FCEA 1S36A 1WLMA 4PCWA 3O4YA 4PE0A 5KTYA 2HPSA 1J7PA 2KBMA 1XFWO 3CWGA 2K2FA 5HKZA 1CLBA 2WCEA 1DMOA 2O5GA 3PM2A 1Y1XA 3QRXA 1DJXA 2Y1NA 5HKYA 1CFFA 1QLKA 2WC6A 2QPTA 3OB1B 4MVFA 1KFUS 1G33A 1PULA 2GTEA 3DY9A 1ALWA 1EXRA 2CT9A 3I5IB 5FI7A 4OZDA 2LV7A 1B8RA 3OGNA 3BOWA 4CIDA 1KSOA 2WC8A 3PLFB 4GBAA 2LNKA 2PMYA 1IWQA 4N5XA 4DRWA 1CMGA 1BODA 2SASA 3FE8A 1OW4A 3BJHA 1B8CA 1Z2CB 1YX8A 1L7ZA 2WCFA 3OHMB 2OTGB 2AMIA 1BR1B 1KK8B 2SCPA 1FI5A 2F2PA 3SG5A 2F3YA 3O4XA 3ZWHA 4N1GA 4NDDA 4D1EA 1CDLA 1EJ3A 1F54A 3D77A 3KO0A 1CM4A 3NSKA 3WHUB 3VGOA 1A4PA 4FQTA 1UWOA 4GGNA 2LHIA 2KOTA 3CZ2A 1M39A 1N65A 1WY9A 1YTZC 2V53A 3IF7A 2H61C 3TDZA 1BOCA 1ZUZA 4ZCVA 2L98A 3D0YA 3D76A 3ICBA 3CR2A 3RM1A 2LLTA 1WDCC 3DF0B 4MZJA 2PRUA 5DKRA 1SKTA 2M49B 1HT9A 1ZACA 1U5IA 1NX2A 2LVVA 3F45A 1SMGA 3LK0A 4F0ZB 2LMUA 2JNXA 2G9BA 2KYCA 3AAKA 4NDCA 2LLUA 2A4JA 2LMTA 3EKHA 1ORGA 1RFJA 3CZ0A 3EK8A 4JD9A 4BY4A 2MA2A 4JPZB 1FF1A 2PSRA 5AFPA 1JBAA 1YX7A 3DZTA 4WRIA 3WNXB 2LVJA 2I94A 4INWA 1KSMA 1MUXA 3EKJA 1B7TZ 1CNPA 1KWOC 3VRQA 5HLVA 1KK8C 2BKHB 2KSPA 2LUCA 1KCYA 1S6CA 4MEWA 3I5GC 3SS5A 1JSAA 1TNQA 2JT0A 5I2LA 2LUXA 5CPVA 2F2OA 3CR5X 4M2OA 2I7AA 3SJSA 1J7OA 1KFXS 2LC5A 1ALVA 3LCPC 5KSZA 2H61A 1DEKA 1DQEA 3OX5A 2M9GA 1CFDA 2EGDA 1NX1A 1K2HA 3GK1A 1YUSA 4C0KA 2LHLA 1NIWA 1QS7A 2BCXA 4UPGA 2M7NA 2BCAA 4WQ3A 3R1PA 1OQPA 3EK7A 2Y1MA 1RROA 3SG4A 1B1GA 1M46A 1QV0A 2COLB 1F71A 2FCDA 3GK2A 1DTLA 2KAXA 1MXLC 3BUMB 2Q4UA 1SCMC 1MXEA 1SL9A 2KAYA 1TTXA 2KLEA 4YRUA 1KQMB 2O60A 1K93D 2BKIB 1Y6WA 4CFQA 3HCMA 3NSLA 1OOJA 3DVJA 3R1VA 4MLWA 4ZCUA 1A2XA 4CPVA 4JQ0D 2ERBA 5I8NA 3SS4A 3Q8IA 2K7DA 1OOFA 2KI4C 4ETOA 5HL1A 5J3XA 2NLNA 3K21A 4P2YB 1K9KA 2JNFA 2CBLA 3AKBA 3FWCA 1OSAA 2P70A 2JC2A 3VB1A 4C0JA 4PHMA 4XJKB 2K8MB 2PALA 4I5NB 4PE7A 5I2QA 3L47A 5AERA 1BG1A 3NHTA 1H8BA 1XFYO 1IH0A 3BQ3A 2IS9A 2WC5A 4YI8A 5JJGA 2L5YA 1YUUA 1F8HA 3OP0A 4L9MA 3SIBA 1GM0A 2KAVA 2K0JA 2WOSA 2JPOA 3KEVA 1B8LA 5JOLA 3GOFA 3S0AA 3TS5C 2LP3A 4AQIA 2LVKA 3NHIA 2L51A 1Z4HA 1GGZA 5PALA 1JFJA 3V2LA 4XJKA 1W7JB 4QJ5B 2K60A 2QDIA 1CB1A 4OV2A 1JFKA 1PALA 4TNCA 3A4UB 3JVTC 4MBEA 3CDNA 1PSRA 3FWBA 1LA0A 3B6XA 4DCKA 1DJIA 2WCLA 1SR6C 2FJYA 3FIAA 3NGVA 3D74A 1GGWA 1YR5A 3JVTB 4PHKA 1JUOA 2KI6D 1FI6A 1CFCA 4A4CA 5G08A 1SNLA 1MWNA 1J7QA 3VRNA 4DIRA 2LAPA 2KGBC 3PSRA 2FJUB 3DXLA 3NSOA 1NP8A 5FYXA 1XFUO 1G4YR 2BNXA 2KQ6A 2PYQA 2Y5IA 3WXAA 1UHJA 1JF2A 1K9PA 3PJIA 2JT3A 1W7IB 2L50A 1NPQA 1QIVA 5D3OA 1OZSA 1WRLA 1J1EA 1WRZA 1XFXO 2WNDA 1DJHA 1KK7Z 4P5OE 4GPLB 4IL1A 1S6IA 3UNWA 1XVJA 2B1UA 3VRRA 1MF8B 4DS7A 1OE9B 4Q04A 2ZFDA 2JPTA 2E30A 3IQQA 3EVVA 1TUJA 1QV1A 1TWOA 1B9AA 1NCXA 2M1KB 2WCHA 3PFVA 3BUXB 5D69A 1TNPA 2M0RA 1Y0VH 2R2IA 4I5KA 1ZMZA 1C3ZA 1SYMA 1FW4A 3PM8A 2QEHA 3AAJA 1XFVO 1N0YA 2JTZA 1H4BA 3DVEA 1QLSA 2EC6C 2BE4A 4PT1A 2WCJA 4PE4A 2K7OA 4AQJA 2BL0B 2NCOA 2L2EA 4HRGA 3EG5B 4E68A 3E3RA 1V1FA 4F7FA 3FS7A 2MRDA 4M2PA 1B47A 3S0EA 3FE6A 1SCVA 3FE9A 1F55A 1YURA 1OOGA 3CLNA 2M7LA 1TN4A 2BCBA 4HSZA 1QJTA 4GGFC 4A4BA 1R2UA 1MHOA 3KF9A 3BUNB 2MHHA 1LA3A 2EC6B 4QJ4B 1BF5A 1XA5A 3JTDC 1IIOA 5CSIA 1YUTA 3LLEA 1BJFA 1J55A 2LVIA 1TCFA 2WORA 1M45A 4HRHA 2PVBA 2TN4A 1YVHA 1LS8A 1CMFA 3NXAA 2ZNDA 2MAZA 5ER5A 2H8VA 1DVIA 4AOMA 1TNXA 4GNKB 4ORBB 1S5GZ 2L5XB 2BE6A 1GJYA 3L4LA 1IG5A 1LKJA 5BPJA 3B7AA 1WRKA 2E6WA 2LP2A 3IQOA 1EH2A 2M8UA 2JU0A 1CM1A 1TIZA 2HETA 1ZOTB 3D75A 2JZIA 3CZTX 4ORAB 5GQQC 3A8RA 4OKHA 1MR8A 1QX2A 2NCPA 2WCKA 5DICA 4XYNA 2Q91A 1QVIY 1JC2A 1XFRA 3HX4A 1CDMA 1NX3A 3B87A 1OMDA 5KU1A 3H4SE 4PDZA 4GGFA 3CYZA 2KHNA 1DJZA 3S0BA 3TUYB 2L0PA 1S1EA 1SRAA 1K94A 2GV5A 1C7WA 1TOPA 1NCZA 1T14A 3OB2B 5ER4X 1NCYA 4PHNA 5I2OA 5CSFA 2JQ6A 1QIWA 3O2PA 1WDCB 3S0DA 3S0FA 2JULA 5TNCA 2QEVA 3OBVA 1NSHA 2KFHA 3JTDB 3TDUA 3EVRA 1DJYA 1DELA 3BXKA 3TDIA 1LVCD 4PE1A 2OPOA 5AANA 4ICBA 3KPXA 2ZRTA 4MRXA 3WHTB 3DD4A 1IKUA 2HQWA 3IVTA 3KHEA 5AXIA 3K1EA 2JXCA 1L2OB 2CCMA 3B86A 4MSPA 1DF0A 1KWOB 2F3ZA 1IRJA 1HQVA 1OMRA 2ZRSA 3VRPA 2ZKMX 4YGBB 1Y1AA 1LINA 2KFFA 1B7TY 2KYFA 1EG3A 1UURA 2L2CA 4YBHB 1PVAA 5FI2A 3D78A 1CFPA 1XYDA 2JWWA 2CXJA 3OX6A 2KPHA 3SG7A 2P6BB 1VRKA 4N1FA 4C0LA 3LL8B 2LMVA 2QACA 3BFHA 3I5IC 3O78A 1KQVA 2JRFA 1YRUB 1J1DA 2KI4B 1PK0D 1GQMA 1S6JA 1B4CA 1CKKA 1S3PA 4U8DA 1M63B 1C7VA 1TNWA 2KBIA
chains in the Genus database with same CATH topology
2FOTA 1J7RA 1YRTB 3SG3A 1CDPA 5B8IB 1AUIB 1UP5A 2GGMA 1MQ1A 1QVIZ 1NUBA 1SL8A 1UHNA 1XK4A 1Q80A 1SW8A 4WQ2A 1KQMC 2M97A 4YGCB 3MSEB 1K8UA 1V1GA 1DF0B 2VRGA 2JOJA 1QX7A 1TCOB 2LM5A 1SBJA 4MZKA 4GUKA 1EG4A 1A75A 3I5HB 4I5LB 2BECA 2OTGC 1OMVA 1K96A 2M1UA 1ODBA 1YVLA 1RJVA 3BYAA 4USLA 5DKNA 1JWDA 2AAOA 2F8PA 2JXLA 3TZ1A 3RLZA 2GGZA 3EVUA 2LANA 1SK6D 3D0YB 5CSNA 4NDBA 3DF0A 2AUCA 5AEQA 2ZNEA 3CGAA 2Y4QA 1A75B 1K9UA 4BY5A 2G2BA 1XO5A 1IGVA 1XK4C 1S26D 3CTNA 3TUYC 1WLZA 3DVKA 1CLMA 2MJWB 1RTP1 2CTNA 1XFZO 1NWDA 2K61A 1BR4B 1CLLA 1RK9A 3M0WA 1L2OC 2BBNA 2PASA 1IQ3A 3AKAA 1F70A 2NXQA 1UHKA 4PHJA 3I5FC 1LXFC 5DKQA 4CFRA 1QXPA 1QATA 3BOWB 4CLNA 3O6BA 5K89A 1UHIA 4YI9A 1D1OA 2ISDA 1R6PA 4FTGA 2K7BA 3PN7C 5CSJA 2KQYA 1QX5B 2LE9B 1AK8A 2KDHA 1AP4A 2KI6C 1IJ6A 1PSBA 3PN7B 4MN0A 4MRYA 3SIAA 4GFTA 1BT6A 1K95A 2KFGA 1KK7Y 1NX0A 4HREE 4M2QA 1AJ4A 3I5FB 1AJ5A 1DGUA 2K7CA 2M29A 2EHBA 4DUQA 3PALA 1SCMB 2ZN8A 2MBXA 1CTRA 3NSIA 1E8AA 1AHRA 1DJWA 4R1EA 1FPWA 3DVMA 1EL4A 1F4QA 1QASA 2ZN9A 1CDNA 2JT8A 5D7FA 1TRFA 1U5IB 3BUWB 3VROA 1K90D 3SG2A 1PVBA 2MLEC 1A03A 3SG6A 1BMOA 1UHHA 1SR6B 3EK4A 2L4IA 2RGIA 4YGDB 1NYAA 5HLOA 4ORCB 1JF0A 4PALA 4NQGA 5F6TA 3D10A 3GK4X 2L4HA 1KFXL 1F4OA 3CR4X 3I5GB 1C07A 1SY9A 3I5HC 2M3WA 1FBVA 3CS1A 3TS5B 4YGAA 2HF5A 3ZNIA 3LK1A 2DOQA 4GAOA 1DGVA 1IJ5A 2BL0C 1X02A 1PRWA 2OS8B 3PATA 1BU3A 1RWYA 4OCIA 2CNPA 2HQ8A 1AVSA 2MLFC 4OVNF 2H2KA 1KFUL 1S5GY 2JTTA 1N2DA 4MZLA 4YGEB 2KNEA 1IQ5A 3BUOB 4I5JA 2K2AA 1UUSA 1G8IA 2I18A 1DJGA 5IBWA 2BBMA 4QJ3B 2F33A 1QTXA 1SPYA 4FQOA 5HKWA 1OZOA 1RECA 3C1VA 4JWQA 2NZ0A 2I2RE 1SL7A 1A29A 1DT7B 2LCPA 1ZFSA 2LLSA 2OS8C 2WCBA 5HYDA 2D8NA 1Y1UA 4OR9B 2KGRA 1M31A 1BLQA 2FCEA 1S36A 1WLMA 4PCWA 3O4YA 4PE0A 5KTYA 2HPSA 1J7PA 2KBMA 1XFWO 3CWGA 2K2FA 5HKZA 1CLBA 2WCEA 1DMOA 2O5GA 3QRXA 1Y1XA 5HKYA 1DJXA 2Y1NA 1CFFA 1QLKA 2QPTA 3OB1B 4MVFA 1KFUS 1G33A 1PULA 1ALWA 1EXRA 2CT9A 3I5IB 2LV7A 1B8RA 3BOWA 4CIDA 1KSOA 2WC8A 3PLFB 4GBAA 2LNKA 2PMYA 1IWQA 4N5XA 4DRWA 1CMGA 1BODA 2SASA 1B8CA 1YX8A 1L7ZA 2WCFA 3OHMB 2OTGB 2AMIA 1BR1B 1KK8B 2SCPA 1FI5A 2F2PA 3SG5A 2F3YA 3ZWHA 4N1GA 4NDDA 4D1EA 1CDLA 1EJ3A 1F54A 3KO0A 1CM4A 3NSKA 3WHUB 3VGOA 1A4PA 1UWOA 4GGNA 2LHIA 2KOTA 1M39A 1N65A 1WY9A 1YTZC 2V53A 3IF7A 2H61C 3TDZA 1BOCA 1ZUZA 4ZCVA 2L98A 3D0YA 3ICBA 3RM1A 3CR2A 2LLTA 1WDCC 3DF0B 4MZJA 2PRUA 5DKRA 1SKTA 2M49B 1HT9A 1ZACA 1U5IA 1NX2A 2LVVA 3F45A 1SMGA 3LK0A 4F0ZB 2LMUA 2JNXA 2G9BA 2KYCA 3AAKA 4NDCA 2LLUA 2A4JA 2LMTA 3EKHA 1RFJA 3EK8A 4BY4A 2MA2A 4JPZB 1FF1A 2PSRA 5AFPA 1JBAA 1YX7A 4WRIA 3WNXB 2LVJA 2I94A 1KSMA 1MUXA 3EKJA 1B7TZ 1CNPA 1KWOC 3VRQA 5HLVA 1KK8C 2BKHB 2KSPA 2LUCA 1KCYA 1S6CA 4MEWA 3I5GC 1JSAA 1TNQA 2JT0A 5I2LA 2LUXA 5CPVA 2F2OA 3CR5X 4M2OA 2I7AA 3SJSA 1J7OA 1KFXS 2LC5A 1ALVA 3LCPC 5KSZA 2H61A 3OX5A 2M9GA 1CFDA 2EGDA 1NX1A 1K2HA 3GK1A 1YUSA 4C0KA 2LHLA 1NIWA 1QS7A 2BCXA 4UPGA 2M7NA 2BCAA 4WQ3A 1OQPA 3EK7A 2Y1MA 1RROA 3SG4A 1B1GA 1M46A 1QV0A 2COLB 1F71A 2FCDA 3GK2A 1DTLA 2KAXA 1MXLC 3BUMB 2Q4UA 1SCMC 1MXEA 1SL9A 2KAYA 1TTXA 4YRUA 1KQMB 2O60A 1K93D 2BKIB 1Y6WA 4CFQA 3HCMA 3NSLA 1OOJA 3DVJA 4MLWA 4ZCUA 1A2XA 4CPVA 4JQ0D 5I8NA 2K7DA 2KI4C 4ETOA 5J3XA 2NLNA 3K21A 4P2YB 1K9KA 2JNFA 2CBLA 3AKBA 3FWCA 1OSAA 2JC2A 4C0JA 4PHMA 4XJKB 2K8MB 2PALA 4I5NB 4PE7A 5I2QA 1BG1A 5AERA 1H8BA 1XFYO 1IH0A 3BQ3A 2IS9A 4YI8A 5JJGA 1YUUA 1F8HA 3OP0A 4L9MA 3SIBA 2KAVA 2K0JA 2WOSA 3KEVA 1B8LA 5JOLA 3GOFA 3TS5C 2LP3A 4AQIA 2LVKA 2L51A 1GGZA 5PALA 1JFJA 4XJKA 1W7JB 4QJ5B 1CB1A 4OV2A 1JFKA 1PALA 4TNCA 3A4UB 3JVTC 4MBEA 1PSRA 3FWBA 1LA0A 4DCKA 1DJIA 1SR6C 3FIAA 1GGWA 1YR5A 3JVTB 4PHKA 1JUOA 2KI6D 1FI6A 1CFCA 4A4CA 5G08A 1SNLA 1MWNA 1J7QA 3VRNA 4DIRA 2LAPA 2KGBC 3PSRA 2FJUB 3NSOA 1NP8A 5FYXA 1XFUO 1G4YR 2KQ6A 2Y5IA 3WXAA 1UHJA 1JF2A 1K9PA 2JT3A 1W7IB 2L50A 1NPQA 1QIVA 1OZSA 1WRLA 1J1EA 1WRZA 1XFXO 2WNDA 1DJHA 1KK7Z 4P5OE 4GPLB 4IL1A 1S6IA 1XVJA 2B1UA 3VRRA 1MF8B 4DS7A 1OE9B 4Q04A 2ZFDA 2JPTA 2E30A 3IQQA 3EVVA 1QV1A 1B9AA 1NCXA 2M1KB 3PFVA 3BUXB 5D69A 1TNPA 2M0RA 1Y0VH 2R2IA 4I5KA 1ZMZA 1SYMA 1FW4A 3PM8A 3AAJA 1XFVO 1N0YA 2JTZA 1H4BA 3DVEA 1QLSA 2EC6C 2BE4A 4PE4A 2K7OA 4AQJA 2BL0B 2NCOA 2L2EA 4HRGA 4E68A 3E3RA 1V1FA 3FS7A 2MRDA 4M2PA 1B47A 1SCVA 1F55A 1YURA 3CLNA 2M7LA 1TN4A 2BCBA 4HSZA 1QJTA 4GGFC 4A4BA 1R2UA 1MHOA 3KF9A 3BUNB 2MHHA 1LA3A 2EC6B 4QJ4B 1BF5A 1XA5A 3JTDC 5CSIA 1YUTA 3LLEA 1BJFA 1J55A 2LVIA 1TCFA 2WORA 1M45A 4HRHA 2PVBA 2TN4A 1YVHA 1CMFA 3NXAA 2ZNDA 2MAZA 5ER5A 4AOMA 1DVIA 1TNXA 4GNKB 4ORBB 1S5GZ 2L5XB 2BE6A 1GJYA 1IG5A 1LKJA 5BPJA 1WRKA 2E6WA 2LP2A 3IQOA 1EH2A 2M8UA 2JU0A 1CM1A 2HETA 1TIZA 1ZOTB 4ORAB 2JZIA 3CZTX 5GQQC 3A8RA 4OKHA 1MR8A 1QX2A 2NCPA 1JC2A 4XYNA 2Q91A 1QVIY 3HX4A 1CDMA 1NX3A 1OMDA 5KU1A 3H4SE 4PDZA 4GGFA 2KHNA 1DJZA 3TUYB 2L0PA 1S1EA 1SRAA 1K94A 2GV5A 1C7WA 1TOPA 1NCZA 3OB2B 5ER4X 1NCYA 4PHNA 5I2OA 5CSFA 2JQ6A 1QIWA 3O2PA 1WDCB 2JULA 5TNCA 1NSHA 2KFHA 3JTDB 3TDUA 3EVRA 1DJYA 3BXKA 3TDIA 1LVCD 4PE1A 2OPOA 5AANA 4ICBA 3KPXA 2ZRTA 4MRXA 3WHTB 3DD4A 1IKUA 2HQWA 3KHEA 5AXIA 2JXCA 1L2OB 2CCMA 4MSPA 1DF0A 1KWOB 2F3ZA 1IRJA 1HQVA 1OMRA 2ZRSA 3VRPA 2ZKMX 4YGBB 1Y1AA 1LINA 2KFFA 1B7TY 2KYFA 1EG3A 1UURA 4YBHB 1PVAA 1CFPA 1XYDA 2JWWA 2CXJA 3OX6A 3SG7A 2P6BB 1VRKA 4N1FA 4C0LA 3LL8B 2LMVA 2QACA 3I5IC 3O78A 1KQVA 2JRFA 1YRUB 1J1DA 2KI4B 1PK0D 1GQMA 1S6JA 1B4CA 1CKKA 1S3PA 4U8DA 1M63B 1C7VA 1TNWA 2KBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOT A;  1J7R A;  1YRT B;  3SG3 A;  1CDP A;  5B8I B;  1AUI B;  1UP5 A;  2GGM A;  1MQ1 A;  1QVI Z;  1NUB A;  1SL8 A;  1UHN A;  1XK4 A;  1Q80 A;  1SW8 A;  4WQ2 A;  1KQM C;  2M97 A;  4YGC B;  3MSE B;  1K8U A;  1V1G A;  1DF0 B;  2VRG A;  2JOJ A;  1QX7 A;  1TCO B;  2LM5 A;  1SBJ A;  4MZK A;  4GUK A;  1EG4 A;  1A75 A;  3I5H B;  4I5L B;  2BEC A;  2OTG C;  1OMV A;  1K96 A;  2M1U A;  1ODB A;  1YVL A;  1RJV A;  3BYA A;  4USL A;  5DKN A;  1JWD A;  2AAO A;  2F8P A;  2JXL A;  3TZ1 A;  3RLZ A;  2GGZ A;  3EVU A;  2LAN A;  1SK6 D;  3D0Y B;  5CSN A;  4NDB A;  3DF0 A;  2AUC A;  5AEQ A;  2ZNE A;  3CGA A;  2Y4Q A;  1A75 B;  1K9U A;  4BY5 A;  2G2B A;  1XO5 A;  1IGV A;  1XK4 C;  1S26 D;  3CTN A;  3TUY C;  1WLZ A;  3DVK A;  1CLM A;  2MJW B;  1RTP 1;  2CTN A;  1XFZ O;  1NWD A;  2K61 A;  1BR4 B;  1CLL A;  1RK9 A;  3M0W A;  1L2O C;  2BBN A;  2PAS A;  1IQ3 A;  3AKA A;  1F70 A;  2NXQ A;  1UHK A;  4PHJ A;  3I5F C;  1LXF C;  5DKQ A;  4CFR A;  1QXP A;  1QAT A;  3BOW B;  4CLN A;  3O6B A;  5K89 A;  1UHI A;  4YI9 A;  1D1O A;  2ISD A;  1R6P A;  4FTG A;  2K7B A;  3PN7 C;  5CSJ A;  2KQY A;  1QX5 B;  2LE9 B;  1AK8 A;  2KDH A;  1AP4 A;  2KI6 C;  1IJ6 A;  1PSB A;  3PN7 B;  4MN0 A;  4MRY A;  3SIA A;  4GFT A;  1BT6 A;  1K95 A;  2KFG A;  1KK7 Y;  1NX0 A;  4HRE E;  4M2Q A;  1AJ4 A;  3I5F B;  1AJ5 A;  1DGU A;  2K7C A;  2M29 A;  2EHB A;  4DUQ A;  3PAL A;  1SCM B;  2ZN8 A;  2MBX A;  1CTR A;  3NSI A;  1E8A A;  1AHR A;  1DJW A;  4R1E A;  1FPW A;  3DVM A;  1EL4 A;  1F4Q A;  1QAS A;  2ZN9 A;  1CDN A;  2JT8 A;  5D7F A;  1TRF A;  1U5I B;  3BUW B;  3VRO A;  1K90 D;  3SG2 A;  1PVB A;  2MLE C;  1A03 A;  3SG6 A;  1BMO A;  1UHH A;  1SR6 B;  3EK4 A;  2L4I A;  2RGI A;  4YGD B;  1NYA A;  5HLO A;  4ORC B;  1JF0 A;  4PAL A;  4NQG A;  5F6T A;  3D10 A;  3GK4 X;  2L4H A;  1KFX L;  1F4O A;  3CR4 X;  3I5G B;  1C07 A;  1SY9 A;  3I5H C;  2M3W A;  1FBV A;  3CS1 A;  3TS5 B;  4YGA A;  2HF5 A;  3ZNI A;  3LK1 A;  2DOQ A;  4GAO A;  1DGV A;  1IJ5 A;  2BL0 C;  1X02 A;  1PRW A;  2OS8 B;  3PAT A;  1BU3 A;  1RWY A;  4OCI A;  2CNP A;  2HQ8 A;  1AVS A;  2MLF C;  4OVN F;  2H2K A;  1KFU L;  1S5G Y;  2JTT A;  1N2D A;  4MZL A;  4YGE B;  2KNE A;  1IQ5 A;  3BUO B;  4I5J A;  2K2A A;  1UUS A;  1G8I A;  2I18 A;  1DJG A;  5IBW A;  2BBM A;  4QJ3 B;  2F33 A;  1QTX A;  1SPY A;  4FQO A;  5HKW A;  1OZO A;  1REC A;  3C1V A;  4JWQ A;  2NZ0 A;  2I2R E;  1SL7 A;  1A29 A;  1DT7 B;  2LCP A;  1ZFS A;  2LLS A;  2OS8 C;  2WCB A;  5HYD A;  2D8N A;  1Y1U A;  4OR9 B;  2KGR A;  1M31 A;  1BLQ A;  2FCE A;  1S36 A;  1WLM A;  4PCW A;  3O4Y A;  4PE0 A;  5KTY A;  2HPS A;  1J7P A;  2KBM A;  1XFW O;  3CWG A;  2K2F A;  5HKZ A;  1CLB A;  2WCE A;  1DMO A;  2O5G A;  3QRX A;  1Y1X A;  5HKY A;  1DJX A;  2Y1N A;  1CFF A;  1QLK A;  2QPT A;  3OB1 B;  4MVF A;  1KFU S;  1G33 A;  1PUL A;  1ALW A;  1EXR A;  2CT9 A;  3I5I B;  2LV7 A;  1B8R A;  3BOW A;  4CID A;  1KSO A;  2WC8 A;  3PLF B;  4GBA A;  2LNK A;  2PMY A;  1IWQ A;  4N5X A;  4DRW A;  1CMG A;  1BOD A;  2SAS A;  1B8C A;  1YX8 A;  1L7Z A;  2WCF A;  3OHM B;  2OTG B;  2AMI A;  1BR1 B;  1KK8 B;  2SCP A;  1FI5 A;  2F2P A;  3SG5 A;  2F3Y A;  3ZWH A;  4N1G A;  4NDD A;  4D1E A;  1CDL A;  1EJ3 A;  1F54 A;  3KO0 A;  1CM4 A;  3NSK A;  3WHU B;  3VGO A;  1A4P A;  1UWO A;  4GGN A;  2LHI A;  2KOT A;  1M39 A;  1N65 A;  1WY9 A;  1YTZ C;  2V53 A;  3IF7 A;  2H61 C;  3TDZ A;  1BOC A;  1ZUZ A;  4ZCV A;  2L98 A;  3D0Y A;  3ICB A;  3RM1 A;  3CR2 A;  2LLT A;  1WDC C;  3DF0 B;  4MZJ A;  2PRU A;  5DKR A;  1SKT A;  2M49 B;  1HT9 A;  1ZAC A;  1U5I A;  1NX2 A;  2LVV A;  3F45 A;  1SMG A;  3LK0 A;  4F0Z B;  2LMU A;  2JNX A;  2G9B A;  2KYC A;  3AAK A;  4NDC A;  2LLU A;  2A4J A;  2LMT A;  3EKH A;  1RFJ A;  3EK8 A;  4BY4 A;  2MA2 A;  4JPZ B;  1FF1 A;  2PSR A;  5AFP A;  1JBA A;  1YX7 A;  4WRI A;  3WNX B;  2LVJ A;  2I94 A;  1KSM A;  1MUX A;  3EKJ A;  1B7T Z;  1CNP A;  1KWO C;  3VRQ A;  5HLV A;  1KK8 C;  2BKH B;  2KSP A;  2LUC A;  1KCY A;  1S6C A;  4MEW A;  3I5G C;  1JSA A;  1TNQ A;  2JT0 A;  5I2L A;  2LUX A;  5CPV A;  2F2O A;  3CR5 X;  4M2O A;  2I7A A;  3SJS A;  1J7O A;  1KFX S;  2LC5 A;  1ALV A;  3LCP C;  5KSZ A;  2H61 A;  3OX5 A;  2M9G A;  1CFD A;  2EGD A;  1NX1 A;  1K2H A;  3GK1 A;  1YUS A;  4C0K A;  2LHL A;  1NIW A;  1QS7 A;  2BCX A;  4UPG A;  2M7N A;  2BCA A;  4WQ3 A;  1OQP A;  3EK7 A;  2Y1M A;  1RRO A;  3SG4 A;  1B1G A;  1M46 A;  1QV0 A;  2COL B;  1F71 A;  2FCD A;  3GK2 A;  1DTL A;  2KAX A;  1MXL C;  3BUM B;  2Q4U A;  1SCM C;  1MXE A;  1SL9 A;  2KAY A;  1TTX A;  4YRU A;  1KQM B;  2O60 A;  1K93 D;  2BKI B;  1Y6W A;  4CFQ A;  3HCM A;  3NSL A;  1OOJ A;  3DVJ A;  4MLW A;  4ZCU A;  1A2X A;  4CPV A;  4JQ0 D;  5I8N A;  2K7D A;  2KI4 C;  4ETO A;  5J3X A;  2NLN A;  3K21 A;  4P2Y B;  1K9K A;  2JNF A;  2CBL A;  3AKB A;  3FWC A;  1OSA A;  2JC2 A;  4C0J A;  4PHM A;  4XJK B;  2K8M B;  2PAL A;  4I5N B;  4PE7 A;  5I2Q A;  1BG1 A;  5AER A;  1H8B A;  1XFY O;  1IH0 A;  3BQ3 A;  2IS9 A;  4YI8 A;  5JJG A;  1YUU A;  1F8H A;  3OP0 A;  4L9M A;  3SIB A;  2KAV A;  2K0J A;  2WOS A;  3KEV A;  1B8L A;  5JOL A;  3GOF A;  3TS5 C;  2LP3 A;  4AQI A;  2LVK A;  2L51 A;  1GGZ A;  5PAL A;  1JFJ A;  4XJK A;  1W7J B;  4QJ5 B;  1CB1 A;  4OV2 A;  1JFK A;  1PAL A;  4TNC A;  3A4U B;  3JVT C;  4MBE A;  1PSR A;  3FWB A;  1LA0 A;  4DCK A;  1DJI A;  1SR6 C;  3FIA A;  1GGW A;  1YR5 A;  3JVT B;  4PHK A;  1JUO A;  2KI6 D;  1FI6 A;  1CFC A;  4A4C A;  5G08 A;  1SNL A;  1MWN A;  1J7Q A;  3VRN A;  4DIR A;  2LAP A;  2KGB C;  3PSR A;  2FJU B;  3NSO A;  1NP8 A;  5FYX A;  1XFU O;  1G4Y R;  2KQ6 A;  2Y5I A;  3WXA A;  1UHJ A;  1JF2 A;  1K9P A;  2JT3 A;  1W7I B;  2L50 A;  1NPQ A;  1QIV A;  1OZS A;  1WRL A;  1J1E A;  1WRZ A;  1XFX O;  2WND A;  1DJH A;  1KK7 Z;  4P5O E;  4GPL B;  4IL1 A;  1S6I A;  1XVJ A;  2B1U A;  3VRR A;  1MF8 B;  4DS7 A;  1OE9 B;  4Q04 A;  2ZFD A;  2JPT A;  2E30 A;  3IQQ A;  3EVV A;  1QV1 A;  1B9A A;  1NCX A;  2M1K B;  3PFV A;  3BUX B;  5D69 A;  1TNP A;  2M0R A;  1Y0V H;  2R2I A;  4I5K A;  1ZMZ A;  1SYM A;  1FW4 A;  3PM8 A;  3AAJ A;  1XFV O;  1N0Y A;  2JTZ A;  1H4B A;  3DVE A;  1QLS A;  2EC6 C;  2BE4 A;  4PE4 A;  2K7O A;  4AQJ A;  2BL0 B;  2NCO A;  2L2E A;  4HRG A;  4E68 A;  3E3R A;  1V1F A;  3FS7 A;  2MRD A;  4M2P A;  1B47 A;  1SCV A;  1F55 A;  1YUR A;  3CLN A;  2M7L A;  1TN4 A;  2BCB A;  4HSZ A;  1QJT A;  4GGF C;  4A4B A;  1R2U A;  1MHO A;  3KF9 A;  3BUN B;  2MHH A;  1LA3 A;  2EC6 B;  4QJ4 B;  1BF5 A;  1XA5 A;  3JTD C;  5CSI A;  1YUT A;  3LLE A;  1BJF A;  1J55 A;  2LVI A;  1TCF A;  2WOR A;  1M45 A;  4HRH A;  2PVB A;  2TN4 A;  1YVH A;  1CMF A;  3NXA A;  2ZND A;  2MAZ A;  5ER5 A;  4AOM A;  1DVI A;  1TNX A;  4GNK B;  4ORB B;  1S5G Z;  2L5X B;  2BE6 A;  1GJY A;  1IG5 A;  1LKJ A;  5BPJ A;  1WRK A;  2E6W A;  2LP2 A;  3IQO A;  1EH2 A;  2M8U A;  2JU0 A;  1CM1 A;  2HET A;  1TIZ A;  1ZOT B;  4ORA B;  2JZI A;  3CZT X;  5GQQ C;  3A8R A;  4OKH A;  1MR8 A;  1QX2 A;  2NCP A;  1JC2 A;  4XYN A;  2Q91 A;  1QVI Y;  3HX4 A;  1CDM A;  1NX3 A;  1OMD A;  5KU1 A;  3H4S E;  4PDZ A;  4GGF A;  2KHN A;  1DJZ A;  3TUY B;  2L0P A;  1S1E A;  1SRA A;  1K94 A;  2GV5 A;  1C7W A;  1TOP A;  1NCZ A;  3OB2 B;  5ER4 X;  1NCY A;  4PHN A;  5I2O A;  5CSF A;  2JQ6 A;  1QIW A;  3O2P A;  1WDC B;  2JUL A;  5TNC A;  1NSH A;  2KFH A;  3JTD B;  3TDU A;  3EVR A;  1DJY A;  3BXK A;  3TDI A;  1LVC D;  4PE1 A;  2OPO A;  5AAN A;  4ICB A;  3KPX A;  2ZRT A;  4MRX A;  3WHT B;  3DD4 A;  1IKU A;  2HQW A;  3KHE A;  5AXI A;  2JXC A;  1L2O B;  2CCM A;  4MSP A;  1DF0 A;  1KWO B;  2F3Z A;  1IRJ A;  1HQV A;  1OMR A;  2ZRS A;  3VRP A;  2ZKM X;  4YGB B;  1Y1A A;  1LIN A;  2KFF A;  1B7T Y;  2KYF A;  1EG3 A;  1UUR A;  4YBH B;  1PVA A;  1CFP A;  1XYD A;  2JWW A;  2CXJ A;  3OX6 A;  3SG7 A;  2P6B B;  1VRK A;  4N1F A;  4C0L A;  3LL8 B;  2LMV A;  2QAC A;  3I5I C;  3O78 A;  1KQV A;  2JRF A;  1YRU B;  1J1D A;  2KI4 B;  1PK0 D;  1GQM A;  1S6J A;  1B4C A;  1CKK A;  1S3P A;  4U8D A;  1M63 B;  1C7V A;  1TNW A;  2KBI A; 
#chains in the Genus database with same CATH topology
 2FOT A;  3SS3 A;  1J7R A;  1YRT B;  3SG3 A;  1CDP A;  5B8I B;  1AUI B;  1UP5 A;  2P71 A;  2GGM A;  1MQ1 A;  1QVI Z;  1NUB A;  1SL8 A;  1UHN A;  1XK4 A;  1Q80 A;  1SW8 A;  4WQ2 A;  1KQM C;  2M97 A;  4YGC B;  3MSE B;  4INX A;  1K8U A;  3R72 A;  1V1G A;  4KYN A;  1DF0 B;  2VRG A;  2JOJ A;  2WCM A;  1QX7 A;  1TCO B;  2LM5 A;  1SBJ A;  4MZK A;  4GUK A;  1EG4 A;  1A75 A;  3I5H B;  2PQL A;  4I5L B;  2BEC A;  2OTG C;  1OMV A;  3UO9 A;  1K96 A;  2M1U A;  1ODB A;  1YVL A;  1RJV A;  3BYA A;  3CAB A;  4USL A;  5DKN A;  1JWD A;  2AAO A;  2F8P A;  2JXL A;  3TZ1 A;  3B88 A;  3RLZ A;  2GGZ A;  3EVU A;  2LAN A;  1SK6 D;  3D0Y B;  1OOI X;  4IJ7 A;  5CSN A;  4NDB A;  3DF0 A;  2AUC A;  5AEQ A;  2ZNE A;  4JKT A;  3CGA A;  2Y4Q A;  1A75 B;  1K9U A;  4BY5 A;  2G2B A;  1XO5 A;  1IGV A;  1XK4 C;  1S26 D;  3CTN A;  3CZ1 A;  1WLZ A;  3TUY C;  3DVK A;  1CLM A;  2MJW B;  1RTP 1;  1SSE B;  1XFZ O;  1NWD A;  2CTN A;  2K61 A;  1BR4 B;  1CLL A;  2KLD A;  1RK9 A;  3M0W A;  1L2O C;  2BBN A;  1TUZ A;  2PAS A;  1IQ3 A;  3AKA A;  1F70 A;  2NXQ A;  1OOH A;  1UHK A;  4PHJ A;  3I5F C;  1LXF C;  5DKQ A;  4CFR A;  1QXP A;  3R1O A;  1QAT A;  3BOW B;  4CLN A;  3O6B A;  5K89 A;  1UHI A;  4YI9 A;  2QEB A;  1D1O A;  2ISD A;  1R6P A;  4FTG A;  2K7B A;  3PN7 C;  5CSJ A;  2KQY A;  1QX5 B;  2LE9 B;  1AK8 A;  3L4A A;  2KDH A;  3BFB A;  2KI6 C;  1AP4 A;  1IJ6 A;  1PSB A;  3PN7 B;  5EL2 A;  4MN0 A;  1QWV A;  4MRY A;  4GFT A;  3SIA A;  1BT6 A;  1K95 A;  2KFG A;  1KK7 Y;  1NX0 A;  4HRE E;  4M2Q A;  1AJ4 A;  3I5F B;  1AJ5 A;  1DGU A;  2K7C A;  2M29 A;  2EHB A;  4DUQ A;  3PAL A;  1SCM B;  2ZN8 A;  2MBX A;  1CTR A;  3NSI A;  1E8A A;  1AHR A;  1DJW A;  4R1E A;  1FPW A;  3DVM A;  1EL4 A;  1W9Z A;  1F4Q A;  3QME A;  1QAS A;  2ZN9 A;  3N7H A;  1CDN A;  2JT8 A;  5D7F A;  1TRF A;  1U5I B;  3DYE A;  3BUW B;  3VRO A;  1K90 D;  3SG2 A;  1PVB A;  2MLE C;  5FI6 A;  2YGU A;  1A03 A;  3SG6 A;  1BMO A;  1UHH A;  1SR6 B;  3S0G A;  3EK4 A;  2L4I A;  2RGI A;  4YGD B;  1NYA A;  5HLO A;  4ORC B;  1JF0 A;  4PAL A;  4NQG A;  5F6T A;  3D10 A;  3GK4 X;  2L4H A;  1KFX L;  1F4O A;  2BAP A;  3CR4 X;  3I5G B;  1DC1 A;  1C07 A;  1SY9 A;  3I5H C;  2M3W A;  1FBV A;  1C3Y A;  3CS1 A;  3TS5 B;  4YGA A;  2HF5 A;  3ZNI A;  1P28 A;  2DOQ A;  3LK1 A;  4GAO A;  1DGV A;  3BFA A;  1IJ5 A;  2BL0 C;  1X02 A;  1PRW A;  2OS8 B;  3PAT A;  1BU3 A;  1RWY A;  4OCI A;  2CNP A;  2HQ8 A;  1AVS A;  2MLF C;  4OVN F;  2H2K A;  1KFU L;  1S5G Y;  2JTT A;  1N2D A;  4MZL A;  4YGE B;  2KNE A;  1IQ5 A;  3BUO B;  4I5J A;  2K2A A;  1UUS A;  3D73 A;  1G8I A;  2I18 A;  1DJG A;  5IBW A;  2BBM A;  4QJ3 B;  2F33 A;  1QTX A;  1SPY A;  4FQO A;  5HKW A;  1OZO A;  1REC A;  3C1V A;  4JWQ A;  2NZ0 A;  2I2R E;  1SL7 A;  1A29 A;  1DT7 B;  3RZS A;  2LCP A;  1ZFS A;  2LLS A;  2OS8 C;  2WCB A;  5HYD A;  2D8N A;  1Y1U A;  2QEO A;  4OR9 B;  2KGR A;  1M31 A;  5I94 A;  1BLQ A;  2FCE A;  1S36 A;  1WLM A;  4PCW A;  3O4Y A;  4PE0 A;  5KTY A;  2HPS A;  1J7P A;  2KBM A;  1XFW O;  3CWG A;  2K2F A;  5HKZ A;  1CLB A;  2WCE A;  1DMO A;  2O5G A;  3PM2 A;  1Y1X A;  3QRX A;  1DJX A;  2Y1N A;  5HKY A;  1CFF A;  1QLK A;  2WC6 A;  2QPT A;  3OB1 B;  4MVF A;  1KFU S;  1G33 A;  1PUL A;  2GTE A;  3DY9 A;  1ALW A;  1EXR A;  2CT9 A;  3I5I B;  5FI7 A;  4OZD A;  2LV7 A;  1B8R A;  3OGN A;  3BOW A;  4CID A;  1KSO A;  2WC8 A;  3PLF B;  4GBA A;  2LNK A;  2PMY A;  1IWQ A;  4N5X A;  4DRW A;  1CMG A;  1BOD A;  2SAS A;  3FE8 A;  1OW4 A;  3BJH A;  1B8C A;  1Z2C B;  1YX8 A;  1L7Z A;  2WCF A;  3OHM B;  2OTG B;  2AMI A;  1BR1 B;  1KK8 B;  2SCP A;  1FI5 A;  2F2P A;  3SG5 A;  2F3Y A;  3O4X A;  3ZWH A;  4N1G A;  4NDD A;  4D1E A;  1CDL A;  1EJ3 A;  1F54 A;  3D77 A;  3KO0 A;  1CM4 A;  3NSK A;  3WHU B;  3VGO A;  1A4P A;  4FQT A;  1UWO A;  4GGN A;  2LHI A;  2KOT A;  3CZ2 A;  1M39 A;  1N65 A;  1WY9 A;  1YTZ C;  2V53 A;  3IF7 A;  2H61 C;  3TDZ A;  1BOC A;  1ZUZ A;  4ZCV A;  2L98 A;  3D0Y A;  3D76 A;  3ICB A;  3CR2 A;  3RM1 A;  2LLT A;  1WDC C;  3DF0 B;  4MZJ A;  2PRU A;  5DKR A;  1SKT A;  2M49 B;  1HT9 A;  1ZAC A;  1U5I A;  1NX2 A;  2LVV A;  3F45 A;  1SMG A;  3LK0 A;  4F0Z B;  2LMU A;  2JNX A;  2G9B A;  2KYC A;  3AAK A;  4NDC A;  2LLU A;  2A4J A;  2LMT A;  3EKH A;  1ORG A;  1RFJ A;  3CZ0 A;  3EK8 A;  4JD9 A;  4BY4 A;  2MA2 A;  4JPZ B;  1FF1 A;  2PSR A;  5AFP A;  1JBA A;  1YX7 A;  3DZT A;  4WRI A;  3WNX B;  2LVJ A;  2I94 A;  4INW A;  1KSM A;  1MUX A;  3EKJ A;  1B7T Z;  1CNP A;  1KWO C;  3VRQ A;  5HLV A;  1KK8 C;  2BKH B;  2KSP A;  2LUC A;  1KCY A;  1S6C A;  4MEW A;  3I5G C;  3SS5 A;  1JSA A;  1TNQ A;  2JT0 A;  5I2L A;  2LUX A;  5CPV A;  2F2O A;  3CR5 X;  4M2O A;  2I7A A;  3SJS A;  1J7O A;  1KFX S;  2LC5 A;  1ALV A;  3LCP C;  5KSZ A;  2H61 A;  1DEK A;  1DQE A;  3OX5 A;  2M9G A;  1CFD A;  2EGD A;  1NX1 A;  1K2H A;  3GK1 A;  1YUS A;  4C0K A;  2LHL A;  1NIW A;  1QS7 A;  2BCX A;  4UPG A;  2M7N A;  2BCA A;  4WQ3 A;  3R1P A;  1OQP A;  3EK7 A;  2Y1M A;  1RRO A;  3SG4 A;  1B1G A;  1M46 A;  1QV0 A;  2COL B;  1F71 A;  2FCD A;  3GK2 A;  1DTL A;  2KAX A;  1MXL C;  3BUM B;  2Q4U A;  1SCM C;  1MXE A;  1SL9 A;  2KAY A;  1TTX A;  2KLE A;  4YRU A;  1KQM B;  2O60 A;  1K93 D;  2BKI B;  1Y6W A;  4CFQ A;  3HCM A;  3NSL A;  1OOJ A;  3DVJ A;  3R1V A;  4MLW A;  4ZCU A;  1A2X A;  4CPV A;  4JQ0 D;  2ERB A;  5I8N A;  3SS4 A;  3Q8I A;  2K7D A;  1OOF A;  2KI4 C;  4ETO A;  5HL1 A;  5J3X A;  2NLN A;  3K21 A;  4P2Y B;  1K9K A;  2JNF A;  2CBL A;  3AKB A;  3FWC A;  1OSA A;  2P70 A;  2JC2 A;  3VB1 A;  4C0J A;  4PHM A;  4XJK B;  2K8M B;  2PAL A;  4I5N B;  4PE7 A;  5I2Q A;  3L47 A;  5AER A;  1BG1 A;  3NHT A;  1H8B A;  1XFY O;  1IH0 A;  3BQ3 A;  2IS9 A;  2WC5 A;  4YI8 A;  5JJG A;  2L5Y A;  1YUU A;  1F8H A;  3OP0 A;  4L9M A;  3SIB A;  1GM0 A;  2KAV A;  2K0J A;  2WOS A;  2JPO A;  3KEV A;  1B8L A;  5JOL A;  3GOF A;  3S0A A;  3TS5 C;  2LP3 A;  4AQI A;  2LVK A;  3NHI A;  2L51 A;  1Z4H A;  1GGZ A;  5PAL A;  1JFJ A;  3V2L A;  4XJK A;  1W7J B;  4QJ5 B;  2K60 A;  2QDI A;  1CB1 A;  4OV2 A;  1JFK A;  1PAL A;  4TNC A;  3A4U B;  3JVT C;  4MBE A;  3CDN A;  1PSR A;  3FWB A;  1LA0 A;  3B6X A;  4DCK A;  1DJI A;  2WCL A;  1SR6 C;  2FJY A;  3FIA A;  3NGV A;  3D74 A;  1GGW A;  1YR5 A;  3JVT B;  4PHK A;  1JUO A;  2KI6 D;  1FI6 A;  1CFC A;  4A4C A;  5G08 A;  1SNL A;  1MWN A;  1J7Q A;  3VRN A;  4DIR A;  2LAP A;  2KGB C;  3PSR A;  2FJU B;  3DXL A;  3NSO A;  1NP8 A;  5FYX A;  1XFU O;  1G4Y R;  2BNX A;  2KQ6 A;  2PYQ A;  2Y5I A;  3WXA A;  1UHJ A;  1JF2 A;  1K9P A;  3PJI A;  2JT3 A;  1W7I B;  2L50 A;  1NPQ A;  1QIV A;  5D3O A;  1OZS A;  1WRL A;  1J1E A;  1WRZ A;  1XFX O;  2WND A;  1DJH A;  1KK7 Z;  4P5O E;  4GPL B;  4IL1 A;  1S6I A;  3UNW A;  1XVJ A;  2B1U A;  3VRR A;  1MF8 B;  4DS7 A;  1OE9 B;  4Q04 A;  2ZFD A;  2JPT A;  2E30 A;  3IQQ A;  3EVV A;  1TUJ A;  1QV1 A;  1TWO A;  1B9A A;  1NCX A;  2M1K B;  2WCH A;  3PFV A;  3BUX B;  5D69 A;  1TNP A;  2M0R A;  1Y0V H;  2R2I A;  4I5K A;  1ZMZ A;  1C3Z A;  1SYM A;  1FW4 A;  3PM8 A;  2QEH A;  3AAJ A;  1XFV O;  1N0Y A;  2JTZ A;  1H4B A;  3DVE A;  1QLS A;  2EC6 C;  2BE4 A;  4PT1 A;  2WCJ A;  4PE4 A;  2K7O A;  4AQJ A;  2BL0 B;  2NCO A;  2L2E A;  4HRG A;  3EG5 B;  4E68 A;  3E3R A;  1V1F A;  4F7F A;  3FS7 A;  2MRD A;  4M2P A;  1B47 A;  3S0E A;  3FE6 A;  1SCV A;  3FE9 A;  1F55 A;  1YUR A;  1OOG A;  3CLN A;  2M7L A;  1TN4 A;  2BCB A;  4HSZ A;  1QJT A;  4GGF C;  4A4B A;  1R2U A;  1MHO A;  3KF9 A;  3BUN B;  2MHH A;  1LA3 A;  2EC6 B;  4QJ4 B;  1BF5 A;  1XA5 A;  3JTD C;  1IIO A;  5CSI A;  1YUT A;  3LLE A;  1BJF A;  1J55 A;  2LVI A;  1TCF A;  2WOR A;  1M45 A;  4HRH A;  2PVB A;  2TN4 A;  1YVH A;  1LS8 A;  1CMF A;  3NXA A;  2ZND A;  2MAZ A;  5ER5 A;  2H8V A;  1DVI A;  4AOM A;  1TNX A;  4GNK B;  4ORB B;  1S5G Z;  2L5X B;  2BE6 A;  1GJY A;  3L4L A;  1IG5 A;  1LKJ A;  5BPJ A;  3B7A A;  1WRK A;  2E6W A;  2LP2 A;  3IQO A;  1EH2 A;  2M8U A;  2JU0 A;  1CM1 A;  1TIZ A;  2HET A;  1ZOT B;  3D75 A;  2JZI A;  3CZT X;  4ORA B;  5GQQ C;  3A8R A;  4OKH A;  1MR8 A;  1QX2 A;  2NCP A;  2WCK A;  5DIC A;  4XYN A;  2Q91 A;  1QVI Y;  1JC2 A;  1XFR A;  3HX4 A;  1CDM A;  1NX3 A;  3B87 A;  1OMD A;  5KU1 A;  3H4S E;  4PDZ A;  4GGF A;  3CYZ A;  2KHN A;  1DJZ A;  3S0B A;  3TUY B;  2L0P A;  1S1E A;  1SRA A;  1K94 A;  2GV5 A;  1C7W A;  1TOP A;  1NCZ A;  1T14 A;  3OB2 B;  5ER4 X;  1NCY A;  4PHN A;  5I2O A;  5CSF A;  2JQ6 A;  1QIW A;  3O2P A;  1WDC B;  3S0D A;  3S0F A;  2JUL A;  5TNC A;  2QEV A;  3OBV A;  1NSH A;  2KFH A;  3JTD B;  3TDU A;  3EVR A;  1DJY A;  1DEL A;  3BXK A;  3TDI A;  1LVC D;  4PE1 A;  2OPO A;  5AAN A;  4ICB A;  3KPX A;  2ZRT A;  4MRX A;  3WHT B;  3DD4 A;  1IKU A;  2HQW A;  3IVT A;  3KHE A;  5AXI A;  3K1E A;  2JXC A;  1L2O B;  2CCM A;  3B86 A;  4MSP A;  1DF0 A;  1KWO B;  2F3Z A;  1IRJ A;  1HQV A;  1OMR A;  2ZRS A;  3VRP A;  2ZKM X;  4YGB B;  1Y1A A;  1LIN A;  2KFF A;  1B7T Y;  2KYF A;  1EG3 A;  1UUR A;  2L2C A;  4YBH B;  1PVA A;  5FI2 A;  3D78 A;  1CFP A;  1XYD A;  2JWW A;  2CXJ A;  3OX6 A;  2KPH A;  3SG7 A;  2P6B B;  1VRK A;  4N1F A;  4C0L A;  3LL8 B;  2LMV A;  2QAC A;  3BFH A;  3I5I C;  3O78 A;  1KQV A;  2JRF A;  1YRU B;  1J1D A;  2KI4 B;  1PK0 D;  1GQM A;  1S6J A;  1B4C A;  1CKK A;  1S3P A;  4U8D A;  1M63 B;  1C7V A;  1TNW A;  2KBI A; 
#chains in the Genus database with same CATH homology
 2FOT A;  1J7R A;  1YRT B;  3SG3 A;  1CDP A;  5B8I B;  1AUI B;  1UP5 A;  2GGM A;  1MQ1 A;  1QVI Z;  1NUB A;  1SL8 A;  1UHN A;  1XK4 A;  1Q80 A;  1SW8 A;  4WQ2 A;  1KQM C;  2M97 A;  4YGC B;  3MSE B;  1K8U A;  1V1G A;  1DF0 B;  2VRG A;  2JOJ A;  1QX7 A;  1TCO B;  2LM5 A;  1SBJ A;  4MZK A;  4GUK A;  1EG4 A;  1A75 A;  3I5H B;  4I5L B;  2BEC A;  2OTG C;  1OMV A;  1K96 A;  2M1U A;  1ODB A;  1YVL A;  1RJV A;  3BYA A;  4USL A;  5DKN A;  1JWD A;  2AAO A;  2F8P A;  2JXL A;  3TZ1 A;  3RLZ A;  2GGZ A;  3EVU A;  2LAN A;  1SK6 D;  3D0Y B;  5CSN A;  4NDB A;  3DF0 A;  2AUC A;  5AEQ A;  2ZNE A;  3CGA A;  2Y4Q A;  1A75 B;  1K9U A;  4BY5 A;  2G2B A;  1XO5 A;  1IGV A;  1XK4 C;  1S26 D;  3CTN A;  3TUY C;  1WLZ A;  3DVK A;  1CLM A;  2MJW B;  1RTP 1;  2CTN A;  1XFZ O;  1NWD A;  2K61 A;  1BR4 B;  1CLL A;  1RK9 A;  3M0W A;  1L2O C;  2BBN A;  2PAS A;  1IQ3 A;  3AKA A;  1F70 A;  2NXQ A;  1UHK A;  4PHJ A;  3I5F C;  1LXF C;  5DKQ A;  4CFR A;  1QXP A;  1QAT A;  3BOW B;  4CLN A;  3O6B A;  5K89 A;  1UHI A;  4YI9 A;  1D1O A;  2ISD A;  1R6P A;  4FTG A;  2K7B A;  3PN7 C;  5CSJ A;  2KQY A;  1QX5 B;  2LE9 B;  1AK8 A;  2KDH A;  1AP4 A;  2KI6 C;  1IJ6 A;  1PSB A;  3PN7 B;  4MN0 A;  4MRY A;  3SIA A;  4GFT A;  1BT6 A;  1K95 A;  2KFG A;  1KK7 Y;  1NX0 A;  4HRE E;  4M2Q A;  1AJ4 A;  3I5F B;  1AJ5 A;  1DGU A;  2K7C A;  2M29 A;  2EHB A;  4DUQ A;  3PAL A;  1SCM B;  2ZN8 A;  2MBX A;  1CTR A;  3NSI A;  1E8A A;  1AHR A;  1DJW A;  4R1E A;  1FPW A;  3DVM A;  1EL4 A;  1F4Q A;  1QAS A;  2ZN9 A;  1CDN A;  2JT8 A;  5D7F A;  1TRF A;  1U5I B;  3BUW B;  3VRO A;  1K90 D;  3SG2 A;  1PVB A;  2MLE C;  1A03 A;  3SG6 A;  1BMO A;  1UHH A;  1SR6 B;  3EK4 A;  2L4I A;  2RGI A;  4YGD B;  1NYA A;  5HLO A;  4ORC B;  1JF0 A;  4PAL A;  4NQG A;  5F6T A;  3D10 A;  3GK4 X;  2L4H A;  1KFX L;  1F4O A;  3CR4 X;  3I5G B;  1C07 A;  1SY9 A;  3I5H C;  2M3W A;  1FBV A;  3CS1 A;  3TS5 B;  4YGA A;  2HF5 A;  3ZNI A;  3LK1 A;  2DOQ A;  4GAO A;  1DGV A;  1IJ5 A;  2BL0 C;  1X02 A;  1PRW A;  2OS8 B;  3PAT A;  1BU3 A;  1RWY A;  4OCI A;  2CNP A;  2HQ8 A;  1AVS A;  2MLF C;  4OVN F;  2H2K A;  1KFU L;  1S5G Y;  2JTT A;  1N2D A;  4MZL A;  4YGE B;  2KNE A;  1IQ5 A;  3BUO B;  4I5J A;  2K2A A;  1UUS A;  1G8I A;  2I18 A;  1DJG A;  5IBW A;  2BBM A;  4QJ3 B;  2F33 A;  1QTX A;  1SPY A;  4FQO A;  5HKW A;  1OZO A;  1REC A;  3C1V A;  4JWQ A;  2NZ0 A;  2I2R E;  1SL7 A;  1A29 A;  1DT7 B;  2LCP A;  1ZFS A;  2LLS A;  2OS8 C;  2WCB A;  5HYD A;  2D8N A;  1Y1U A;  4OR9 B;  2KGR A;  1M31 A;  1BLQ A;  2FCE A;  1S36 A;  1WLM A;  4PCW A;  3O4Y A;  4PE0 A;  5KTY A;  2HPS A;  1J7P A;  2KBM A;  1XFW O;  3CWG A;  2K2F A;  5HKZ A;  1CLB A;  2WCE A;  1DMO A;  2O5G A;  3QRX A;  1Y1X A;  5HKY A;  1DJX A;  2Y1N A;  1CFF A;  1QLK A;  2QPT A;  3OB1 B;  4MVF A;  1KFU S;  1G33 A;  1PUL A;  1ALW A;  1EXR A;  2CT9 A;  3I5I B;  2LV7 A;  1B8R A;  3BOW A;  4CID A;  1KSO A;  2WC8 A;  3PLF B;  4GBA A;  2LNK A;  2PMY A;  1IWQ A;  4N5X A;  4DRW A;  1CMG A;  1BOD A;  2SAS A;  1B8C A;  1YX8 A;  1L7Z A;  2WCF A;  3OHM B;  2OTG B;  2AMI A;  1BR1 B;  1KK8 B;  2SCP A;  1FI5 A;  2F2P A;  3SG5 A;  2F3Y A;  3ZWH A;  4N1G A;  4NDD A;  4D1E A;  1CDL A;  1EJ3 A;  1F54 A;  3KO0 A;  1CM4 A;  3NSK A;  3WHU B;  3VGO A;  1A4P A;  1UWO A;  4GGN A;  2LHI A;  2KOT A;  1M39 A;  1N65 A;  1WY9 A;  1YTZ C;  2V53 A;  3IF7 A;  2H61 C;  3TDZ A;  1BOC A;  1ZUZ A;  4ZCV A;  2L98 A;  3D0Y A;  3ICB A;  3RM1 A;  3CR2 A;  2LLT A;  1WDC C;  3DF0 B;  4MZJ A;  2PRU A;  5DKR A;  1SKT A;  2M49 B;  1HT9 A;  1ZAC A;  1U5I A;  1NX2 A;  2LVV A;  3F45 A;  1SMG A;  3LK0 A;  4F0Z B;  2LMU A;  2JNX A;  2G9B A;  2KYC A;  3AAK A;  4NDC A;  2LLU A;  2A4J A;  2LMT A;  3EKH A;  1RFJ A;  3EK8 A;  4BY4 A;  2MA2 A;  4JPZ B;  1FF1 A;  2PSR A;  5AFP A;  1JBA A;  1YX7 A;  4WRI A;  3WNX B;  2LVJ A;  2I94 A;  1KSM A;  1MUX A;  3EKJ A;  1B7T Z;  1CNP A;  1KWO C;  3VRQ A;  5HLV A;  1KK8 C;  2BKH B;  2KSP A;  2LUC A;  1KCY A;  1S6C A;  4MEW A;  3I5G C;  1JSA A;  1TNQ A;  2JT0 A;  5I2L A;  2LUX A;  5CPV A;  2F2O A;  3CR5 X;  4M2O A;  2I7A A;  3SJS A;  1J7O A;  1KFX S;  2LC5 A;  1ALV A;  3LCP C;  5KSZ A;  2H61 A;  3OX5 A;  2M9G A;  1CFD A;  2EGD A;  1NX1 A;  1K2H A;  3GK1 A;  1YUS A;  4C0K A;  2LHL A;  1NIW A;  1QS7 A;  2BCX A;  4UPG A;  2M7N A;  2BCA A;  4WQ3 A;  1OQP A;  3EK7 A;  2Y1M A;  1RRO A;  3SG4 A;  1B1G A;  1M46 A;  1QV0 A;  2COL B;  1F71 A;  2FCD A;  3GK2 A;  1DTL A;  2KAX A;  1MXL C;  3BUM B;  2Q4U A;  1SCM C;  1MXE A;  1SL9 A;  2KAY A;  1TTX A;  4YRU A;  1KQM B;  2O60 A;  1K93 D;  2BKI B;  1Y6W A;  4CFQ A;  3HCM A;  3NSL A;  1OOJ A;  3DVJ A;  4MLW A;  4ZCU A;  1A2X A;  4CPV A;  4JQ0 D;  5I8N A;  2K7D A;  2KI4 C;  4ETO A;  5J3X A;  2NLN A;  3K21 A;  4P2Y B;  1K9K A;  2JNF A;  2CBL A;  3AKB A;  3FWC A;  1OSA A;  2JC2 A;  4C0J A;  4PHM A;  4XJK B;  2K8M B;  2PAL A;  4I5N B;  4PE7 A;  5I2Q A;  1BG1 A;  5AER A;  1H8B A;  1XFY O;  1IH0 A;  3BQ3 A;  2IS9 A;  4YI8 A;  5JJG A;  1YUU A;  1F8H A;  3OP0 A;  4L9M A;  3SIB A;  2KAV A;  2K0J A;  2WOS A;  3KEV A;  1B8L A;  5JOL A;  3GOF A;  3TS5 C;  2LP3 A;  4AQI A;  2LVK A;  2L51 A;  1GGZ A;  5PAL A;  1JFJ A;  4XJK A;  1W7J B;  4QJ5 B;  1CB1 A;  4OV2 A;  1JFK A;  1PAL A;  4TNC A;  3A4U B;  3JVT C;  4MBE A;  1PSR A;  3FWB A;  1LA0 A;  4DCK A;  1DJI A;  1SR6 C;  3FIA A;  1GGW A;  1YR5 A;  3JVT B;  4PHK A;  1JUO A;  2KI6 D;  1FI6 A;  1CFC A;  4A4C A;  5G08 A;  1SNL A;  1MWN A;  1J7Q A;  3VRN A;  4DIR A;  2LAP A;  2KGB C;  3PSR A;  2FJU B;  3NSO A;  1NP8 A;  5FYX A;  1XFU O;  1G4Y R;  2KQ6 A;  2Y5I A;  3WXA A;  1UHJ A;  1JF2 A;  1K9P A;  2JT3 A;  1W7I B;  2L50 A;  1NPQ A;  1QIV A;  1OZS A;  1WRL A;  1J1E A;  1WRZ A;  1XFX O;  2WND A;  1DJH A;  1KK7 Z;  4P5O E;  4GPL B;  4IL1 A;  1S6I A;  1XVJ A;  2B1U A;  3VRR A;  1MF8 B;  4DS7 A;  1OE9 B;  4Q04 A;  2ZFD A;  2JPT A;  2E30 A;  3IQQ A;  3EVV A;  1QV1 A;  1B9A A;  1NCX A;  2M1K B;  3PFV A;  3BUX B;  5D69 A;  1TNP A;  2M0R A;  1Y0V H;  2R2I A;  4I5K A;  1ZMZ A;  1SYM A;  1FW4 A;  3PM8 A;  3AAJ A;  1XFV O;  1N0Y A;  2JTZ A;  1H4B A;  3DVE A;  1QLS A;  2EC6 C;  2BE4 A;  4PE4 A;  2K7O A;  4AQJ A;  2BL0 B;  2NCO A;  2L2E A;  4HRG A;  4E68 A;  3E3R A;  1V1F A;  3FS7 A;  2MRD A;  4M2P A;  1B47 A;  1SCV A;  1F55 A;  1YUR A;  3CLN A;  2M7L A;  1TN4 A;  2BCB A;  4HSZ A;  1QJT A;  4GGF C;  4A4B A;  1R2U A;  1MHO A;  3KF9 A;  3BUN B;  2MHH A;  1LA3 A;  2EC6 B;  4QJ4 B;  1BF5 A;  1XA5 A;  3JTD C;  5CSI A;  1YUT A;  3LLE A;  1BJF A;  1J55 A;  2LVI A;  1TCF A;  2WOR A;  1M45 A;  4HRH A;  2PVB A;  2TN4 A;  1YVH A;  1CMF A;  3NXA A;  2ZND A;  2MAZ A;  5ER5 A;  4AOM A;  1DVI A;  1TNX A;  4GNK B;  4ORB B;  1S5G Z;  2L5X B;  2BE6 A;  1GJY A;  1IG5 A;  1LKJ A;  5BPJ A;  1WRK A;  2E6W A;  2LP2 A;  3IQO A;  1EH2 A;  2M8U A;  2JU0 A;  1CM1 A;  2HET A;  1TIZ A;  1ZOT B;  4ORA B;  2JZI A;  3CZT X;  5GQQ C;  3A8R A;  4OKH A;  1MR8 A;  1QX2 A;  2NCP A;  1JC2 A;  4XYN A;  2Q91 A;  1QVI Y;  3HX4 A;  1CDM A;  1NX3 A;  1OMD A;  5KU1 A;  3H4S E;  4PDZ A;  4GGF A;  2KHN A;  1DJZ A;  3TUY B;  2L0P A;  1S1E A;  1SRA A;  1K94 A;  2GV5 A;  1C7W A;  1TOP A;  1NCZ A;  3OB2 B;  5ER4 X;  1NCY A;  4PHN A;  5I2O A;  5CSF A;  2JQ6 A;  1QIW A;  3O2P A;  1WDC B;  2JUL A;  5TNC A;  1NSH A;  2KFH A;  3JTD B;  3TDU A;  3EVR A;  1DJY A;  3BXK A;  3TDI A;  1LVC D;  4PE1 A;  2OPO A;  5AAN A;  4ICB A;  3KPX A;  2ZRT A;  4MRX A;  3WHT B;  3DD4 A;  1IKU A;  2HQW A;  3KHE A;  5AXI A;  2JXC A;  1L2O B;  2CCM A;  4MSP A;  1DF0 A;  1KWO B;  2F3Z A;  1IRJ A;  1HQV A;  1OMR A;  2ZRS A;  3VRP A;  2ZKM X;  4YGB B;  1Y1A A;  1LIN A;  2KFF A;  1B7T Y;  2KYF A;  1EG3 A;  1UUR A;  4YBH B;  1PVA A;  1CFP A;  1XYD A;  2JWW A;  2CXJ A;  3OX6 A;  3SG7 A;  2P6B B;  1VRK A;  4N1F A;  4C0L A;  3LL8 B;  2LMV A;  2QAC A;  3I5I C;  3O78 A;  1KQV A;  2JRF A;  1YRU B;  1J1D A;  2KI4 B;  1PK0 D;  1GQM A;  1S6J A;  1B4C A;  1CKK A;  1S3P A;  4U8D A;  1M63 B;  1C7V A;  1TNW A;  2KBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...