2M1KB

Interaction of human s100a6 (c3s) with v domain of receptor for advanced glycation end products (rage)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
ASPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A6
publication title Interaction of the S100A6 mutant (C3S) with the V domain of the receptor for advanced glycation end products (RAGE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 33
structure length 89
sequence length 89
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m1kB00
2PALA 3WHTB 4HRGA 4R1EA 3PN7B 1KK8B 2CBLA 3PM8A 2LVIA 2ZN9A 3CZTX 1GGWA 1SRAA 3BUOB 1U5IB 4HSZA 3SG6A 1UHIA 1MXLC 1B4CA 1F71A 2CTNA 4GBAA 1KCYA 1C07A 3CWGA 1L2OC 5G08A 2FCDA 1NX1A 1IG5A 2LVJA 4AOMA 1CFFA 1AJ5A 2CNPA 1FW4A 5HKZA 2V53A 4A4CA 1Y1UA 2KI6C 1DJYA 2QPTA 5I2QA 3TUYC 2Q4UA 5KU1A 2L51A 1MHOA 5DKRA 1PVBA 2VRGA 1BF5A 1SYMA 4P5OE 5KSZA 1GGZA 2KNEA 3OHMB 1S26D 2LCPA 1XFWO 1A29A 2EHBA 3QRXA 5CSNA 5KTYA 1OE9B 2HQ8A 1MWNA 1N65A 1SKTA 3F45A 1V1FA 3CR5X 2JWWA 4GFTA 1FI5A 3EVUA 3HX4A 3RLZA 5CSFA 1WY9A 4GGFC 1NX2A 1SR6C 3I5FB 4GGNA 1JFKA 5AFPA 3AAKA 5J3XA 5AEQA 1XO5A 1DMOA 1KFUL 3WHUB 1ALWA 1H8BA 5FYXA 3SG7A 1QX7A 3IF7A 2JULA 1G8IA 1AUIB 3FWCA 1DGVA 2EC6B 2WCBA 1H4BA 1A75A 5D69A 3I5IB 2BCBA 1PRWA 2KBMA 1IQ3A 5K89A 1DJZA 2Y1MA 1SW8A 1RFJA 3EK4A 3OP0A 4ZCVA 1A03A 2JTTA 3NXAA 3PFVA 2GV5A 1PULA 3VRRA 1WDCC 2LE9B 2WNDA 4M2PA 1MUXA 2OS8C 4GPLB 3DVMA 3NSKA 4OV2A 2NLNA 2BCAA 1KSOA 2LHIA 2NCPA 3NSIA 1OZOA 2WC8A 1LXFC 1OMDA 4MRYA 2F2PA 1L7ZA 2I94A 2QACA 3LLEA 2DOQA 3TDZA 3KEVA 1AHRA 1B7TY 2LANA 3HCMA 3DF0B 2CCMA 3SG3A 5IBWA 1B8RA 1KK7Y 1SCVA 2KI4B 1FI6A 3C1VA 1JC2A 1KSMA 2Y4QA 2F3YA 2Q91A 3PLFB 2LMVA 3D10A 3KF9A 1EH2A 1F8HA 2KFHA 1TN4A 2MRDA 1WRLA 4GAOA 2JXCA 1TIZA 2BBMA 3WXAA 1TCOB 1J7OA 1M39A 2PVBA 2SASA 2FCEA 1KFXL 1OOJA 2IS9A 3VROA 5F6TA 2L4IA 2WCFA 3JVTB 5PALA 1XK4A 2K0JA 1CNPA 2G2BA 1K8UA 3CR2A 1KQVA 3OX5A 4NDBA 1B9AA 2JQ6A 1UHNA 4BY4A 3NSOA 3VGOA 2A4JA 4PE0A 2JT0A 2JOJA 5AERA 1M46A 1SL9A 1KWOC 2F8PA 4ZCUA 4WQ2A 2KGRA 1F4OA 4GNKB 4YRUA 5DKQA 1TRFA 1NIWA 3EK8A 1EG4A 1YTZC 1N2DA 1NSHA 2LAPA 2H61A 5JJGA 1B47A 2ZKMX 1CM1A 1E8AA 3H4SE 3FWBA 1KQMB 3I5IC 4JQ0D 4PE1A 3SG4A 3BOWB 4BY5A 1C7WA 1TNXA 1A4PA 1SPYA 2WORA 1BMOA 1EG3A 3CTNA 2KFFA 1R6PA 4I5LB 1OSAA 2M7NA 1F70A 2JT3A 1QASA 4AQIA 1B1GA 1AP4A 3EKHA 1SCMB 1BODA 3DVEA 4ETOA 3SIBA 1OQPA 1HQVA 1YRTB 4PHKA 2WCEA 1DJIA 3GOFA 3BUXB 1Y6WA 1S5GZ 1GJYA 1BOCA 1DGUA 1XFYO 3CR4X 2KI4C 1UUSA 1XK4C 1YX7A 3NSLA 1PK0D 1JFJA 1QVIZ 1SL8A 4YGBB 1C7VA 3AAJA 1WLMA 2GGZA 3FS7A 3TS5C 2OPOA 1B8LA 1TNQA 2KHNA 4XJKB 4HREE 2E30A 3JTDB 2KOTA 1UP5A 2CXJA 3GK4X 1AK8A 2M29A 1AVSA 2M9GA 1K96A 1U5IA 2GGMA 1TTXA 2H2KA 2LV7A 3IQQA 4CFQA 2G9BA 2H61C 2L5XB 5HKYA 1YUUA 1YUSA 1RJVA 4IL1A 4C0LA 1QS7A 4MZJA 5I2OA 4CPVA 4XYNA 4QJ4B 3EKJA 1S1EA 3ZWHA 4DS7A 2LLUA 2JTZA 3TDIA 3BXKA 2KBIA 1EXRA 1TNWA 3I5GC 4CFRA 1OZSA 2LP2A 1CM4A 3LK0A 1Y1XA 1QV1A 1CFDA 1K9KA 2NCOA 1CFCA 1CDLA 4DRWA 1NCXA 2F33A 4MSPA 1D1OA 1SBJA 1KQMC 1NUBA 1XYDA 1CB1A 1G33A 5TNCA 4JPZB 4TNCA 1J55A 2BL0B 2K61A 3BYAA 1Y1AA 2I18A 3LL8B 2M3WA 1IQ5A 2MLFC 2OTGB 4I5KA 2HPSA 4YGEB 2ZNDA 2M1KB 1QLKA 1RK9A 2CT9A 3DVJA 4FQOA 1DJGA 2KSPA 1XA5A 2BKIB 2O5GA 2KQ6A 4YGDB 3PN7C 4MN0A 1KK8C 4PCWA 4PE7A 2K2AA 2KGBC 2NXQA 3I5HB 3PALA 4M2OA 1DF0B 1QATA 1DJHA 2LUCA 3DVKA 1MXEA 5CSJA 1CDMA 1Q80A 2NZ0A 1IRJA 3CS1A 2K8MB 1BR1B 2JNFA 1WRZA 1FF1A 2ZN8A 1FPWA 1F55A 1YX8A 3VRNA 1JBAA 2K7OA 2KAXA 2RGIA 1CKKA 1L2OB 2LVVA 4MZKA 2L2EA 1HT9A 3DF0A 4USLA 1CLLA 1IGVA 1S36A 1RWYA 4L9MA 3EVVA 1J7PA 3LK1A 5ER5A 1TOPA 5HYDA 3I5FC 3BUNB 2D8NA 4WRIA 1YRUB 2LC5A 2R2IA 3VRQA 1K93D 3EVRA 3TZ1A 1QXPA 1XFVO 1YVLA 2JZIA 3VRPA 1UWOA 1ODBA 2AMIA 1JF0A 4PHMA 1FBVA 3SG2A 5I8NA 1XFUO 2I7AA 1K9PA 1LVCD 2EC6C 1KFUS 1CLMA 4PHJA 1SR6B 2EGDA 1KK7Z 1XFZO 2Y1NA 2LP3A 3D0YB 5GQQC 1S5GY 2P6BB 1TNPA 1IJ6A 4MBEA 2KAYA 2BCXA 1DT7B 4GUKA 1RTP1 2K2FA 2JC2A 4N1GA 4QJ3B 1DVIA 1ALVA 1JWDA 1NCYA 2L98A 1BG1A 1VRKA 2FOTA 4C0KA 1QTXA 3BUWB 1K9UA 4M2QA 2E6WA 4YGAA 1K94A 1YURA 4N1FA 1GQMA 1M63B 2HQWA 3BOWA 1QIVA 1NP8A 1W7JB 3PSRA 3A8RA 1S3PA 4I5NB 2MHHA 4P2YB 1WDCB 3LCPC 2Y5IA 1JF2A 2M0RA 1M45A 1NX3A 2OS8B 4MZLA 4OVNF 3AKAA 4YBHB 1BU3A 3OB2B 1WRKA 2F3ZA 1SMGA 3GK2A 1QX5B 3SIAA 4F0ZB 1DJXA 1SY9A 1Y0VH 2ZRTA 2LNKA 1BT6A 3K21A 1CLBA 1NWDA 4MEWA 3JVTC 1M31A 1S6IA 1JSAA 3CGAA 4U8DA 5CPVA 1RECA 4NDCA 3ICBA 2JNXA 3IQOA 1EJ3A 1ZFSA 1CTRA 1KFXS 4OCIA 2LMUA 1EL4A 4XJKA 1QX2A 4I5JA 3O4YA 1YUTA 1AJ4A 4C0JA 3KPXA 1RROA 1B8CA 3KO0A 1PSBA 5B8IB 4YGCB 1YR5A 3M0WA 1LA3A 4CIDA 1A75B 1MQ1A 2AAOA 1LA0A 4AQJA 2AUCA 2PMYA 4ICBA 1LKJA 2LLTA 4PHNA 1PALA 2PASA 3FIAA 2K7DA 1BLQA 1IWQA 1TCFA 2BECA 3KHEA 5I2LA 2KDHA 3WNXB 4DUQA 1XVJA 3OB1B 2B1UA 1CFPA 2MA2A 1CDPA 1J1EA 1N0YA 1R2UA 1QJTA 1KWOB 1OMVA 2ZRSA 4CLNA 4E68A 1SL7A 2MJWB 1CDNA 2LLSA 1CMFA 1MF8B 1IH0A 2M8UA 3PATA 4YI8A 2MAZA 2WOSA 1SCMC 5CSIA 5AANA 2BE4A 5JOLA 4MRXA 2JT8A 1J1DA 1NCZA 2KYCA 4JWQA 3SG5A 2ZFDA 2K7BA 3BUMB 1XFXO 2LM5A 2M49B 1UHKA 5ER4X 1NPQA 1UHHA 3ZNIA 1NX0A 1K2HA 4PALA 2SCPA 1OMRA 2LHLA 4A4BA 3JTDC 4D1EA 4WQ3A 1DJWA 5HLOA 4OKHA 2JU0A 3O2PA 1IKUA 1K90D 2COLB 4ORBB 2F2OA 5D7FA 4DIRA 1J7RA 1PSRA 1DF0A 3TUYB 2L0PA 2M97A 1SK6D 2KFGA 1QLSA 2LUXA 2KI6D 2BE6A 3CLNA 1PVAA 3TS5B 1V1GA 2JPTA 4MVFA 2TN4A 5AXIA 2M7LA 1DTLA 1J7QA 4HRHA 4NDDA 1NYAA 2PRUA 2LVKA 5DKNA 4QJ5B 2ZNEA 2BBNA 1F4QA 2HETA 3O78A 5HLVA 1BR4B 4N5XA 3EK7A 3AKBA 1B7TZ 1QIWA 1JUOA 1QV0A 2BKHB 3GK1A 5BPJA 2ISDA 4UPGA 2LMTA 2M1UA 1S6CA 3SJSA 1CMGA 5HKWA 2K7CA 1ZMZA 1QVIY 2KYFA 4PDZA 2I2RE 2BL0C 1UURA 1G4YR 3I5GB 4Q04A 1LINA 1UHJA 2HF5A 2KQYA 2OTGC 1K95A 3O6BA 4OR9B 4YI9A 1F54A 2MBXA 3OX6A 4NQGA 1ZUZA 1MR8A 3MSEB 3TDUA 1SNLA 1ZOTB 2L4HA 4GGFA 2JRFA 2JXLA 2KAVA 1ZACA 2L50A 1YVHA 1BJFA 2MLEC 3E3RA 4ORCB 2PSRA 3D0YA 2O60A 1A2XA 3I5HC 4FTGA 4MLWA 4ORAB 4DCKA 3RM1A 2FJUB 3DD4A 1X02A 3BQ3A 3A4UB 1IJ5A 1W7IB 1S6JA 1WLZA 4PE4A
chains in the Genus database with same CATH superfamily
2PALA 3WHTB 4HRGA 3CZ0A 4R1EA 3PN7B 1KK8B 2CBLA 3PM8A 2LVIA 2ZN9A 3CZTX 1GGWA 1SRAA 3BUOB 1U5IB 2WCMA 3S0BA 4HSZA 3SG6A 1TUZA 1UHIA 1MXLC 1B4CA 1F71A 2CTNA 4GBAA 1GM0A 1KCYA 1C07A 3CWGA 1L2OC 5G08A 2FCDA 1NX1A 1IG5A 2LVJA 4AOMA 1CFFA 1AJ5A 1FW4A 2CNPA 5HKZA 2V53A 5D3OA 4A4CA 1Y1UA 2KI6C 1DJYA 2QPTA 5I2QA 3TUYC 2Q4UA 5KU1A 2L51A 1MHOA 3B7AA 1PVBA 2KLDA 2VRGA 5DKRA 1SYMA 4P5OE 4JKTA 5KSZA 1GGZA 2PYQA 2KNEA 3OHMB 1S26D 2LCPA 1XFWO 1A29A 2EHBA 3QRXA 5CSNA 5KTYA 1OE9B 2HQ8A 1MWNA 1N65A 1SKTA 3F45A 1V1FA 3CR5X 2JWWA 3Q8IA 4GFTA 1FI5A 3EVUA 3HX4A 3RLZA 3CDNA 5CSFA 2WCLA 1WY9A 4GGFC 1NX2A 1SR6C 3I5FB 4GGNA 1JFKA 5DICA 5AFPA 3AAKA 2QEOA 5J3XA 5AEQA 1XO5A 1DMOA 1KFUL 3WHUB 2YGUA 2JPOA 1ALWA 1H8BA 2H8VA 5FYXA 1QX7A 3IF7A 3SG7A 3K1EA 2JULA 1G8IA 3SS3A 1AUIB 3FWCA 1DGVA 2EC6B 2WCBA 1H4BA 1A75A 5D69A 3I5IB 2BCBA 1PRWA 1P28A 3PJIA 2KBMA 1IQ3A 1C3YA 5K89A 1DJZA 2Y1MA 1SW8A 3DYEA 1RFJA 3EK4A 3DY9A 3OP0A 4ZCVA 1A03A 2WCJA 1C3ZA 2JTTA 3NXAA 2FJYA 3PFVA 2GV5A 1PULA 3VRRA 1WDCC 2LE9B 2WNDA 4M2PA 1MUXA 2WCHA 3B6XA 2OS8C 4GPLB 3DVMA 3NSKA 4OV2A 2NLNA 2BCAA 1KSOA 2LHIA 2NCPA 3NSIA 1OZOA 2WC8A 1LXFC 1OMDA 4INXA 4MRYA 2F2PA 1L7ZA 3FE6A 2I94A 2QACA 3LLEA 2DOQA 4JD9A 3TDZA 1OOIX 1AHRA 1B7TY 2LANA 3HCMA 3KEVA 3DF0B 2CCMA 3BFBA 3SG3A 5IBWA 1B8RA 1KK7Y 1SCVA 2KI4B 3D73A 1FI6A 3C1VA 1JC2A 1KSMA 2Y4QA 2F3YA 2Q91A 3PLFB 2LMVA 3D10A 2BAPA 3KF9A 1EH2A 1OOGA 2KFHA 1TN4A 2MRDA 1WRLA 3L4AA 2JXCA 4GAOA 1F8HA 1TIZA 3D75A 3BFHA 2BBMA 3WXAA 3EG5B 1TCOB 2WC6A 1J7OA 1M39A 2PVBA 2SASA 2FCEA 1KFXL 1OOJA 2IS9A 3VROA 5F6TA 2L4IA 2WCFA 3JVTB 3NHIA 5PALA 3S0EA 1XK4A 2K0JA 1CNPA 2L5YA 2G2BA 1K8UA 3CR2A 1KQVA 3OX5A 4NDBA 1B9AA 2JQ6A 1UHNA 4BY4A 3NSOA 3VGOA 2L2CA 2A4JA 4PE0A 3S0DA 2WCKA 2JT0A 2JOJA 5AERA 1M46A 1SL9A 1KWOC 2F8PA 4ZCUA 4WQ2A 2KGRA 1F4OA 4GNKB 4YRUA 5DKQA 1TRFA 1OOHA 1NIWA 3EK8A 1EG4A 1YTZC 1N2DA 1NSHA 2LAPA 2H61A 5JJGA 1B47A 2ZKMX 1CM1A 1E8AA 3H4SE 3FWBA 1KQMB 3I5IC 4JQ0D 4PE1A 3SG4A 3BOWB 4BY5A 1C7WA 1TNXA 1A4PA 1SPYA 2WORA 1BMOA 1EG3A 3CTNA 2KFFA 1R6PA 4I5LB 1OSAA 2M7NA 1F70A 2JT3A 3UO9A 1QASA 4AQIA 1B1GA 1AP4A 3EKHA 1SCMB 1BODA 3DVEA 3L47A 4ETOA 3SIBA 3O4XA 1OQPA 1HQVA 1YRTB 4PHKA 2WCEA 1DJIA 3GOFA 3BUXB 1Y6WA 1S5GZ 1GJYA 1BOCA 1DGUA 1XFYO 5HL1A 3CR4X 2KI4C 1UUSA 1XK4C 1YX7A 2PQLA 1PK0D 3NSLA 1QVIZ 1SL8A 1JFJA 4YGBB 1C7VA 3AAJA 1WLMA 2GGZA 3FS7A 3TS5C 2OPOA 1B8LA 1TNQA 2KHNA 4XJKB 4HREE 2E30A 3JTDB 2KOTA 1UP5A 1XFRA 2CXJA 3GK4X 1AK8A 2M29A 1AVSA 2M9GA 1K96A 1U5IA 2GGMA 1TTXA 2H2KA 2LV7A 3IQQA 4IJ7A 4CFQA 2G9BA 2P71A 2H61C 2L5XB 5HKYA 1YUUA 1YUSA 1RJVA 4IL1A 4C0LA 1QS7A 4MZJA 5I2OA 4CPVA 4FQTA 4XYNA 4QJ4B 3EKJA 1S1EA 3ZWHA 4DS7A 2LLUA 2JTZA 3CZ1A 3TDIA 3BXKA 2KBIA 1EXRA 1TNWA 3B87A 3I5GC 4CFRA 1OZSA 2LP2A 1LS8A 3UNWA 1CM4A 3LK0A 1Y1XA 1QV1A 1CFDA 1K9KA 2NCOA 2KPHA 1CFCA 1CDLA 4DRWA 1NCXA 2F33A 4MSPA 1D1OA 1SBJA 1KQMC 1NUBA 1XYDA 1CB1A 1G33A 5TNCA 4JPZB 4TNCA 1J55A 1W9ZA 2BL0B 2K61A 3BYAA 1Y1AA 2I18A 3LL8B 3IVTA 2M3WA 1IQ5A 2MLFC 2OTGB 4I5KA 2HPSA 4YGEB 2ZNDA 2M1KB 1QLKA 1RK9A 2CT9A 2BNXA 3DVJA 4FQOA 1DJGA 2KSPA 1XA5A 2BKIB 3DZTA 2O5GA 2KQ6A 4YGDB 3PN7C 3R72A 1KK8C 4MN0A 4PE7A 2K2AA 2KGBC 2NXQA 4PCWA 3S0AA 3I5HB 3CABA 3R1PA 3PALA 4M2OA 3FE8A 1DF0B 1Z2CB 1OW4A 1QATA 1DJHA 2LUCA 3DVKA 1MXEA 5CSJA 1CDMA 3R1OA 5EL2A 1Q80A 2NZ0A 1BF5A 1IRJA 3CS1A 2K8MB 1BR1B 2JNFA 1WRZA 2QEVA 2ZN8A 1FF1A 1FPWA 1F55A 1YX8A 3VRNA 2K60A 1JBAA 2K7OA 2KAXA 2RGIA 2WC5A 1L2OB 2LVVA 4MZKA 2L2EA 1HT9A 3DF0A 4USLA 1CKKA 1CLLA 1IGVA 1S36A 1RWYA 4L9MA 3EVVA 1J7PA 3LK1A 5ER5A 1TOPA 5HYDA 3I5FC 3BUNB 2D8NA 4WRIA 1YRUB 2LC5A 2R2IA 3V2LA 1K93D 3EVRA 3TZ1A 3VRQA 1QXPA 4KYNA 1XFVO 1YVLA 2JZIA 3VRPA 1UWOA 1ODBA 2AMIA 1JF0A 4PHMA 1FBVA 1TUJA 3SG2A 5I8NA 1XFUO 2I7AA 1ORGA 1K9PA 1LVCD 2EC6C 1KFUS 1CLMA 4PHJA 1SR6B 2EGDA 1KK7Z 2QEHA 1XFZO 2Y1NA 2LP3A 3D0YB 5GQQC 1S5GY 2P6BB 1TNPA 1IJ6A 4MBEA 2KAYA 2BCXA 1DT7B 1TWOA 4GUKA 3D78A 1RTP1 2K2FA 2JC2A 4N1GA 4QJ3B 1DVIA 1ALVA 1JWDA 1NCYA 2L98A 1BG1A 1VRKA 2FOTA 3BFAA 1QTXA 3CZ2A 4C0KA 3BUWB 1K9UA 4M2QA 2E6WA 4YGAA 1K94A 1YURA 4N1FA 3RZSA 1GQMA 1M63B 3NHTA 2HQWA 1DELA 3BOWA 1QIVA 1NP8A 1W7JB 3PSRA 3A8RA 3B86A 4OZDA 1S3PA 4I5NB 2MHHA 4P2YB 1WDCB 3LCPC 2Y5IA 1JF2A 2M0RA 1M45A 1NX3A 2OS8B 4MZLA 3D76A 4OVNF 3AKAA 4YBHB 1BU3A 3OB2B 1WRKA 2F3ZA 1SMGA 3GK2A 1QX5B 3SIAA 3R1VA 3N7HA 4F0ZB 1DJXA 1SY9A 1Y0VH 2ZRTA 2LNKA 1BT6A 3K21A 1CLBA 1NWDA 4MEWA 3JVTC 1M31A 1S6IA 2GTEA 1JSAA 3CGAA 4U8DA 5CPVA 1RECA 4F7FA 4NDCA 2ERBA 3ICBA 2KLEA 2JNXA 3IQOA 1EJ3A 1ZFSA 1CTRA 1KFXS 3D77A 4OCIA 2LMUA 4PT1A 1EL4A 4XJKA 1QX2A 4I5JA 3O4YA 1YUTA 1AJ4A 4C0JA 3KPXA 1RROA 1B8CA 3KO0A 1PSBA 5B8IB 4YGCB 1YR5A 3M0WA 1LA3A 4CIDA 1A75B 1MQ1A 2AAOA 1LA0A 4AQJA 2AUCA 2PMYA 4ICBA 1LKJA 2LLTA 4PHNA 1PALA 2PASA 3FIAA 2K7DA 1BLQA 1IWQA 3B88A 1TCFA 2BECA 3KHEA 3DXLA 5FI2A 3NGVA 5I2LA 2KDHA 3WNXB 4DUQA 1XVJA 3OB1B 2B1UA 1CFPA 2MA2A 1CDPA 1J1EA 1N0YA 1R2UA 1QJTA 1KWOB 1OMVA 2ZRSA 4CLNA 4E68A 1SL7A 3SS5A 2MJWB 3PM2A 1CDNA 2LLSA 1CMFA 1MF8B 1IH0A 2M8UA 3PATA 4YI8A 1SSEB 2MAZA 2WOSA 1SCMC 5CSIA 5AANA 2BE4A 5JOLA 3D74A 3L4LA 4MRXA 2JT8A 1J1DA 1NCZA 2KYCA 4JWQA 3SG5A 2ZFDA 3OBVA 3VB1A 2K7BA 3BUMB 1XFXO 2LM5A 2M49B 1UHKA 5ER4X 1NPQA 1OOFA 1UHHA 3ZNIA 1NX0A 1K2HA 4PALA 2SCPA 1OMRA 2LHLA 1QWVA 4A4BA 3JTDC 4D1EA 4WQ3A 1DQEA 1DJWA 3CYZA 4OKHA 5HLOA 2JU0A 3O2PA 3BJHA 1IKUA 1K90D 2COLB 4ORBB 2F2OA 5D7FA 4DIRA 1J7RA 1PSRA 1DF0A 3TUYB 2L0PA 2M97A 2QEBA 1SK6D 2KFGA 1QLSA 2LUXA 2KI6D 2BE6A 2QDIA 1PVAA 3CLNA 3TS5B 1V1GA 2JPTA 4MVFA 2TN4A 5AXIA 2M7LA 1DTLA 4INWA 1J7QA 4HRHA 4NDDA 1NYAA 2PRUA 2LVKA 5DKNA 4QJ5B 2ZNEA 2BBNA 1F4QA 2HETA 3O78A 1DC1A 5HLVA 1BR4B 4N5XA 3EK7A 3AKBA 1B7TZ 1QIWA 1JUOA 1QV0A 2BKHB 3GK1A 5I94A 5BPJA 2ISDA 4UPGA 2LMTA 2M1UA 1S6CA 3SJSA 1CMGA 1DEKA 5HKWA 2K7CA 1ZMZA 5FI7A 1QVIY 2KYFA 1Z4HA 4PDZA 2I2RE 2BL0C 1UURA 1G4YR 3I5GB 4Q04A 1LINA 1UHJA 2HF5A 2KQYA 2OTGC 1K95A 3O6BA 4OR9B 4YI9A 3S0GA 1F54A 2MBXA 3OX6A 3S0FA 3FE9A 4NQGA 5FI6A 1ZUZA 1MR8A 3MSEB 3QMEA 3TDUA 1SNLA 1IIOA 1ZOTB 2L4HA 4GGFA 2JRFA 2JXLA 2KAVA 1ZACA 2L50A 1YVHA 1BJFA 2MLEC 3E3RA 4ORCB 2PSRA 3D0YA 2O60A 1A2XA 2P70A 3I5HC 4FTGA 3OGNA 4MLWA 4ORAB 4DCKA 3RM1A 2FJUB 3DD4A 1X02A 1T14A 3BQ3A 3SS4A 3A4UB 1IJ5A 1W7IB 1S6JA 1WLZA 4PE4A
chains in the Genus database with same CATH topology
2PALA 3WHTB 4HRGA 4R1EA 3PN7B 1KK8B 2CBLA 3PM8A 2LVIA 2ZN9A 3CZTX 1GGWA 1SRAA 3BUOB 1U5IB 4HSZA 3SG6A 1UHIA 1MXLC 1B4CA 1F71A 2CTNA 4GBAA 1KCYA 1C07A 3CWGA 1L2OC 5G08A 2FCDA 1NX1A 1IG5A 2LVJA 4AOMA 1CFFA 1AJ5A 2CNPA 1FW4A 5HKZA 2V53A 4A4CA 1Y1UA 2KI6C 1DJYA 2QPTA 5I2QA 3TUYC 2Q4UA 5KU1A 2L51A 1MHOA 5DKRA 1PVBA 2VRGA 1BF5A 1SYMA 4P5OE 5KSZA 1GGZA 2KNEA 3OHMB 1S26D 2LCPA 1XFWO 1A29A 2EHBA 3QRXA 5CSNA 5KTYA 1OE9B 2HQ8A 1MWNA 1N65A 1SKTA 3F45A 1V1FA 3CR5X 2JWWA 4GFTA 1FI5A 3EVUA 3HX4A 3RLZA 5CSFA 1WY9A 4GGFC 1NX2A 1SR6C 3I5FB 4GGNA 1JFKA 5AFPA 3AAKA 5J3XA 5AEQA 1XO5A 1DMOA 1KFUL 3WHUB 1ALWA 1H8BA 5FYXA 3SG7A 1QX7A 3IF7A 2JULA 1G8IA 1AUIB 3FWCA 1DGVA 2EC6B 2WCBA 1H4BA 1A75A 5D69A 3I5IB 2BCBA 1PRWA 2KBMA 1IQ3A 5K89A 1DJZA 2Y1MA 1SW8A 1RFJA 3EK4A 3OP0A 4ZCVA 1A03A 2JTTA 3NXAA 3PFVA 2GV5A 1PULA 3VRRA 1WDCC 2LE9B 2WNDA 4M2PA 1MUXA 2OS8C 4GPLB 3DVMA 3NSKA 4OV2A 2NLNA 2BCAA 1KSOA 2LHIA 2NCPA 3NSIA 1OZOA 2WC8A 1LXFC 1OMDA 4MRYA 2F2PA 1L7ZA 2I94A 2QACA 3LLEA 2DOQA 3TDZA 3KEVA 1AHRA 1B7TY 2LANA 3HCMA 3DF0B 2CCMA 3SG3A 5IBWA 1B8RA 1KK7Y 1SCVA 2KI4B 1FI6A 3C1VA 1JC2A 1KSMA 2Y4QA 2F3YA 2Q91A 3PLFB 2LMVA 3D10A 3KF9A 1EH2A 1F8HA 2KFHA 1TN4A 2MRDA 1WRLA 4GAOA 2JXCA 1TIZA 2BBMA 3WXAA 1TCOB 1J7OA 1M39A 2PVBA 2SASA 2FCEA 1KFXL 1OOJA 2IS9A 3VROA 5F6TA 2L4IA 2WCFA 3JVTB 5PALA 1XK4A 2K0JA 1CNPA 2G2BA 1K8UA 3CR2A 1KQVA 3OX5A 4NDBA 1B9AA 2JQ6A 1UHNA 4BY4A 3NSOA 3VGOA 2A4JA 4PE0A 2JT0A 2JOJA 5AERA 1M46A 1SL9A 1KWOC 2F8PA 4ZCUA 4WQ2A 2KGRA 1F4OA 4GNKB 4YRUA 5DKQA 1TRFA 1NIWA 3EK8A 1EG4A 1YTZC 1N2DA 1NSHA 2LAPA 2H61A 5JJGA 1B47A 2ZKMX 1CM1A 1E8AA 3H4SE 3FWBA 1KQMB 3I5IC 4JQ0D 4PE1A 3SG4A 3BOWB 4BY5A 1C7WA 1TNXA 1A4PA 1SPYA 2WORA 1BMOA 1EG3A 3CTNA 2KFFA 1R6PA 4I5LB 1OSAA 2M7NA 1F70A 2JT3A 1QASA 4AQIA 1B1GA 1AP4A 3EKHA 1SCMB 1BODA 3DVEA 4ETOA 3SIBA 1OQPA 1HQVA 1YRTB 4PHKA 2WCEA 1DJIA 3GOFA 3BUXB 1Y6WA 1S5GZ 1GJYA 1BOCA 1DGUA 1XFYO 3CR4X 2KI4C 1UUSA 1XK4C 1YX7A 3NSLA 1PK0D 1JFJA 1QVIZ 1SL8A 4YGBB 1C7VA 3AAJA 1WLMA 2GGZA 3FS7A 3TS5C 2OPOA 1B8LA 1TNQA 2KHNA 4XJKB 4HREE 2E30A 3JTDB 2KOTA 1UP5A 2CXJA 3GK4X 1AK8A 2M29A 1AVSA 2M9GA 1K96A 1U5IA 2GGMA 1TTXA 2H2KA 2LV7A 3IQQA 4CFQA 2G9BA 2H61C 2L5XB 5HKYA 1YUUA 1YUSA 1RJVA 4IL1A 4C0LA 1QS7A 4MZJA 5I2OA 4CPVA 4XYNA 4QJ4B 3EKJA 1S1EA 3ZWHA 4DS7A 2LLUA 2JTZA 3TDIA 3BXKA 2KBIA 1EXRA 1TNWA 3I5GC 4CFRA 1OZSA 2LP2A 1CM4A 3LK0A 1Y1XA 1QV1A 1CFDA 1K9KA 2NCOA 1CFCA 1CDLA 4DRWA 1NCXA 2F33A 4MSPA 1D1OA 1SBJA 1KQMC 1NUBA 1XYDA 1CB1A 1G33A 5TNCA 4JPZB 4TNCA 1J55A 2BL0B 2K61A 3BYAA 1Y1AA 2I18A 3LL8B 2M3WA 1IQ5A 2MLFC 2OTGB 4I5KA 2HPSA 4YGEB 2ZNDA 2M1KB 1QLKA 1RK9A 2CT9A 3DVJA 4FQOA 1DJGA 2KSPA 1XA5A 2BKIB 2O5GA 2KQ6A 4YGDB 3PN7C 4MN0A 1KK8C 4PCWA 4PE7A 2K2AA 2KGBC 2NXQA 3I5HB 3PALA 4M2OA 1DF0B 1QATA 1DJHA 2LUCA 3DVKA 1MXEA 5CSJA 1CDMA 1Q80A 2NZ0A 1IRJA 3CS1A 2K8MB 1BR1B 2JNFA 1WRZA 1FF1A 2ZN8A 1FPWA 1F55A 1YX8A 3VRNA 1JBAA 2K7OA 2KAXA 2RGIA 1CKKA 1L2OB 2LVVA 4MZKA 2L2EA 1HT9A 3DF0A 4USLA 1CLLA 1IGVA 1S36A 1RWYA 4L9MA 3EVVA 1J7PA 3LK1A 5ER5A 1TOPA 5HYDA 3I5FC 3BUNB 2D8NA 4WRIA 1YRUB 2LC5A 2R2IA 3VRQA 1K93D 3EVRA 3TZ1A 1QXPA 1XFVO 1YVLA 2JZIA 3VRPA 1UWOA 1ODBA 2AMIA 1JF0A 4PHMA 1FBVA 3SG2A 5I8NA 1XFUO 2I7AA 1K9PA 1LVCD 2EC6C 1KFUS 1CLMA 4PHJA 1SR6B 2EGDA 1KK7Z 1XFZO 2Y1NA 2LP3A 3D0YB 5GQQC 1S5GY 2P6BB 1TNPA 1IJ6A 4MBEA 2KAYA 2BCXA 1DT7B 4GUKA 1RTP1 2K2FA 2JC2A 4N1GA 4QJ3B 1DVIA 1ALVA 1JWDA 1NCYA 2L98A 1BG1A 1VRKA 2FOTA 4C0KA 1QTXA 3BUWB 1K9UA 4M2QA 2E6WA 4YGAA 1K94A 1YURA 4N1FA 1GQMA 1M63B 2HQWA 3BOWA 1QIVA 1NP8A 1W7JB 3PSRA 3A8RA 1S3PA 4I5NB 2MHHA 4P2YB 1WDCB 3LCPC 2Y5IA 1JF2A 2M0RA 1M45A 1NX3A 2OS8B 4MZLA 4OVNF 3AKAA 4YBHB 1BU3A 3OB2B 1WRKA 2F3ZA 1SMGA 3GK2A 1QX5B 3SIAA 4F0ZB 1DJXA 1SY9A 1Y0VH 2ZRTA 2LNKA 1BT6A 3K21A 1CLBA 1NWDA 4MEWA 3JVTC 1M31A 1S6IA 1JSAA 3CGAA 4U8DA 5CPVA 1RECA 4NDCA 3ICBA 2JNXA 3IQOA 1EJ3A 1ZFSA 1CTRA 1KFXS 4OCIA 2LMUA 1EL4A 4XJKA 1QX2A 4I5JA 3O4YA 1YUTA 1AJ4A 4C0JA 3KPXA 1RROA 1B8CA 3KO0A 1PSBA 5B8IB 4YGCB 1YR5A 3M0WA 1LA3A 4CIDA 1A75B 1MQ1A 2AAOA 1LA0A 4AQJA 2AUCA 2PMYA 4ICBA 1LKJA 2LLTA 4PHNA 1PALA 2PASA 3FIAA 2K7DA 1BLQA 1IWQA 1TCFA 2BECA 3KHEA 5I2LA 2KDHA 3WNXB 4DUQA 1XVJA 3OB1B 2B1UA 1CFPA 2MA2A 1CDPA 1J1EA 1N0YA 1R2UA 1QJTA 1KWOB 1OMVA 2ZRSA 4CLNA 4E68A 1SL7A 2MJWB 1CDNA 2LLSA 1CMFA 1MF8B 1IH0A 2M8UA 3PATA 4YI8A 2MAZA 2WOSA 1SCMC 5CSIA 5AANA 2BE4A 5JOLA 4MRXA 2JT8A 1J1DA 1NCZA 2KYCA 4JWQA 3SG5A 2ZFDA 2K7BA 3BUMB 1XFXO 2LM5A 2M49B 1UHKA 5ER4X 1NPQA 1UHHA 3ZNIA 1NX0A 1K2HA 4PALA 2SCPA 1OMRA 2LHLA 4A4BA 3JTDC 4D1EA 4WQ3A 1DJWA 5HLOA 4OKHA 2JU0A 3O2PA 1IKUA 1K90D 2COLB 4ORBB 2F2OA 5D7FA 4DIRA 1J7RA 1PSRA 1DF0A 3TUYB 2L0PA 2M97A 1SK6D 2KFGA 1QLSA 2LUXA 2KI6D 2BE6A 3CLNA 1PVAA 3TS5B 1V1GA 2JPTA 4MVFA 2TN4A 5AXIA 2M7LA 1DTLA 1J7QA 4HRHA 4NDDA 1NYAA 2PRUA 2LVKA 5DKNA 4QJ5B 2ZNEA 2BBNA 1F4QA 2HETA 3O78A 5HLVA 1BR4B 4N5XA 3EK7A 3AKBA 1B7TZ 1QIWA 1JUOA 1QV0A 2BKHB 3GK1A 5BPJA 2ISDA 4UPGA 2LMTA 2M1UA 1S6CA 3SJSA 1CMGA 5HKWA 2K7CA 1ZMZA 1QVIY 2KYFA 4PDZA 2I2RE 2BL0C 1UURA 1G4YR 3I5GB 4Q04A 1LINA 1UHJA 2HF5A 2KQYA 2OTGC 1K95A 3O6BA 4OR9B 4YI9A 1F54A 2MBXA 3OX6A 4NQGA 1ZUZA 1MR8A 3MSEB 3TDUA 1SNLA 1ZOTB 2L4HA 4GGFA 2JRFA 2JXLA 2KAVA 1ZACA 2L50A 1YVHA 1BJFA 2MLEC 3E3RA 4ORCB 2PSRA 3D0YA 2O60A 1A2XA 3I5HC 4FTGA 4MLWA 4ORAB 4DCKA 3RM1A 2FJUB 3DD4A 1X02A 3BQ3A 3A4UB 1IJ5A 1W7IB 1S6JA 1WLZA 4PE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAL A;  3WHT B;  4HRG A;  4R1E A;  3PN7 B;  1KK8 B;  2CBL A;  3PM8 A;  2LVI A;  2ZN9 A;  3CZT X;  1GGW A;  1SRA A;  3BUO B;  1U5I B;  4HSZ A;  3SG6 A;  1UHI A;  1MXL C;  1B4C A;  1F71 A;  2CTN A;  4GBA A;  1KCY A;  1C07 A;  3CWG A;  1L2O C;  5G08 A;  2FCD A;  1NX1 A;  1IG5 A;  2LVJ A;  4AOM A;  1CFF A;  1AJ5 A;  2CNP A;  1FW4 A;  5HKZ A;  2V53 A;  4A4C A;  1Y1U A;  2KI6 C;  1DJY A;  2QPT A;  5I2Q A;  3TUY C;  2Q4U A;  5KU1 A;  2L51 A;  1MHO A;  5DKR A;  1PVB A;  2VRG A;  1BF5 A;  1SYM A;  4P5O E;  5KSZ A;  1GGZ A;  2KNE A;  3OHM B;  1S26 D;  2LCP A;  1XFW O;  1A29 A;  2EHB A;  3QRX A;  5CSN A;  5KTY A;  1OE9 B;  2HQ8 A;  1MWN A;  1N65 A;  1SKT A;  3F45 A;  1V1F A;  3CR5 X;  2JWW A;  4GFT A;  1FI5 A;  3EVU A;  3HX4 A;  3RLZ A;  5CSF A;  1WY9 A;  4GGF C;  1NX2 A;  1SR6 C;  3I5F B;  4GGN A;  1JFK A;  5AFP A;  3AAK A;  5J3X A;  5AEQ A;  1XO5 A;  1DMO A;  1KFU L;  3WHU B;  1ALW A;  1H8B A;  5FYX A;  3SG7 A;  1QX7 A;  3IF7 A;  2JUL A;  1G8I A;  1AUI B;  3FWC A;  1DGV A;  2EC6 B;  2WCB A;  1H4B A;  1A75 A;  5D69 A;  3I5I B;  2BCB A;  1PRW A;  2KBM A;  1IQ3 A;  5K89 A;  1DJZ A;  2Y1M A;  1SW8 A;  1RFJ A;  3EK4 A;  3OP0 A;  4ZCV A;  1A03 A;  2JTT A;  3NXA A;  3PFV A;  2GV5 A;  1PUL A;  3VRR A;  1WDC C;  2LE9 B;  2WND A;  4M2P A;  1MUX A;  2OS8 C;  4GPL B;  3DVM A;  3NSK A;  4OV2 A;  2NLN A;  2BCA A;  1KSO A;  2LHI A;  2NCP A;  3NSI A;  1OZO A;  2WC8 A;  1LXF C;  1OMD A;  4MRY A;  2F2P A;  1L7Z A;  2I94 A;  2QAC A;  3LLE A;  2DOQ A;  3TDZ A;  3KEV A;  1AHR A;  1B7T Y;  2LAN A;  3HCM A;  3DF0 B;  2CCM A;  3SG3 A;  5IBW A;  1B8R A;  1KK7 Y;  1SCV A;  2KI4 B;  1FI6 A;  3C1V A;  1JC2 A;  1KSM A;  2Y4Q A;  2F3Y A;  2Q91 A;  3PLF B;  2LMV A;  3D10 A;  3KF9 A;  1EH2 A;  1F8H A;  2KFH A;  1TN4 A;  2MRD A;  1WRL A;  4GAO A;  2JXC A;  1TIZ A;  2BBM A;  3WXA A;  1TCO B;  1J7O A;  1M39 A;  2PVB A;  2SAS A;  2FCE A;  1KFX L;  1OOJ A;  2IS9 A;  3VRO A;  5F6T A;  2L4I A;  2WCF A;  3JVT B;  5PAL A;  1XK4 A;  2K0J A;  1CNP A;  2G2B A;  1K8U A;  3CR2 A;  1KQV A;  3OX5 A;  4NDB A;  1B9A A;  2JQ6 A;  1UHN A;  4BY4 A;  3NSO A;  3VGO A;  2A4J A;  4PE0 A;  2JT0 A;  2JOJ A;  5AER A;  1M46 A;  1SL9 A;  1KWO C;  2F8P A;  4ZCU A;  4WQ2 A;  2KGR A;  1F4O A;  4GNK B;  4YRU A;  5DKQ A;  1TRF A;  1NIW A;  3EK8 A;  1EG4 A;  1YTZ C;  1N2D A;  1NSH A;  2LAP A;  2H61 A;  5JJG A;  1B47 A;  2ZKM X;  1CM1 A;  1E8A A;  3H4S E;  3FWB A;  1KQM B;  3I5I C;  4JQ0 D;  4PE1 A;  3SG4 A;  3BOW B;  4BY5 A;  1C7W A;  1TNX A;  1A4P A;  1SPY A;  2WOR A;  1BMO A;  1EG3 A;  3CTN A;  2KFF A;  1R6P A;  4I5L B;  1OSA A;  2M7N A;  1F70 A;  2JT3 A;  1QAS A;  4AQI A;  1B1G A;  1AP4 A;  3EKH A;  1SCM B;  1BOD A;  3DVE A;  4ETO A;  3SIB A;  1OQP A;  1HQV A;  1YRT B;  4PHK A;  2WCE A;  1DJI A;  3GOF A;  3BUX B;  1Y6W A;  1S5G Z;  1GJY A;  1BOC A;  1DGU A;  1XFY O;  3CR4 X;  2KI4 C;  1UUS A;  1XK4 C;  1YX7 A;  3NSL A;  1PK0 D;  1JFJ A;  1QVI Z;  1SL8 A;  4YGB B;  1C7V A;  3AAJ A;  1WLM A;  2GGZ A;  3FS7 A;  3TS5 C;  2OPO A;  1B8L A;  1TNQ A;  2KHN A;  4XJK B;  4HRE E;  2E30 A;  3JTD B;  2KOT A;  1UP5 A;  2CXJ A;  3GK4 X;  1AK8 A;  2M29 A;  1AVS A;  2M9G A;  1K96 A;  1U5I A;  2GGM A;  1TTX A;  2H2K A;  2LV7 A;  3IQQ A;  4CFQ A;  2G9B A;  2H61 C;  2L5X B;  5HKY A;  1YUU A;  1YUS A;  1RJV A;  4IL1 A;  4C0L A;  1QS7 A;  4MZJ A;  5I2O A;  4CPV A;  4XYN A;  4QJ4 B;  3EKJ A;  1S1E A;  3ZWH A;  4DS7 A;  2LLU A;  2JTZ A;  3TDI A;  3BXK A;  2KBI A;  1EXR A;  1TNW A;  3I5G C;  4CFR A;  1OZS A;  2LP2 A;  1CM4 A;  3LK0 A;  1Y1X A;  1QV1 A;  1CFD A;  1K9K A;  2NCO A;  1CFC A;  1CDL A;  4DRW A;  1NCX A;  2F33 A;  4MSP A;  1D1O A;  1SBJ A;  1KQM C;  1NUB A;  1XYD A;  1CB1 A;  1G33 A;  5TNC A;  4JPZ B;  4TNC A;  1J55 A;  2BL0 B;  2K61 A;  3BYA A;  1Y1A A;  2I18 A;  3LL8 B;  2M3W A;  1IQ5 A;  2MLF C;  2OTG B;  4I5K A;  2HPS A;  4YGE B;  2ZND A;  2M1K B;  1QLK A;  1RK9 A;  2CT9 A;  3DVJ A;  4FQO A;  1DJG A;  2KSP A;  1XA5 A;  2BKI B;  2O5G A;  2KQ6 A;  4YGD B;  3PN7 C;  4MN0 A;  1KK8 C;  4PCW A;  4PE7 A;  2K2A A;  2KGB C;  2NXQ A;  3I5H B;  3PAL A;  4M2O A;  1DF0 B;  1QAT A;  1DJH A;  2LUC A;  3DVK A;  1MXE A;  5CSJ A;  1CDM A;  1Q80 A;  2NZ0 A;  1IRJ A;  3CS1 A;  2K8M B;  1BR1 B;  2JNF A;  1WRZ A;  1FF1 A;  2ZN8 A;  1FPW A;  1F55 A;  1YX8 A;  3VRN A;  1JBA A;  2K7O A;  2KAX A;  2RGI A;  1CKK A;  1L2O B;  2LVV A;  4MZK A;  2L2E A;  1HT9 A;  3DF0 A;  4USL A;  1CLL A;  1IGV A;  1S36 A;  1RWY A;  4L9M A;  3EVV A;  1J7P A;  3LK1 A;  5ER5 A;  1TOP A;  5HYD A;  3I5F C;  3BUN B;  2D8N A;  4WRI A;  1YRU B;  2LC5 A;  2R2I A;  3VRQ A;  1K93 D;  3EVR A;  3TZ1 A;  1QXP A;  1XFV O;  1YVL A;  2JZI A;  3VRP A;  1UWO A;  1ODB A;  2AMI A;  1JF0 A;  4PHM A;  1FBV A;  3SG2 A;  5I8N A;  1XFU O;  2I7A A;  1K9P A;  1LVC D;  2EC6 C;  1KFU S;  1CLM A;  4PHJ A;  1SR6 B;  2EGD A;  1KK7 Z;  1XFZ O;  2Y1N A;  2LP3 A;  3D0Y B;  5GQQ C;  1S5G Y;  2P6B B;  1TNP A;  1IJ6 A;  4MBE A;  2KAY A;  2BCX A;  1DT7 B;  4GUK A;  1RTP 1;  2K2F A;  2JC2 A;  4N1G A;  4QJ3 B;  1DVI A;  1ALV A;  1JWD A;  1NCY A;  2L98 A;  1BG1 A;  1VRK A;  2FOT A;  4C0K A;  1QTX A;  3BUW B;  1K9U A;  4M2Q A;  2E6W A;  4YGA A;  1K94 A;  1YUR A;  4N1F A;  1GQM A;  1M63 B;  2HQW A;  3BOW A;  1QIV A;  1NP8 A;  1W7J B;  3PSR A;  3A8R A;  1S3P A;  4I5N B;  2MHH A;  4P2Y B;  1WDC B;  3LCP C;  2Y5I A;  1JF2 A;  2M0R A;  1M45 A;  1NX3 A;  2OS8 B;  4MZL A;  4OVN F;  3AKA A;  4YBH B;  1BU3 A;  3OB2 B;  1WRK A;  2F3Z A;  1SMG A;  3GK2 A;  1QX5 B;  3SIA A;  4F0Z B;  1DJX A;  1SY9 A;  1Y0V H;  2ZRT A;  2LNK A;  1BT6 A;  3K21 A;  1CLB A;  1NWD A;  4MEW A;  3JVT C;  1M31 A;  1S6I A;  1JSA A;  3CGA A;  4U8D A;  5CPV A;  1REC A;  4NDC A;  3ICB A;  2JNX A;  3IQO A;  1EJ3 A;  1ZFS A;  1CTR A;  1KFX S;  4OCI A;  2LMU A;  1EL4 A;  4XJK A;  1QX2 A;  4I5J A;  3O4Y A;  1YUT A;  1AJ4 A;  4C0J A;  3KPX A;  1RRO A;  1B8C A;  3KO0 A;  1PSB A;  5B8I B;  4YGC B;  1YR5 A;  3M0W A;  1LA3 A;  4CID A;  1A75 B;  1MQ1 A;  2AAO A;  1LA0 A;  4AQJ A;  2AUC A;  2PMY A;  4ICB A;  1LKJ A;  2LLT A;  4PHN A;  1PAL A;  2PAS A;  3FIA A;  2K7D A;  1BLQ A;  1IWQ A;  1TCF A;  2BEC A;  3KHE A;  5I2L A;  2KDH A;  3WNX B;  4DUQ A;  1XVJ A;  3OB1 B;  2B1U A;  1CFP A;  2MA2 A;  1CDP A;  1J1E A;  1N0Y A;  1R2U A;  1QJT A;  1KWO B;  1OMV A;  2ZRS A;  4CLN A;  4E68 A;  1SL7 A;  2MJW B;  1CDN A;  2LLS A;  1CMF A;  1MF8 B;  1IH0 A;  2M8U A;  3PAT A;  4YI8 A;  2MAZ A;  2WOS A;  1SCM C;  5CSI A;  5AAN A;  2BE4 A;  5JOL A;  4MRX A;  2JT8 A;  1J1D A;  1NCZ A;  2KYC A;  4JWQ A;  3SG5 A;  2ZFD A;  2K7B A;  3BUM B;  1XFX O;  2LM5 A;  2M49 B;  1UHK A;  5ER4 X;  1NPQ A;  1UHH A;  3ZNI A;  1NX0 A;  1K2H A;  4PAL A;  2SCP A;  1OMR A;  2LHL A;  4A4B A;  3JTD C;  4D1E A;  4WQ3 A;  1DJW A;  5HLO A;  4OKH A;  2JU0 A;  3O2P A;  1IKU A;  1K90 D;  2COL B;  4ORB B;  2F2O A;  5D7F A;  4DIR A;  1J7R A;  1PSR A;  1DF0 A;  3TUY B;  2L0P A;  2M97 A;  1SK6 D;  2KFG A;  1QLS A;  2LUX A;  2KI6 D;  2BE6 A;  3CLN A;  1PVA A;  3TS5 B;  1V1G A;  2JPT A;  4MVF A;  2TN4 A;  5AXI A;  2M7L A;  1DTL A;  1J7Q A;  4HRH A;  4NDD A;  1NYA A;  2PRU A;  2LVK A;  5DKN A;  4QJ5 B;  2ZNE A;  2BBN A;  1F4Q A;  2HET A;  3O78 A;  5HLV A;  1BR4 B;  4N5X A;  3EK7 A;  3AKB A;  1B7T Z;  1QIW A;  1JUO A;  1QV0 A;  2BKH B;  3GK1 A;  5BPJ A;  2ISD A;  4UPG A;  2LMT A;  2M1U A;  1S6C A;  3SJS A;  1CMG A;  5HKW A;  2K7C A;  1ZMZ A;  1QVI Y;  2KYF A;  4PDZ A;  2I2R E;  2BL0 C;  1UUR A;  1G4Y R;  3I5G B;  4Q04 A;  1LIN A;  1UHJ A;  2HF5 A;  2KQY A;  2OTG C;  1K95 A;  3O6B A;  4OR9 B;  4YI9 A;  1F54 A;  2MBX A;  3OX6 A;  4NQG A;  1ZUZ A;  1MR8 A;  3MSE B;  3TDU A;  1SNL A;  1ZOT B;  2L4H A;  4GGF A;  2JRF A;  2JXL A;  2KAV A;  1ZAC A;  2L50 A;  1YVH A;  1BJF A;  2MLE C;  3E3R A;  4ORC B;  2PSR A;  3D0Y A;  2O60 A;  1A2X A;  3I5H C;  4FTG A;  4MLW A;  4ORA B;  4DCK A;  3RM1 A;  2FJU B;  3DD4 A;  1X02 A;  3BQ3 A;  3A4U B;  1IJ5 A;  1W7I B;  1S6J A;  1WLZ A;  4PE4 A; 
#chains in the Genus database with same CATH topology
 2PAL A;  3WHT B;  4HRG A;  3CZ0 A;  4R1E A;  3PN7 B;  1KK8 B;  2CBL A;  3PM8 A;  2LVI A;  2ZN9 A;  3CZT X;  1GGW A;  1SRA A;  3BUO B;  1U5I B;  2WCM A;  3S0B A;  4HSZ A;  3SG6 A;  1TUZ A;  1UHI A;  1MXL C;  1B4C A;  1F71 A;  2CTN A;  4GBA A;  1GM0 A;  1KCY A;  1C07 A;  3CWG A;  1L2O C;  5G08 A;  2FCD A;  1NX1 A;  1IG5 A;  2LVJ A;  4AOM A;  1CFF A;  1AJ5 A;  1FW4 A;  2CNP A;  5HKZ A;  2V53 A;  5D3O A;  4A4C A;  1Y1U A;  2KI6 C;  1DJY A;  2QPT A;  5I2Q A;  3TUY C;  2Q4U A;  5KU1 A;  2L51 A;  1MHO A;  3B7A A;  1PVB A;  2KLD A;  2VRG A;  5DKR A;  1SYM A;  4P5O E;  4JKT A;  5KSZ A;  1GGZ A;  2PYQ A;  2KNE A;  3OHM B;  1S26 D;  2LCP A;  1XFW O;  1A29 A;  2EHB A;  3QRX A;  5CSN A;  5KTY A;  1OE9 B;  2HQ8 A;  1MWN A;  1N65 A;  1SKT A;  3F45 A;  1V1F A;  3CR5 X;  2JWW A;  3Q8I A;  4GFT A;  1FI5 A;  3EVU A;  3HX4 A;  3RLZ A;  3CDN A;  5CSF A;  2WCL A;  1WY9 A;  4GGF C;  1NX2 A;  1SR6 C;  3I5F B;  4GGN A;  1JFK A;  5DIC A;  5AFP A;  3AAK A;  2QEO A;  5J3X A;  5AEQ A;  1XO5 A;  1DMO A;  1KFU L;  3WHU B;  2YGU A;  2JPO A;  1ALW A;  1H8B A;  2H8V A;  5FYX A;  1QX7 A;  3IF7 A;  3SG7 A;  3K1E A;  2JUL A;  1G8I A;  3SS3 A;  1AUI B;  3FWC A;  1DGV A;  2EC6 B;  2WCB A;  1H4B A;  1A75 A;  5D69 A;  3I5I B;  2BCB A;  1PRW A;  1P28 A;  3PJI A;  2KBM A;  1IQ3 A;  1C3Y A;  5K89 A;  1DJZ A;  2Y1M A;  1SW8 A;  3DYE A;  1RFJ A;  3EK4 A;  3DY9 A;  3OP0 A;  4ZCV A;  1A03 A;  2WCJ A;  1C3Z A;  2JTT A;  3NXA A;  2FJY A;  3PFV A;  2GV5 A;  1PUL A;  3VRR A;  1WDC C;  2LE9 B;  2WND A;  4M2P A;  1MUX A;  2WCH A;  3B6X A;  2OS8 C;  4GPL B;  3DVM A;  3NSK A;  4OV2 A;  2NLN A;  2BCA A;  1KSO A;  2LHI A;  2NCP A;  3NSI A;  1OZO A;  2WC8 A;  1LXF C;  1OMD A;  4INX A;  4MRY A;  2F2P A;  1L7Z A;  3FE6 A;  2I94 A;  2QAC A;  3LLE A;  2DOQ A;  4JD9 A;  3TDZ A;  1OOI X;  1AHR A;  1B7T Y;  2LAN A;  3HCM A;  3KEV A;  3DF0 B;  2CCM A;  3BFB A;  3SG3 A;  5IBW A;  1B8R A;  1KK7 Y;  1SCV A;  2KI4 B;  3D73 A;  1FI6 A;  3C1V A;  1JC2 A;  1KSM A;  2Y4Q A;  2F3Y A;  2Q91 A;  3PLF B;  2LMV A;  3D10 A;  2BAP A;  3KF9 A;  1EH2 A;  1OOG A;  2KFH A;  1TN4 A;  2MRD A;  1WRL A;  3L4A A;  2JXC A;  4GAO A;  1F8H A;  1TIZ A;  3D75 A;  3BFH A;  2BBM A;  3WXA A;  3EG5 B;  1TCO B;  2WC6 A;  1J7O A;  1M39 A;  2PVB A;  2SAS A;  2FCE A;  1KFX L;  1OOJ A;  2IS9 A;  3VRO A;  5F6T A;  2L4I A;  2WCF A;  3JVT B;  3NHI A;  5PAL A;  3S0E A;  1XK4 A;  2K0J A;  1CNP A;  2L5Y A;  2G2B A;  1K8U A;  3CR2 A;  1KQV A;  3OX5 A;  4NDB A;  1B9A A;  2JQ6 A;  1UHN A;  4BY4 A;  3NSO A;  3VGO A;  2L2C A;  2A4J A;  4PE0 A;  3S0D A;  2WCK A;  2JT0 A;  2JOJ A;  5AER A;  1M46 A;  1SL9 A;  1KWO C;  2F8P A;  4ZCU A;  4WQ2 A;  2KGR A;  1F4O A;  4GNK B;  4YRU A;  5DKQ A;  1TRF A;  1OOH A;  1NIW A;  3EK8 A;  1EG4 A;  1YTZ C;  1N2D A;  1NSH A;  2LAP A;  2H61 A;  5JJG A;  1B47 A;  2ZKM X;  1CM1 A;  1E8A A;  3H4S E;  3FWB A;  1KQM B;  3I5I C;  4JQ0 D;  4PE1 A;  3SG4 A;  3BOW B;  4BY5 A;  1C7W A;  1TNX A;  1A4P A;  1SPY A;  2WOR A;  1BMO A;  1EG3 A;  3CTN A;  2KFF A;  1R6P A;  4I5L B;  1OSA A;  2M7N A;  1F70 A;  2JT3 A;  3UO9 A;  1QAS A;  4AQI A;  1B1G A;  1AP4 A;  3EKH A;  1SCM B;  1BOD A;  3DVE A;  3L47 A;  4ETO A;  3SIB A;  3O4X A;  1OQP A;  1HQV A;  1YRT B;  4PHK A;  2WCE A;  1DJI A;  3GOF A;  3BUX B;  1Y6W A;  1S5G Z;  1GJY A;  1BOC A;  1DGU A;  1XFY O;  5HL1 A;  3CR4 X;  2KI4 C;  1UUS A;  1XK4 C;  1YX7 A;  2PQL A;  1PK0 D;  3NSL A;  1QVI Z;  1SL8 A;  1JFJ A;  4YGB B;  1C7V A;  3AAJ A;  1WLM A;  2GGZ A;  3FS7 A;  3TS5 C;  2OPO A;  1B8L A;  1TNQ A;  2KHN A;  4XJK B;  4HRE E;  2E30 A;  3JTD B;  2KOT A;  1UP5 A;  1XFR A;  2CXJ A;  3GK4 X;  1AK8 A;  2M29 A;  1AVS A;  2M9G A;  1K96 A;  1U5I A;  2GGM A;  1TTX A;  2H2K A;  2LV7 A;  3IQQ A;  4IJ7 A;  4CFQ A;  2G9B A;  2P71 A;  2H61 C;  2L5X B;  5HKY A;  1YUU A;  1YUS A;  1RJV A;  4IL1 A;  4C0L A;  1QS7 A;  4MZJ A;  5I2O A;  4CPV A;  4FQT A;  4XYN A;  4QJ4 B;  3EKJ A;  1S1E A;  3ZWH A;  4DS7 A;  2LLU A;  2JTZ A;  3CZ1 A;  3TDI A;  3BXK A;  2KBI A;  1EXR A;  1TNW A;  3B87 A;  3I5G C;  4CFR A;  1OZS A;  2LP2 A;  1LS8 A;  3UNW A;  1CM4 A;  3LK0 A;  1Y1X A;  1QV1 A;  1CFD A;  1K9K A;  2NCO A;  2KPH A;  1CFC A;  1CDL A;  4DRW A;  1NCX A;  2F33 A;  4MSP A;  1D1O A;  1SBJ A;  1KQM C;  1NUB A;  1XYD A;  1CB1 A;  1G33 A;  5TNC A;  4JPZ B;  4TNC A;  1J55 A;  1W9Z A;  2BL0 B;  2K61 A;  3BYA A;  1Y1A A;  2I18 A;  3LL8 B;  3IVT A;  2M3W A;  1IQ5 A;  2MLF C;  2OTG B;  4I5K A;  2HPS A;  4YGE B;  2ZND A;  2M1K B;  1QLK A;  1RK9 A;  2CT9 A;  2BNX A;  3DVJ A;  4FQO A;  1DJG A;  2KSP A;  1XA5 A;  2BKI B;  3DZT A;  2O5G A;  2KQ6 A;  4YGD B;  3PN7 C;  3R72 A;  1KK8 C;  4MN0 A;  4PE7 A;  2K2A A;  2KGB C;  2NXQ A;  4PCW A;  3S0A A;  3I5H B;  3CAB A;  3R1P A;  3PAL A;  4M2O A;  3FE8 A;  1DF0 B;  1Z2C B;  1OW4 A;  1QAT A;  1DJH A;  2LUC A;  3DVK A;  1MXE A;  5CSJ A;  1CDM A;  3R1O A;  5EL2 A;  1Q80 A;  2NZ0 A;  1BF5 A;  1IRJ A;  3CS1 A;  2K8M B;  1BR1 B;  2JNF A;  1WRZ A;  2QEV A;  2ZN8 A;  1FF1 A;  1FPW A;  1F55 A;  1YX8 A;  3VRN A;  2K60 A;  1JBA A;  2K7O A;  2KAX A;  2RGI A;  2WC5 A;  1L2O B;  2LVV A;  4MZK A;  2L2E A;  1HT9 A;  3DF0 A;  4USL A;  1CKK A;  1CLL A;  1IGV A;  1S36 A;  1RWY A;  4L9M A;  3EVV A;  1J7P A;  3LK1 A;  5ER5 A;  1TOP A;  5HYD A;  3I5F C;  3BUN B;  2D8N A;  4WRI A;  1YRU B;  2LC5 A;  2R2I A;  3V2L A;  1K93 D;  3EVR A;  3TZ1 A;  3VRQ A;  1QXP A;  4KYN A;  1XFV O;  1YVL A;  2JZI A;  3VRP A;  1UWO A;  1ODB A;  2AMI A;  1JF0 A;  4PHM A;  1FBV A;  1TUJ A;  3SG2 A;  5I8N A;  1XFU O;  2I7A A;  1ORG A;  1K9P A;  1LVC D;  2EC6 C;  1KFU S;  1CLM A;  4PHJ A;  1SR6 B;  2EGD A;  1KK7 Z;  2QEH A;  1XFZ O;  2Y1N A;  2LP3 A;  3D0Y B;  5GQQ C;  1S5G Y;  2P6B B;  1TNP A;  1IJ6 A;  4MBE A;  2KAY A;  2BCX A;  1DT7 B;  1TWO A;  4GUK A;  3D78 A;  1RTP 1;  2K2F A;  2JC2 A;  4N1G A;  4QJ3 B;  1DVI A;  1ALV A;  1JWD A;  1NCY A;  2L98 A;  1BG1 A;  1VRK A;  2FOT A;  3BFA A;  1QTX A;  3CZ2 A;  4C0K A;  3BUW B;  1K9U A;  4M2Q A;  2E6W A;  4YGA A;  1K94 A;  1YUR A;  4N1F A;  3RZS A;  1GQM A;  1M63 B;  3NHT A;  2HQW A;  1DEL A;  3BOW A;  1QIV A;  1NP8 A;  1W7J B;  3PSR A;  3A8R A;  3B86 A;  4OZD A;  1S3P A;  4I5N B;  2MHH A;  4P2Y B;  1WDC B;  3LCP C;  2Y5I A;  1JF2 A;  2M0R A;  1M45 A;  1NX3 A;  2OS8 B;  4MZL A;  3D76 A;  4OVN F;  3AKA A;  4YBH B;  1BU3 A;  3OB2 B;  1WRK A;  2F3Z A;  1SMG A;  3GK2 A;  1QX5 B;  3SIA A;  3R1V A;  3N7H A;  4F0Z B;  1DJX A;  1SY9 A;  1Y0V H;  2ZRT A;  2LNK A;  1BT6 A;  3K21 A;  1CLB A;  1NWD A;  4MEW A;  3JVT C;  1M31 A;  1S6I A;  2GTE A;  1JSA A;  3CGA A;  4U8D A;  5CPV A;  1REC A;  4F7F A;  4NDC A;  2ERB A;  3ICB A;  2KLE A;  2JNX A;  3IQO A;  1EJ3 A;  1ZFS A;  1CTR A;  1KFX S;  3D77 A;  4OCI A;  2LMU A;  4PT1 A;  1EL4 A;  4XJK A;  1QX2 A;  4I5J A;  3O4Y A;  1YUT A;  1AJ4 A;  4C0J A;  3KPX A;  1RRO A;  1B8C A;  3KO0 A;  1PSB A;  5B8I B;  4YGC B;  1YR5 A;  3M0W A;  1LA3 A;  4CID A;  1A75 B;  1MQ1 A;  2AAO A;  1LA0 A;  4AQJ A;  2AUC A;  2PMY A;  4ICB A;  1LKJ A;  2LLT A;  4PHN A;  1PAL A;  2PAS A;  3FIA A;  2K7D A;  1BLQ A;  1IWQ A;  3B88 A;  1TCF A;  2BEC A;  3KHE A;  3DXL A;  5FI2 A;  3NGV A;  5I2L A;  2KDH A;  3WNX B;  4DUQ A;  1XVJ A;  3OB1 B;  2B1U A;  1CFP A;  2MA2 A;  1CDP A;  1J1E A;  1N0Y A;  1R2U A;  1QJT A;  1KWO B;  1OMV A;  2ZRS A;  4CLN A;  4E68 A;  1SL7 A;  3SS5 A;  2MJW B;  3PM2 A;  1CDN A;  2LLS A;  1CMF A;  1MF8 B;  1IH0 A;  2M8U A;  3PAT A;  4YI8 A;  1SSE B;  2MAZ A;  2WOS A;  1SCM C;  5CSI A;  5AAN A;  2BE4 A;  5JOL A;  3D74 A;  3L4L A;  4MRX A;  2JT8 A;  1J1D A;  1NCZ A;  2KYC A;  4JWQ A;  3SG5 A;  2ZFD A;  3OBV A;  3VB1 A;  2K7B A;  3BUM B;  1XFX O;  2LM5 A;  2M49 B;  1UHK A;  5ER4 X;  1NPQ A;  1OOF A;  1UHH A;  3ZNI A;  1NX0 A;  1K2H A;  4PAL A;  2SCP A;  1OMR A;  2LHL A;  1QWV A;  4A4B A;  3JTD C;  4D1E A;  4WQ3 A;  1DQE A;  1DJW A;  3CYZ A;  4OKH A;  5HLO A;  2JU0 A;  3O2P A;  3BJH A;  1IKU A;  1K90 D;  2COL B;  4ORB B;  2F2O A;  5D7F A;  4DIR A;  1J7R A;  1PSR A;  1DF0 A;  3TUY B;  2L0P A;  2M97 A;  2QEB A;  1SK6 D;  2KFG A;  1QLS A;  2LUX A;  2KI6 D;  2BE6 A;  2QDI A;  1PVA A;  3CLN A;  3TS5 B;  1V1G A;  2JPT A;  4MVF A;  2TN4 A;  5AXI A;  2M7L A;  1DTL A;  4INW A;  1J7Q A;  4HRH A;  4NDD A;  1NYA A;  2PRU A;  2LVK A;  5DKN A;  4QJ5 B;  2ZNE A;  2BBN A;  1F4Q A;  2HET A;  3O78 A;  1DC1 A;  5HLV A;  1BR4 B;  4N5X A;  3EK7 A;  3AKB A;  1B7T Z;  1QIW A;  1JUO A;  1QV0 A;  2BKH B;  3GK1 A;  5I94 A;  5BPJ A;  2ISD A;  4UPG A;  2LMT A;  2M1U A;  1S6C A;  3SJS A;  1CMG A;  1DEK A;  5HKW A;  2K7C A;  1ZMZ A;  5FI7 A;  1QVI Y;  2KYF A;  1Z4H A;  4PDZ A;  2I2R E;  2BL0 C;  1UUR A;  1G4Y R;  3I5G B;  4Q04 A;  1LIN A;  1UHJ A;  2HF5 A;  2KQY A;  2OTG C;  1K95 A;  3O6B A;  4OR9 B;  4YI9 A;  3S0G A;  1F54 A;  2MBX A;  3OX6 A;  3S0F A;  3FE9 A;  4NQG A;  5FI6 A;  1ZUZ A;  1MR8 A;  3MSE B;  3QME A;  3TDU A;  1SNL A;  1IIO A;  1ZOT B;  2L4H A;  4GGF A;  2JRF A;  2JXL A;  2KAV A;  1ZAC A;  2L50 A;  1YVH A;  1BJF A;  2MLE C;  3E3R A;  4ORC B;  2PSR A;  3D0Y A;  2O60 A;  1A2X A;  2P70 A;  3I5H C;  4FTG A;  3OGN A;  4MLW A;  4ORA B;  4DCK A;  3RM1 A;  2FJU B;  3DD4 A;  1X02 A;  1T14 A;  3BQ3 A;  3SS4 A;  3A4U B;  1IJ5 A;  1W7I B;  1S6J A;  1WLZ A;  4PE4 A; 
#chains in the Genus database with same CATH homology
 2PAL A;  3WHT B;  4HRG A;  4R1E A;  3PN7 B;  1KK8 B;  2CBL A;  3PM8 A;  2LVI A;  2ZN9 A;  3CZT X;  1GGW A;  1SRA A;  3BUO B;  1U5I B;  4HSZ A;  3SG6 A;  1UHI A;  1MXL C;  1B4C A;  1F71 A;  2CTN A;  4GBA A;  1KCY A;  1C07 A;  3CWG A;  1L2O C;  5G08 A;  2FCD A;  1NX1 A;  1IG5 A;  2LVJ A;  4AOM A;  1CFF A;  1AJ5 A;  2CNP A;  1FW4 A;  5HKZ A;  2V53 A;  4A4C A;  1Y1U A;  2KI6 C;  1DJY A;  2QPT A;  5I2Q A;  3TUY C;  2Q4U A;  5KU1 A;  2L51 A;  1MHO A;  5DKR A;  1PVB A;  2VRG A;  1BF5 A;  1SYM A;  4P5O E;  5KSZ A;  1GGZ A;  2KNE A;  3OHM B;  1S26 D;  2LCP A;  1XFW O;  1A29 A;  2EHB A;  3QRX A;  5CSN A;  5KTY A;  1OE9 B;  2HQ8 A;  1MWN A;  1N65 A;  1SKT A;  3F45 A;  1V1F A;  3CR5 X;  2JWW A;  4GFT A;  1FI5 A;  3EVU A;  3HX4 A;  3RLZ A;  5CSF A;  1WY9 A;  4GGF C;  1NX2 A;  1SR6 C;  3I5F B;  4GGN A;  1JFK A;  5AFP A;  3AAK A;  5J3X A;  5AEQ A;  1XO5 A;  1DMO A;  1KFU L;  3WHU B;  1ALW A;  1H8B A;  5FYX A;  3SG7 A;  1QX7 A;  3IF7 A;  2JUL A;  1G8I A;  1AUI B;  3FWC A;  1DGV A;  2EC6 B;  2WCB A;  1H4B A;  1A75 A;  5D69 A;  3I5I B;  2BCB A;  1PRW A;  2KBM A;  1IQ3 A;  5K89 A;  1DJZ A;  2Y1M A;  1SW8 A;  1RFJ A;  3EK4 A;  3OP0 A;  4ZCV A;  1A03 A;  2JTT A;  3NXA A;  3PFV A;  2GV5 A;  1PUL A;  3VRR A;  1WDC C;  2LE9 B;  2WND A;  4M2P A;  1MUX A;  2OS8 C;  4GPL B;  3DVM A;  3NSK A;  4OV2 A;  2NLN A;  2BCA A;  1KSO A;  2LHI A;  2NCP A;  3NSI A;  1OZO A;  2WC8 A;  1LXF C;  1OMD A;  4MRY A;  2F2P A;  1L7Z A;  2I94 A;  2QAC A;  3LLE A;  2DOQ A;  3TDZ A;  3KEV A;  1AHR A;  1B7T Y;  2LAN A;  3HCM A;  3DF0 B;  2CCM A;  3SG3 A;  5IBW A;  1B8R A;  1KK7 Y;  1SCV A;  2KI4 B;  1FI6 A;  3C1V A;  1JC2 A;  1KSM A;  2Y4Q A;  2F3Y A;  2Q91 A;  3PLF B;  2LMV A;  3D10 A;  3KF9 A;  1EH2 A;  1F8H A;  2KFH A;  1TN4 A;  2MRD A;  1WRL A;  4GAO A;  2JXC A;  1TIZ A;  2BBM A;  3WXA A;  1TCO B;  1J7O A;  1M39 A;  2PVB A;  2SAS A;  2FCE A;  1KFX L;  1OOJ A;  2IS9 A;  3VRO A;  5F6T A;  2L4I A;  2WCF A;  3JVT B;  5PAL A;  1XK4 A;  2K0J A;  1CNP A;  2G2B A;  1K8U A;  3CR2 A;  1KQV A;  3OX5 A;  4NDB A;  1B9A A;  2JQ6 A;  1UHN A;  4BY4 A;  3NSO A;  3VGO A;  2A4J A;  4PE0 A;  2JT0 A;  2JOJ A;  5AER A;  1M46 A;  1SL9 A;  1KWO C;  2F8P A;  4ZCU A;  4WQ2 A;  2KGR A;  1F4O A;  4GNK B;  4YRU A;  5DKQ A;  1TRF A;  1NIW A;  3EK8 A;  1EG4 A;  1YTZ C;  1N2D A;  1NSH A;  2LAP A;  2H61 A;  5JJG A;  1B47 A;  2ZKM X;  1CM1 A;  1E8A A;  3H4S E;  3FWB A;  1KQM B;  3I5I C;  4JQ0 D;  4PE1 A;  3SG4 A;  3BOW B;  4BY5 A;  1C7W A;  1TNX A;  1A4P A;  1SPY A;  2WOR A;  1BMO A;  1EG3 A;  3CTN A;  2KFF A;  1R6P A;  4I5L B;  1OSA A;  2M7N A;  1F70 A;  2JT3 A;  1QAS A;  4AQI A;  1B1G A;  1AP4 A;  3EKH A;  1SCM B;  1BOD A;  3DVE A;  4ETO A;  3SIB A;  1OQP A;  1HQV A;  1YRT B;  4PHK A;  2WCE A;  1DJI A;  3GOF A;  3BUX B;  1Y6W A;  1S5G Z;  1GJY A;  1BOC A;  1DGU A;  1XFY O;  3CR4 X;  2KI4 C;  1UUS A;  1XK4 C;  1YX7 A;  3NSL A;  1PK0 D;  1JFJ A;  1QVI Z;  1SL8 A;  4YGB B;  1C7V A;  3AAJ A;  1WLM A;  2GGZ A;  3FS7 A;  3TS5 C;  2OPO A;  1B8L A;  1TNQ A;  2KHN A;  4XJK B;  4HRE E;  2E30 A;  3JTD B;  2KOT A;  1UP5 A;  2CXJ A;  3GK4 X;  1AK8 A;  2M29 A;  1AVS A;  2M9G A;  1K96 A;  1U5I A;  2GGM A;  1TTX A;  2H2K A;  2LV7 A;  3IQQ A;  4CFQ A;  2G9B A;  2H61 C;  2L5X B;  5HKY A;  1YUU A;  1YUS A;  1RJV A;  4IL1 A;  4C0L A;  1QS7 A;  4MZJ A;  5I2O A;  4CPV A;  4XYN A;  4QJ4 B;  3EKJ A;  1S1E A;  3ZWH A;  4DS7 A;  2LLU A;  2JTZ A;  3TDI A;  3BXK A;  2KBI A;  1EXR A;  1TNW A;  3I5G C;  4CFR A;  1OZS A;  2LP2 A;  1CM4 A;  3LK0 A;  1Y1X A;  1QV1 A;  1CFD A;  1K9K A;  2NCO A;  1CFC A;  1CDL A;  4DRW A;  1NCX A;  2F33 A;  4MSP A;  1D1O A;  1SBJ A;  1KQM C;  1NUB A;  1XYD A;  1CB1 A;  1G33 A;  5TNC A;  4JPZ B;  4TNC A;  1J55 A;  2BL0 B;  2K61 A;  3BYA A;  1Y1A A;  2I18 A;  3LL8 B;  2M3W A;  1IQ5 A;  2MLF C;  2OTG B;  4I5K A;  2HPS A;  4YGE B;  2ZND A;  2M1K B;  1QLK A;  1RK9 A;  2CT9 A;  3DVJ A;  4FQO A;  1DJG A;  2KSP A;  1XA5 A;  2BKI B;  2O5G A;  2KQ6 A;  4YGD B;  3PN7 C;  4MN0 A;  1KK8 C;  4PCW A;  4PE7 A;  2K2A A;  2KGB C;  2NXQ A;  3I5H B;  3PAL A;  4M2O A;  1DF0 B;  1QAT A;  1DJH A;  2LUC A;  3DVK A;  1MXE A;  5CSJ A;  1CDM A;  1Q80 A;  2NZ0 A;  1IRJ A;  3CS1 A;  2K8M B;  1BR1 B;  2JNF A;  1WRZ A;  1FF1 A;  2ZN8 A;  1FPW A;  1F55 A;  1YX8 A;  3VRN A;  1JBA A;  2K7O A;  2KAX A;  2RGI A;  1CKK A;  1L2O B;  2LVV A;  4MZK A;  2L2E A;  1HT9 A;  3DF0 A;  4USL A;  1CLL A;  1IGV A;  1S36 A;  1RWY A;  4L9M A;  3EVV A;  1J7P A;  3LK1 A;  5ER5 A;  1TOP A;  5HYD A;  3I5F C;  3BUN B;  2D8N A;  4WRI A;  1YRU B;  2LC5 A;  2R2I A;  3VRQ A;  1K93 D;  3EVR A;  3TZ1 A;  1QXP A;  1XFV O;  1YVL A;  2JZI A;  3VRP A;  1UWO A;  1ODB A;  2AMI A;  1JF0 A;  4PHM A;  1FBV A;  3SG2 A;  5I8N A;  1XFU O;  2I7A A;  1K9P A;  1LVC D;  2EC6 C;  1KFU S;  1CLM A;  4PHJ A;  1SR6 B;  2EGD A;  1KK7 Z;  1XFZ O;  2Y1N A;  2LP3 A;  3D0Y B;  5GQQ C;  1S5G Y;  2P6B B;  1TNP A;  1IJ6 A;  4MBE A;  2KAY A;  2BCX A;  1DT7 B;  4GUK A;  1RTP 1;  2K2F A;  2JC2 A;  4N1G A;  4QJ3 B;  1DVI A;  1ALV A;  1JWD A;  1NCY A;  2L98 A;  1BG1 A;  1VRK A;  2FOT A;  4C0K A;  1QTX A;  3BUW B;  1K9U A;  4M2Q A;  2E6W A;  4YGA A;  1K94 A;  1YUR A;  4N1F A;  1GQM A;  1M63 B;  2HQW A;  3BOW A;  1QIV A;  1NP8 A;  1W7J B;  3PSR A;  3A8R A;  1S3P A;  4I5N B;  2MHH A;  4P2Y B;  1WDC B;  3LCP C;  2Y5I A;  1JF2 A;  2M0R A;  1M45 A;  1NX3 A;  2OS8 B;  4MZL A;  4OVN F;  3AKA A;  4YBH B;  1BU3 A;  3OB2 B;  1WRK A;  2F3Z A;  1SMG A;  3GK2 A;  1QX5 B;  3SIA A;  4F0Z B;  1DJX A;  1SY9 A;  1Y0V H;  2ZRT A;  2LNK A;  1BT6 A;  3K21 A;  1CLB A;  1NWD A;  4MEW A;  3JVT C;  1M31 A;  1S6I A;  1JSA A;  3CGA A;  4U8D A;  5CPV A;  1REC A;  4NDC A;  3ICB A;  2JNX A;  3IQO A;  1EJ3 A;  1ZFS A;  1CTR A;  1KFX S;  4OCI A;  2LMU A;  1EL4 A;  4XJK A;  1QX2 A;  4I5J A;  3O4Y A;  1YUT A;  1AJ4 A;  4C0J A;  3KPX A;  1RRO A;  1B8C A;  3KO0 A;  1PSB A;  5B8I B;  4YGC B;  1YR5 A;  3M0W A;  1LA3 A;  4CID A;  1A75 B;  1MQ1 A;  2AAO A;  1LA0 A;  4AQJ A;  2AUC A;  2PMY A;  4ICB A;  1LKJ A;  2LLT A;  4PHN A;  1PAL A;  2PAS A;  3FIA A;  2K7D A;  1BLQ A;  1IWQ A;  1TCF A;  2BEC A;  3KHE A;  5I2L A;  2KDH A;  3WNX B;  4DUQ A;  1XVJ A;  3OB1 B;  2B1U A;  1CFP A;  2MA2 A;  1CDP A;  1J1E A;  1N0Y A;  1R2U A;  1QJT A;  1KWO B;  1OMV A;  2ZRS A;  4CLN A;  4E68 A;  1SL7 A;  2MJW B;  1CDN A;  2LLS A;  1CMF A;  1MF8 B;  1IH0 A;  2M8U A;  3PAT A;  4YI8 A;  2MAZ A;  2WOS A;  1SCM C;  5CSI A;  5AAN A;  2BE4 A;  5JOL A;  4MRX A;  2JT8 A;  1J1D A;  1NCZ A;  2KYC A;  4JWQ A;  3SG5 A;  2ZFD A;  2K7B A;  3BUM B;  1XFX O;  2LM5 A;  2M49 B;  1UHK A;  5ER4 X;  1NPQ A;  1UHH A;  3ZNI A;  1NX0 A;  1K2H A;  4PAL A;  2SCP A;  1OMR A;  2LHL A;  4A4B A;  3JTD C;  4D1E A;  4WQ3 A;  1DJW A;  5HLO A;  4OKH A;  2JU0 A;  3O2P A;  1IKU A;  1K90 D;  2COL B;  4ORB B;  2F2O A;  5D7F A;  4DIR A;  1J7R A;  1PSR A;  1DF0 A;  3TUY B;  2L0P A;  2M97 A;  1SK6 D;  2KFG A;  1QLS A;  2LUX A;  2KI6 D;  2BE6 A;  3CLN A;  1PVA A;  3TS5 B;  1V1G A;  2JPT A;  4MVF A;  2TN4 A;  5AXI A;  2M7L A;  1DTL A;  1J7Q A;  4HRH A;  4NDD A;  1NYA A;  2PRU A;  2LVK A;  5DKN A;  4QJ5 B;  2ZNE A;  2BBN A;  1F4Q A;  2HET A;  3O78 A;  5HLV A;  1BR4 B;  4N5X A;  3EK7 A;  3AKB A;  1B7T Z;  1QIW A;  1JUO A;  1QV0 A;  2BKH B;  3GK1 A;  5BPJ A;  2ISD A;  4UPG A;  2LMT A;  2M1U A;  1S6C A;  3SJS A;  1CMG A;  5HKW A;  2K7C A;  1ZMZ A;  1QVI Y;  2KYF A;  4PDZ A;  2I2R E;  2BL0 C;  1UUR A;  1G4Y R;  3I5G B;  4Q04 A;  1LIN A;  1UHJ A;  2HF5 A;  2KQY A;  2OTG C;  1K95 A;  3O6B A;  4OR9 B;  4YI9 A;  1F54 A;  2MBX A;  3OX6 A;  4NQG A;  1ZUZ A;  1MR8 A;  3MSE B;  3TDU A;  1SNL A;  1ZOT B;  2L4H A;  4GGF A;  2JRF A;  2JXL A;  2KAV A;  1ZAC A;  2L50 A;  1YVH A;  1BJF A;  2MLE C;  3E3R A;  4ORC B;  2PSR A;  3D0Y A;  2O60 A;  1A2X A;  3I5H C;  4FTG A;  4MLW A;  4ORA B;  4DCK A;  3RM1 A;  2FJU B;  3DD4 A;  1X02 A;  3BQ3 A;  3A4U B;  1IJ5 A;  1W7I B;  1S6J A;  1WLZ A;  4PE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...