1RJVA

Solution structure of human alpha-parvalbumin refined with a paramagnetism-based strategy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Paramagnetism-Based Refinement Strategy for the Solution Structure of Human alpha-Parvalbumin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rjvA00
4DS7A 4N1FA 4HRHA 4CLNA 2BCXA 1JWDA 2ZNDA 3TDIA 1CLBA 2KI4B 4OV2A 2WOSA 1K9UA 1K90D 1BOCA 1B47A 5PALA 2JOJA 4YGAA 4GUKA 3ZWHA 4MLWA 1QXPA 3EKHA 1BLQA 1LINA 3RM1A 3BUOB 1YVLA 2HF5A 3KO0A 2H2KA 1PSBA 3GK1A 4YGBB 3BYAA 1UHKA 1KCYA 1CLLA 2JT0A 1XK4C 3PSRA 1CNPA 1J7OA 1C7WA 1YUUA 2DOQA 2KBMA 2L5XB 3JVTB 3MSEB 3TS5C 1CDPA 2KYCA 5AFPA 1KQVA 3WHTB 4C0KA 3PLFB 1MQ1A 3FWCA 4WRIA 2QACA 1BG1A 1KFXL 1MUXA 1TNWA 4YGCB 3WXAA 1UHJA 3I5FB 3CTNA 4FTGA 2OS8B 1IH0A 3DVKA 1K9KA 1AJ4A 3DVMA 1M45A 1U5IA 2L2EA 1RWYA 4U8DA 2EC6B 3DVEA 3A8RA 4PE7A 3IQQA 2OPOA 3VRNA 4F0ZB 1TNXA 1KK8C 3WHUB 2OTGB 1IWQA 2KGBC 1EJ3A 4XYNA 2E6WA 1B7TZ 1MWNA 1YRTB 2F2OA 1M63B 3SG6A 1EXRA 2NXQA 3CWGA 4MZKA 4P5OE 3I5HC 2AMIA 1YX7A 1CB1A 3O6BA 1NSHA 2NZ0A 2KGRA 3JTDB 1WRKA 4I5KA 1XFVO 3SIBA 1XVJA 1KWOC 5ER5A 1B8CA 2LC5A 1YTZC 4JQ0D 1GQMA 4AOMA 1SNLA 2M29A 4M2OA 2JU0A 3SJSA 3CS1A 2Y1MA 1CM4A 5K89A 2KNEA 4DRWA 3I5HB 1NX3A 1KK7Z 1CLMA 2BBNA 5CPVA 1SCMC 2LHIA 1LKJA 1J1DA 1WDCC 1CM1A 2WNDA 3CGAA 4ZCVA 1TCOB 2JZIA 1S26D 3EKJA 1Y1UA 5ER4X 4YBHB 5DKQA 2FOTA 1KWOB 2JXLA 4YRUA 2G2BA 1IQ5A 5KTYA 1DJGA 1A29A 3SG5A 2LHLA 5I2LA 4HRGA 1SCVA 1MR8A 2F3ZA 3VRRA 4DUQA 1LXFC 1KFUS 2PSRA 1SR6C 2JTTA 1EH2A 1WRZA 1S5GZ 2M7NA 3LL8B 5I2QA 3RLZA 4DIRA 5AANA 1YVHA 3PALA 2KDHA 1PALA 1QX7A 2Y1NA 1SCMB 1K8UA 1OMVA 1Y1XA 1JUOA 3M0WA 4AQJA 2MBXA 4BY5A 4QJ4B 1B7TY 2LNKA 2MAZA 3AKAA 1Q80A 4WQ2A 4BY4A 1SK6D 4ETOA 3A4UB 4C0JA 4PE1A 4GFTA 1F71A 1NCXA 2JPTA 1XYDA 1J1EA 1XK4A 3K21A 2F33A 3GOFA 4HREE 2B1UA 2K7CA 1QIVA 4PE0A 3D10A 1RECA 1CMFA 1CDLA 3TUYB 3VRQA 1OZSA 1K93D 3VRPA 3IQOA 1B8LA 2LVVA 4A4BA 1A2XA 1QS7A 1DVIA 1QX5B 1FF1A 1KFUL 1MXLC 1NCZA 1DF0A 1S3PA 2LMTA 3JVTC 1LA3A 3BOWB 2KFFA 1R2UA 2QPTA 2E30A 1QVIZ 1F55A 2LV7A 2ISDA 5J3XA 3I5FC 4QJ5B 2RGIA 2O60A 2OS8C 1FI5A 2GV5A 4GNKB 5DKNA 4ZCUA 1K2HA 2D8NA 2EC6C 2M0RA 1X02A 3FWBA 1OSAA 1QASA 3NXAA 2KFHA 1A75A 4JWQA 4AQIA 2OTGC 1JFKA 3IF7A 2BBMA 2HPSA 4I5LB 2KFGA 5HKWA 1S5GY 1GGZA 2JTZA 2MRDA 1D1OA 2GGZA 2JQ6A 2O5GA 1ZOTB 4MSPA 3NSKA 3PATA 4OVNF 1QATA 2CCMA 2M97A 4NQGA 1TNPA 1ZACA 2K8MB 4ORCB 5AEQA 1Y1AA 2BL0C 4CFRA 1ZMZA 3GK2A 1CFFA 3JTDC 2EGDA 1RK9A 1Y6WA 2LUXA 1SPYA 2M8UA 3OP0A 2CXJA 3LCPC 1B1GA 1RFJA 3PM8A 1V1FA 2CTNA 1AP4A 5F6TA 1SL9A 2Y4QA 2ZRTA 1N65A 1N0YA 1NWDA 1MHOA 1YUTA 2MHHA 4N1GA 2BCBA 2L51A 3NSOA 4CIDA 5CSJA 1PVAA 2WC8A 2GGMA 2Y5IA 2LVKA 1FW4A 1QV1A 2F3YA 2WCEA 2BL0B 2HETA 2PVBA 2I94A 1DJXA 4PCWA 2K61A 1G4YR 2KQYA 1NPQA 1PULA 2AAOA 3OB2B 4I5JA 3SG7A 2KI6C 2NCPA 1QV0A 1QVIY 4XJKA 1SW8A 4WQ3A 2M1KB 3FIAA 3I5IB 2L4HA 1KQMB 4Q04A 1CMGA 1YR5A 1HT9A 1S6JA 1M39A 4MZLA 4MBEA 2LUCA 2JT3A 3EK8A 2R2IA 2F8PA 4L9MA 1XFUO 2AUCA 2BE4A 2KOTA 5DKRA 2I18A 2JNFA 4ORAB 1MXEA 1LA0A 2KSPA 1CDMA 5IBWA 1LVCD 1DJIA 2CBLA 1TRFA 1QLSA 2CNPA 1AVSA 4I5NB 1ODBA 2SASA 1R6PA 1H8BA 2WORA 4MEWA 3QRXA 2FCEA 2KAYA 1FPWA 2KAVA 4M2QA 1DJZA 4PDZA 3H4SE 2LANA 1KSMA 1PSRA 1G8IA 1B4CA 3D0YB 4ORBB 1DGVA 1F4OA 1QIWA 1SBJA 3EK4A 4D1EA 1M46A 2LLSA 2WCFA 1FBVA 2K7DA 1DGUA 1OMRA 2K0JA 4R1EA 1AHRA 5HKYA 3TUYC 1J7QA 2CT9A 1AUIB 1JFJA 1EG4A 3AAJA 2H61C 1XFZO 2KQ6A 1DJHA 2FCDA 1B8RA 2Q4UA 3HX4A 4PE4A 1QJTA 1WRLA 1IJ6A 1A4PA 1K9PA 1NX0A 3O4YA 4JPZB 1CDNA 2ZN8A 1PVBA 4ICBA 3DVJA 1AJ5A 4HSZA 1JF0A 5JJGA 2MA2A 2PASA 1U5IB 5CSFA 4GGFC 2HQWA 2ZRSA 3VGOA 5KSZA 4E68A 2LM5A 2SCPA 3FS7A 4PHKA 5B8IB 1CFPA 3E3RA 4MZJA 1G33A 5D7FA 3VROA 1IG5A 5AERA 2LP2A 1JSAA 2KYFA 2JWWA 2L0PA 2K2FA 2M3WA 4N5XA 1KK7Y 1K95A 3WNXB 4MN0A 5KU1A 1SL8A 1XFXO 2JRFA 2K7BA 2KAXA 1OOJA 3HCMA 3OHMB 3EK7A 3EVRA 4OR9B 3NSIA 1NCYA 2BE6A 4NDBA 4GBAA 1DT7B 1H4BA 1RJVA 1TTXA 3AKBA 4DCKA 1F8HA 1KFXS 4UPGA 1JC2A 4TNCA 1VRKA 2LVJA 3OB1B 1ZUZA 1DJWA 3BQ3A 1TCFA 1RTP1 5HLVA 2BCAA 1YRUB 5HYDA 3CLNA 1UHIA 3TDUA 1L2OB 3I5GB 3PN7B 2Q91A 1BT6A 3D0YA 2LE9B 1UUSA 1V1GA 2MLEC 1KSOA 5D69A 1K94A 3PFVA 2NLNA 4MRYA 4P2YB 3DF0B 2MLFC 1XA5A 4GGNA 1JF2A 4A4CA 1GGWA 2PRUA 1ALVA 1NP8A 1NIWA 3I5IC 1J7RA 1KQMC 5TNCA 1IRJA 2HQ8A 3LLEA 3SG3A 1TNQA 1SYMA 3KF9A 3BXKA 1L7ZA 1RROA 1QLKA 2TN4A 2M1UA 3GK4X 4MRXA 4OCIA 4NDCA 3CZTX 3BUMB 4GPLB 1C07A 1WLMA 4OKHA 5AXIA 2BECA 3KHEA 1OMDA 1S6IA 3BUWB 1S1EA 2K7OA 1SY9A 3EVUA 5I8NA 1F70A 2WCBA 1C7VA 1NX1A 1UP5A 4YI9A 3BUNB 1XO5A 4M2PA 1QTXA 2JC2A 2H61A 2K2AA 3CR4X 4USLA 4PALA 2V53A 1GJYA 1N2DA 2NCOA 1CKKA 2KHNA 2LP3A 3TS5B 1S36A 4PHNA 2COLB 1W7JB 3LK0A 1HQVA 2I7AA 3BOWA 1J7PA 1BJFA 1TN4A 4QJ3B 2P6BB 1FI6A 1YX8A 2F2PA 1OZOA 1IJ5A 3BUXB 1UHHA 1EL4A 2I2RE 1DF0B 4GGFA 4PHMA 4YI8A 1A03A 1SL7A 2A4JA 1NX2A 3OX6A 1SRAA 4FQOA 1DJYA 1DMOA 1KK8B 1ZFSA 1Y0VH 2LMVA 5JOLA 1UHNA 2ZFDA 2LLTA 1AK8A 1TOPA 1F54A 1BU3A 4NDDA 2EHBA 1IKUA 1QX2A 3CR2A 5I2OA 1BMOA 1JBAA 4IL1A 2IS9A 3TDZA 2JT8A 5CSIA 2L50A 3O2PA 3SIAA 2BKIB 1TIZA 1A75B 1MF8B 1K96A 2PALA 1IGVA 2PMYA 1J55A 2FJUB 5HKZA 2MJWB 4CPVA 1YUSA 3CR5X 3DF0A 5HLOA 4YGEB 2LLUA 3ZNIA 1CFCA 1W7IB 2LCPA 5GQQC 2M7LA 2LVIA 2ZN9A 4MVFA 5G08A 5FYXA 4C0LA 1OE9B 3O78A 2L98A 4YGDB 1S6CA 3DD4A 2M9GA 3ICBA 1XFYO 1NYAA 1IQ3A 5CSNA 4PHJA 1F4QA 1NUBA 3F45A 2ZNEA 1WDCB 3AAKA 3EVVA 1B9AA 1CTRA 1OQPA 3SG2A 2LAPA 1XFWO 1YURA 3LK1A 1CFDA 1WLZA 3TZ1A 1PK0D 3OX5A 1SMGA 2JXCA 3C1VA 3NSLA 2KI4C 3KEVA 1L2OC 3I5GC 4CFQA 3PN7C 1M31A 2M49B 1E8AA 2LMUA 2KBIA 2L4IA 2ZKMX 1BODA 2BKHB 1BR1B 1SR6B 1EG3A 1PRWA 1ALWA 2KI6D 2JNXA 1SKTA 2JULA 3KPXA 1WY9A 3SG4A 1UWOA 4XJKB 2VRGA 2G9BA 1BF5A 1DTLA 5BPJA 1UURA 4GAOA 1BR4B
chains in the Genus database with same CATH superfamily
4DS7A 4N1FA 4HRHA 4CLNA 2BCXA 1OW4A 1JWDA 2ZNDA 3R1PA 3TDIA 1CLBA 2KI4B 4OV2A 2WOSA 1K9UA 1K90D 1BOCA 3D74A 1B47A 5PALA 1OOFA 2JOJA 4YGAA 3B7AA 4GUKA 3DYEA 3ZWHA 4MLWA 1QXPA 3EKHA 1BLQA 1LINA 3RM1A 3BUOB 2P71A 1YVLA 2HF5A 3KO0A 2H2KA 1PSBA 3FE8A 3GK1A 4YGBB 3BYAA 1UHKA 3FE9A 1KCYA 1CLLA 2JT0A 1XK4C 3PSRA 1CNPA 1J7OA 1C7WA 1YUUA 2DOQA 2KBMA 2L5XB 3JVTB 3MSEB 3TS5C 1CDPA 2KYCA 5AFPA 1KQVA 3WHTB 4C0KA 3PLFB 1MQ1A 3FWCA 4WRIA 3CZ2A 2QACA 1BG1A 1KFXL 1MUXA 1TNWA 4YGCB 3WXAA 1UHJA 3I5FB 3CTNA 4FTGA 2OS8B 1IH0A 3DVKA 1K9KA 1AJ4A 3DVMA 1M45A 1U5IA 2L2EA 1RWYA 4U8DA 2EC6B 5HL1A 3DVEA 3A8RA 3K1EA 3IQQA 4PE7A 1Z4HA 2OPOA 3VRNA 4F0ZB 1TNXA 1KK8C 3WHUB 2OTGB 1IWQA 2KGBC 1EJ3A 4XYNA 2E6WA 5I94A 1B7TZ 1MWNA 1YRTB 2F2OA 1M63B 3SG6A 3FE6A 1EXRA 2KLEA 2NXQA 3CWGA 4MZKA 4P5OE 3I5HC 2AMIA 3VB1A 1YX7A 1CB1A 3O6BA 1NSHA 2NZ0A 2KGRA 2WC6A 3D77A 3JTDB 5FI6A 1WRKA 4I5KA 1XFVO 3SIBA 1XVJA 1KWOC 5ER5A 1B8CA 2LC5A 1YTZC 4JQ0D 1GQMA 4AOMA 1SNLA 2M29A 4M2OA 2JU0A 3SJSA 3B6XA 3CS1A 5D3OA 2Y1MA 1CM4A 5K89A 2KNEA 4DRWA 3I5HB 1NX3A 1KK7Z 1CLMA 1DQEA 2BBNA 3BJHA 1SCMC 2LHIA 5CPVA 1LKJA 1J1DA 1WDCC 1CM1A 2WNDA 3CGAA 4ZCVA 1TCOB 2JZIA 1S26D 2WCKA 3EKJA 1Y1UA 5ER4X 4YBHB 5DKQA 2FOTA 1KWOB 2JXLA 2WC5A 4YRUA 2G2BA 1IQ5A 5KTYA 1DJGA 1A29A 3SG5A 2QEBA 2LHLA 3UO9A 5I2LA 4HRGA 1SCVA 1MR8A 2F3ZA 3VRRA 4DUQA 1LXFC 1KFUS 2PSRA 1SR6C 2JTTA 1EH2A 1WRZA 1S5GZ 1P28A 2M7NA 3LL8B 3RLZA 5I2QA 4DIRA 5AANA 1YVHA 3PALA 2KDHA 1PALA 1QX7A 2Y1NA 1SCMB 1K8UA 1OMVA 1Y1XA 1JUOA 3M0WA 4AQJA 2MBXA 4BY5A 4QJ4B 1B7TY 2LNKA 2MAZA 3AKAA 1Q80A 4WQ2A 4BY4A 1SK6D 4INWA 4ETOA 3A4UB 4C0JA 4PE1A 4GFTA 1F71A 1NCXA 2JPTA 1XYDA 1J1EA 1XK4A 2QDIA 3K21A 2F33A 3GOFA 4HREE 2B1UA 2YGUA 2K7CA 3QMEA 1QIVA 4PE0A 3D10A 1RECA 2QEVA 1CMFA 1CDLA 3TUYB 3VRQA 1OZSA 1K93D 3VRPA 3IQOA 1B8LA 2LVVA 4A4BA 1A2XA 1QS7A 1DVIA 1QX5B 1TUJA 1FF1A 1KFUL 1MXLC 1NCZA 1DF0A 1S3PA 2LMTA 3JVTC 2KPHA 1LA3A 3BOWB 2KFFA 2PQLA 1R2UA 2QPTA 2E30A 1QVIZ 1F55A 2LV7A 3DY9A 2ISDA 3B86A 5J3XA 3I5FC 3V2LA 4QJ5B 2RGIA 2O60A 2OS8C 1FI5A 2GV5A 4GNKB 5DKNA 4ZCUA 1K2HA 2D8NA 2EC6C 1QWVA 3BFAA 2M0RA 1X02A 3FWBA 1OSAA 3D73A 1QASA 3B88A 3NXAA 2KFHA 1A75A 4JWQA 4AQIA 2OTGC 1JFKA 2L5YA 3IF7A 2BBMA 1SSEB 2HPSA 2KFGA 4I5LB 5HKWA 1S5GY 1GGZA 2JTZA 2MRDA 1D1OA 2GGZA 2JQ6A 2O5GA 3R1VA 1ZOTB 4MSPA 3NSKA 3PATA 4OVNF 1QATA 2CCMA 2M97A 4NQGA 1TNPA 1ZACA 2K8MB 4ORCB 5AEQA 1Y1AA 2BL0C 4CFRA 1ZMZA 3R1OA 3GK2A 1CFFA 3JTDC 2EGDA 1RK9A 1Y6WA 2LUXA 1SPYA 2M8UA 3OP0A 2CXJA 3LCPC 1B1GA 1RFJA 3B87A 3PM8A 1V1FA 2CTNA 3NHIA 5F6TA 1AP4A 1SL9A 2Y4QA 2ZRTA 3SS4A 1N65A 1N0YA 1NWDA 1MHOA 1YUTA 2MHHA 4N1GA 2BCBA 2L51A 3NSOA 4CIDA 3S0BA 5CSJA 1PVAA 2WC8A 2GGMA 2Y5IA 2LVKA 1FW4A 1QV1A 2F3YA 2WCEA 2BL0B 2HETA 2PVBA 2I94A 1DJXA 4PCWA 2K61A 1G4YR 2KQYA 1NPQA 1PULA 2AAOA 3OB2B 4INXA 4I5JA 3SG7A 2KI6C 2NCPA 3S0EA 1QV0A 3Q8IA 4IJ7A 1QVIY 4XJKA 1SW8A 2ERBA 2M1KB 3FIAA 3I5IB 2L4HA 1KQMB 4Q04A 4WQ3A 1CMGA 1YR5A 1HT9A 1S6JA 1M39A 4MZLA 1IIOA 3CABA 4MBEA 2LUCA 2JT3A 3EK8A 2R2IA 2F8PA 4L9MA 3DZTA 1XFUO 2AUCA 2BE4A 2KOTA 5DKRA 2I18A 2JNFA 4ORAB 1MXEA 1LA0A 2KSPA 1CDMA 5IBWA 1LVCD 1DJIA 2KLDA 2CBLA 1TRFA 1QLSA 2CNPA 1AVSA 4I5NB 1ODBA 2SASA 1R6PA 2QEHA 1H8BA 2WORA 4MEWA 1W9ZA 3QRXA 2FCEA 2KAYA 1FPWA 5FI2A 2P70A 2KAVA 4M2QA 1DJZA 4PDZA 3H4SE 2LANA 1KSMA 1PSRA 1G8IA 1B4CA 3D0YB 4ORBB 3IVTA 1DGVA 1F4OA 1QIWA 1SBJA 3EK4A 4D1EA 1M46A 2LLSA 2WCFA 1FBVA 2K7DA 1DGUA 1OMRA 2K0JA 4R1EA 1AHRA 5HKYA 3TUYC 1J7QA 2CT9A 1AUIB 1OOGA 1JFJA 1EG4A 2PYQA 3AAJA 2H61C 1XFZO 2JPOA 2KQ6A 1DJHA 2FCDA 1B8RA 1LS8A 2Q4UA 3HX4A 4PE4A 1QJTA 1WRLA 1IJ6A 1A4PA 1K9PA 1NX0A 3NHTA 3O4YA 4JPZB 2ZN8A 1CDNA 1PVBA 4ICBA 3DVJA 1AJ5A 4HSZA 1JF0A 1TUZA 5FI7A 5JJGA 2MA2A 2PASA 4JKTA 3RZSA 1U5IB 5CSFA 4GGFC 2HQWA 2ZRSA 3VGOA 5KSZA 4E68A 2LM5A 2SCPA 3FS7A 4PHKA 5B8IB 1CFPA 3E3RA 1T14A 4MZJA 1G33A 3L47A 2K60A 5D7FA 3VROA 1IG5A 5AERA 2LP2A 1JSAA 2KYFA 2JWWA 2L0PA 3O4XA 2K2FA 2M3WA 4N5XA 1KK7Y 1K95A 3WNXB 4MN0A 5KU1A 4KYNA 1SL8A 1XFXO 2FJYA 2JRFA 2K7BA 1OOJA 2KAXA 3HCMA 3EK7A 3EVRA 3OHMB 3NSIA 1NCYA 2BE6A 4NDBA 4GBAA 1DT7B 1H4BA 3OGNA 1RJVA 1TTXA 3EG5B 3AKBA 4DCKA 1F8HA 1KFXS 4UPGA 1JC2A 4TNCA 1VRKA 2LVJA 3OB1B 1ZUZA 3N7HA 1DJWA 3BQ3A 1TCFA 4OZDA 1RTP1 5HLVA 2BCAA 3D78A 3PJIA 1YRUB 5HYDA 3CLNA 3CZ0A 1UHIA 3TDUA 1L2OB 3I5GB 3BFBA 3PN7B 2Q91A 1BT6A 3D0YA 2LE9B 1UUSA 1TWOA 1V1GA 2MLEC 1KSOA 2QEOA 5D69A 1K94A 3PFVA 2NLNA 3L4AA 4MRYA 4P2YB 2WCMA 3DF0B 2MLFC 1XA5A 4GGNA 1JF2A 4A4CA 1GGWA 2PRUA 1ALVA 1NP8A 1DELA 1NIWA 3I5IC 1J7RA 1KQMC 5TNCA 1IRJA 2HQ8A 3LLEA 4FQTA 1TNQA 3SG3A 1SYMA 3KF9A 3BXKA 1L7ZA 1RROA 1QLKA 3NGVA 2TN4A 3CYZA 1Z2CB 2M1UA 3GK4X 4MRXA 4NDCA 3CZTX 3BUMB 4GPLB 4OCIA 3SS3A 1C07A 2WCHA 1WLMA 1GM0A 4OKHA 3D76A 5AXIA 2BECA 3KHEA 1OMDA 1S6IA 3BFHA 3BUWB 1S1EA 2K7OA 1SY9A 3EVUA 5I8NA 1F70A 2WCBA 1C7VA 1NX1A 1UP5A 2BAPA 3BUNB 1XO5A 4M2PA 4PT1A 4YI9A 1QTXA 2JC2A 2H61A 2K2AA 3CR4X 4USLA 4PALA 2V53A 1GJYA 3PM2A 1N2DA 2NCOA 1CKKA 1ORGA 2KHNA 1C3ZA 2LP3A 3L4LA 3OBVA 3TS5B 1S36A 4PHNA 1XFRA 2COLB 1W7JB 3LK0A 1HQVA 2I7AA 3BOWA 4OR9B 1J7PA 1BJFA 1TN4A 4QJ3B 2P6BB 1FI6A 1YX8A 2F2PA 1OZOA 2L2CA 1IJ5A 3BUXB 1UHHA 1EL4A 2I2RE 3S0FA 1DF0B 3CDNA 4GGFA 4PHMA 4YI8A 1A03A 3CZ1A 1SL7A 2A4JA 1NX2A 3OX6A 1SRAA 4FQOA 1DJYA 1DMOA 1KK8B 1ZFSA 1Y0VH 2LMVA 5EL2A 1UHNA 2ZFDA 5JOLA 2LLTA 5DICA 1AK8A 1TOPA 1F54A 1BU3A 4NDDA 2EHBA 1IKUA 3DXLA 1QX2A 1OOIX 3CR2A 5I2OA 2BNXA 1DC1A 1BMOA 1JBAA 4IL1A 2IS9A 3TDZA 2JT8A 5CSIA 2L50A 3O2PA 3SIAA 2BKIB 1TIZA 1A75B 1MF8B 1K96A 2PALA 1IGVA 2H8VA 2PMYA 1J55A 2FJUB 5HKZA 2MJWB 4CPVA 1YUSA 3CR5X 3DF0A 5HLOA 3S0GA 4YGEB 2LLUA 3ZNIA 1CFCA 1W7IB 2LCPA 5GQQC 2M7LA 2LVIA 2ZN9A 4MVFA 5G08A 5FYXA 4C0LA 1OE9B 3O78A 2L98A 4F7FA 3UNWA 4YGDB 2GTEA 1S6CA 3DD4A 2M9GA 3ICBA 1XFYO 1C3YA 1NYAA 1IQ3A 5CSNA 3SS5A 4PHJA 1F4QA 1NUBA 3F45A 2ZNEA 1WDCB 3AAKA 2WCJA 1B9AA 3EVVA 1CTRA 1OQPA 3SG2A 2LAPA 1XFWO 1YURA 3LK1A 1CFDA 4JD9A 1WLZA 3TZ1A 1PK0D 3OX5A 2WCLA 1SMGA 2JXCA 3C1VA 3NSLA 2KI4C 3KEVA 1L2OC 3I5GC 4CFQA 3PN7C 1M31A 3S0AA 2M49B 1E8AA 2LMUA 2KBIA 2L4IA 2ZKMX 1BODA 1DEKA 2BKHB 1BR1B 1SR6B 1EG3A 1PRWA 1ALWA 2KI6D 2JNXA 1SKTA 2JULA 3KPXA 3D75A 1WY9A 3SG4A 1UWOA 4XJKB 1OOHA 2VRGA 2G9BA 3R72A 1BF5A 3S0DA 1DTLA 5BPJA 1UURA 4GAOA 1BR4B
chains in the Genus database with same CATH topology
4DS7A 4N1FA 4HRHA 4CLNA 2BCXA 1JWDA 2ZNDA 3TDIA 1CLBA 2KI4B 4OV2A 2WOSA 1K9UA 1K90D 1BOCA 1B47A 5PALA 2JOJA 4YGAA 4GUKA 3ZWHA 4MLWA 1QXPA 3EKHA 1BLQA 1LINA 3RM1A 3BUOB 1YVLA 2HF5A 3KO0A 2H2KA 1PSBA 3GK1A 4YGBB 3BYAA 1UHKA 1KCYA 1CLLA 2JT0A 1XK4C 3PSRA 1CNPA 1J7OA 1C7WA 1YUUA 2DOQA 2KBMA 2L5XB 3JVTB 3MSEB 3TS5C 1CDPA 2KYCA 5AFPA 1KQVA 3WHTB 4C0KA 3PLFB 1MQ1A 3FWCA 4WRIA 2QACA 1BG1A 1KFXL 1MUXA 1TNWA 4YGCB 3WXAA 1UHJA 3I5FB 3CTNA 4FTGA 2OS8B 1IH0A 3DVKA 1K9KA 1AJ4A 3DVMA 1M45A 1U5IA 2L2EA 1RWYA 4U8DA 2EC6B 3DVEA 3A8RA 4PE7A 3IQQA 2OPOA 3VRNA 4F0ZB 1TNXA 1KK8C 3WHUB 2OTGB 1IWQA 2KGBC 1EJ3A 4XYNA 2E6WA 1B7TZ 1MWNA 1YRTB 2F2OA 1M63B 3SG6A 1EXRA 2NXQA 3CWGA 4MZKA 4P5OE 3I5HC 2AMIA 1YX7A 1CB1A 3O6BA 1NSHA 2NZ0A 2KGRA 3JTDB 1WRKA 4I5KA 1XFVO 3SIBA 1XVJA 1KWOC 5ER5A 1B8CA 2LC5A 1YTZC 4JQ0D 1GQMA 4AOMA 1SNLA 2M29A 4M2OA 2JU0A 3SJSA 3CS1A 2Y1MA 1CM4A 5K89A 2KNEA 4DRWA 3I5HB 1NX3A 1KK7Z 1CLMA 2BBNA 5CPVA 1SCMC 2LHIA 1LKJA 1J1DA 1WDCC 1CM1A 2WNDA 3CGAA 4ZCVA 1TCOB 2JZIA 1S26D 3EKJA 1Y1UA 5ER4X 4YBHB 5DKQA 2FOTA 1KWOB 2JXLA 4YRUA 2G2BA 1IQ5A 5KTYA 1DJGA 1A29A 3SG5A 2LHLA 5I2LA 4HRGA 1SCVA 1MR8A 2F3ZA 3VRRA 4DUQA 1LXFC 1KFUS 2PSRA 1SR6C 2JTTA 1EH2A 1WRZA 1S5GZ 2M7NA 3LL8B 5I2QA 3RLZA 4DIRA 5AANA 1YVHA 3PALA 2KDHA 1PALA 1QX7A 2Y1NA 1SCMB 1K8UA 1OMVA 1Y1XA 1JUOA 3M0WA 4AQJA 2MBXA 4BY5A 4QJ4B 1B7TY 2LNKA 2MAZA 3AKAA 1Q80A 4WQ2A 4BY4A 1SK6D 4ETOA 3A4UB 4C0JA 4PE1A 4GFTA 1F71A 1NCXA 2JPTA 1XYDA 1J1EA 1XK4A 3K21A 2F33A 3GOFA 4HREE 2B1UA 2K7CA 1QIVA 4PE0A 3D10A 1RECA 1CMFA 1CDLA 3TUYB 3VRQA 1OZSA 1K93D 3VRPA 3IQOA 1B8LA 2LVVA 4A4BA 1A2XA 1QS7A 1DVIA 1QX5B 1FF1A 1KFUL 1MXLC 1NCZA 1DF0A 1S3PA 2LMTA 3JVTC 1LA3A 3BOWB 2KFFA 1R2UA 2QPTA 2E30A 1QVIZ 1F55A 2LV7A 2ISDA 5J3XA 3I5FC 4QJ5B 2RGIA 2O60A 2OS8C 1FI5A 2GV5A 4GNKB 5DKNA 4ZCUA 1K2HA 2D8NA 2EC6C 2M0RA 1X02A 3FWBA 1OSAA 1QASA 3NXAA 2KFHA 1A75A 4JWQA 4AQIA 2OTGC 1JFKA 3IF7A 2BBMA 2HPSA 4I5LB 2KFGA 5HKWA 1S5GY 1GGZA 2JTZA 2MRDA 1D1OA 2GGZA 2JQ6A 2O5GA 1ZOTB 4MSPA 3NSKA 3PATA 4OVNF 1QATA 2CCMA 2M97A 4NQGA 1TNPA 1ZACA 2K8MB 4ORCB 5AEQA 1Y1AA 2BL0C 4CFRA 1ZMZA 3GK2A 1CFFA 3JTDC 2EGDA 1RK9A 1Y6WA 2LUXA 1SPYA 2M8UA 3OP0A 2CXJA 3LCPC 1B1GA 1RFJA 3PM8A 1V1FA 2CTNA 1AP4A 5F6TA 1SL9A 2Y4QA 2ZRTA 1N65A 1N0YA 1NWDA 1MHOA 1YUTA 2MHHA 4N1GA 2BCBA 2L51A 3NSOA 4CIDA 5CSJA 1PVAA 2WC8A 2GGMA 2Y5IA 2LVKA 1FW4A 1QV1A 2F3YA 2WCEA 2BL0B 2HETA 2PVBA 2I94A 1DJXA 4PCWA 2K61A 1G4YR 2KQYA 1NPQA 1PULA 2AAOA 3OB2B 4I5JA 3SG7A 2KI6C 2NCPA 1QV0A 1QVIY 4XJKA 1SW8A 4WQ3A 2M1KB 3FIAA 3I5IB 2L4HA 1KQMB 4Q04A 1CMGA 1YR5A 1HT9A 1S6JA 1M39A 4MZLA 4MBEA 2LUCA 2JT3A 3EK8A 2R2IA 2F8PA 4L9MA 1XFUO 2AUCA 2BE4A 2KOTA 5DKRA 2I18A 2JNFA 4ORAB 1MXEA 1LA0A 2KSPA 1CDMA 5IBWA 1LVCD 1DJIA 2CBLA 1TRFA 1QLSA 2CNPA 1AVSA 4I5NB 1ODBA 2SASA 1R6PA 1H8BA 2WORA 4MEWA 3QRXA 2FCEA 2KAYA 1FPWA 2KAVA 4M2QA 1DJZA 4PDZA 3H4SE 2LANA 1KSMA 1PSRA 1G8IA 1B4CA 3D0YB 4ORBB 1DGVA 1F4OA 1QIWA 1SBJA 3EK4A 4D1EA 1M46A 2LLSA 2WCFA 1FBVA 2K7DA 1DGUA 1OMRA 2K0JA 4R1EA 1AHRA 5HKYA 3TUYC 1J7QA 2CT9A 1AUIB 1JFJA 1EG4A 3AAJA 2H61C 1XFZO 2KQ6A 1DJHA 2FCDA 1B8RA 2Q4UA 3HX4A 4PE4A 1QJTA 1WRLA 1IJ6A 1A4PA 1K9PA 1NX0A 3O4YA 4JPZB 1CDNA 2ZN8A 1PVBA 4ICBA 3DVJA 1AJ5A 4HSZA 1JF0A 5JJGA 2MA2A 2PASA 1U5IB 5CSFA 4GGFC 2HQWA 2ZRSA 3VGOA 5KSZA 4E68A 2LM5A 2SCPA 3FS7A 4PHKA 5B8IB 1CFPA 3E3RA 4MZJA 1G33A 5D7FA 3VROA 1IG5A 5AERA 2LP2A 1JSAA 2KYFA 2JWWA 2L0PA 2K2FA 2M3WA 4N5XA 1KK7Y 1K95A 3WNXB 4MN0A 5KU1A 1SL8A 1XFXO 2JRFA 2K7BA 2KAXA 1OOJA 3HCMA 3OHMB 3EK7A 3EVRA 4OR9B 3NSIA 1NCYA 2BE6A 4NDBA 4GBAA 1DT7B 1H4BA 1RJVA 1TTXA 3AKBA 4DCKA 1F8HA 1KFXS 4UPGA 1JC2A 4TNCA 1VRKA 2LVJA 3OB1B 1ZUZA 1DJWA 3BQ3A 1TCFA 1RTP1 5HLVA 2BCAA 1YRUB 5HYDA 3CLNA 1UHIA 3TDUA 1L2OB 3I5GB 3PN7B 2Q91A 1BT6A 3D0YA 2LE9B 1UUSA 1V1GA 2MLEC 1KSOA 5D69A 1K94A 3PFVA 2NLNA 4MRYA 4P2YB 3DF0B 2MLFC 1XA5A 4GGNA 1JF2A 4A4CA 1GGWA 2PRUA 1ALVA 1NP8A 1NIWA 3I5IC 1J7RA 1KQMC 5TNCA 1IRJA 2HQ8A 3LLEA 3SG3A 1TNQA 1SYMA 3KF9A 3BXKA 1L7ZA 1RROA 1QLKA 2TN4A 2M1UA 3GK4X 4MRXA 4OCIA 4NDCA 3CZTX 3BUMB 4GPLB 1C07A 1WLMA 4OKHA 5AXIA 2BECA 3KHEA 1OMDA 1S6IA 3BUWB 1S1EA 2K7OA 1SY9A 3EVUA 5I8NA 1F70A 2WCBA 1C7VA 1NX1A 1UP5A 4YI9A 3BUNB 1XO5A 4M2PA 1QTXA 2JC2A 2H61A 2K2AA 3CR4X 4USLA 4PALA 2V53A 1GJYA 1N2DA 2NCOA 1CKKA 2KHNA 2LP3A 3TS5B 1S36A 4PHNA 2COLB 1W7JB 3LK0A 1HQVA 2I7AA 3BOWA 1J7PA 1BJFA 1TN4A 4QJ3B 2P6BB 1FI6A 1YX8A 2F2PA 1OZOA 1IJ5A 3BUXB 1UHHA 1EL4A 2I2RE 1DF0B 4GGFA 4PHMA 4YI8A 1A03A 1SL7A 2A4JA 1NX2A 3OX6A 1SRAA 4FQOA 1DJYA 1DMOA 1KK8B 1ZFSA 1Y0VH 2LMVA 5JOLA 1UHNA 2ZFDA 2LLTA 1AK8A 1TOPA 1F54A 1BU3A 4NDDA 2EHBA 1IKUA 1QX2A 3CR2A 5I2OA 1BMOA 1JBAA 4IL1A 2IS9A 3TDZA 2JT8A 5CSIA 2L50A 3O2PA 3SIAA 2BKIB 1TIZA 1A75B 1MF8B 1K96A 2PALA 1IGVA 2PMYA 1J55A 2FJUB 5HKZA 2MJWB 4CPVA 1YUSA 3CR5X 3DF0A 5HLOA 4YGEB 2LLUA 3ZNIA 1CFCA 1W7IB 2LCPA 5GQQC 2M7LA 2LVIA 2ZN9A 4MVFA 5G08A 5FYXA 4C0LA 1OE9B 3O78A 2L98A 4YGDB 1S6CA 3DD4A 2M9GA 3ICBA 1XFYO 1NYAA 1IQ3A 5CSNA 4PHJA 1F4QA 1NUBA 3F45A 2ZNEA 1WDCB 3AAKA 3EVVA 1B9AA 1CTRA 1OQPA 3SG2A 2LAPA 1XFWO 1YURA 3LK1A 1CFDA 1WLZA 3TZ1A 1PK0D 3OX5A 1SMGA 2JXCA 3C1VA 3NSLA 2KI4C 3KEVA 1L2OC 3I5GC 4CFQA 3PN7C 1M31A 2M49B 1E8AA 2LMUA 2KBIA 2L4IA 2ZKMX 1BODA 2BKHB 1BR1B 1SR6B 1EG3A 1PRWA 1ALWA 2KI6D 2JNXA 1SKTA 2JULA 3KPXA 1WY9A 3SG4A 1UWOA 4XJKB 2VRGA 2G9BA 1BF5A 1DTLA 5BPJA 1UURA 4GAOA 1BR4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DS7 A;  4N1F A;  4HRH A;  4CLN A;  2BCX A;  1JWD A;  2ZND A;  3TDI A;  1CLB A;  2KI4 B;  4OV2 A;  2WOS A;  1K9U A;  1K90 D;  1BOC A;  1B47 A;  5PAL A;  2JOJ A;  4YGA A;  4GUK A;  3ZWH A;  4MLW A;  1QXP A;  3EKH A;  1BLQ A;  1LIN A;  3RM1 A;  3BUO B;  1YVL A;  2HF5 A;  3KO0 A;  2H2K A;  1PSB A;  3GK1 A;  4YGB B;  3BYA A;  1UHK A;  1KCY A;  1CLL A;  2JT0 A;  1XK4 C;  3PSR A;  1CNP A;  1J7O A;  1C7W A;  1YUU A;  2DOQ A;  2KBM A;  2L5X B;  3JVT B;  3MSE B;  3TS5 C;  1CDP A;  2KYC A;  5AFP A;  1KQV A;  3WHT B;  4C0K A;  3PLF B;  1MQ1 A;  3FWC A;  4WRI A;  2QAC A;  1BG1 A;  1KFX L;  1MUX A;  1TNW A;  4YGC B;  3WXA A;  1UHJ A;  3I5F B;  3CTN A;  4FTG A;  2OS8 B;  1IH0 A;  3DVK A;  1K9K A;  1AJ4 A;  3DVM A;  1M45 A;  1U5I A;  2L2E A;  1RWY A;  4U8D A;  2EC6 B;  3DVE A;  3A8R A;  4PE7 A;  3IQQ A;  2OPO A;  3VRN A;  4F0Z B;  1TNX A;  1KK8 C;  3WHU B;  2OTG B;  1IWQ A;  2KGB C;  1EJ3 A;  4XYN A;  2E6W A;  1B7T Z;  1MWN A;  1YRT B;  2F2O A;  1M63 B;  3SG6 A;  1EXR A;  2NXQ A;  3CWG A;  4MZK A;  4P5O E;  3I5H C;  2AMI A;  1YX7 A;  1CB1 A;  3O6B A;  1NSH A;  2NZ0 A;  2KGR A;  3JTD B;  1WRK A;  4I5K A;  1XFV O;  3SIB A;  1XVJ A;  1KWO C;  5ER5 A;  1B8C A;  2LC5 A;  1YTZ C;  4JQ0 D;  1GQM A;  4AOM A;  1SNL A;  2M29 A;  4M2O A;  2JU0 A;  3SJS A;  3CS1 A;  2Y1M A;  1CM4 A;  5K89 A;  2KNE A;  4DRW A;  3I5H B;  1NX3 A;  1KK7 Z;  1CLM A;  2BBN A;  5CPV A;  1SCM C;  2LHI A;  1LKJ A;  1J1D A;  1WDC C;  1CM1 A;  2WND A;  3CGA A;  4ZCV A;  1TCO B;  2JZI A;  1S26 D;  3EKJ A;  1Y1U A;  5ER4 X;  4YBH B;  5DKQ A;  2FOT A;  1KWO B;  2JXL A;  4YRU A;  2G2B A;  1IQ5 A;  5KTY A;  1DJG A;  1A29 A;  3SG5 A;  2LHL A;  5I2L A;  4HRG A;  1SCV A;  1MR8 A;  2F3Z A;  3VRR A;  4DUQ A;  1LXF C;  1KFU S;  2PSR A;  1SR6 C;  2JTT A;  1EH2 A;  1WRZ A;  1S5G Z;  2M7N A;  3LL8 B;  5I2Q A;  3RLZ A;  4DIR A;  5AAN A;  1YVH A;  3PAL A;  2KDH A;  1PAL A;  1QX7 A;  2Y1N A;  1SCM B;  1K8U A;  1OMV A;  1Y1X A;  1JUO A;  3M0W A;  4AQJ A;  2MBX A;  4BY5 A;  4QJ4 B;  1B7T Y;  2LNK A;  2MAZ A;  3AKA A;  1Q80 A;  4WQ2 A;  4BY4 A;  1SK6 D;  4ETO A;  3A4U B;  4C0J A;  4PE1 A;  4GFT A;  1F71 A;  1NCX A;  2JPT A;  1XYD A;  1J1E A;  1XK4 A;  3K21 A;  2F33 A;  3GOF A;  4HRE E;  2B1U A;  2K7C A;  1QIV A;  4PE0 A;  3D10 A;  1REC A;  1CMF A;  1CDL A;  3TUY B;  3VRQ A;  1OZS A;  1K93 D;  3VRP A;  3IQO A;  1B8L A;  2LVV A;  4A4B A;  1A2X A;  1QS7 A;  1DVI A;  1QX5 B;  1FF1 A;  1KFU L;  1MXL C;  1NCZ A;  1DF0 A;  1S3P A;  2LMT A;  3JVT C;  1LA3 A;  3BOW B;  2KFF A;  1R2U A;  2QPT A;  2E30 A;  1QVI Z;  1F55 A;  2LV7 A;  2ISD A;  5J3X A;  3I5F C;  4QJ5 B;  2RGI A;  2O60 A;  2OS8 C;  1FI5 A;  2GV5 A;  4GNK B;  5DKN A;  4ZCU A;  1K2H A;  2D8N A;  2EC6 C;  2M0R A;  1X02 A;  3FWB A;  1OSA A;  1QAS A;  3NXA A;  2KFH A;  1A75 A;  4JWQ A;  4AQI A;  2OTG C;  1JFK A;  3IF7 A;  2BBM A;  2HPS A;  4I5L B;  2KFG A;  5HKW A;  1S5G Y;  1GGZ A;  2JTZ A;  2MRD A;  1D1O A;  2GGZ A;  2JQ6 A;  2O5G A;  1ZOT B;  4MSP A;  3NSK A;  3PAT A;  4OVN F;  1QAT A;  2CCM A;  2M97 A;  4NQG A;  1TNP A;  1ZAC A;  2K8M B;  4ORC B;  5AEQ A;  1Y1A A;  2BL0 C;  4CFR A;  1ZMZ A;  3GK2 A;  1CFF A;  3JTD C;  2EGD A;  1RK9 A;  1Y6W A;  2LUX A;  1SPY A;  2M8U A;  3OP0 A;  2CXJ A;  3LCP C;  1B1G A;  1RFJ A;  3PM8 A;  1V1F A;  2CTN A;  1AP4 A;  5F6T A;  1SL9 A;  2Y4Q A;  2ZRT A;  1N65 A;  1N0Y A;  1NWD A;  1MHO A;  1YUT A;  2MHH A;  4N1G A;  2BCB A;  2L51 A;  3NSO A;  4CID A;  5CSJ A;  1PVA A;  2WC8 A;  2GGM A;  2Y5I A;  2LVK A;  1FW4 A;  1QV1 A;  2F3Y A;  2WCE A;  2BL0 B;  2HET A;  2PVB A;  2I94 A;  1DJX A;  4PCW A;  2K61 A;  1G4Y R;  2KQY A;  1NPQ A;  1PUL A;  2AAO A;  3OB2 B;  4I5J A;  3SG7 A;  2KI6 C;  2NCP A;  1QV0 A;  1QVI Y;  4XJK A;  1SW8 A;  4WQ3 A;  2M1K B;  3FIA A;  3I5I B;  2L4H A;  1KQM B;  4Q04 A;  1CMG A;  1YR5 A;  1HT9 A;  1S6J A;  1M39 A;  4MZL A;  4MBE A;  2LUC A;  2JT3 A;  3EK8 A;  2R2I A;  2F8P A;  4L9M A;  1XFU O;  2AUC A;  2BE4 A;  2KOT A;  5DKR A;  2I18 A;  2JNF A;  4ORA B;  1MXE A;  1LA0 A;  2KSP A;  1CDM A;  5IBW A;  1LVC D;  1DJI A;  2CBL A;  1TRF A;  1QLS A;  2CNP A;  1AVS A;  4I5N B;  1ODB A;  2SAS A;  1R6P A;  1H8B A;  2WOR A;  4MEW A;  3QRX A;  2FCE A;  2KAY A;  1FPW A;  2KAV A;  4M2Q A;  1DJZ A;  4PDZ A;  3H4S E;  2LAN A;  1KSM A;  1PSR A;  1G8I A;  1B4C A;  3D0Y B;  4ORB B;  1DGV A;  1F4O A;  1QIW A;  1SBJ A;  3EK4 A;  4D1E A;  1M46 A;  2LLS A;  2WCF A;  1FBV A;  2K7D A;  1DGU A;  1OMR A;  2K0J A;  4R1E A;  1AHR A;  5HKY A;  3TUY C;  1J7Q A;  2CT9 A;  1AUI B;  1JFJ A;  1EG4 A;  3AAJ A;  2H61 C;  1XFZ O;  2KQ6 A;  1DJH A;  2FCD A;  1B8R A;  2Q4U A;  3HX4 A;  4PE4 A;  1QJT A;  1WRL A;  1IJ6 A;  1A4P A;  1K9P A;  1NX0 A;  3O4Y A;  4JPZ B;  1CDN A;  2ZN8 A;  1PVB A;  4ICB A;  3DVJ A;  1AJ5 A;  4HSZ A;  1JF0 A;  5JJG A;  2MA2 A;  2PAS A;  1U5I B;  5CSF A;  4GGF C;  2HQW A;  2ZRS A;  3VGO A;  5KSZ A;  4E68 A;  2LM5 A;  2SCP A;  3FS7 A;  4PHK A;  5B8I B;  1CFP A;  3E3R A;  4MZJ A;  1G33 A;  5D7F A;  3VRO A;  1IG5 A;  5AER A;  2LP2 A;  1JSA A;  2KYF A;  2JWW A;  2L0P A;  2K2F A;  2M3W A;  4N5X A;  1KK7 Y;  1K95 A;  3WNX B;  4MN0 A;  5KU1 A;  1SL8 A;  1XFX O;  2JRF A;  2K7B A;  2KAX A;  1OOJ A;  3HCM A;  3OHM B;  3EK7 A;  3EVR A;  4OR9 B;  3NSI A;  1NCY A;  2BE6 A;  4NDB A;  4GBA A;  1DT7 B;  1H4B A;  1RJV A;  1TTX A;  3AKB A;  4DCK A;  1F8H A;  1KFX S;  4UPG A;  1JC2 A;  4TNC A;  1VRK A;  2LVJ A;  3OB1 B;  1ZUZ A;  1DJW A;  3BQ3 A;  1TCF A;  1RTP 1;  5HLV A;  2BCA A;  1YRU B;  5HYD A;  3CLN A;  1UHI A;  3TDU A;  1L2O B;  3I5G B;  3PN7 B;  2Q91 A;  1BT6 A;  3D0Y A;  2LE9 B;  1UUS A;  1V1G A;  2MLE C;  1KSO A;  5D69 A;  1K94 A;  3PFV A;  2NLN A;  4MRY A;  4P2Y B;  3DF0 B;  2MLF C;  1XA5 A;  4GGN A;  1JF2 A;  4A4C A;  1GGW A;  2PRU A;  1ALV A;  1NP8 A;  1NIW A;  3I5I C;  1J7R A;  1KQM C;  5TNC A;  1IRJ A;  2HQ8 A;  3LLE A;  3SG3 A;  1TNQ A;  1SYM A;  3KF9 A;  3BXK A;  1L7Z A;  1RRO A;  1QLK A;  2TN4 A;  2M1U A;  3GK4 X;  4MRX A;  4OCI A;  4NDC A;  3CZT X;  3BUM B;  4GPL B;  1C07 A;  1WLM A;  4OKH A;  5AXI A;  2BEC A;  3KHE A;  1OMD A;  1S6I A;  3BUW B;  1S1E A;  2K7O A;  1SY9 A;  3EVU A;  5I8N A;  1F70 A;  2WCB A;  1C7V A;  1NX1 A;  1UP5 A;  4YI9 A;  3BUN B;  1XO5 A;  4M2P A;  1QTX A;  2JC2 A;  2H61 A;  2K2A A;  3CR4 X;  4USL A;  4PAL A;  2V53 A;  1GJY A;  1N2D A;  2NCO A;  1CKK A;  2KHN A;  2LP3 A;  3TS5 B;  1S36 A;  4PHN A;  2COL B;  1W7J B;  3LK0 A;  1HQV A;  2I7A A;  3BOW A;  1J7P A;  1BJF A;  1TN4 A;  4QJ3 B;  2P6B B;  1FI6 A;  1YX8 A;  2F2P A;  1OZO A;  1IJ5 A;  3BUX B;  1UHH A;  1EL4 A;  2I2R E;  1DF0 B;  4GGF A;  4PHM A;  4YI8 A;  1A03 A;  1SL7 A;  2A4J A;  1NX2 A;  3OX6 A;  1SRA A;  4FQO A;  1DJY A;  1DMO A;  1KK8 B;  1ZFS A;  1Y0V H;  2LMV A;  5JOL A;  1UHN A;  2ZFD A;  2LLT A;  1AK8 A;  1TOP A;  1F54 A;  1BU3 A;  4NDD A;  2EHB A;  1IKU A;  1QX2 A;  3CR2 A;  5I2O A;  1BMO A;  1JBA A;  4IL1 A;  2IS9 A;  3TDZ A;  2JT8 A;  5CSI A;  2L50 A;  3O2P A;  3SIA A;  2BKI B;  1TIZ A;  1A75 B;  1MF8 B;  1K96 A;  2PAL A;  1IGV A;  2PMY A;  1J55 A;  2FJU B;  5HKZ A;  2MJW B;  4CPV A;  1YUS A;  3CR5 X;  3DF0 A;  5HLO A;  4YGE B;  2LLU A;  3ZNI A;  1CFC A;  1W7I B;  2LCP A;  5GQQ C;  2M7L A;  2LVI A;  2ZN9 A;  4MVF A;  5G08 A;  5FYX A;  4C0L A;  1OE9 B;  3O78 A;  2L98 A;  4YGD B;  1S6C A;  3DD4 A;  2M9G A;  3ICB A;  1XFY O;  1NYA A;  1IQ3 A;  5CSN A;  4PHJ A;  1F4Q A;  1NUB A;  3F45 A;  2ZNE A;  1WDC B;  3AAK A;  3EVV A;  1B9A A;  1CTR A;  1OQP A;  3SG2 A;  2LAP A;  1XFW O;  1YUR A;  3LK1 A;  1CFD A;  1WLZ A;  3TZ1 A;  1PK0 D;  3OX5 A;  1SMG A;  2JXC A;  3C1V A;  3NSL A;  2KI4 C;  3KEV A;  1L2O C;  3I5G C;  4CFQ A;  3PN7 C;  1M31 A;  2M49 B;  1E8A A;  2LMU A;  2KBI A;  2L4I A;  2ZKM X;  1BOD A;  2BKH B;  1BR1 B;  1SR6 B;  1EG3 A;  1PRW A;  1ALW A;  2KI6 D;  2JNX A;  1SKT A;  2JUL A;  3KPX A;  1WY9 A;  3SG4 A;  1UWO A;  4XJK B;  2VRG A;  2G9B A;  1BF5 A;  1DTL A;  5BPJ A;  1UUR A;  4GAO A;  1BR4 B; 
#chains in the Genus database with same CATH topology
 4DS7 A;  4N1F A;  4HRH A;  4CLN A;  2BCX A;  1OW4 A;  1JWD A;  2ZND A;  3R1P A;  3TDI A;  1CLB A;  2KI4 B;  4OV2 A;  2WOS A;  1K9U A;  1K90 D;  1BOC A;  3D74 A;  1B47 A;  5PAL A;  1OOF A;  2JOJ A;  4YGA A;  3B7A A;  4GUK A;  3DYE A;  3ZWH A;  4MLW A;  1QXP A;  3EKH A;  1BLQ A;  1LIN A;  3RM1 A;  3BUO B;  2P71 A;  1YVL A;  2HF5 A;  3KO0 A;  2H2K A;  1PSB A;  3FE8 A;  3GK1 A;  4YGB B;  3BYA A;  1UHK A;  3FE9 A;  1KCY A;  1CLL A;  2JT0 A;  1XK4 C;  3PSR A;  1CNP A;  1J7O A;  1C7W A;  1YUU A;  2DOQ A;  2KBM A;  2L5X B;  3JVT B;  3MSE B;  3TS5 C;  1CDP A;  2KYC A;  5AFP A;  1KQV A;  3WHT B;  4C0K A;  3PLF B;  1MQ1 A;  3FWC A;  4WRI A;  3CZ2 A;  2QAC A;  1BG1 A;  1KFX L;  1MUX A;  1TNW A;  4YGC B;  3WXA A;  1UHJ A;  3I5F B;  3CTN A;  4FTG A;  2OS8 B;  1IH0 A;  3DVK A;  1K9K A;  1AJ4 A;  3DVM A;  1M45 A;  1U5I A;  2L2E A;  1RWY A;  4U8D A;  2EC6 B;  5HL1 A;  3DVE A;  3A8R A;  3K1E A;  3IQQ A;  4PE7 A;  1Z4H A;  2OPO A;  3VRN A;  4F0Z B;  1TNX A;  1KK8 C;  3WHU B;  2OTG B;  1IWQ A;  2KGB C;  1EJ3 A;  4XYN A;  2E6W A;  5I94 A;  1B7T Z;  1MWN A;  1YRT B;  2F2O A;  1M63 B;  3SG6 A;  3FE6 A;  1EXR A;  2KLE A;  2NXQ A;  3CWG A;  4MZK A;  4P5O E;  3I5H C;  2AMI A;  3VB1 A;  1YX7 A;  1CB1 A;  3O6B A;  1NSH A;  2NZ0 A;  2KGR A;  2WC6 A;  3D77 A;  3JTD B;  5FI6 A;  1WRK A;  4I5K A;  1XFV O;  3SIB A;  1XVJ A;  1KWO C;  5ER5 A;  1B8C A;  2LC5 A;  1YTZ C;  4JQ0 D;  1GQM A;  4AOM A;  1SNL A;  2M29 A;  4M2O A;  2JU0 A;  3SJS A;  3B6X A;  3CS1 A;  5D3O A;  2Y1M A;  1CM4 A;  5K89 A;  2KNE A;  4DRW A;  3I5H B;  1NX3 A;  1KK7 Z;  1CLM A;  1DQE A;  2BBN A;  3BJH A;  1SCM C;  2LHI A;  5CPV A;  1LKJ A;  1J1D A;  1WDC C;  1CM1 A;  2WND A;  3CGA A;  4ZCV A;  1TCO B;  2JZI A;  1S26 D;  2WCK A;  3EKJ A;  1Y1U A;  5ER4 X;  4YBH B;  5DKQ A;  2FOT A;  1KWO B;  2JXL A;  2WC5 A;  4YRU A;  2G2B A;  1IQ5 A;  5KTY A;  1DJG A;  1A29 A;  3SG5 A;  2QEB A;  2LHL A;  3UO9 A;  5I2L A;  4HRG A;  1SCV A;  1MR8 A;  2F3Z A;  3VRR A;  4DUQ A;  1LXF C;  1KFU S;  2PSR A;  1SR6 C;  2JTT A;  1EH2 A;  1WRZ A;  1S5G Z;  1P28 A;  2M7N A;  3LL8 B;  3RLZ A;  5I2Q A;  4DIR A;  5AAN A;  1YVH A;  3PAL A;  2KDH A;  1PAL A;  1QX7 A;  2Y1N A;  1SCM B;  1K8U A;  1OMV A;  1Y1X A;  1JUO A;  3M0W A;  4AQJ A;  2MBX A;  4BY5 A;  4QJ4 B;  1B7T Y;  2LNK A;  2MAZ A;  3AKA A;  1Q80 A;  4WQ2 A;  4BY4 A;  1SK6 D;  4INW A;  4ETO A;  3A4U B;  4C0J A;  4PE1 A;  4GFT A;  1F71 A;  1NCX A;  2JPT A;  1XYD A;  1J1E A;  1XK4 A;  2QDI A;  3K21 A;  2F33 A;  3GOF A;  4HRE E;  2B1U A;  2YGU A;  2K7C A;  3QME A;  1QIV A;  4PE0 A;  3D10 A;  1REC A;  2QEV A;  1CMF A;  1CDL A;  3TUY B;  3VRQ A;  1OZS A;  1K93 D;  3VRP A;  3IQO A;  1B8L A;  2LVV A;  4A4B A;  1A2X A;  1QS7 A;  1DVI A;  1QX5 B;  1TUJ A;  1FF1 A;  1KFU L;  1MXL C;  1NCZ A;  1DF0 A;  1S3P A;  2LMT A;  3JVT C;  2KPH A;  1LA3 A;  3BOW B;  2KFF A;  2PQL A;  1R2U A;  2QPT A;  2E30 A;  1QVI Z;  1F55 A;  2LV7 A;  3DY9 A;  2ISD A;  3B86 A;  5J3X A;  3I5F C;  3V2L A;  4QJ5 B;  2RGI A;  2O60 A;  2OS8 C;  1FI5 A;  2GV5 A;  4GNK B;  5DKN A;  4ZCU A;  1K2H A;  2D8N A;  2EC6 C;  1QWV A;  3BFA A;  2M0R A;  1X02 A;  3FWB A;  1OSA A;  3D73 A;  1QAS A;  3B88 A;  3NXA A;  2KFH A;  1A75 A;  4JWQ A;  4AQI A;  2OTG C;  1JFK A;  2L5Y A;  3IF7 A;  2BBM A;  1SSE B;  2HPS A;  2KFG A;  4I5L B;  5HKW A;  1S5G Y;  1GGZ A;  2JTZ A;  2MRD A;  1D1O A;  2GGZ A;  2JQ6 A;  2O5G A;  3R1V A;  1ZOT B;  4MSP A;  3NSK A;  3PAT A;  4OVN F;  1QAT A;  2CCM A;  2M97 A;  4NQG A;  1TNP A;  1ZAC A;  2K8M B;  4ORC B;  5AEQ A;  1Y1A A;  2BL0 C;  4CFR A;  1ZMZ A;  3R1O A;  3GK2 A;  1CFF A;  3JTD C;  2EGD A;  1RK9 A;  1Y6W A;  2LUX A;  1SPY A;  2M8U A;  3OP0 A;  2CXJ A;  3LCP C;  1B1G A;  1RFJ A;  3B87 A;  3PM8 A;  1V1F A;  2CTN A;  3NHI A;  5F6T A;  1AP4 A;  1SL9 A;  2Y4Q A;  2ZRT A;  3SS4 A;  1N65 A;  1N0Y A;  1NWD A;  1MHO A;  1YUT A;  2MHH A;  4N1G A;  2BCB A;  2L51 A;  3NSO A;  4CID A;  3S0B A;  5CSJ A;  1PVA A;  2WC8 A;  2GGM A;  2Y5I A;  2LVK A;  1FW4 A;  1QV1 A;  2F3Y A;  2WCE A;  2BL0 B;  2HET A;  2PVB A;  2I94 A;  1DJX A;  4PCW A;  2K61 A;  1G4Y R;  2KQY A;  1NPQ A;  1PUL A;  2AAO A;  3OB2 B;  4INX A;  4I5J A;  3SG7 A;  2KI6 C;  2NCP A;  3S0E A;  1QV0 A;  3Q8I A;  4IJ7 A;  1QVI Y;  4XJK A;  1SW8 A;  2ERB A;  2M1K B;  3FIA A;  3I5I B;  2L4H A;  1KQM B;  4Q04 A;  4WQ3 A;  1CMG A;  1YR5 A;  1HT9 A;  1S6J A;  1M39 A;  4MZL A;  1IIO A;  3CAB A;  4MBE A;  2LUC A;  2JT3 A;  3EK8 A;  2R2I A;  2F8P A;  4L9M A;  3DZT A;  1XFU O;  2AUC A;  2BE4 A;  2KOT A;  5DKR A;  2I18 A;  2JNF A;  4ORA B;  1MXE A;  1LA0 A;  2KSP A;  1CDM A;  5IBW A;  1LVC D;  1DJI A;  2KLD A;  2CBL A;  1TRF A;  1QLS A;  2CNP A;  1AVS A;  4I5N B;  1ODB A;  2SAS A;  1R6P A;  2QEH A;  1H8B A;  2WOR A;  4MEW A;  1W9Z A;  3QRX A;  2FCE A;  2KAY A;  1FPW A;  5FI2 A;  2P70 A;  2KAV A;  4M2Q A;  1DJZ A;  4PDZ A;  3H4S E;  2LAN A;  1KSM A;  1PSR A;  1G8I A;  1B4C A;  3D0Y B;  4ORB B;  3IVT A;  1DGV A;  1F4O A;  1QIW A;  1SBJ A;  3EK4 A;  4D1E A;  1M46 A;  2LLS A;  2WCF A;  1FBV A;  2K7D A;  1DGU A;  1OMR A;  2K0J A;  4R1E A;  1AHR A;  5HKY A;  3TUY C;  1J7Q A;  2CT9 A;  1AUI B;  1OOG A;  1JFJ A;  1EG4 A;  2PYQ A;  3AAJ A;  2H61 C;  1XFZ O;  2JPO A;  2KQ6 A;  1DJH A;  2FCD A;  1B8R A;  1LS8 A;  2Q4U A;  3HX4 A;  4PE4 A;  1QJT A;  1WRL A;  1IJ6 A;  1A4P A;  1K9P A;  1NX0 A;  3NHT A;  3O4Y A;  4JPZ B;  2ZN8 A;  1CDN A;  1PVB A;  4ICB A;  3DVJ A;  1AJ5 A;  4HSZ A;  1JF0 A;  1TUZ A;  5FI7 A;  5JJG A;  2MA2 A;  2PAS A;  4JKT A;  3RZS A;  1U5I B;  5CSF A;  4GGF C;  2HQW A;  2ZRS A;  3VGO A;  5KSZ A;  4E68 A;  2LM5 A;  2SCP A;  3FS7 A;  4PHK A;  5B8I B;  1CFP A;  3E3R A;  1T14 A;  4MZJ A;  1G33 A;  3L47 A;  2K60 A;  5D7F A;  3VRO A;  1IG5 A;  5AER A;  2LP2 A;  1JSA A;  2KYF A;  2JWW A;  2L0P A;  3O4X A;  2K2F A;  2M3W A;  4N5X A;  1KK7 Y;  1K95 A;  3WNX B;  4MN0 A;  5KU1 A;  4KYN A;  1SL8 A;  1XFX O;  2FJY A;  2JRF A;  2K7B A;  1OOJ A;  2KAX A;  3HCM A;  3EK7 A;  3EVR A;  3OHM B;  3NSI A;  1NCY A;  2BE6 A;  4NDB A;  4GBA A;  1DT7 B;  1H4B A;  3OGN A;  1RJV A;  1TTX A;  3EG5 B;  3AKB A;  4DCK A;  1F8H A;  1KFX S;  4UPG A;  1JC2 A;  4TNC A;  1VRK A;  2LVJ A;  3OB1 B;  1ZUZ A;  3N7H A;  1DJW A;  3BQ3 A;  1TCF A;  4OZD A;  1RTP 1;  5HLV A;  2BCA A;  3D78 A;  3PJI A;  1YRU B;  5HYD A;  3CLN A;  3CZ0 A;  1UHI A;  3TDU A;  1L2O B;  3I5G B;  3BFB A;  3PN7 B;  2Q91 A;  1BT6 A;  3D0Y A;  2LE9 B;  1UUS A;  1TWO A;  1V1G A;  2MLE C;  1KSO A;  2QEO A;  5D69 A;  1K94 A;  3PFV A;  2NLN A;  3L4A A;  4MRY A;  4P2Y B;  2WCM A;  3DF0 B;  2MLF C;  1XA5 A;  4GGN A;  1JF2 A;  4A4C A;  1GGW A;  2PRU A;  1ALV A;  1NP8 A;  1DEL A;  1NIW A;  3I5I C;  1J7R A;  1KQM C;  5TNC A;  1IRJ A;  2HQ8 A;  3LLE A;  4FQT A;  1TNQ A;  3SG3 A;  1SYM A;  3KF9 A;  3BXK A;  1L7Z A;  1RRO A;  1QLK A;  3NGV A;  2TN4 A;  3CYZ A;  1Z2C B;  2M1U A;  3GK4 X;  4MRX A;  4NDC A;  3CZT X;  3BUM B;  4GPL B;  4OCI A;  3SS3 A;  1C07 A;  2WCH A;  1WLM A;  1GM0 A;  4OKH A;  3D76 A;  5AXI A;  2BEC A;  3KHE A;  1OMD A;  1S6I A;  3BFH A;  3BUW B;  1S1E A;  2K7O A;  1SY9 A;  3EVU A;  5I8N A;  1F70 A;  2WCB A;  1C7V A;  1NX1 A;  1UP5 A;  2BAP A;  3BUN B;  1XO5 A;  4M2P A;  4PT1 A;  4YI9 A;  1QTX A;  2JC2 A;  2H61 A;  2K2A A;  3CR4 X;  4USL A;  4PAL A;  2V53 A;  1GJY A;  3PM2 A;  1N2D A;  2NCO A;  1CKK A;  1ORG A;  2KHN A;  1C3Z A;  2LP3 A;  3L4L A;  3OBV A;  3TS5 B;  1S36 A;  4PHN A;  1XFR A;  2COL B;  1W7J B;  3LK0 A;  1HQV A;  2I7A A;  3BOW A;  4OR9 B;  1J7P A;  1BJF A;  1TN4 A;  4QJ3 B;  2P6B B;  1FI6 A;  1YX8 A;  2F2P A;  1OZO A;  2L2C A;  1IJ5 A;  3BUX B;  1UHH A;  1EL4 A;  2I2R E;  3S0F A;  1DF0 B;  3CDN A;  4GGF A;  4PHM A;  4YI8 A;  1A03 A;  3CZ1 A;  1SL7 A;  2A4J A;  1NX2 A;  3OX6 A;  1SRA A;  4FQO A;  1DJY A;  1DMO A;  1KK8 B;  1ZFS A;  1Y0V H;  2LMV A;  5EL2 A;  1UHN A;  2ZFD A;  5JOL A;  2LLT A;  5DIC A;  1AK8 A;  1TOP A;  1F54 A;  1BU3 A;  4NDD A;  2EHB A;  1IKU A;  3DXL A;  1QX2 A;  1OOI X;  3CR2 A;  5I2O A;  2BNX A;  1DC1 A;  1BMO A;  1JBA A;  4IL1 A;  2IS9 A;  3TDZ A;  2JT8 A;  5CSI A;  2L50 A;  3O2P A;  3SIA A;  2BKI B;  1TIZ A;  1A75 B;  1MF8 B;  1K96 A;  2PAL A;  1IGV A;  2H8V A;  2PMY A;  1J55 A;  2FJU B;  5HKZ A;  2MJW B;  4CPV A;  1YUS A;  3CR5 X;  3DF0 A;  5HLO A;  3S0G A;  4YGE B;  2LLU A;  3ZNI A;  1CFC A;  1W7I B;  2LCP A;  5GQQ C;  2M7L A;  2LVI A;  2ZN9 A;  4MVF A;  5G08 A;  5FYX A;  4C0L A;  1OE9 B;  3O78 A;  2L98 A;  4F7F A;  3UNW A;  4YGD B;  2GTE A;  1S6C A;  3DD4 A;  2M9G A;  3ICB A;  1XFY O;  1C3Y A;  1NYA A;  1IQ3 A;  5CSN A;  3SS5 A;  4PHJ A;  1F4Q A;  1NUB A;  3F45 A;  2ZNE A;  1WDC B;  3AAK A;  2WCJ A;  1B9A A;  3EVV A;  1CTR A;  1OQP A;  3SG2 A;  2LAP A;  1XFW O;  1YUR A;  3LK1 A;  1CFD A;  4JD9 A;  1WLZ A;  3TZ1 A;  1PK0 D;  3OX5 A;  2WCL A;  1SMG A;  2JXC A;  3C1V A;  3NSL A;  2KI4 C;  3KEV A;  1L2O C;  3I5G C;  4CFQ A;  3PN7 C;  1M31 A;  3S0A A;  2M49 B;  1E8A A;  2LMU A;  2KBI A;  2L4I A;  2ZKM X;  1BOD A;  1DEK A;  2BKH B;  1BR1 B;  1SR6 B;  1EG3 A;  1PRW A;  1ALW A;  2KI6 D;  2JNX A;  1SKT A;  2JUL A;  3KPX A;  3D75 A;  1WY9 A;  3SG4 A;  1UWO A;  4XJK B;  1OOH A;  2VRG A;  2G9B A;  3R72 A;  1BF5 A;  3S0D A;  1DTL A;  5BPJ A;  1UUR A;  4GAO A;  1BR4 B; 
#chains in the Genus database with same CATH homology
 4DS7 A;  4N1F A;  4HRH A;  4CLN A;  2BCX A;  1JWD A;  2ZND A;  3TDI A;  1CLB A;  2KI4 B;  4OV2 A;  2WOS A;  1K9U A;  1K90 D;  1BOC A;  1B47 A;  5PAL A;  2JOJ A;  4YGA A;  4GUK A;  3ZWH A;  4MLW A;  1QXP A;  3EKH A;  1BLQ A;  1LIN A;  3RM1 A;  3BUO B;  1YVL A;  2HF5 A;  3KO0 A;  2H2K A;  1PSB A;  3GK1 A;  4YGB B;  3BYA A;  1UHK A;  1KCY A;  1CLL A;  2JT0 A;  1XK4 C;  3PSR A;  1CNP A;  1J7O A;  1C7W A;  1YUU A;  2DOQ A;  2KBM A;  2L5X B;  3JVT B;  3MSE B;  3TS5 C;  1CDP A;  2KYC A;  5AFP A;  1KQV A;  3WHT B;  4C0K A;  3PLF B;  1MQ1 A;  3FWC A;  4WRI A;  2QAC A;  1BG1 A;  1KFX L;  1MUX A;  1TNW A;  4YGC B;  3WXA A;  1UHJ A;  3I5F B;  3CTN A;  4FTG A;  2OS8 B;  1IH0 A;  3DVK A;  1K9K A;  1AJ4 A;  3DVM A;  1M45 A;  1U5I A;  2L2E A;  1RWY A;  4U8D A;  2EC6 B;  3DVE A;  3A8R A;  4PE7 A;  3IQQ A;  2OPO A;  3VRN A;  4F0Z B;  1TNX A;  1KK8 C;  3WHU B;  2OTG B;  1IWQ A;  2KGB C;  1EJ3 A;  4XYN A;  2E6W A;  1B7T Z;  1MWN A;  1YRT B;  2F2O A;  1M63 B;  3SG6 A;  1EXR A;  2NXQ A;  3CWG A;  4MZK A;  4P5O E;  3I5H C;  2AMI A;  1YX7 A;  1CB1 A;  3O6B A;  1NSH A;  2NZ0 A;  2KGR A;  3JTD B;  1WRK A;  4I5K A;  1XFV O;  3SIB A;  1XVJ A;  1KWO C;  5ER5 A;  1B8C A;  2LC5 A;  1YTZ C;  4JQ0 D;  1GQM A;  4AOM A;  1SNL A;  2M29 A;  4M2O A;  2JU0 A;  3SJS A;  3CS1 A;  2Y1M A;  1CM4 A;  5K89 A;  2KNE A;  4DRW A;  3I5H B;  1NX3 A;  1KK7 Z;  1CLM A;  2BBN A;  5CPV A;  1SCM C;  2LHI A;  1LKJ A;  1J1D A;  1WDC C;  1CM1 A;  2WND A;  3CGA A;  4ZCV A;  1TCO B;  2JZI A;  1S26 D;  3EKJ A;  1Y1U A;  5ER4 X;  4YBH B;  5DKQ A;  2FOT A;  1KWO B;  2JXL A;  4YRU A;  2G2B A;  1IQ5 A;  5KTY A;  1DJG A;  1A29 A;  3SG5 A;  2LHL A;  5I2L A;  4HRG A;  1SCV A;  1MR8 A;  2F3Z A;  3VRR A;  4DUQ A;  1LXF C;  1KFU S;  2PSR A;  1SR6 C;  2JTT A;  1EH2 A;  1WRZ A;  1S5G Z;  2M7N A;  3LL8 B;  5I2Q A;  3RLZ A;  4DIR A;  5AAN A;  1YVH A;  3PAL A;  2KDH A;  1PAL A;  1QX7 A;  2Y1N A;  1SCM B;  1K8U A;  1OMV A;  1Y1X A;  1JUO A;  3M0W A;  4AQJ A;  2MBX A;  4BY5 A;  4QJ4 B;  1B7T Y;  2LNK A;  2MAZ A;  3AKA A;  1Q80 A;  4WQ2 A;  4BY4 A;  1SK6 D;  4ETO A;  3A4U B;  4C0J A;  4PE1 A;  4GFT A;  1F71 A;  1NCX A;  2JPT A;  1XYD A;  1J1E A;  1XK4 A;  3K21 A;  2F33 A;  3GOF A;  4HRE E;  2B1U A;  2K7C A;  1QIV A;  4PE0 A;  3D10 A;  1REC A;  1CMF A;  1CDL A;  3TUY B;  3VRQ A;  1OZS A;  1K93 D;  3VRP A;  3IQO A;  1B8L A;  2LVV A;  4A4B A;  1A2X A;  1QS7 A;  1DVI A;  1QX5 B;  1FF1 A;  1KFU L;  1MXL C;  1NCZ A;  1DF0 A;  1S3P A;  2LMT A;  3JVT C;  1LA3 A;  3BOW B;  2KFF A;  1R2U A;  2QPT A;  2E30 A;  1QVI Z;  1F55 A;  2LV7 A;  2ISD A;  5J3X A;  3I5F C;  4QJ5 B;  2RGI A;  2O60 A;  2OS8 C;  1FI5 A;  2GV5 A;  4GNK B;  5DKN A;  4ZCU A;  1K2H A;  2D8N A;  2EC6 C;  2M0R A;  1X02 A;  3FWB A;  1OSA A;  1QAS A;  3NXA A;  2KFH A;  1A75 A;  4JWQ A;  4AQI A;  2OTG C;  1JFK A;  3IF7 A;  2BBM A;  2HPS A;  4I5L B;  2KFG A;  5HKW A;  1S5G Y;  1GGZ A;  2JTZ A;  2MRD A;  1D1O A;  2GGZ A;  2JQ6 A;  2O5G A;  1ZOT B;  4MSP A;  3NSK A;  3PAT A;  4OVN F;  1QAT A;  2CCM A;  2M97 A;  4NQG A;  1TNP A;  1ZAC A;  2K8M B;  4ORC B;  5AEQ A;  1Y1A A;  2BL0 C;  4CFR A;  1ZMZ A;  3GK2 A;  1CFF A;  3JTD C;  2EGD A;  1RK9 A;  1Y6W A;  2LUX A;  1SPY A;  2M8U A;  3OP0 A;  2CXJ A;  3LCP C;  1B1G A;  1RFJ A;  3PM8 A;  1V1F A;  2CTN A;  1AP4 A;  5F6T A;  1SL9 A;  2Y4Q A;  2ZRT A;  1N65 A;  1N0Y A;  1NWD A;  1MHO A;  1YUT A;  2MHH A;  4N1G A;  2BCB A;  2L51 A;  3NSO A;  4CID A;  5CSJ A;  1PVA A;  2WC8 A;  2GGM A;  2Y5I A;  2LVK A;  1FW4 A;  1QV1 A;  2F3Y A;  2WCE A;  2BL0 B;  2HET A;  2PVB A;  2I94 A;  1DJX A;  4PCW A;  2K61 A;  1G4Y R;  2KQY A;  1NPQ A;  1PUL A;  2AAO A;  3OB2 B;  4I5J A;  3SG7 A;  2KI6 C;  2NCP A;  1QV0 A;  1QVI Y;  4XJK A;  1SW8 A;  4WQ3 A;  2M1K B;  3FIA A;  3I5I B;  2L4H A;  1KQM B;  4Q04 A;  1CMG A;  1YR5 A;  1HT9 A;  1S6J A;  1M39 A;  4MZL A;  4MBE A;  2LUC A;  2JT3 A;  3EK8 A;  2R2I A;  2F8P A;  4L9M A;  1XFU O;  2AUC A;  2BE4 A;  2KOT A;  5DKR A;  2I18 A;  2JNF A;  4ORA B;  1MXE A;  1LA0 A;  2KSP A;  1CDM A;  5IBW A;  1LVC D;  1DJI A;  2CBL A;  1TRF A;  1QLS A;  2CNP A;  1AVS A;  4I5N B;  1ODB A;  2SAS A;  1R6P A;  1H8B A;  2WOR A;  4MEW A;  3QRX A;  2FCE A;  2KAY A;  1FPW A;  2KAV A;  4M2Q A;  1DJZ A;  4PDZ A;  3H4S E;  2LAN A;  1KSM A;  1PSR A;  1G8I A;  1B4C A;  3D0Y B;  4ORB B;  1DGV A;  1F4O A;  1QIW A;  1SBJ A;  3EK4 A;  4D1E A;  1M46 A;  2LLS A;  2WCF A;  1FBV A;  2K7D A;  1DGU A;  1OMR A;  2K0J A;  4R1E A;  1AHR A;  5HKY A;  3TUY C;  1J7Q A;  2CT9 A;  1AUI B;  1JFJ A;  1EG4 A;  3AAJ A;  2H61 C;  1XFZ O;  2KQ6 A;  1DJH A;  2FCD A;  1B8R A;  2Q4U A;  3HX4 A;  4PE4 A;  1QJT A;  1WRL A;  1IJ6 A;  1A4P A;  1K9P A;  1NX0 A;  3O4Y A;  4JPZ B;  1CDN A;  2ZN8 A;  1PVB A;  4ICB A;  3DVJ A;  1AJ5 A;  4HSZ A;  1JF0 A;  5JJG A;  2MA2 A;  2PAS A;  1U5I B;  5CSF A;  4GGF C;  2HQW A;  2ZRS A;  3VGO A;  5KSZ A;  4E68 A;  2LM5 A;  2SCP A;  3FS7 A;  4PHK A;  5B8I B;  1CFP A;  3E3R A;  4MZJ A;  1G33 A;  5D7F A;  3VRO A;  1IG5 A;  5AER A;  2LP2 A;  1JSA A;  2KYF A;  2JWW A;  2L0P A;  2K2F A;  2M3W A;  4N5X A;  1KK7 Y;  1K95 A;  3WNX B;  4MN0 A;  5KU1 A;  1SL8 A;  1XFX O;  2JRF A;  2K7B A;  2KAX A;  1OOJ A;  3HCM A;  3OHM B;  3EK7 A;  3EVR A;  4OR9 B;  3NSI A;  1NCY A;  2BE6 A;  4NDB A;  4GBA A;  1DT7 B;  1H4B A;  1RJV A;  1TTX A;  3AKB A;  4DCK A;  1F8H A;  1KFX S;  4UPG A;  1JC2 A;  4TNC A;  1VRK A;  2LVJ A;  3OB1 B;  1ZUZ A;  1DJW A;  3BQ3 A;  1TCF A;  1RTP 1;  5HLV A;  2BCA A;  1YRU B;  5HYD A;  3CLN A;  1UHI A;  3TDU A;  1L2O B;  3I5G B;  3PN7 B;  2Q91 A;  1BT6 A;  3D0Y A;  2LE9 B;  1UUS A;  1V1G A;  2MLE C;  1KSO A;  5D69 A;  1K94 A;  3PFV A;  2NLN A;  4MRY A;  4P2Y B;  3DF0 B;  2MLF C;  1XA5 A;  4GGN A;  1JF2 A;  4A4C A;  1GGW A;  2PRU A;  1ALV A;  1NP8 A;  1NIW A;  3I5I C;  1J7R A;  1KQM C;  5TNC A;  1IRJ A;  2HQ8 A;  3LLE A;  3SG3 A;  1TNQ A;  1SYM A;  3KF9 A;  3BXK A;  1L7Z A;  1RRO A;  1QLK A;  2TN4 A;  2M1U A;  3GK4 X;  4MRX A;  4OCI A;  4NDC A;  3CZT X;  3BUM B;  4GPL B;  1C07 A;  1WLM A;  4OKH A;  5AXI A;  2BEC A;  3KHE A;  1OMD A;  1S6I A;  3BUW B;  1S1E A;  2K7O A;  1SY9 A;  3EVU A;  5I8N A;  1F70 A;  2WCB A;  1C7V A;  1NX1 A;  1UP5 A;  4YI9 A;  3BUN B;  1XO5 A;  4M2P A;  1QTX A;  2JC2 A;  2H61 A;  2K2A A;  3CR4 X;  4USL A;  4PAL A;  2V53 A;  1GJY A;  1N2D A;  2NCO A;  1CKK A;  2KHN A;  2LP3 A;  3TS5 B;  1S36 A;  4PHN A;  2COL B;  1W7J B;  3LK0 A;  1HQV A;  2I7A A;  3BOW A;  1J7P A;  1BJF A;  1TN4 A;  4QJ3 B;  2P6B B;  1FI6 A;  1YX8 A;  2F2P A;  1OZO A;  1IJ5 A;  3BUX B;  1UHH A;  1EL4 A;  2I2R E;  1DF0 B;  4GGF A;  4PHM A;  4YI8 A;  1A03 A;  1SL7 A;  2A4J A;  1NX2 A;  3OX6 A;  1SRA A;  4FQO A;  1DJY A;  1DMO A;  1KK8 B;  1ZFS A;  1Y0V H;  2LMV A;  5JOL A;  1UHN A;  2ZFD A;  2LLT A;  1AK8 A;  1TOP A;  1F54 A;  1BU3 A;  4NDD A;  2EHB A;  1IKU A;  1QX2 A;  3CR2 A;  5I2O A;  1BMO A;  1JBA A;  4IL1 A;  2IS9 A;  3TDZ A;  2JT8 A;  5CSI A;  2L50 A;  3O2P A;  3SIA A;  2BKI B;  1TIZ A;  1A75 B;  1MF8 B;  1K96 A;  2PAL A;  1IGV A;  2PMY A;  1J55 A;  2FJU B;  5HKZ A;  2MJW B;  4CPV A;  1YUS A;  3CR5 X;  3DF0 A;  5HLO A;  4YGE B;  2LLU A;  3ZNI A;  1CFC A;  1W7I B;  2LCP A;  5GQQ C;  2M7L A;  2LVI A;  2ZN9 A;  4MVF A;  5G08 A;  5FYX A;  4C0L A;  1OE9 B;  3O78 A;  2L98 A;  4YGD B;  1S6C A;  3DD4 A;  2M9G A;  3ICB A;  1XFY O;  1NYA A;  1IQ3 A;  5CSN A;  4PHJ A;  1F4Q A;  1NUB A;  3F45 A;  2ZNE A;  1WDC B;  3AAK A;  3EVV A;  1B9A A;  1CTR A;  1OQP A;  3SG2 A;  2LAP A;  1XFW O;  1YUR A;  3LK1 A;  1CFD A;  1WLZ A;  3TZ1 A;  1PK0 D;  3OX5 A;  1SMG A;  2JXC A;  3C1V A;  3NSL A;  2KI4 C;  3KEV A;  1L2O C;  3I5G C;  4CFQ A;  3PN7 C;  1M31 A;  2M49 B;  1E8A A;  2LMU A;  2KBI A;  2L4I A;  2ZKM X;  1BOD A;  2BKH B;  1BR1 B;  1SR6 B;  1EG3 A;  1PRW A;  1ALW A;  2KI6 D;  2JNX A;  1SKT A;  2JUL A;  3KPX A;  1WY9 A;  3SG4 A;  1UWO A;  4XJK B;  2VRG A;  2G9B A;  1BF5 A;  1DTL A;  5BPJ A;  1UUR A;  4GAO A;  1BR4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...