2M1KB

Interaction of human s100a6 (c3s) with v domain of receptor for advanced glycation end products (rage)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
ASPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of the S100A6 mutant (C3S) with the V domain of the receptor for advanced glycation end products (RAGE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein S100-A6
total genus 33
structure length 89
sequence length 89
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m1kB00
3I5GC 1F4OA 1TTXA 2I94A 3TZ1A 2JT0A 1ZFSA 2OS8B 4R1EA 3SG6A 4AQJA 4C0KA 3IQOA 4M2QA 1SL9A 5CSJA 5DKQA 4NQGA 1YVHA 1FI5A 1L7ZA 2K61A 2WCEA 3AAKA 1LINA 2F3ZA 4DS7A 1SK6D 1U5IA 1SCMC 3KEVA 3KF9A 1OMRA 2F2PA 1ODBA 1TCOB 2HETA 2R2IA 1UWOA 2EHBA 2AUCA 4PE4A 2JU0A 1W7IB 1J7RA 1H8BA 1Y0VH 3BUXB 4YGEB 1OOJA 2WOSA 1BMOA 1MHOA 2JNXA 1K2HA 2OTGB 1QTXA 4PDZA 1M39A 3ZWHA 2G2BA 1CMGA 1DJIA 1SPYA 1WLMA 3ICBA 4MBEA 4C0JA 1CB1A 2L98A 1JWDA 1K9PA 2F2OA 1SL7A 4D1EA 1HT9A 3WHTB 1S5GZ 4IL1A 1PRWA 3PM8A 1QX5B 1PK0D 2A4JA 1F71A 5JOLA 1G8IA 1K8UA 4XJKB 5DKRA 1WRZA 2H61A 1JFJA 4WRIA 1YURA 2AMIA 1E8AA 1TIZA 2KHNA 1CDLA 2KAXA 4PE0A 2FCDA 2M49B 4MZLA 4I5LB 2GGMA 1A75A 2JTTA 1QV0A 2E30A 1KQVA 2ZRTA 1NCZA 1QIWA 1BF5A 2KBMA 3BUMB 3BOWA 4GNKB 3PFVA 2JT8A 3WXAA 4HREE 3OX6A 3JTDB 5HKZA 1F54A 1B9AA 1EG3A 1B4CA 3BQ3A 1CDNA 3DF0B 4I5KA 2JXCA 1YX8A 1CLMA 2CXJA 2PVBA 1MXEA 1JBAA 1SCVA 1WDCC 1DF0B 4ICBA 1NX2A 1W7JB 2K8MB 2E6WA 4PALA 4MLWA 2L50A 4YGAA 1CKKA 1Y1AA 2LUCA 1IKUA 3SIAA 4DRWA 2FJUB 1YX7A 3OHMB 1SR6B 1UHKA 3F45A 3VRNA 2LANA 4WQ2A 2L0PA 1AJ4A 1C7WA 3NSIA 2ZN9A 1AK8A 3JVTC 5AXIA 1R2UA 1HQVA 3DVKA 1DJYA 1LA3A 4XYNA 1N65A 1PVAA 1ALVA 1YUTA 1IRJA 2B1UA 2MAZA 5J3XA 1CMFA 1V1FA 1A2XA 1CFPA 2K2AA 2OPOA 4QJ4B 1WRLA 1XFVO 3VRPA 2WCFA 3SG5A 2JTZA 2JULA 2MA2A 1KK7Z 3D10A 2MHHA 4PHJA 1CM1A 2K7OA 3M0WA 1AJ5A 1NSHA 1XO5A 1XFYO 5FYXA 4XJKA 3TS5C 1JSAA 2MJWB 2BBNA 4GAOA 2JRFA 5IBWA 4PHNA 2JPTA 1UP5A 2K2FA 3CZTX 1QV1A 1UUSA 1IQ5A 1WLZA 3JVTB 3PN7C 1QASA 3NSOA 4NDDA 3TDUA 2LMUA 1X02A 1A75B 1BR4B 3GK2A 1MQ1A 5AFPA 4P5OE 1SR6C 1BR1B 1KQMC 2Q91A 3MSEB 3KHEA 4HRHA 2LP2A 2KDHA 4MZJA 1SKTA 1NPQA 5I2LA 4OVNF 2COLB 3DVJA 2KOTA 3DD4A 3HCMA 1YTZC 1BJFA 1K96A 1SCMB 1K90D 2KI6D 1GGZA 1G33A 3DF0A 2K7CA 3LL8B 4N5XA 1MXLC 1J7OA 3CR4X 1KFUS 4CIDA 3SIBA 4QJ3B 1IJ6A 1WRKA 1K93D 2M3WA 3RM1A 3IQQA 3EVVA 2BCXA 3LK0A 2PSRA 3BXKA 1S5GY 2D8NA 4PCWA 1KSOA 3DVEA 4JPZB 1M45A 1CDMA 3FWCA 2F33A 1DGVA 3NSLA 2LVKA 1TRFA 1YUSA 4YGBB 1QS7A 4PHKA 2L2EA 1J7QA 1KSMA 2M0RA 3PSRA 1AUIB 1K9UA 1SNLA 3SG3A 3GK4X 1H4BA 4CLNA 1XFXO 4DCKA 1FI6A 5D7FA 4UPGA 2MLFC 4OKHA 1JFKA 4N1FA 3I5FB 4P2YB 2LVIA 1GGWA 2H2KA 5JJGA 2BBMA 3TS5B 2ZFDA 1CFCA 3TDZA 1TNPA 1CTRA 1OE9B 2KYFA 2LVJA 4YI9A 2SCPA 1M46A 2MRDA 2LLTA 3CTNA 3IF7A 1DGUA 1XK4C 2PASA 4MN0A 5HYDA 4BY5A 1YRTB 2GV5A 1YUUA 2LHLA 1XVJA 2LE9B 1DJXA 2HF5A 2Y4QA 1BT6A 1TCFA 4CFRA 2BL0B 1KWOB 1FF1A 1N0YA 1S6IA 1IGVA 2LC5A 1OMDA 3EK7A 1QVIZ 4NDCA 3QRXA 1BODA 2OTGC 2WC8A 3CR2A 4GGFA 2K7BA 1BOCA 1MR8A 2KQYA 3LLEA 5KU1A 1EXRA 2HQWA 2KYCA 4PE7A 2WCBA 1G4YR 1Y1UA 1FPWA 3O4YA 1GQMA 1SW8A 4MSPA 3KO0A 4Q04A 3DVMA 1EL4A 1Y6WA 3CWGA 3FWBA 1DJHA 1PVBA 1SY9A 1DJGA 4AOMA 2WNDA 4YGDB 4M2PA 4A4CA 2ZNDA 3BUOB 1OSAA 1RTP1 1C7VA 1L2OC 1ZACA 1KFXL 2KFHA 1S26D 1NP8A 4OV2A 4OCIA 2M1UA 5DKNA 1YRUB 2KI4C 4JWQA 1TNQA 1AHRA 1B8RA 1CFFA 1ZMZA 2LV7A 5AERA 1DVIA 2KFGA 4MEWA 3VROA 1B8CA 1PSRA 2CTNA 3PATA 3JTDC 1Q80A 1NX1A 2M9GA 1F70A 1K95A 1F8HA 1ALWA 5HKWA 1MF8B 1TNXA 4C0LA 5BPJA 2KQ6A 1TN4A 2CCMA 1B47A 3EK8A 5ER5A 1DF0A 4AQIA 2FOTA 2DOQA 2KAYA 3PLFB 1NYAA 3AKAA 4GFTA 3I5FC 4GGNA 3SG4A 3CLNA 2JOJA 1EH2A 3A8RA 1S1EA 2ZN8A 3O2PA 2HQ8A 1SL8A 4GPLB 5I2QA 1WY9A 2ZKMX 1MUXA 4GGFC 2NLNA 1NIWA 5K89A 4HSZA 1JF0A 1UURA 2EC6C 1RFJA 4E68A 3CR5X 3TUYB 1KQMB 1QIVA 1B7TY 1S3PA 2M7NA 3NXAA 4M2OA 1IH0A 3SG2A 3WNXB 2CBLA 1UHHA 2SASA 3PN7B 4YI8A 1XFWO 5AANA 3LK1A 1KK8C 5AEQA 4YGCB 2CT9A 3GOFA 1LA0A 5HLVA 1QJTA 4ZCVA 2V53A 2M1KB 2M7LA 3EVUA 2Y1NA 1J7PA 1NX3A 1XYDA 4JQ0D 2BKHB 5TNCA 3WHUB 1F4QA 2Y5IA 2L4HA 2MLEC 1B7TZ 1YVLA 1J1EA 2K0JA 5CSNA 4ORAB 3I5GB 1DJWA 3FIAA 1J1DA 1XA5A 2IS9A 1UHNA 4FTGA 2KAVA 2LVVA 3EK4A 4TNCA 4A4BA 1IQ3A 2H61C 1UHJA 1Y1XA 1S6JA 2ISDA 1NUBA 1D1OA 4BY4A 2KFFA 2NZ0A 2LM5A 5G08A 2KSPA 2LLSA 1OZSA 4ETOA 1LVCD 2AAOA 1C07A 4YRUA 1QXPA 2LCPA 1DMOA 3BUWB 1B8LA 4PHMA 3BYAA 3EVRA 1JC2A 2MBXA 1K9KA 4F0ZB 1SMGA 1KK8B 3KPXA 4QJ5B 1YR5A 2BCAA 2PALA 2LUXA 1PSBA 4N1GA 1A29A 4GUKA 1NWDA 4I5NB 2QACA 1KK7Y 3VGOA 1UHIA 1TOPA 1A03A 1XK4A 2LLUA 3TDIA 2WORA 1KFUL 1IWQA 3BOWB 1R6PA 4DIRA 3K21A 1CM4A 3OB2B 2Y1MA 1CDPA 4MZKA 2BECA 3BUNB 4L9MA 1KFXS 1LKJA 1N2DA 1QX7A 3SJSA 4MVFA 3ZNIA 1BLQA 2I2RE 2F3YA 4HRGA 5HLOA 2ZRSA 2KGRA 1EJ3A 2L4IA 1RK9A 1V1GA 5F6TA 2NCOA 1CFDA 3D0YA 2JNFA 4YBHB 3HX4A 2BCBA 3VRQA 2LMVA 1CLBA 3VRRA 5CSIA 1OZOA 5D69A 2G9BA 3GK1A 2OS8C 1RECA 2KBIA 2GGZA 4GBAA 1LXFC 2Q4UA 1S6CA 1AP4A 1F55A 2F8PA 2FCEA 3H4SE 2JZIA 1FBVA 5ER4X 4CPVA 2M97A 2BE4A 2I18A 1XFUO 2O5GA 1SBJA 3O78A 1ZUZA 1BG1A 2L51A 1IG5A 5CPVA 2QPTA 3LCPC 3OX5A 1WDCB 2PRUA 1VRKA 2LHIA 3C1VA 3NSKA 1M31A 2KGBC 2JT3A 2VRGA 2NCPA 1M63B 1OMVA 2BE6A 1QLSA 2JQ6A 4ORBB 5PALA 1DJZA 3I5HB 2LNKA 2I7AA 4MRXA 1PALA 2O60A 3OB1B 3TUYC 2LP3A 1AVSA 1RJVA 4I5JA 4CFQA 5HKYA 5KTYA 5I8NA 1NCYA 1IJ5A 1EG4A 3CS1A 1QX2A 1GJYA 1QLKA 4U8DA 3EKHA 1MWNA 4WQ3A 1PULA 3O6BA 1KCYA 2EC6B 2M8UA 1K94A 4DUQA 2LAPA 2PMYA 4MRYA 2K7DA 2NXQA 3I5IC 3SG7A 3RLZA 3AKBA 2L5XB 1CNPA 5I2OA 1KWOC 2BL0C 2KNEA 2LMTA 3D0YB 3PALA 1JUOA 1S36A 1RWYA 3E3RA 1CLLA 1SRAA 1SYMA 3A4UB 4NDBA 3AAJA 1J55A 1A4PA 2KI4B 5KSZA 1FW4A 2RGIA 1TNWA 1QVIY 1U5IB 1OQPA 3I5HC 1NCXA 2EGDA 1L2OB 5B8IB 3I5IB 1BU3A 2P6BB 2CNPA 4FQOA 2ZNEA 1QATA 3FS7A 4USLA 4ORCB 2KI6C 4OR9B 1NX0A 3CGAA 5CSFA 3EKJA 2TN4A 1DT7B 3OP0A 1JF2A 5GQQC 1ZOTB 4PE1A 1B1GA 2HPSA 4ZCUA 2JC2A 2BKIB 2JWWA 1XFZO 2M29A 1RROA 1DTLA 2JXLA
chains in the Genus database with same CATH superfamily
3I5GC 1F4OA 1TTXA 2I94A 3TZ1A 2JT0A 1ZFSA 2OS8B 3CABA 4R1EA 3SG6A 4AQJA 4C0KA 3IQOA 4M2QA 1SL9A 2L2CA 5CSJA 5DKQA 4NQGA 1Z4HA 1YVHA 1FI5A 1L7ZA 2K61A 2WCEA 3AAKA 1LINA 2F3ZA 4DS7A 1TUZA 1SK6D 1U5IA 1SCMC 3KEVA 3KF9A 1OMRA 2F2PA 3S0AA 1ODBA 1TCOB 2HETA 2PYQA 3B87A 3SS4A 2R2IA 1UWOA 2EHBA 1QWVA 2AUCA 4PE4A 2JU0A 1W7IB 1J7RA 1H8BA 3NHTA 1Y0VH 3BUXB 1GM0A 4YGEB 1OOJA 2WOSA 1BMOA 1MHOA 2JNXA 3R72A 1K2HA 2OTGB 1QTXA 4PDZA 1M39A 3ZWHA 2G2BA 1CMGA 1DJIA 1SPYA 1WLMA 1DELA 3ICBA 4MBEA 4C0JA 2L98A 1CB1A 1JWDA 1K9PA 2F2OA 1SL7A 4D1EA 1HT9A 3WHTB 1S5GZ 4IL1A 1PRWA 3PM8A 1QX5B 1PK0D 2A4JA 4KYNA 1F71A 2QEBA 2K60A 5JOLA 1G8IA 1K8UA 2KLDA 4XJKB 5DKRA 1WRZA 2H61A 1JFJA 4WRIA 1YURA 2AMIA 1E8AA 1TIZA 2KHNA 1CDLA 2KAXA 4PE0A 2FCDA 2M49B 4MZLA 4I5LB 1DEKA 2GGMA 1A75A 2JTTA 1QV0A 2E30A 2WC6A 2ZRTA 1NCZA 1KQVA 1QIWA 1BF5A 2KBMA 3BUMB 3BOWA 4GNKB 3PFVA 3CZ1A 2JT8A 3WXAA 4HREE 3OX6A 3JTDB 5HKZA 1F54A 1B9AA 1EG3A 1B4CA 3BQ3A 1CDNA 3DF0B 4I5KA 2JXCA 1YX8A 1CLMA 2CXJA 2PVBA 1MXEA 2WC5A 1JBAA 1SCVA 1WDCC 1DF0B 4ICBA 1NX2A 1W7JB 2K8MB 2WCLA 2E6WA 4PALA 4MLWA 2L50A 4YGAA 1CKKA 1Y1AA 3S0EA 2LUCA 1IKUA 3SIAA 3VB1A 2FJUB 4DRWA 1YX7A 3OHMB 1SR6B 3S0GA 2P70A 2BAPA 1UHKA 3F45A 3VRNA 2LANA 4WQ2A 2L0PA 1AJ4A 1C7WA 3NSIA 2ZN9A 1AK8A 3JVTC 5AXIA 1R2UA 1ORGA 1HQVA 3DVKA 1DJYA 1LA3A 4XYNA 1N65A 1PVAA 1ALVA 1YUTA 1IRJA 2B1UA 2MAZA 2WCJA 5J3XA 1CMFA 1W9ZA 1V1FA 1A2XA 1CFPA 2K2AA 2OPOA 5FI6A 4QJ4B 1WRLA 1XFVO 3VRPA 2WCFA 3SG5A 2JTZA 2JULA 2MA2A 1KK7Z 3D10A 2MHHA 2PQLA 4PHJA 1CM1A 2K7OA 3M0WA 1AJ5A 1NSHA 1XO5A 1XFYO 5FYXA 4XJKA 3TS5C 1JSAA 2MJWB 2BBNA 4GAOA 2JRFA 5IBWA 4PHNA 2JPTA 1UP5A 2K2FA 3CZTX 1QV1A 1UUSA 1IQ5A 1WLZA 3JVTB 3PN7C 1QASA 3NSOA 4NDDA 3TDUA 3BFBA 1C3YA 2LMUA 1X02A 1A75B 1BR4B 3GK2A 1MQ1A 5AFPA 3Q8IA 4P5OE 1SR6C 1BR1B 1KQMC 2Q91A 3MSEB 3KHEA 4HRHA 2LP2A 2KDHA 4MZJA 1SKTA 1NPQA 5I2LA 4OVNF 2COLB 3DVJA 3SS5A 2KOTA 3DD4A 3HCMA 1YTZC 1BJFA 1K96A 1SCMB 3B7AA 1K90D 1OW4A 2KI6D 1GGZA 1G33A 1OOFA 2WCMA 3DF0A 2K7CA 3LL8B 4N5XA 1MXLC 1J7OA 3CR4X 1KFUS 4CIDA 3SIBA 4QJ3B 1IJ6A 1WRKA 1K93D 2M3WA 3RM1A 3IQQA 3EVVA 2BCXA 3LK0A 2PSRA 2QEVA 3BXKA 3R1OA 1S5GY 2D8NA 4PCWA 1KSOA 3DVEA 4JPZB 1M45A 2WCKA 1CDMA 3FWCA 3BJHA 5I94A 2F33A 1DGVA 3NSLA 2LVKA 1TRFA 1YUSA 3PJIA 4YGBB 1QS7A 4PHKA 2L2EA 1J7QA 1KSMA 2M0RA 3PSRA 5FI2A 1AUIB 1K9UA 1SNLA 1XFRA 3SG3A 3GK4X 1H4BA 4CLNA 4FQTA 2BNXA 1DQEA 1XFXO 4DCKA 1FI6A 5D7FA 4UPGA 3UNWA 2MLFC 4OKHA 1C3ZA 1JFKA 4N1FA 3I5FB 4P2YB 2LVIA 1GGWA 2H2KA 5JJGA 2BBMA 3NGVA 3TS5B 2ZFDA 1CFCA 3QMEA 3TDZA 1TNPA 1CTRA 1OE9B 2KYFA 2LVJA 4YI9A 2SCPA 1M46A 2MRDA 2QEOA 2LLTA 3CTNA 3IF7A 1DGUA 1XK4C 2PASA 3CDNA 4MN0A 5HYDA 1SSEB 4BY5A 1YRTB 2GV5A 1YUUA 2LHLA 1XVJA 2LE9B 1DJXA 2HF5A 3D76A 2Y4QA 1BT6A 3FE6A 1TCFA 4CFRA 2BL0B 1KWOB 1FF1A 1N0YA 1S6IA 1IGVA 2LC5A 1OMDA 3EK7A 1QVIZ 4NDCA 3QRXA 1BODA 2OTGC 2WC8A 3CR2A 4GGFA 2K7BA 1BOCA 1MR8A 2KQYA 3LLEA 5KU1A 1EXRA 2HQWA 2KYCA 4PE7A 2WCBA 1G4YR 3L4AA 2WCHA 1Y1UA 1FPWA 3O4YA 1GQMA 1SW8A 4MSPA 2KLEA 3KO0A 3NHIA 4Q04A 3DVMA 1EL4A 1Y6WA 3CWGA 3DYEA 3FWBA 1DJHA 1PVBA 1SY9A 3OGNA 1DJGA 2L5YA 2WNDA 4YGDB 4M2PA 4A4CA 4AOMA 2ZNDA 3BUOB 1OSAA 1RTP1 1C7VA 1L2OC 1ZACA 1KFXL 2KFHA 1S26D 1NP8A 4OV2A 4OCIA 2M1UA 5DKNA 1YRUB 2KI4C 4JWQA 1TNQA 1AHRA 1B8RA 1TWOA 1CFFA 1ZMZA 2LV7A 5AERA 1DVIA 2KFGA 4MEWA 3VROA 1B8CA 2KPHA 1PSRA 2CTNA 3PATA 3FE8A 3JTDC 4PT1A 5EL2A 1Z2CB 1Q80A 1NX1A 2M9GA 3D77A 1K95A 1F70A 1ALWA 1F8HA 5HKWA 1MF8B 1TNXA 4C0LA 5BPJA 2KQ6A 1TN4A 2CCMA 1B47A 3EK8A 5ER5A 1DF0A 4AQIA 2FOTA 2DOQA 2KAYA 3PLFB 1NYAA 3AKAA 4GFTA 3I5FC 4GGNA 3SG4A 3CLNA 2JOJA 1EH2A 3A8RA 1S1EA 2ZN8A 3O2PA 2HQ8A 1SL8A 4GPLB 5I2QA 1WY9A 2ZKMX 4JD9A 3B86A 3B88A 1MUXA 4GGFC 2NLNA 1NIWA 4IJ7A 5K89A 4HSZA 1JF0A 1UURA 2EC6C 1RFJA 4E68A 3CR5X 4INWA 1KQMB 3D74A 3TUYB 1QIVA 1B7TY 1S3PA 2M7NA 3NXAA 3D75A 1P28A 4M2OA 1IH0A 3SG2A 3WNXB 2CBLA 1UHHA 2SASA 3PN7B 5DICA 4YI8A 1XFWO 5AANA 3LK1A 1KK8C 5AEQA 4YGCB 2CT9A 3GOFA 1LA0A 3BFHA 5HLVA 1QJTA 4ZCVA 2V53A 2M1KB 2M7LA 3EVUA 2Y1NA 1J7PA 1NX3A 1XYDA 3L4LA 3N7HA 2BKHB 4JQ0D 5TNCA 3WHUB 1F4QA 2Y5IA 2L4HA 2MLEC 1B7TZ 1YVLA 1J1EA 2K0JA 5CSNA 4ORAB 3I5GB 1DJWA 3FIAA 1J1DA 1XA5A 2IS9A 1UHNA 4FTGA 2KAVA 3V2LA 2LVVA 1OOHA 3EK4A 4TNCA 4A4BA 1IQ3A 2H61C 1UHJA 1Y1XA 1S6JA 2ISDA 1NUBA 4INXA 1D1OA 3BFAA 4BY4A 2KFFA 3CZ0A 2NZ0A 2LM5A 5G08A 2KSPA 2LLSA 1OZSA 4ETOA 1LVCD 2AAOA 2QDIA 3UO9A 1C07A 2H8VA 1QXPA 2LCPA 4YRUA 3BUWB 1DMOA 1B8LA 3FE9A 3PM2A 4PHMA 3BYAA 3EVRA 1JC2A 2MBXA 3S0FA 1K9KA 4F0ZB 1SMGA 1KK8B 3KPXA 1OOIX 4QJ5B 1YR5A 2BCAA 2PALA 2LUXA 1PSBA 4N1GA 1A29A 4GUKA 1NWDA 4I5NB 2QACA 1KK7Y 3VGOA 1UHIA 1TOPA 1DC1A 5HL1A 1A03A 1XK4A 1TUJA 2LLUA 3TDIA 2WORA 3S0DA 1KFUL 1IWQA 3BOWB 1R6PA 4DIRA 3K21A 1CM4A 3OB2B 2Y1MA 1CDPA 4MZKA 2BECA 3BUNB 4L9MA 1KFXS 1LKJA 1N2DA 1QX7A 3SJSA 4MVFA 3ZNIA 5D3OA 1BLQA 2I2RE 2F3YA 4HRGA 5FI7A 5HLOA 3CZ2A 2ZRSA 2KGRA 1EJ3A 2L4IA 3S0BA 1RK9A 1V1GA 5F6TA 3SS3A 2NCOA 1CFDA 3D0YA 2JNFA 4YBHB 3HX4A 2FJYA 2BCBA 3VRQA 2LMVA 2GTEA 1CLBA 3VRRA 5CSIA 1OZOA 5D69A 3DY9A 2G9BA 3GK1A 2OS8C 1RECA 2KBIA 3EG5B 2GGZA 4GBAA 1LXFC 2Q4UA 1S6CA 1AP4A 1F55A 2F8PA 2FCEA 3IVTA 3H4SE 2JZIA 1FBVA 3O4XA 5ER4X 4CPVA 2M97A 3DZTA 2BE4A 2I18A 1XFUO 2O5GA 1SBJA 3O78A 1ZUZA 1BG1A 2L51A 1IG5A 5CPVA 2QPTA 3LCPC 3OX5A 3D78A 1WDCB 2PRUA 1VRKA 2LHIA 3C1VA 3NSKA 1M31A 2JPOA 2KGBC 2JT3A 2VRGA 2NCPA 3L47A 1M63B 1OMVA 2BE6A 1QLSA 2JQ6A 2P71A 4ORBB 1DJZA 5PALA 3I5HB 2LNKA 2I7AA 4MRXA 1PALA 2O60A 3OB1B 3TUYC 2LP3A 1AVSA 4OZDA 2ERBA 1RJVA 4I5JA 4CFQA 5HKYA 5KTYA 5I8NA 1NCYA 1IJ5A 1EG4A 3R1PA 3CS1A 1QX2A 1GJYA 1QLKA 1T14A 3R1VA 3EKHA 4U8DA 1MWNA 4WQ3A 1PULA 3O6BA 3OBVA 2YGUA 1KCYA 2EC6B 2M8UA 1K94A 4DUQA 2LAPA 2PMYA 3K1EA 4MRYA 2K7DA 2NXQA 3I5IC 3SG7A 3RLZA 3AKBA 2L5XB 1CNPA 5I2OA 1KWOC 2BL0C 2KNEA 2LMTA 3D0YB 3PALA 1JUOA 1S36A 1RWYA 3B6XA 1IIOA 3E3RA 1CLLA 1SRAA 1OOGA 3D73A 1SYMA 1LS8A 3A4UB 4NDBA 3AAJA 1J55A 1A4PA 2KI4B 5KSZA 1FW4A 2RGIA 1TNWA 1QVIY 1U5IB 4JKTA 2QEHA 1OQPA 3I5HC 1NCXA 2EGDA 1L2OB 5B8IB 3I5IB 1BU3A 2P6BB 2CNPA 4FQOA 4F7FA 2ZNEA 1QATA 3FS7A 4USLA 4ORCB 3RZSA 2KI6C 3CYZA 4OR9B 1NX0A 3CGAA 3DXLA 5CSFA 3EKJA 2TN4A 1DT7B 3OP0A 1JF2A 5GQQC 1ZOTB 4PE1A 1B1GA 2HPSA 4ZCUA 2JC2A 2BKIB 2JWWA 1XFZO 2M29A 1RROA 1DTLA 2JXLA
chains in the Genus database with same CATH topology
3I5GC 1F4OA 1TTXA 2I94A 3TZ1A 2JT0A 1ZFSA 2OS8B 4R1EA 3SG6A 4AQJA 4C0KA 3IQOA 4M2QA 1SL9A 5CSJA 5DKQA 4NQGA 1YVHA 1FI5A 1L7ZA 2K61A 2WCEA 3AAKA 1LINA 2F3ZA 4DS7A 1SK6D 1U5IA 1SCMC 3KEVA 3KF9A 1OMRA 2F2PA 1ODBA 1TCOB 2HETA 2R2IA 1UWOA 2EHBA 2AUCA 4PE4A 2JU0A 1W7IB 1J7RA 1H8BA 1Y0VH 3BUXB 4YGEB 1OOJA 2WOSA 1BMOA 1MHOA 2JNXA 1K2HA 2OTGB 1QTXA 4PDZA 1M39A 3ZWHA 2G2BA 1CMGA 1DJIA 1SPYA 1WLMA 3ICBA 4MBEA 4C0JA 1CB1A 2L98A 1JWDA 1K9PA 2F2OA 1SL7A 4D1EA 1HT9A 3WHTB 1S5GZ 4IL1A 1PRWA 3PM8A 1QX5B 1PK0D 2A4JA 1F71A 5JOLA 1G8IA 1K8UA 4XJKB 5DKRA 1WRZA 2H61A 1JFJA 4WRIA 1YURA 2AMIA 1E8AA 1TIZA 2KHNA 1CDLA 2KAXA 4PE0A 2FCDA 2M49B 4MZLA 4I5LB 2GGMA 1A75A 2JTTA 1QV0A 2E30A 1KQVA 2ZRTA 1NCZA 1QIWA 1BF5A 2KBMA 3BUMB 3BOWA 4GNKB 3PFVA 2JT8A 3WXAA 4HREE 3OX6A 3JTDB 5HKZA 1F54A 1B9AA 1EG3A 1B4CA 3BQ3A 1CDNA 3DF0B 4I5KA 2JXCA 1YX8A 1CLMA 2CXJA 2PVBA 1MXEA 1JBAA 1SCVA 1WDCC 1DF0B 4ICBA 1NX2A 1W7JB 2K8MB 2E6WA 4PALA 4MLWA 2L50A 4YGAA 1CKKA 1Y1AA 2LUCA 1IKUA 3SIAA 4DRWA 2FJUB 1YX7A 3OHMB 1SR6B 1UHKA 3F45A 3VRNA 2LANA 4WQ2A 2L0PA 1AJ4A 1C7WA 3NSIA 2ZN9A 1AK8A 3JVTC 5AXIA 1R2UA 1HQVA 3DVKA 1DJYA 1LA3A 4XYNA 1N65A 1PVAA 1ALVA 1YUTA 1IRJA 2B1UA 2MAZA 5J3XA 1CMFA 1V1FA 1A2XA 1CFPA 2K2AA 2OPOA 4QJ4B 1WRLA 1XFVO 3VRPA 2WCFA 3SG5A 2JTZA 2JULA 2MA2A 1KK7Z 3D10A 2MHHA 4PHJA 1CM1A 2K7OA 3M0WA 1AJ5A 1NSHA 1XO5A 1XFYO 5FYXA 4XJKA 3TS5C 1JSAA 2MJWB 2BBNA 4GAOA 2JRFA 5IBWA 4PHNA 2JPTA 1UP5A 2K2FA 3CZTX 1QV1A 1UUSA 1IQ5A 1WLZA 3JVTB 3PN7C 1QASA 3NSOA 4NDDA 3TDUA 2LMUA 1X02A 1A75B 1BR4B 3GK2A 1MQ1A 5AFPA 4P5OE 1SR6C 1BR1B 1KQMC 2Q91A 3MSEB 3KHEA 4HRHA 2LP2A 2KDHA 4MZJA 1SKTA 1NPQA 5I2LA 4OVNF 2COLB 3DVJA 2KOTA 3DD4A 3HCMA 1YTZC 1BJFA 1K96A 1SCMB 1K90D 2KI6D 1GGZA 1G33A 3DF0A 2K7CA 3LL8B 4N5XA 1MXLC 1J7OA 3CR4X 1KFUS 4CIDA 3SIBA 4QJ3B 1IJ6A 1WRKA 1K93D 2M3WA 3RM1A 3IQQA 3EVVA 2BCXA 3LK0A 2PSRA 3BXKA 1S5GY 2D8NA 4PCWA 1KSOA 3DVEA 4JPZB 1M45A 1CDMA 3FWCA 2F33A 1DGVA 3NSLA 2LVKA 1TRFA 1YUSA 4YGBB 1QS7A 4PHKA 2L2EA 1J7QA 1KSMA 2M0RA 3PSRA 1AUIB 1K9UA 1SNLA 3SG3A 3GK4X 1H4BA 4CLNA 1XFXO 4DCKA 1FI6A 5D7FA 4UPGA 2MLFC 4OKHA 1JFKA 4N1FA 3I5FB 4P2YB 2LVIA 1GGWA 2H2KA 5JJGA 2BBMA 3TS5B 2ZFDA 1CFCA 3TDZA 1TNPA 1CTRA 1OE9B 2KYFA 2LVJA 4YI9A 2SCPA 1M46A 2MRDA 2LLTA 3CTNA 3IF7A 1DGUA 1XK4C 2PASA 4MN0A 5HYDA 4BY5A 1YRTB 2GV5A 1YUUA 2LHLA 1XVJA 2LE9B 1DJXA 2HF5A 2Y4QA 1BT6A 1TCFA 4CFRA 2BL0B 1KWOB 1FF1A 1N0YA 1S6IA 1IGVA 2LC5A 1OMDA 3EK7A 1QVIZ 4NDCA 3QRXA 1BODA 2OTGC 2WC8A 3CR2A 4GGFA 2K7BA 1BOCA 1MR8A 2KQYA 3LLEA 5KU1A 1EXRA 2HQWA 2KYCA 4PE7A 2WCBA 1G4YR 1Y1UA 1FPWA 3O4YA 1GQMA 1SW8A 4MSPA 3KO0A 4Q04A 3DVMA 1EL4A 1Y6WA 3CWGA 3FWBA 1DJHA 1PVBA 1SY9A 1DJGA 4AOMA 2WNDA 4YGDB 4M2PA 4A4CA 2ZNDA 3BUOB 1OSAA 1RTP1 1C7VA 1L2OC 1ZACA 1KFXL 2KFHA 1S26D 1NP8A 4OV2A 4OCIA 2M1UA 5DKNA 1YRUB 2KI4C 4JWQA 1TNQA 1AHRA 1B8RA 1CFFA 1ZMZA 2LV7A 5AERA 1DVIA 2KFGA 4MEWA 3VROA 1B8CA 1PSRA 2CTNA 3PATA 3JTDC 1Q80A 1NX1A 2M9GA 1F70A 1K95A 1F8HA 1ALWA 5HKWA 1MF8B 1TNXA 4C0LA 5BPJA 2KQ6A 1TN4A 2CCMA 1B47A 3EK8A 5ER5A 1DF0A 4AQIA 2FOTA 2DOQA 2KAYA 3PLFB 1NYAA 3AKAA 4GFTA 3I5FC 4GGNA 3SG4A 3CLNA 2JOJA 1EH2A 3A8RA 1S1EA 2ZN8A 3O2PA 2HQ8A 1SL8A 4GPLB 5I2QA 1WY9A 2ZKMX 1MUXA 4GGFC 2NLNA 1NIWA 5K89A 4HSZA 1JF0A 1UURA 2EC6C 1RFJA 4E68A 3CR5X 3TUYB 1KQMB 1QIVA 1B7TY 1S3PA 2M7NA 3NXAA 4M2OA 1IH0A 3SG2A 3WNXB 2CBLA 1UHHA 2SASA 3PN7B 4YI8A 1XFWO 5AANA 3LK1A 1KK8C 5AEQA 4YGCB 2CT9A 3GOFA 1LA0A 5HLVA 1QJTA 4ZCVA 2V53A 2M1KB 2M7LA 3EVUA 2Y1NA 1J7PA 1NX3A 1XYDA 4JQ0D 2BKHB 5TNCA 3WHUB 1F4QA 2Y5IA 2L4HA 2MLEC 1B7TZ 1YVLA 1J1EA 2K0JA 5CSNA 4ORAB 3I5GB 1DJWA 3FIAA 1J1DA 1XA5A 2IS9A 1UHNA 4FTGA 2KAVA 2LVVA 3EK4A 4TNCA 4A4BA 1IQ3A 2H61C 1UHJA 1Y1XA 1S6JA 2ISDA 1NUBA 1D1OA 4BY4A 2KFFA 2NZ0A 2LM5A 5G08A 2KSPA 2LLSA 1OZSA 4ETOA 1LVCD 2AAOA 1C07A 4YRUA 1QXPA 2LCPA 1DMOA 3BUWB 1B8LA 4PHMA 3BYAA 3EVRA 1JC2A 2MBXA 1K9KA 4F0ZB 1SMGA 1KK8B 3KPXA 4QJ5B 1YR5A 2BCAA 2PALA 2LUXA 1PSBA 4N1GA 1A29A 4GUKA 1NWDA 4I5NB 2QACA 1KK7Y 3VGOA 1UHIA 1TOPA 1A03A 1XK4A 2LLUA 3TDIA 2WORA 1KFUL 1IWQA 3BOWB 1R6PA 4DIRA 3K21A 1CM4A 3OB2B 2Y1MA 1CDPA 4MZKA 2BECA 3BUNB 4L9MA 1KFXS 1LKJA 1N2DA 1QX7A 3SJSA 4MVFA 3ZNIA 1BLQA 2I2RE 2F3YA 4HRGA 5HLOA 2ZRSA 2KGRA 1EJ3A 2L4IA 1RK9A 1V1GA 5F6TA 2NCOA 1CFDA 3D0YA 2JNFA 4YBHB 3HX4A 2BCBA 3VRQA 2LMVA 1CLBA 3VRRA 5CSIA 1OZOA 5D69A 2G9BA 3GK1A 2OS8C 1RECA 2KBIA 2GGZA 4GBAA 1LXFC 2Q4UA 1S6CA 1AP4A 1F55A 2F8PA 2FCEA 3H4SE 2JZIA 1FBVA 5ER4X 4CPVA 2M97A 2BE4A 2I18A 1XFUO 2O5GA 1SBJA 3O78A 1ZUZA 1BG1A 2L51A 1IG5A 5CPVA 2QPTA 3LCPC 3OX5A 1WDCB 2PRUA 1VRKA 2LHIA 3C1VA 3NSKA 1M31A 2KGBC 2JT3A 2VRGA 2NCPA 1M63B 1OMVA 2BE6A 1QLSA 2JQ6A 4ORBB 5PALA 1DJZA 3I5HB 2LNKA 2I7AA 4MRXA 1PALA 2O60A 3OB1B 3TUYC 2LP3A 1AVSA 1RJVA 4I5JA 4CFQA 5HKYA 5KTYA 5I8NA 1NCYA 1IJ5A 1EG4A 3CS1A 1QX2A 1GJYA 1QLKA 4U8DA 3EKHA 1MWNA 4WQ3A 1PULA 3O6BA 1KCYA 2EC6B 2M8UA 1K94A 4DUQA 2LAPA 2PMYA 4MRYA 2K7DA 2NXQA 3I5IC 3SG7A 3RLZA 3AKBA 2L5XB 1CNPA 5I2OA 1KWOC 2BL0C 2KNEA 2LMTA 3D0YB 3PALA 1JUOA 1S36A 1RWYA 3E3RA 1CLLA 1SRAA 1SYMA 3A4UB 4NDBA 3AAJA 1J55A 1A4PA 2KI4B 5KSZA 1FW4A 2RGIA 1TNWA 1QVIY 1U5IB 1OQPA 3I5HC 1NCXA 2EGDA 1L2OB 5B8IB 3I5IB 1BU3A 2P6BB 2CNPA 4FQOA 2ZNEA 1QATA 3FS7A 4USLA 4ORCB 2KI6C 4OR9B 1NX0A 3CGAA 5CSFA 3EKJA 2TN4A 1DT7B 3OP0A 1JF2A 5GQQC 1ZOTB 4PE1A 1B1GA 2HPSA 4ZCUA 2JC2A 2BKIB 2JWWA 1XFZO 2M29A 1RROA 1DTLA 2JXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5G C;  1F4O A;  1TTX A;  2I94 A;  3TZ1 A;  2JT0 A;  1ZFS A;  2OS8 B;  4R1E A;  3SG6 A;  4AQJ A;  4C0K A;  3IQO A;  4M2Q A;  1SL9 A;  5CSJ A;  5DKQ A;  4NQG A;  1YVH A;  1FI5 A;  1L7Z A;  2K61 A;  2WCE A;  3AAK A;  1LIN A;  2F3Z A;  4DS7 A;  1SK6 D;  1U5I A;  1SCM C;  3KEV A;  3KF9 A;  1OMR A;  2F2P A;  1ODB A;  1TCO B;  2HET A;  2R2I A;  1UWO A;  2EHB A;  2AUC A;  4PE4 A;  2JU0 A;  1W7I B;  1J7R A;  1H8B A;  1Y0V H;  3BUX B;  4YGE B;  1OOJ A;  2WOS A;  1BMO A;  1MHO A;  2JNX A;  1K2H A;  2OTG B;  1QTX A;  4PDZ A;  1M39 A;  3ZWH A;  2G2B A;  1CMG A;  1DJI A;  1SPY A;  1WLM A;  3ICB A;  4MBE A;  4C0J A;  1CB1 A;  2L98 A;  1JWD A;  1K9P A;  2F2O A;  1SL7 A;  4D1E A;  1HT9 A;  3WHT B;  1S5G Z;  4IL1 A;  1PRW A;  3PM8 A;  1QX5 B;  1PK0 D;  2A4J A;  1F71 A;  5JOL A;  1G8I A;  1K8U A;  4XJK B;  5DKR A;  1WRZ A;  2H61 A;  1JFJ A;  4WRI A;  1YUR A;  2AMI A;  1E8A A;  1TIZ A;  2KHN A;  1CDL A;  2KAX A;  4PE0 A;  2FCD A;  2M49 B;  4MZL A;  4I5L B;  2GGM A;  1A75 A;  2JTT A;  1QV0 A;  2E30 A;  1KQV A;  2ZRT A;  1NCZ A;  1QIW A;  1BF5 A;  2KBM A;  3BUM B;  3BOW A;  4GNK B;  3PFV A;  2JT8 A;  3WXA A;  4HRE E;  3OX6 A;  3JTD B;  5HKZ A;  1F54 A;  1B9A A;  1EG3 A;  1B4C A;  3BQ3 A;  1CDN A;  3DF0 B;  4I5K A;  2JXC A;  1YX8 A;  1CLM A;  2CXJ A;  2PVB A;  1MXE A;  1JBA A;  1SCV A;  1WDC C;  1DF0 B;  4ICB A;  1NX2 A;  1W7J B;  2K8M B;  2E6W A;  4PAL A;  4MLW A;  2L50 A;  4YGA A;  1CKK A;  1Y1A A;  2LUC A;  1IKU A;  3SIA A;  4DRW A;  2FJU B;  1YX7 A;  3OHM B;  1SR6 B;  1UHK A;  3F45 A;  3VRN A;  2LAN A;  4WQ2 A;  2L0P A;  1AJ4 A;  1C7W A;  3NSI A;  2ZN9 A;  1AK8 A;  3JVT C;  5AXI A;  1R2U A;  1HQV A;  3DVK A;  1DJY A;  1LA3 A;  4XYN A;  1N65 A;  1PVA A;  1ALV A;  1YUT A;  1IRJ A;  2B1U A;  2MAZ A;  5J3X A;  1CMF A;  1V1F A;  1A2X A;  1CFP A;  2K2A A;  2OPO A;  4QJ4 B;  1WRL A;  1XFV O;  3VRP A;  2WCF A;  3SG5 A;  2JTZ A;  2JUL A;  2MA2 A;  1KK7 Z;  3D10 A;  2MHH A;  4PHJ A;  1CM1 A;  2K7O A;  3M0W A;  1AJ5 A;  1NSH A;  1XO5 A;  1XFY O;  5FYX A;  4XJK A;  3TS5 C;  1JSA A;  2MJW B;  2BBN A;  4GAO A;  2JRF A;  5IBW A;  4PHN A;  2JPT A;  1UP5 A;  2K2F A;  3CZT X;  1QV1 A;  1UUS A;  1IQ5 A;  1WLZ A;  3JVT B;  3PN7 C;  1QAS A;  3NSO A;  4NDD A;  3TDU A;  2LMU A;  1X02 A;  1A75 B;  1BR4 B;  3GK2 A;  1MQ1 A;  5AFP A;  4P5O E;  1SR6 C;  1BR1 B;  1KQM C;  2Q91 A;  3MSE B;  3KHE A;  4HRH A;  2LP2 A;  2KDH A;  4MZJ A;  1SKT A;  1NPQ A;  5I2L A;  4OVN F;  2COL B;  3DVJ A;  2KOT A;  3DD4 A;  3HCM A;  1YTZ C;  1BJF A;  1K96 A;  1SCM B;  1K90 D;  2KI6 D;  1GGZ A;  1G33 A;  3DF0 A;  2K7C A;  3LL8 B;  4N5X A;  1MXL C;  1J7O A;  3CR4 X;  1KFU S;  4CID A;  3SIB A;  4QJ3 B;  1IJ6 A;  1WRK A;  1K93 D;  2M3W A;  3RM1 A;  3IQQ A;  3EVV A;  2BCX A;  3LK0 A;  2PSR A;  3BXK A;  1S5G Y;  2D8N A;  4PCW A;  1KSO A;  3DVE A;  4JPZ B;  1M45 A;  1CDM A;  3FWC A;  2F33 A;  1DGV A;  3NSL A;  2LVK A;  1TRF A;  1YUS A;  4YGB B;  1QS7 A;  4PHK A;  2L2E A;  1J7Q A;  1KSM A;  2M0R A;  3PSR A;  1AUI B;  1K9U A;  1SNL A;  3SG3 A;  3GK4 X;  1H4B A;  4CLN A;  1XFX O;  4DCK A;  1FI6 A;  5D7F A;  4UPG A;  2MLF C;  4OKH A;  1JFK A;  4N1F A;  3I5F B;  4P2Y B;  2LVI A;  1GGW A;  2H2K A;  5JJG A;  2BBM A;  3TS5 B;  2ZFD A;  1CFC A;  3TDZ A;  1TNP A;  1CTR A;  1OE9 B;  2KYF A;  2LVJ A;  4YI9 A;  2SCP A;  1M46 A;  2MRD A;  2LLT A;  3CTN A;  3IF7 A;  1DGU A;  1XK4 C;  2PAS A;  4MN0 A;  5HYD A;  4BY5 A;  1YRT B;  2GV5 A;  1YUU A;  2LHL A;  1XVJ A;  2LE9 B;  1DJX A;  2HF5 A;  2Y4Q A;  1BT6 A;  1TCF A;  4CFR A;  2BL0 B;  1KWO B;  1FF1 A;  1N0Y A;  1S6I A;  1IGV A;  2LC5 A;  1OMD A;  3EK7 A;  1QVI Z;  4NDC A;  3QRX A;  1BOD A;  2OTG C;  2WC8 A;  3CR2 A;  4GGF A;  2K7B A;  1BOC A;  1MR8 A;  2KQY A;  3LLE A;  5KU1 A;  1EXR A;  2HQW A;  2KYC A;  4PE7 A;  2WCB A;  1G4Y R;  1Y1U A;  1FPW A;  3O4Y A;  1GQM A;  1SW8 A;  4MSP A;  3KO0 A;  4Q04 A;  3DVM A;  1EL4 A;  1Y6W A;  3CWG A;  3FWB A;  1DJH A;  1PVB A;  1SY9 A;  1DJG A;  4AOM A;  2WND A;  4YGD B;  4M2P A;  4A4C A;  2ZND A;  3BUO B;  1OSA A;  1RTP 1;  1C7V A;  1L2O C;  1ZAC A;  1KFX L;  2KFH A;  1S26 D;  1NP8 A;  4OV2 A;  4OCI A;  2M1U A;  5DKN A;  1YRU B;  2KI4 C;  4JWQ A;  1TNQ A;  1AHR A;  1B8R A;  1CFF A;  1ZMZ A;  2LV7 A;  5AER A;  1DVI A;  2KFG A;  4MEW A;  3VRO A;  1B8C A;  1PSR A;  2CTN A;  3PAT A;  3JTD C;  1Q80 A;  1NX1 A;  2M9G A;  1F70 A;  1K95 A;  1F8H A;  1ALW A;  5HKW A;  1MF8 B;  1TNX A;  4C0L A;  5BPJ A;  2KQ6 A;  1TN4 A;  2CCM A;  1B47 A;  3EK8 A;  5ER5 A;  1DF0 A;  4AQI A;  2FOT A;  2DOQ A;  2KAY A;  3PLF B;  1NYA A;  3AKA A;  4GFT A;  3I5F C;  4GGN A;  3SG4 A;  3CLN A;  2JOJ A;  1EH2 A;  3A8R A;  1S1E A;  2ZN8 A;  3O2P A;  2HQ8 A;  1SL8 A;  4GPL B;  5I2Q A;  1WY9 A;  2ZKM X;  1MUX A;  4GGF C;  2NLN A;  1NIW A;  5K89 A;  4HSZ A;  1JF0 A;  1UUR A;  2EC6 C;  1RFJ A;  4E68 A;  3CR5 X;  3TUY B;  1KQM B;  1QIV A;  1B7T Y;  1S3P A;  2M7N A;  3NXA A;  4M2O A;  1IH0 A;  3SG2 A;  3WNX B;  2CBL A;  1UHH A;  2SAS A;  3PN7 B;  4YI8 A;  1XFW O;  5AAN A;  3LK1 A;  1KK8 C;  5AEQ A;  4YGC B;  2CT9 A;  3GOF A;  1LA0 A;  5HLV A;  1QJT A;  4ZCV A;  2V53 A;  2M1K B;  2M7L A;  3EVU A;  2Y1N A;  1J7P A;  1NX3 A;  1XYD A;  4JQ0 D;  2BKH B;  5TNC A;  3WHU B;  1F4Q A;  2Y5I A;  2L4H A;  2MLE C;  1B7T Z;  1YVL A;  1J1E A;  2K0J A;  5CSN A;  4ORA B;  3I5G B;  1DJW A;  3FIA A;  1J1D A;  1XA5 A;  2IS9 A;  1UHN A;  4FTG A;  2KAV A;  2LVV A;  3EK4 A;  4TNC A;  4A4B A;  1IQ3 A;  2H61 C;  1UHJ A;  1Y1X A;  1S6J A;  2ISD A;  1NUB A;  1D1O A;  4BY4 A;  2KFF A;  2NZ0 A;  2LM5 A;  5G08 A;  2KSP A;  2LLS A;  1OZS A;  4ETO A;  1LVC D;  2AAO A;  1C07 A;  4YRU A;  1QXP A;  2LCP A;  1DMO A;  3BUW B;  1B8L A;  4PHM A;  3BYA A;  3EVR A;  1JC2 A;  2MBX A;  1K9K A;  4F0Z B;  1SMG A;  1KK8 B;  3KPX A;  4QJ5 B;  1YR5 A;  2BCA A;  2PAL A;  2LUX A;  1PSB A;  4N1G A;  1A29 A;  4GUK A;  1NWD A;  4I5N B;  2QAC A;  1KK7 Y;  3VGO A;  1UHI A;  1TOP A;  1A03 A;  1XK4 A;  2LLU A;  3TDI A;  2WOR A;  1KFU L;  1IWQ A;  3BOW B;  1R6P A;  4DIR A;  3K21 A;  1CM4 A;  3OB2 B;  2Y1M A;  1CDP A;  4MZK A;  2BEC A;  3BUN B;  4L9M A;  1KFX S;  1LKJ A;  1N2D A;  1QX7 A;  3SJS A;  4MVF A;  3ZNI A;  1BLQ A;  2I2R E;  2F3Y A;  4HRG A;  5HLO A;  2ZRS A;  2KGR A;  1EJ3 A;  2L4I A;  1RK9 A;  1V1G A;  5F6T A;  2NCO A;  1CFD A;  3D0Y A;  2JNF A;  4YBH B;  3HX4 A;  2BCB A;  3VRQ A;  2LMV A;  1CLB A;  3VRR A;  5CSI A;  1OZO A;  5D69 A;  2G9B A;  3GK1 A;  2OS8 C;  1REC A;  2KBI A;  2GGZ A;  4GBA A;  1LXF C;  2Q4U A;  1S6C A;  1AP4 A;  1F55 A;  2F8P A;  2FCE A;  3H4S E;  2JZI A;  1FBV A;  5ER4 X;  4CPV A;  2M97 A;  2BE4 A;  2I18 A;  1XFU O;  2O5G A;  1SBJ A;  3O78 A;  1ZUZ A;  1BG1 A;  2L51 A;  1IG5 A;  5CPV A;  2QPT A;  3LCP C;  3OX5 A;  1WDC B;  2PRU A;  1VRK A;  2LHI A;  3C1V A;  3NSK A;  1M31 A;  2KGB C;  2JT3 A;  2VRG A;  2NCP A;  1M63 B;  1OMV A;  2BE6 A;  1QLS A;  2JQ6 A;  4ORB B;  5PAL A;  1DJZ A;  3I5H B;  2LNK A;  2I7A A;  4MRX A;  1PAL A;  2O60 A;  3OB1 B;  3TUY C;  2LP3 A;  1AVS A;  1RJV A;  4I5J A;  4CFQ A;  5HKY A;  5KTY A;  5I8N A;  1NCY A;  1IJ5 A;  1EG4 A;  3CS1 A;  1QX2 A;  1GJY A;  1QLK A;  4U8D A;  3EKH A;  1MWN A;  4WQ3 A;  1PUL A;  3O6B A;  1KCY A;  2EC6 B;  2M8U A;  1K94 A;  4DUQ A;  2LAP A;  2PMY A;  4MRY A;  2K7D A;  2NXQ A;  3I5I C;  3SG7 A;  3RLZ A;  3AKB A;  2L5X B;  1CNP A;  5I2O A;  1KWO C;  2BL0 C;  2KNE A;  2LMT A;  3D0Y B;  3PAL A;  1JUO A;  1S36 A;  1RWY A;  3E3R A;  1CLL A;  1SRA A;  1SYM A;  3A4U B;  4NDB A;  3AAJ A;  1J55 A;  1A4P A;  2KI4 B;  5KSZ A;  1FW4 A;  2RGI A;  1TNW A;  1QVI Y;  1U5I B;  1OQP A;  3I5H C;  1NCX A;  2EGD A;  1L2O B;  5B8I B;  3I5I B;  1BU3 A;  2P6B B;  2CNP A;  4FQO A;  2ZNE A;  1QAT A;  3FS7 A;  4USL A;  4ORC B;  2KI6 C;  4OR9 B;  1NX0 A;  3CGA A;  5CSF A;  3EKJ A;  2TN4 A;  1DT7 B;  3OP0 A;  1JF2 A;  5GQQ C;  1ZOT B;  4PE1 A;  1B1G A;  2HPS A;  4ZCU A;  2JC2 A;  2BKI B;  2JWW A;  1XFZ O;  2M29 A;  1RRO A;  1DTL A;  2JXL A; 
#chains in the Genus database with same CATH topology
 3I5G C;  1F4O A;  1TTX A;  2I94 A;  3TZ1 A;  2JT0 A;  1ZFS A;  2OS8 B;  3CAB A;  4R1E A;  3SG6 A;  4AQJ A;  4C0K A;  3IQO A;  4M2Q A;  1SL9 A;  2L2C A;  5CSJ A;  5DKQ A;  4NQG A;  1Z4H A;  1YVH A;  1FI5 A;  1L7Z A;  2K61 A;  2WCE A;  3AAK A;  1LIN A;  2F3Z A;  4DS7 A;  1TUZ A;  1SK6 D;  1U5I A;  1SCM C;  3KEV A;  3KF9 A;  1OMR A;  2F2P A;  3S0A A;  1ODB A;  1TCO B;  2HET A;  2PYQ A;  3B87 A;  3SS4 A;  2R2I A;  1UWO A;  2EHB A;  1QWV A;  2AUC A;  4PE4 A;  2JU0 A;  1W7I B;  1J7R A;  1H8B A;  3NHT A;  1Y0V H;  3BUX B;  1GM0 A;  4YGE B;  1OOJ A;  2WOS A;  1BMO A;  1MHO A;  2JNX A;  3R72 A;  1K2H A;  2OTG B;  1QTX A;  4PDZ A;  1M39 A;  3ZWH A;  2G2B A;  1CMG A;  1DJI A;  1SPY A;  1WLM A;  1DEL A;  3ICB A;  4MBE A;  4C0J A;  2L98 A;  1CB1 A;  1JWD A;  1K9P A;  2F2O A;  1SL7 A;  4D1E A;  1HT9 A;  3WHT B;  1S5G Z;  4IL1 A;  1PRW A;  3PM8 A;  1QX5 B;  1PK0 D;  2A4J A;  4KYN A;  1F71 A;  2QEB A;  2K60 A;  5JOL A;  1G8I A;  1K8U A;  2KLD A;  4XJK B;  5DKR A;  1WRZ A;  2H61 A;  1JFJ A;  4WRI A;  1YUR A;  2AMI A;  1E8A A;  1TIZ A;  2KHN A;  1CDL A;  2KAX A;  4PE0 A;  2FCD A;  2M49 B;  4MZL A;  4I5L B;  1DEK A;  2GGM A;  1A75 A;  2JTT A;  1QV0 A;  2E30 A;  2WC6 A;  2ZRT A;  1NCZ A;  1KQV A;  1QIW A;  1BF5 A;  2KBM A;  3BUM B;  3BOW A;  4GNK B;  3PFV A;  3CZ1 A;  2JT8 A;  3WXA A;  4HRE E;  3OX6 A;  3JTD B;  5HKZ A;  1F54 A;  1B9A A;  1EG3 A;  1B4C A;  3BQ3 A;  1CDN A;  3DF0 B;  4I5K A;  2JXC A;  1YX8 A;  1CLM A;  2CXJ A;  2PVB A;  1MXE A;  2WC5 A;  1JBA A;  1SCV A;  1WDC C;  1DF0 B;  4ICB A;  1NX2 A;  1W7J B;  2K8M B;  2WCL A;  2E6W A;  4PAL A;  4MLW A;  2L50 A;  4YGA A;  1CKK A;  1Y1A A;  3S0E A;  2LUC A;  1IKU A;  3SIA A;  3VB1 A;  2FJU B;  4DRW A;  1YX7 A;  3OHM B;  1SR6 B;  3S0G A;  2P70 A;  2BAP A;  1UHK A;  3F45 A;  3VRN A;  2LAN A;  4WQ2 A;  2L0P A;  1AJ4 A;  1C7W A;  3NSI A;  2ZN9 A;  1AK8 A;  3JVT C;  5AXI A;  1R2U A;  1ORG A;  1HQV A;  3DVK A;  1DJY A;  1LA3 A;  4XYN A;  1N65 A;  1PVA A;  1ALV A;  1YUT A;  1IRJ A;  2B1U A;  2MAZ A;  2WCJ A;  5J3X A;  1CMF A;  1W9Z A;  1V1F A;  1A2X A;  1CFP A;  2K2A A;  2OPO A;  5FI6 A;  4QJ4 B;  1WRL A;  1XFV O;  3VRP A;  2WCF A;  3SG5 A;  2JTZ A;  2JUL A;  2MA2 A;  1KK7 Z;  3D10 A;  2MHH A;  2PQL A;  4PHJ A;  1CM1 A;  2K7O A;  3M0W A;  1AJ5 A;  1NSH A;  1XO5 A;  1XFY O;  5FYX A;  4XJK A;  3TS5 C;  1JSA A;  2MJW B;  2BBN A;  4GAO A;  2JRF A;  5IBW A;  4PHN A;  2JPT A;  1UP5 A;  2K2F A;  3CZT X;  1QV1 A;  1UUS A;  1IQ5 A;  1WLZ A;  3JVT B;  3PN7 C;  1QAS A;  3NSO A;  4NDD A;  3TDU A;  3BFB A;  1C3Y A;  2LMU A;  1X02 A;  1A75 B;  1BR4 B;  3GK2 A;  1MQ1 A;  5AFP A;  3Q8I A;  4P5O E;  1SR6 C;  1BR1 B;  1KQM C;  2Q91 A;  3MSE B;  3KHE A;  4HRH A;  2LP2 A;  2KDH A;  4MZJ A;  1SKT A;  1NPQ A;  5I2L A;  4OVN F;  2COL B;  3DVJ A;  3SS5 A;  2KOT A;  3DD4 A;  3HCM A;  1YTZ C;  1BJF A;  1K96 A;  1SCM B;  3B7A A;  1K90 D;  1OW4 A;  2KI6 D;  1GGZ A;  1G33 A;  1OOF A;  2WCM A;  3DF0 A;  2K7C A;  3LL8 B;  4N5X A;  1MXL C;  1J7O A;  3CR4 X;  1KFU S;  4CID A;  3SIB A;  4QJ3 B;  1IJ6 A;  1WRK A;  1K93 D;  2M3W A;  3RM1 A;  3IQQ A;  3EVV A;  2BCX A;  3LK0 A;  2PSR A;  2QEV A;  3BXK A;  3R1O A;  1S5G Y;  2D8N A;  4PCW A;  1KSO A;  3DVE A;  4JPZ B;  1M45 A;  2WCK A;  1CDM A;  3FWC A;  3BJH A;  5I94 A;  2F33 A;  1DGV A;  3NSL A;  2LVK A;  1TRF A;  1YUS A;  3PJI A;  4YGB B;  1QS7 A;  4PHK A;  2L2E A;  1J7Q A;  1KSM A;  2M0R A;  3PSR A;  5FI2 A;  1AUI B;  1K9U A;  1SNL A;  1XFR A;  3SG3 A;  3GK4 X;  1H4B A;  4CLN A;  4FQT A;  2BNX A;  1DQE A;  1XFX O;  4DCK A;  1FI6 A;  5D7F A;  4UPG A;  3UNW A;  2MLF C;  4OKH A;  1C3Z A;  1JFK A;  4N1F A;  3I5F B;  4P2Y B;  2LVI A;  1GGW A;  2H2K A;  5JJG A;  2BBM A;  3NGV A;  3TS5 B;  2ZFD A;  1CFC A;  3QME A;  3TDZ A;  1TNP A;  1CTR A;  1OE9 B;  2KYF A;  2LVJ A;  4YI9 A;  2SCP A;  1M46 A;  2MRD A;  2QEO A;  2LLT A;  3CTN A;  3IF7 A;  1DGU A;  1XK4 C;  2PAS A;  3CDN A;  4MN0 A;  5HYD A;  1SSE B;  4BY5 A;  1YRT B;  2GV5 A;  1YUU A;  2LHL A;  1XVJ A;  2LE9 B;  1DJX A;  2HF5 A;  3D76 A;  2Y4Q A;  1BT6 A;  3FE6 A;  1TCF A;  4CFR A;  2BL0 B;  1KWO B;  1FF1 A;  1N0Y A;  1S6I A;  1IGV A;  2LC5 A;  1OMD A;  3EK7 A;  1QVI Z;  4NDC A;  3QRX A;  1BOD A;  2OTG C;  2WC8 A;  3CR2 A;  4GGF A;  2K7B A;  1BOC A;  1MR8 A;  2KQY A;  3LLE A;  5KU1 A;  1EXR A;  2HQW A;  2KYC A;  4PE7 A;  2WCB A;  1G4Y R;  3L4A A;  2WCH A;  1Y1U A;  1FPW A;  3O4Y A;  1GQM A;  1SW8 A;  4MSP A;  2KLE A;  3KO0 A;  3NHI A;  4Q04 A;  3DVM A;  1EL4 A;  1Y6W A;  3CWG A;  3DYE A;  3FWB A;  1DJH A;  1PVB A;  1SY9 A;  3OGN A;  1DJG A;  2L5Y A;  2WND A;  4YGD B;  4M2P A;  4A4C A;  4AOM A;  2ZND A;  3BUO B;  1OSA A;  1RTP 1;  1C7V A;  1L2O C;  1ZAC A;  1KFX L;  2KFH A;  1S26 D;  1NP8 A;  4OV2 A;  4OCI A;  2M1U A;  5DKN A;  1YRU B;  2KI4 C;  4JWQ A;  1TNQ A;  1AHR A;  1B8R A;  1TWO A;  1CFF A;  1ZMZ A;  2LV7 A;  5AER A;  1DVI A;  2KFG A;  4MEW A;  3VRO A;  1B8C A;  2KPH A;  1PSR A;  2CTN A;  3PAT A;  3FE8 A;  3JTD C;  4PT1 A;  5EL2 A;  1Z2C B;  1Q80 A;  1NX1 A;  2M9G A;  3D77 A;  1K95 A;  1F70 A;  1ALW A;  1F8H A;  5HKW A;  1MF8 B;  1TNX A;  4C0L A;  5BPJ A;  2KQ6 A;  1TN4 A;  2CCM A;  1B47 A;  3EK8 A;  5ER5 A;  1DF0 A;  4AQI A;  2FOT A;  2DOQ A;  2KAY A;  3PLF B;  1NYA A;  3AKA A;  4GFT A;  3I5F C;  4GGN A;  3SG4 A;  3CLN A;  2JOJ A;  1EH2 A;  3A8R A;  1S1E A;  2ZN8 A;  3O2P A;  2HQ8 A;  1SL8 A;  4GPL B;  5I2Q A;  1WY9 A;  2ZKM X;  4JD9 A;  3B86 A;  3B88 A;  1MUX A;  4GGF C;  2NLN A;  1NIW A;  4IJ7 A;  5K89 A;  4HSZ A;  1JF0 A;  1UUR A;  2EC6 C;  1RFJ A;  4E68 A;  3CR5 X;  4INW A;  1KQM B;  3D74 A;  3TUY B;  1QIV A;  1B7T Y;  1S3P A;  2M7N A;  3NXA A;  3D75 A;  1P28 A;  4M2O A;  1IH0 A;  3SG2 A;  3WNX B;  2CBL A;  1UHH A;  2SAS A;  3PN7 B;  5DIC A;  4YI8 A;  1XFW O;  5AAN A;  3LK1 A;  1KK8 C;  5AEQ A;  4YGC B;  2CT9 A;  3GOF A;  1LA0 A;  3BFH A;  5HLV A;  1QJT A;  4ZCV A;  2V53 A;  2M1K B;  2M7L A;  3EVU A;  2Y1N A;  1J7P A;  1NX3 A;  1XYD A;  3L4L A;  3N7H A;  2BKH B;  4JQ0 D;  5TNC A;  3WHU B;  1F4Q A;  2Y5I A;  2L4H A;  2MLE C;  1B7T Z;  1YVL A;  1J1E A;  2K0J A;  5CSN A;  4ORA B;  3I5G B;  1DJW A;  3FIA A;  1J1D A;  1XA5 A;  2IS9 A;  1UHN A;  4FTG A;  2KAV A;  3V2L A;  2LVV A;  1OOH A;  3EK4 A;  4TNC A;  4A4B A;  1IQ3 A;  2H61 C;  1UHJ A;  1Y1X A;  1S6J A;  2ISD A;  1NUB A;  4INX A;  1D1O A;  3BFA A;  4BY4 A;  2KFF A;  3CZ0 A;  2NZ0 A;  2LM5 A;  5G08 A;  2KSP A;  2LLS A;  1OZS A;  4ETO A;  1LVC D;  2AAO A;  2QDI A;  3UO9 A;  1C07 A;  2H8V A;  1QXP A;  2LCP A;  4YRU A;  3BUW B;  1DMO A;  1B8L A;  3FE9 A;  3PM2 A;  4PHM A;  3BYA A;  3EVR A;  1JC2 A;  2MBX A;  3S0F A;  1K9K A;  4F0Z B;  1SMG A;  1KK8 B;  3KPX A;  1OOI X;  4QJ5 B;  1YR5 A;  2BCA A;  2PAL A;  2LUX A;  1PSB A;  4N1G A;  1A29 A;  4GUK A;  1NWD A;  4I5N B;  2QAC A;  1KK7 Y;  3VGO A;  1UHI A;  1TOP A;  1DC1 A;  5HL1 A;  1A03 A;  1XK4 A;  1TUJ A;  2LLU A;  3TDI A;  2WOR A;  3S0D A;  1KFU L;  1IWQ A;  3BOW B;  1R6P A;  4DIR A;  3K21 A;  1CM4 A;  3OB2 B;  2Y1M A;  1CDP A;  4MZK A;  2BEC A;  3BUN B;  4L9M A;  1KFX S;  1LKJ A;  1N2D A;  1QX7 A;  3SJS A;  4MVF A;  3ZNI A;  5D3O A;  1BLQ A;  2I2R E;  2F3Y A;  4HRG A;  5FI7 A;  5HLO A;  3CZ2 A;  2ZRS A;  2KGR A;  1EJ3 A;  2L4I A;  3S0B A;  1RK9 A;  1V1G A;  5F6T A;  3SS3 A;  2NCO A;  1CFD A;  3D0Y A;  2JNF A;  4YBH B;  3HX4 A;  2FJY A;  2BCB A;  3VRQ A;  2LMV A;  2GTE A;  1CLB A;  3VRR A;  5CSI A;  1OZO A;  5D69 A;  3DY9 A;  2G9B A;  3GK1 A;  2OS8 C;  1REC A;  2KBI A;  3EG5 B;  2GGZ A;  4GBA A;  1LXF C;  2Q4U A;  1S6C A;  1AP4 A;  1F55 A;  2F8P A;  2FCE A;  3IVT A;  3H4S E;  2JZI A;  1FBV A;  3O4X A;  5ER4 X;  4CPV A;  2M97 A;  3DZT A;  2BE4 A;  2I18 A;  1XFU O;  2O5G A;  1SBJ A;  3O78 A;  1ZUZ A;  1BG1 A;  2L51 A;  1IG5 A;  5CPV A;  2QPT A;  3LCP C;  3OX5 A;  3D78 A;  1WDC B;  2PRU A;  1VRK A;  2LHI A;  3C1V A;  3NSK A;  1M31 A;  2JPO A;  2KGB C;  2JT3 A;  2VRG A;  2NCP A;  3L47 A;  1M63 B;  1OMV A;  2BE6 A;  1QLS A;  2JQ6 A;  2P71 A;  4ORB B;  1DJZ A;  5PAL A;  3I5H B;  2LNK A;  2I7A A;  4MRX A;  1PAL A;  2O60 A;  3OB1 B;  3TUY C;  2LP3 A;  1AVS A;  4OZD A;  2ERB A;  1RJV A;  4I5J A;  4CFQ A;  5HKY A;  5KTY A;  5I8N A;  1NCY A;  1IJ5 A;  1EG4 A;  3R1P A;  3CS1 A;  1QX2 A;  1GJY A;  1QLK A;  1T14 A;  3R1V A;  3EKH A;  4U8D A;  1MWN A;  4WQ3 A;  1PUL A;  3O6B A;  3OBV A;  2YGU A;  1KCY A;  2EC6 B;  2M8U A;  1K94 A;  4DUQ A;  2LAP A;  2PMY A;  3K1E A;  4MRY A;  2K7D A;  2NXQ A;  3I5I C;  3SG7 A;  3RLZ A;  3AKB A;  2L5X B;  1CNP A;  5I2O A;  1KWO C;  2BL0 C;  2KNE A;  2LMT A;  3D0Y B;  3PAL A;  1JUO A;  1S36 A;  1RWY A;  3B6X A;  1IIO A;  3E3R A;  1CLL A;  1SRA A;  1OOG A;  3D73 A;  1SYM A;  1LS8 A;  3A4U B;  4NDB A;  3AAJ A;  1J55 A;  1A4P A;  2KI4 B;  5KSZ A;  1FW4 A;  2RGI A;  1TNW A;  1QVI Y;  1U5I B;  4JKT A;  2QEH A;  1OQP A;  3I5H C;  1NCX A;  2EGD A;  1L2O B;  5B8I B;  3I5I B;  1BU3 A;  2P6B B;  2CNP A;  4FQO A;  4F7F A;  2ZNE A;  1QAT A;  3FS7 A;  4USL A;  4ORC B;  3RZS A;  2KI6 C;  3CYZ A;  4OR9 B;  1NX0 A;  3CGA A;  3DXL A;  5CSF A;  3EKJ A;  2TN4 A;  1DT7 B;  3OP0 A;  1JF2 A;  5GQQ C;  1ZOT B;  4PE1 A;  1B1G A;  2HPS A;  4ZCU A;  2JC2 A;  2BKI B;  2JWW A;  1XFZ O;  2M29 A;  1RRO A;  1DTL A;  2JXL A; 
#chains in the Genus database with same CATH homology
 3I5G C;  1F4O A;  1TTX A;  2I94 A;  3TZ1 A;  2JT0 A;  1ZFS A;  2OS8 B;  4R1E A;  3SG6 A;  4AQJ A;  4C0K A;  3IQO A;  4M2Q A;  1SL9 A;  5CSJ A;  5DKQ A;  4NQG A;  1YVH A;  1FI5 A;  1L7Z A;  2K61 A;  2WCE A;  3AAK A;  1LIN A;  2F3Z A;  4DS7 A;  1SK6 D;  1U5I A;  1SCM C;  3KEV A;  3KF9 A;  1OMR A;  2F2P A;  1ODB A;  1TCO B;  2HET A;  2R2I A;  1UWO A;  2EHB A;  2AUC A;  4PE4 A;  2JU0 A;  1W7I B;  1J7R A;  1H8B A;  1Y0V H;  3BUX B;  4YGE B;  1OOJ A;  2WOS A;  1BMO A;  1MHO A;  2JNX A;  1K2H A;  2OTG B;  1QTX A;  4PDZ A;  1M39 A;  3ZWH A;  2G2B A;  1CMG A;  1DJI A;  1SPY A;  1WLM A;  3ICB A;  4MBE A;  4C0J A;  1CB1 A;  2L98 A;  1JWD A;  1K9P A;  2F2O A;  1SL7 A;  4D1E A;  1HT9 A;  3WHT B;  1S5G Z;  4IL1 A;  1PRW A;  3PM8 A;  1QX5 B;  1PK0 D;  2A4J A;  1F71 A;  5JOL A;  1G8I A;  1K8U A;  4XJK B;  5DKR A;  1WRZ A;  2H61 A;  1JFJ A;  4WRI A;  1YUR A;  2AMI A;  1E8A A;  1TIZ A;  2KHN A;  1CDL A;  2KAX A;  4PE0 A;  2FCD A;  2M49 B;  4MZL A;  4I5L B;  2GGM A;  1A75 A;  2JTT A;  1QV0 A;  2E30 A;  1KQV A;  2ZRT A;  1NCZ A;  1QIW A;  1BF5 A;  2KBM A;  3BUM B;  3BOW A;  4GNK B;  3PFV A;  2JT8 A;  3WXA A;  4HRE E;  3OX6 A;  3JTD B;  5HKZ A;  1F54 A;  1B9A A;  1EG3 A;  1B4C A;  3BQ3 A;  1CDN A;  3DF0 B;  4I5K A;  2JXC A;  1YX8 A;  1CLM A;  2CXJ A;  2PVB A;  1MXE A;  1JBA A;  1SCV A;  1WDC C;  1DF0 B;  4ICB A;  1NX2 A;  1W7J B;  2K8M B;  2E6W A;  4PAL A;  4MLW A;  2L50 A;  4YGA A;  1CKK A;  1Y1A A;  2LUC A;  1IKU A;  3SIA A;  4DRW A;  2FJU B;  1YX7 A;  3OHM B;  1SR6 B;  1UHK A;  3F45 A;  3VRN A;  2LAN A;  4WQ2 A;  2L0P A;  1AJ4 A;  1C7W A;  3NSI A;  2ZN9 A;  1AK8 A;  3JVT C;  5AXI A;  1R2U A;  1HQV A;  3DVK A;  1DJY A;  1LA3 A;  4XYN A;  1N65 A;  1PVA A;  1ALV A;  1YUT A;  1IRJ A;  2B1U A;  2MAZ A;  5J3X A;  1CMF A;  1V1F A;  1A2X A;  1CFP A;  2K2A A;  2OPO A;  4QJ4 B;  1WRL A;  1XFV O;  3VRP A;  2WCF A;  3SG5 A;  2JTZ A;  2JUL A;  2MA2 A;  1KK7 Z;  3D10 A;  2MHH A;  4PHJ A;  1CM1 A;  2K7O A;  3M0W A;  1AJ5 A;  1NSH A;  1XO5 A;  1XFY O;  5FYX A;  4XJK A;  3TS5 C;  1JSA A;  2MJW B;  2BBN A;  4GAO A;  2JRF A;  5IBW A;  4PHN A;  2JPT A;  1UP5 A;  2K2F A;  3CZT X;  1QV1 A;  1UUS A;  1IQ5 A;  1WLZ A;  3JVT B;  3PN7 C;  1QAS A;  3NSO A;  4NDD A;  3TDU A;  2LMU A;  1X02 A;  1A75 B;  1BR4 B;  3GK2 A;  1MQ1 A;  5AFP A;  4P5O E;  1SR6 C;  1BR1 B;  1KQM C;  2Q91 A;  3MSE B;  3KHE A;  4HRH A;  2LP2 A;  2KDH A;  4MZJ A;  1SKT A;  1NPQ A;  5I2L A;  4OVN F;  2COL B;  3DVJ A;  2KOT A;  3DD4 A;  3HCM A;  1YTZ C;  1BJF A;  1K96 A;  1SCM B;  1K90 D;  2KI6 D;  1GGZ A;  1G33 A;  3DF0 A;  2K7C A;  3LL8 B;  4N5X A;  1MXL C;  1J7O A;  3CR4 X;  1KFU S;  4CID A;  3SIB A;  4QJ3 B;  1IJ6 A;  1WRK A;  1K93 D;  2M3W A;  3RM1 A;  3IQQ A;  3EVV A;  2BCX A;  3LK0 A;  2PSR A;  3BXK A;  1S5G Y;  2D8N A;  4PCW A;  1KSO A;  3DVE A;  4JPZ B;  1M45 A;  1CDM A;  3FWC A;  2F33 A;  1DGV A;  3NSL A;  2LVK A;  1TRF A;  1YUS A;  4YGB B;  1QS7 A;  4PHK A;  2L2E A;  1J7Q A;  1KSM A;  2M0R A;  3PSR A;  1AUI B;  1K9U A;  1SNL A;  3SG3 A;  3GK4 X;  1H4B A;  4CLN A;  1XFX O;  4DCK A;  1FI6 A;  5D7F A;  4UPG A;  2MLF C;  4OKH A;  1JFK A;  4N1F A;  3I5F B;  4P2Y B;  2LVI A;  1GGW A;  2H2K A;  5JJG A;  2BBM A;  3TS5 B;  2ZFD A;  1CFC A;  3TDZ A;  1TNP A;  1CTR A;  1OE9 B;  2KYF A;  2LVJ A;  4YI9 A;  2SCP A;  1M46 A;  2MRD A;  2LLT A;  3CTN A;  3IF7 A;  1DGU A;  1XK4 C;  2PAS A;  4MN0 A;  5HYD A;  4BY5 A;  1YRT B;  2GV5 A;  1YUU A;  2LHL A;  1XVJ A;  2LE9 B;  1DJX A;  2HF5 A;  2Y4Q A;  1BT6 A;  1TCF A;  4CFR A;  2BL0 B;  1KWO B;  1FF1 A;  1N0Y A;  1S6I A;  1IGV A;  2LC5 A;  1OMD A;  3EK7 A;  1QVI Z;  4NDC A;  3QRX A;  1BOD A;  2OTG C;  2WC8 A;  3CR2 A;  4GGF A;  2K7B A;  1BOC A;  1MR8 A;  2KQY A;  3LLE A;  5KU1 A;  1EXR A;  2HQW A;  2KYC A;  4PE7 A;  2WCB A;  1G4Y R;  1Y1U A;  1FPW A;  3O4Y A;  1GQM A;  1SW8 A;  4MSP A;  3KO0 A;  4Q04 A;  3DVM A;  1EL4 A;  1Y6W A;  3CWG A;  3FWB A;  1DJH A;  1PVB A;  1SY9 A;  1DJG A;  4AOM A;  2WND A;  4YGD B;  4M2P A;  4A4C A;  2ZND A;  3BUO B;  1OSA A;  1RTP 1;  1C7V A;  1L2O C;  1ZAC A;  1KFX L;  2KFH A;  1S26 D;  1NP8 A;  4OV2 A;  4OCI A;  2M1U A;  5DKN A;  1YRU B;  2KI4 C;  4JWQ A;  1TNQ A;  1AHR A;  1B8R A;  1CFF A;  1ZMZ A;  2LV7 A;  5AER A;  1DVI A;  2KFG A;  4MEW A;  3VRO A;  1B8C A;  1PSR A;  2CTN A;  3PAT A;  3JTD C;  1Q80 A;  1NX1 A;  2M9G A;  1F70 A;  1K95 A;  1F8H A;  1ALW A;  5HKW A;  1MF8 B;  1TNX A;  4C0L A;  5BPJ A;  2KQ6 A;  1TN4 A;  2CCM A;  1B47 A;  3EK8 A;  5ER5 A;  1DF0 A;  4AQI A;  2FOT A;  2DOQ A;  2KAY A;  3PLF B;  1NYA A;  3AKA A;  4GFT A;  3I5F C;  4GGN A;  3SG4 A;  3CLN A;  2JOJ A;  1EH2 A;  3A8R A;  1S1E A;  2ZN8 A;  3O2P A;  2HQ8 A;  1SL8 A;  4GPL B;  5I2Q A;  1WY9 A;  2ZKM X;  1MUX A;  4GGF C;  2NLN A;  1NIW A;  5K89 A;  4HSZ A;  1JF0 A;  1UUR A;  2EC6 C;  1RFJ A;  4E68 A;  3CR5 X;  3TUY B;  1KQM B;  1QIV A;  1B7T Y;  1S3P A;  2M7N A;  3NXA A;  4M2O A;  1IH0 A;  3SG2 A;  3WNX B;  2CBL A;  1UHH A;  2SAS A;  3PN7 B;  4YI8 A;  1XFW O;  5AAN A;  3LK1 A;  1KK8 C;  5AEQ A;  4YGC B;  2CT9 A;  3GOF A;  1LA0 A;  5HLV A;  1QJT A;  4ZCV A;  2V53 A;  2M1K B;  2M7L A;  3EVU A;  2Y1N A;  1J7P A;  1NX3 A;  1XYD A;  4JQ0 D;  2BKH B;  5TNC A;  3WHU B;  1F4Q A;  2Y5I A;  2L4H A;  2MLE C;  1B7T Z;  1YVL A;  1J1E A;  2K0J A;  5CSN A;  4ORA B;  3I5G B;  1DJW A;  3FIA A;  1J1D A;  1XA5 A;  2IS9 A;  1UHN A;  4FTG A;  2KAV A;  2LVV A;  3EK4 A;  4TNC A;  4A4B A;  1IQ3 A;  2H61 C;  1UHJ A;  1Y1X A;  1S6J A;  2ISD A;  1NUB A;  1D1O A;  4BY4 A;  2KFF A;  2NZ0 A;  2LM5 A;  5G08 A;  2KSP A;  2LLS A;  1OZS A;  4ETO A;  1LVC D;  2AAO A;  1C07 A;  4YRU A;  1QXP A;  2LCP A;  1DMO A;  3BUW B;  1B8L A;  4PHM A;  3BYA A;  3EVR A;  1JC2 A;  2MBX A;  1K9K A;  4F0Z B;  1SMG A;  1KK8 B;  3KPX A;  4QJ5 B;  1YR5 A;  2BCA A;  2PAL A;  2LUX A;  1PSB A;  4N1G A;  1A29 A;  4GUK A;  1NWD A;  4I5N B;  2QAC A;  1KK7 Y;  3VGO A;  1UHI A;  1TOP A;  1A03 A;  1XK4 A;  2LLU A;  3TDI A;  2WOR A;  1KFU L;  1IWQ A;  3BOW B;  1R6P A;  4DIR A;  3K21 A;  1CM4 A;  3OB2 B;  2Y1M A;  1CDP A;  4MZK A;  2BEC A;  3BUN B;  4L9M A;  1KFX S;  1LKJ A;  1N2D A;  1QX7 A;  3SJS A;  4MVF A;  3ZNI A;  1BLQ A;  2I2R E;  2F3Y A;  4HRG A;  5HLO A;  2ZRS A;  2KGR A;  1EJ3 A;  2L4I A;  1RK9 A;  1V1G A;  5F6T A;  2NCO A;  1CFD A;  3D0Y A;  2JNF A;  4YBH B;  3HX4 A;  2BCB A;  3VRQ A;  2LMV A;  1CLB A;  3VRR A;  5CSI A;  1OZO A;  5D69 A;  2G9B A;  3GK1 A;  2OS8 C;  1REC A;  2KBI A;  2GGZ A;  4GBA A;  1LXF C;  2Q4U A;  1S6C A;  1AP4 A;  1F55 A;  2F8P A;  2FCE A;  3H4S E;  2JZI A;  1FBV A;  5ER4 X;  4CPV A;  2M97 A;  2BE4 A;  2I18 A;  1XFU O;  2O5G A;  1SBJ A;  3O78 A;  1ZUZ A;  1BG1 A;  2L51 A;  1IG5 A;  5CPV A;  2QPT A;  3LCP C;  3OX5 A;  1WDC B;  2PRU A;  1VRK A;  2LHI A;  3C1V A;  3NSK A;  1M31 A;  2KGB C;  2JT3 A;  2VRG A;  2NCP A;  1M63 B;  1OMV A;  2BE6 A;  1QLS A;  2JQ6 A;  4ORB B;  5PAL A;  1DJZ A;  3I5H B;  2LNK A;  2I7A A;  4MRX A;  1PAL A;  2O60 A;  3OB1 B;  3TUY C;  2LP3 A;  1AVS A;  1RJV A;  4I5J A;  4CFQ A;  5HKY A;  5KTY A;  5I8N A;  1NCY A;  1IJ5 A;  1EG4 A;  3CS1 A;  1QX2 A;  1GJY A;  1QLK A;  4U8D A;  3EKH A;  1MWN A;  4WQ3 A;  1PUL A;  3O6B A;  1KCY A;  2EC6 B;  2M8U A;  1K94 A;  4DUQ A;  2LAP A;  2PMY A;  4MRY A;  2K7D A;  2NXQ A;  3I5I C;  3SG7 A;  3RLZ A;  3AKB A;  2L5X B;  1CNP A;  5I2O A;  1KWO C;  2BL0 C;  2KNE A;  2LMT A;  3D0Y B;  3PAL A;  1JUO A;  1S36 A;  1RWY A;  3E3R A;  1CLL A;  1SRA A;  1SYM A;  3A4U B;  4NDB A;  3AAJ A;  1J55 A;  1A4P A;  2KI4 B;  5KSZ A;  1FW4 A;  2RGI A;  1TNW A;  1QVI Y;  1U5I B;  1OQP A;  3I5H C;  1NCX A;  2EGD A;  1L2O B;  5B8I B;  3I5I B;  1BU3 A;  2P6B B;  2CNP A;  4FQO A;  2ZNE A;  1QAT A;  3FS7 A;  4USL A;  4ORC B;  2KI6 C;  4OR9 B;  1NX0 A;  3CGA A;  5CSF A;  3EKJ A;  2TN4 A;  1DT7 B;  3OP0 A;  1JF2 A;  5GQQ C;  1ZOT B;  4PE1 A;  1B1G A;  2HPS A;  4ZCU A;  2JC2 A;  2BKI B;  2JWW A;  1XFZ O;  2M29 A;  1RRO A;  1DTL A;  2JXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...