1RJVA

Solution structure of human alpha-parvalbumin refined with a paramagnetism-based strategy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
b'MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Paramagnetism-Based Refinement Strategy for the Solution Structure of Human alpha-Parvalbumin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rjvA00
3BOWB 1OMVA 5HYDA 1F70A 2B1UA 2JULA 2ZRTA 5AEQA 4GUKA 2LC5A 3EVVA 1UHIA 1G33A 2HF5A 3E3RA 4NDBA 1K93D 4R1EA 2LP2A 1MXEA 4CPVA 1M31A 2JQ6A 4MBEA 1JFJA 1DJGA 2JC2A 2F2OA 2O5GA 4MSPA 1S5GZ 2M97A 3PSRA 1A75A 1QTXA 1JFKA 4YGEB 2BBNA 4U8DA 2ZFDA 4HREE 2M7LA 1JWDA 2MJWB 1OZOA 1K96A 1AHRA 1FF1A 2MAZA 1TNQA 1JF2A 1QJTA 1U5IB 2NXQA 3PM8A 3VRRA 2CTNA 1PULA 2PMYA 2ZNDA 4MRXA 3D10A 3NSLA 2ISDA 1BF5A 3JVTB 1DTLA 3DF0A 2RGIA 1NPQA 2LLTA 1J7QA 1G8IA 2F8PA 1B4CA 3CR2A 2FCEA 4WRIA 2MHHA 4N1FA 1DJHA 2ZN9A 2M29A 4AOMA 3PATA 1N65A 4GFTA 2I94A 3O6BA 3SG6A 2K7CA 5JJGA 4P5OE 1CFPA 1L2OB 1KSOA 2KHNA 3GK2A 2MA2A 1CNPA 4YGBB 3PFVA 1FW4A 5AANA 1LINA 2IS9A 3RLZA 1K8UA 4A4BA 2M7NA 2HQ8A 1RECA 1JUOA 3TDUA 1Q80A 2AMIA 1EJ3A 3SG4A 2QACA 2GGZA 2K7OA 1SR6C 3OX6A 1XVJA 4C0KA 4ORAB 1F55A 3EK7A 1CMGA 1OQPA 1B7TZ 1F71A 2Q91A 2M1KB 5DKQA 2CBLA 1HT9A 1AJ4A 4TNCA 1SRAA 2K61A 1F4OA 2K7BA 4DS7A 1ALWA 3TS5C 3OB1B 5GQQC 1MF8B 4CFQA 4OCIA 5KU1A 1F8HA 1NYAA 2WOSA 2COLB 2ZNEA 3EVUA 1A75B 1RTP1 1K9PA 1OZSA 1QASA 4JPZB 1QS7A 1SY9A 2HQWA 5AXIA 1SW8A 3D0YA 3F45A 4I5LB 4MN0A 1UHNA 4OVNF 3VGOA 4N1GA 3KHEA 1YR5A 1D1OA 4L9MA 3DF0B 2KBIA 2HPSA 4I5NB 1TRFA 3GK1A 1KFUS 1XFZO 1M45A 3A8RA 3MSEB 2LNKA 4ZCVA 1C07A 2MBXA 1N2DA 2Y1MA 4FQOA 1IG5A 2KBMA 3WNXB 2TN4A 1MQ1A 2HETA 1M46A 1W7IB 3PN7B 4MLWA 1CLMA 2NCPA 1IH0A 3VRQA 1J7PA 4MZJA 2K2AA 1AUIB 2L0PA 2SCPA 4DRWA 1NX1A 2CXJA 1SPYA 3SG3A 5JOLA 4NDCA 4E68A 1R6PA 2LAPA 1Y6WA 3FWCA 1A2XA 2AAOA 1QX2A 4ZCUA 1MR8A 1S6JA 3TDZA 3C1VA 1S36A 1ZOTB 1FI6A 3WHUB 2NCOA 1LXFC 2L4IA 5I2QA 1BJFA 4I5JA 2PRUA 1RJVA 1NX3A 2P6BB 2D8NA 1K90D 2CT9A 1L2OC 3I5FC 1DJIA 2JPTA 3AKAA 2KAXA 3VROA 2L50A 2BL0C 2LHIA 2LVIA 1S3PA 2M3WA 1NUBA 1J55A 2Y5IA 1QX5B 1YVHA 3SG7A 1A03A 1B9AA 3VRNA 1BODA 4UPGA 1PVAA 4C0LA 3TUYC 1WY9A 1ZMZA 4PDZA 1WDCC 4QJ4B 1Y1XA 2JXCA 4N5XA 4XYNA 1XO5A 3CR4X 2KQYA 4F0ZB 3WHTB 3I5IC 1S6IA 2KAYA 4PHNA 5HKYA 2JT0A 2WCEA 3SIBA 1KK7Y 4PE0A 1XFVO 2E6WA 2F2PA 2GV5A 5ER4X 1AK8A 1NCXA 3O2PA 5AFPA 1B8LA 2I2RE 4PE7A 2MRDA 1RFJA 2JWWA 5TNCA 1DJXA 2I7AA 1GGWA 3EKJA 2LM5A 1C7WA 3IQQA 1KWOC 1E8AA 2F3ZA 2KYFA 2KFHA 1Y1AA 4PALA 1UHJA 2MLEC 4GBAA 1KFXL 2KYCA 1IJ6A 4I5KA 5I8NA 1UHHA 3VRPA 2R2IA 3I5FB 3GK4X 2NLNA 1PALA 2BL0B 1SCMC 2JU0A 2K7DA 1UHKA 2KQ6A 3BUMB 5I2OA 1XK4A 2KOTA 5PALA 1XFWO 2LCPA 2LUXA 4GNKB 3LL8B 5HLOA 3TUYB 2LMTA 3PN7C 1WDCB 3K21A 4GGFA 4QJ3B 3ZNIA 4BY5A 5F6TA 1H4BA 1QATA 1FPWA 1DJZA 1Y1UA 1XK4C 3I5IB 1B1GA 5I2LA 1YVLA 1YUTA 4P2YB 2EHBA 4GPLB 4HSZA 1S5GY 1TOPA 3LK1A 2KDHA 2BECA 2MLFC 5D7FA 5HKZA 1M63B 3DVJA 1K9KA 3BQ3A 2JNXA 1IKUA 1J7OA 3I5GC 4YI9A 2KI4C 5B8IB 1HQVA 1CDLA 1TNWA 2ZN8A 2OPOA 2SASA 3TDIA 2GGMA 1IWQA 1IJ5A 1KWOB 1EH2A 2E30A 2L51A 4CIDA 1KSMA 4YRUA 1EXRA 1MHOA 2FJUB 1J1DA 1NX0A 1CTRA 5ER5A 3SJSA 3SG2A 4ORBB 1KCYA 1GGZA 4NQGA 2H61A 1SCMB 1MWNA 1NWDA 4PHJA 2BE4A 2KI6C 5HKWA 3OB2B 1FBVA 2BCAA 1IQ3A 1MUXA 1F54A 2M1UA 3DVMA 1KK8C 1WLZA 5HLVA 1CKKA 1R2UA 1LA0A 2G9BA 1CMFA 1KQMC 3FIAA 1B8CA 3EVRA 3SIAA 1F4QA 4QJ5B 2I18A 4JWQA 4USLA 2LMVA 2Q4UA 5G08A 1K9UA 1U5IA 2BCBA 2F3YA 3KEVA 1CDPA 3CS1A 3EK4A 1RROA 1SMGA 1YX8A 2JT3A 2WCFA 1SYMA 1KK7Z 3KO0A 1N0YA 4MVFA 3I5GB 5BPJA 1DF0A 2KI4B 3HX4A 2PSRA 1QLSA 1YUUA 2QPTA 3BUWB 3CLNA 4HRHA 2JT8A 5CSFA 1BLQA 1ZACA 2V53A 2LMUA 3NSOA 2WNDA 2K8MB 5CSJA 1QV0A 3JTDC 3SG5A 1CDNA 1EG4A 1WRLA 3PLFB 2JTTA 3FWBA 2G2BA 1QXPA 2EGDA 1BR1B 1OOJA 3D0YB 4ICBA 3AKBA 3LCPC 4GGNA 1LA3A 3BYAA 2LLUA 2Y4QA 2K0JA 3A4UB 4NDDA 2LP3A 1WLMA 1CDMA 1KK8B 3BUOB 1S6CA 1DGVA 5K89A 4PCWA 4WQ3A 1DJYA 3IF7A 2LVJA 1KQMB 1RK9A 2KI6D 3CTNA 2LUCA 3FS7A 1SKTA 3EKHA 1K95A 4A4CA 3WXAA 2WC8A 3OP0A 4DUQA 2JZIA 4OR9B 3OX5A 1JC2A 1ALVA 1VRKA 2DOQA 1YRTB 2M9GA 5FYXA 2PVBA 1ZUZA 1FI5A 4MEWA 1WRKA 1A4PA 2M8UA 3CWGA 1CLLA 3M0WA 1YRUB 1OMRA 2BKIB 4D1EA 2Y1NA 2NZ0A 3TZ1A 4MRYA 2L4HA 4MZLA 1NIWA 1AP4A 3RM1A 4C0JA 1XA5A 1EG3A 2KSPA 1TIZA 5IBWA 1SNLA 1K94A 1QVIY 3DVKA 3NSIA 4ETOA 1CFFA 1NX2A 3HCMA 2OS8C 3PALA 2BCXA 1DF0B 2EC6C 3JTDB 4PHMA 4XJKA 3I5HB 5KTYA 1SBJA 2LV7A 1OMDA 3KF9A 1QX7A 2WCBA 4YBHB 1CM4A 1TCOB 1C7VA 1XFUO 2K2FA 4DCKA 2M49B 2CNPA 1OE9B 1GQMA 2PALA 2OTGC 2PASA 3BXKA 1A29A 1SL7A 1PVBA 5CSIA 1AVSA 1SL8A 2O60A 4GGFC 4M2PA 1IRJA 1SL9A 1QV1A 3O4YA 5KSZA 1LVCD 1DT7B 5DKRA 3DVEA 1XFXO 2JTZA 1BG1A 1QIVA 1IQ5A 1KFUL 3NSKA 3CZTX 2KNEA 2LANA 1KFXS 4M2QA 1YURA 1TTXA 1BT6A 2AUCA 2JOJA 1KQVA 2KAVA 4MZKA 1TNPA 2M0RA 2F33A 5CPVA 1PSRA 1PRWA 1V1FA 3AAJA 4AQJA 4Q04A 3BOWA 1YTZC 4AQIA 1TCFA 3OHMB 2LE9B 1BU3A 4JQ0D 3IQOA 2FCDA 2JNFA 2LVKA 1DMOA 2A4JA 5J3XA 3CGAA 4GAOA 1S26D 3BUXB 2BBMA 1UURA 2OS8B 3EK8A 2H2KA 1BMOA 1J7RA 4M2OA 1CM1A 1XFYO 2EC6B 3NXAA 1NP8A 1PSBA 5D69A 4YGCB 1ODBA 3ICBA 1RWYA 2KGBC 2L2EA 4FTGA 2L98A 3LLEA 4YGDB 2H61C 1SCVA 1SK6D 3CR5X 1W7JB 1H8BA 1DJWA 1Y0VH 1MXLC 1BOCA 1J1EA 1B7TY 2LHLA 1UWOA 1UUSA 2FOTA 2OTGB 1V1GA 1L7ZA 2LLSA 1YUSA 4XJKB 5CSNA 3ZWHA 3GOFA 4PE4A 1EL4A 2VRGA 4PE1A 2WORA 4HRGA 1UP5A 4CLNA 1WRZA 4OKHA 3DD4A 1JF0A 2KFFA 1G4YR 4YI8A 1AJ5A 2BKHB 1NSHA 1DGUA 1SR6B 4OV2A 1M39A 4WQ2A 1QLKA 2BE6A 4CFRA 1BR4B 1JBAA 2KGRA 3H4SE 2KFGA 1ZFSA 1B47A 4PHKA 1TN4A 3JVTC 1PK0D 1CFCA 1YX7A 2ZRSA 4BY4A 1IGVA 1TNXA 1LKJA 5DKNA 3TS5B 5AERA 4ORCB 1NCZA 2LVVA 3I5HC 4IL1A 3AAKA 1CFDA 4DIRA 3QRXA 3BUNB 1DVIA 1K2HA 1OSAA 1CB1A 1B8RA 1X02A 1XYDA 3KPXA 2ZKMX 1QIWA 1GJYA 2CCMA 2JXLA 4YGAA 2JRFA 2L5XB 1CLBA 1QVIZ 3LK0A 1JSAA 3O78A 1S1EA 1NCYA
chains in the Genus database with same CATH superfamily
3BOWB 1OMVA 5HYDA 1F70A 1TWOA 2B1UA 2JULA 2ZRTA 5AEQA 4F7FA 4GUKA 2LC5A 3EVVA 1UHIA 1G33A 2HF5A 3E3RA 4NDBA 3S0FA 1K93D 4R1EA 2LP2A 1MXEA 4CPVA 1M31A 2JQ6A 3FE8A 4MBEA 1DJGA 1JFJA 2JC2A 2F2OA 2O5GA 4MSPA 1S5GZ 2M97A 3PSRA 1A75A 1QTXA 1JFKA 4YGEB 2BBNA 4U8DA 2ZFDA 4HREE 2M7LA 1JWDA 2KPHA 1OZOA 2MJWB 1K96A 1AHRA 1FF1A 2MAZA 1TNQA 1JF2A 1QJTA 1U5IB 2NXQA 3PM8A 3VRRA 2CTNA 3NHTA 1PULA 2PMYA 2ZNDA 4INXA 4MRXA 3D10A 3NSLA 5FI2A 2ISDA 1GM0A 1BF5A 3JVTB 1DTLA 3DF0A 2RGIA 1NPQA 2LLTA 1J7QA 1G8IA 2F8PA 1B4CA 3CR2A 2FCEA 4WRIA 2MHHA 4N1FA 3OBVA 1DJHA 2ZN9A 2M29A 4AOMA 3PATA 1N65A 4GFTA 2I94A 3O6BA 3SG6A 2K7CA 5JJGA 1Z2CB 4P5OE 1CFPA 1L2OB 1KSOA 2KHNA 2PQLA 3GK2A 2MA2A 1CNPA 4YGBB 3PFVA 1FW4A 5AANA 1LINA 2IS9A 3RLZA 1K8UA 4A4BA 2M7NA 2HQ8A 1RECA 1JUOA 3TDUA 1Q80A 2AMIA 1EJ3A 4OZDA 3SG4A 2QACA 2GGZA 2K7OA 1SR6C 3FE6A 3OX6A 1TUJA 1XVJA 3B87A 4C0KA 4ORAB 1F55A 3EK7A 1CMGA 1OQPA 3NHIA 1B7TZ 1F71A 2Q91A 2M1KB 5DKQA 2CBLA 1HT9A 1AJ4A 4TNCA 1SRAA 2K61A 1F4OA 2K7BA 4DS7A 1ALWA 3TS5C 3OB1B 5GQQC 1MF8B 4CFQA 4OCIA 5KU1A 1F8HA 1NYAA 2WOSA 2COLB 2ZNEA 3EVUA 1A75B 1RTP1 1K9PA 5D3OA 1OZSA 1QASA 4JPZB 1QS7A 1SY9A 2HQWA 5AXIA 2WCLA 1SW8A 3D0YA 3F45A 4I5LB 4MN0A 1UHNA 3S0EA 4OVNF 3VGOA 4N1GA 2ERBA 3CZ2A 3KHEA 1YR5A 1D1OA 3S0DA 4L9MA 3DF0B 2KBIA 2HPSA 4I5NB 1TRFA 3GK1A 1KFUS 1XFZO 1M45A 3A8RA 4INWA 3MSEB 2LNKA 1DEKA 3D73A 3L4LA 4ZCVA 3D75A 1C07A 2MBXA 1N2DA 2Y1MA 4FQOA 1IG5A 2KBMA 2KLEA 3WNXB 2TN4A 1MQ1A 2HETA 1M46A 1W7IB 3PN7B 4MLWA 1CLMA 2NCPA 3B86A 1IH0A 3VRQA 1J7PA 4MZJA 2K2AA 1AUIB 2L0PA 2SCPA 3CZ1A 3DYEA 1NX1A 4DRWA 2CXJA 1XFRA 1SPYA 3SG3A 2WC5A 5JOLA 4NDCA 4E68A 1R6PA 2LAPA 4IJ7A 1Y6WA 3FWCA 1A2XA 2AAOA 1QX2A 4ZCUA 1MR8A 1S6JA 3TDZA 3C1VA 2JPOA 1S36A 1ZOTB 1FI6A 3WHUB 2NCOA 1LXFC 2L4IA 5I2QA 1BJFA 4I5JA 2PRUA 1RJVA 1NX3A 2P6BB 2D8NA 1K90D 2CT9A 1L2OC 3I5FC 3N7HA 1DJIA 2JPTA 3AKAA 5FI7A 2KAXA 3VROA 2L50A 2BL0C 2LHIA 2LVIA 1S3PA 2M3WA 3CYZA 1NUBA 1J55A 2Y5IA 1QX5B 1OW4A 1YVHA 3SG7A 1A03A 1B9AA 3VRNA 1BODA 4UPGA 1PVAA 4C0LA 3TUYC 3SS3A 1WY9A 1ZMZA 4PDZA 1WDCC 4QJ4B 1Y1XA 2JXCA 4N5XA 4XYNA 1XO5A 2P71A 2KQYA 3CR4X 4F0ZB 3WHTB 3SS4A 3I5IC 5I94A 1S6IA 3DXLA 3NGVA 2KAYA 4PHNA 5HKYA 2JT0A 2KLDA 3L4AA 3R1VA 2WCEA 3PM2A 3SIBA 1KK7Y 4PE0A 1XFVO 2E6WA 2F2PA 2GV5A 4KYNA 5ER4X 1NCXA 3DZTA 1AK8A 3O2PA 5AFPA 1B8LA 2I2RE 4PE7A 2MRDA 1RFJA 2JWWA 2WC6A 5TNCA 1DJXA 2I7AA 1GGWA 3EKJA 2LM5A 1C7WA 3IQQA 1KWOC 2WCJA 1E8AA 2F3ZA 2KYFA 2QDIA 2KFHA 1Y1AA 4PALA 1UHJA 2MLEC 4GBAA 1KFXL 2KYCA 1DELA 1IJ6A 4I5KA 5I8NA 1UHHA 3VRPA 2R2IA 3I5FB 3GK4X 2NLNA 1PALA 1SCMC 2BL0B 2JU0A 2K7DA 1UHKA 2KQ6A 3BUMB 5I2OA 1XK4A 2KOTA 5PALA 2K60A 2QEBA 3EG5B 1XFWO 2LCPA 2LUXA 4GNKB 3LL8B 5HLOA 3L47A 3TUYB 5HL1A 2LMTA 5EL2A 2WCHA 3PN7C 1WDCB 3K21A 4GGFA 4QJ3B 3ZNIA 4BY5A 5F6TA 1H4BA 1QATA 1FPWA 1DJZA 1Y1UA 1XK4C 3I5IB 1B1GA 5I2LA 1YVLA 1YUTA 4P2YB 2EHBA 4GPLB 4HSZA 1S5GY 1DQEA 1TOPA 3LK1A 2KDHA 3PJIA 2BECA 3D76A 2MLFC 5D7FA 5HKZA 1M63B 3DVJA 1OOGA 1K9KA 3BQ3A 2JNXA 1IKUA 1J7OA 5FI6A 3I5GC 4FQTA 4YI9A 2GTEA 2KI4C 2WCKA 5B8IB 4PT1A 1HQVA 1Z4HA 1CDLA 1TNWA 2ZN8A 2OPOA 2SASA 3TDIA 2GGMA 1IWQA 1IJ5A 1KWOB 1EH2A 2E30A 2L51A 3UNWA 4CIDA 1KSMA 4YRUA 1EXRA 1MHOA 2FJUB 3V2LA 1J1DA 1NX0A 1CTRA 5ER5A 3SJSA 3SG2A 4ORBB 1KCYA 1GGZA 4NQGA 2H61A 1SCMB 1MWNA 1NWDA 4PHJA 2BE4A 2KI6C 5HKWA 3BFHA 3OB2B 1FBVA 2BCAA 1IQ3A 2H8VA 1MUXA 1F54A 2M1UA 3DVMA 1KK8C 1WLZA 5HLVA 1CKKA 1R2UA 1LA0A 2G9BA 1CMFA 1KQMC 3FIAA 1B8CA 3EVRA 3SIAA 1F4QA 4QJ5B 2I18A 4JWQA 4USLA 2FJYA 2LMVA 2Q4UA 5G08A 1K9UA 1U5IA 2BCBA 2F3YA 3KEVA 1CDPA 3CS1A 3EK4A 1RROA 1SMGA 1YX8A 2BAPA 2JT3A 2WCFA 1SYMA 3CZ0A 3FE9A 1LS8A 1KK7Z 2QEOA 3KO0A 1N0YA 4MVFA 3I5GB 5BPJA 2WCMA 1DF0A 2KI4B 3HX4A 2PSRA 1QLSA 1YUUA 2QPTA 3BUWB 3CLNA 4HRHA 2JT8A 1T14A 3BJHA 5CSFA 1BLQA 1ORGA 1ZACA 2V53A 2LMUA 3NSOA 2WNDA 1C3YA 3R1OA 2K8MB 5CSJA 1QV0A 3JTDC 3SG5A 1CDNA 3D77A 1EG4A 1WRLA 5DICA 3PLFB 2JTTA 3FWBA 2G2BA 1QXPA 2EGDA 1BR1B 1OOJA 3D0YB 4ICBA 3AKBA 3LCPC 4GGNA 1LA3A 3BYAA 2LLUA 2Y4QA 2K0JA 3A4UB 4NDDA 2LP3A 3S0GA 1WLMA 1CDMA 1KK8B 3BUOB 1S6CA 1DGVA 5K89A 4PCWA 4WQ3A 1DJYA 3IF7A 2LVJA 1OOIX 1KQMB 1RK9A 2KI6D 3CTNA 2LUCA 3DY9A 1SKTA 3EKHA 3FS7A 1K95A 4A4CA 3WXAA 2WC8A 3OP0A 4DUQA 2JZIA 4OR9B 3OX5A 1JC2A 1ALVA 1VRKA 2DOQA 1YRTB 2M9GA 5FYXA 2PVBA 4JKTA 1ZUZA 2PYQA 1FI5A 4MEWA 1WRKA 1A4PA 2M8UA 3CWGA 1CLLA 3M0WA 3QMEA 3B7AA 2P70A 1YRUB 1OMRA 2BKIB 4D1EA 2Y1NA 2NZ0A 1DC1A 3TZ1A 4MRYA 2L4HA 4MZLA 1NIWA 1AP4A 3RM1A 1OOHA 4C0JA 1XA5A 1EG3A 3Q8IA 1QWVA 3CABA 2KSPA 1TIZA 5IBWA 1SNLA 1K94A 1QVIY 3DVKA 3NSIA 4ETOA 1CFFA 1NX2A 3HCMA 2OS8C 3PALA 4JD9A 3O4XA 2BCXA 1DF0B 2EC6C 3JTDB 3R1PA 4PHMA 4XJKA 3I5HB 5KTYA 1SBJA 2LV7A 1OMDA 3KF9A 1P28A 1QX7A 2WCBA 4YBHB 1CM4A 1TCOB 1C7VA 1XFUO 2K2FA 4DCKA 2M49B 3BFAA 2CNPA 1OE9B 1GQMA 2QEHA 2PALA 2OTGC 2PASA 3BXKA 1A29A 1SL7A 1PVBA 3OGNA 5CSIA 1AVSA 1SL8A 2O60A 2QEVA 1OOFA 4GGFC 4M2PA 1IIOA 1IRJA 1SL9A 2YGUA 1QV1A 3O4YA 5KSZA 1LVCD 1DT7B 5DKRA 3DVEA 3S0BA 1XFXO 2JTZA 3B6XA 1QIVA 1BG1A 1IQ5A 1KFUL 3NSKA 3CZTX 2KNEA 3D78A 2LANA 3UO9A 1KFXS 4M2QA 1YURA 1SSEB 1TTXA 1BT6A 2AUCA 2JOJA 3S0AA 1KQVA 2KAVA 4MZKA 1TNPA 2M0RA 2F33A 5CPVA 1PSRA 1PRWA 1V1FA 3AAJA 4AQJA 4Q04A 1W9ZA 1YTZC 3BOWA 4AQIA 1TCFA 3OHMB 2LE9B 1BU3A 4JQ0D 3IQOA 1TUZA 2FCDA 2JNFA 2LVKA 1DMOA 2A4JA 5J3XA 1C3ZA 3CGAA 4GAOA 1S26D 3BUXB 2BBMA 1UURA 2OS8B 3EK8A 2H2KA 1BMOA 1J7RA 4M2OA 1CM1A 1XFYO 2EC6B 3NXAA 1NP8A 1PSBA 3R72A 2BNXA 5D69A 4YGCB 1ODBA 3ICBA 1RWYA 2KGBC 2L2EA 4FTGA 2L98A 3BFBA 3LLEA 4YGDB 2H61C 1SCVA 1SK6D 3CR5X 1W7JB 1H8BA 1DJWA 1Y0VH 1MXLC 1BOCA 1J1EA 1B7TY 2LHLA 1UWOA 1UUSA 2FOTA 2L5YA 2OTGB 1V1GA 1L7ZA 2LLSA 1YUSA 4XJKB 5CSNA 3ZWHA 3GOFA 4PE4A 1EL4A 2VRGA 3CDNA 4PE1A 2WORA 3SS5A 4HRGA 1UP5A 2L2CA 1WRZA 4OKHA 4CLNA 3DD4A 1JF0A 2KFFA 1G4YR 4YI8A 1AJ5A 1NSHA 2BKHB 3D74A 1DGUA 1SR6B 4OV2A 1M39A 4WQ2A 1QLKA 2BE6A 3VB1A 4CFRA 1BR4B 1JBAA 2KGRA 3H4SE 2KFGA 1ZFSA 1B47A 4PHKA 3IVTA 1TN4A 3B88A 1PK0D 3JVTC 1CFCA 1YX7A 2ZRSA 4BY4A 1IGVA 1TNXA 1LKJA 5DKNA 3TS5B 5AERA 4ORCB 1NCZA 2LVVA 3I5HC 4IL1A 3AAKA 1CFDA 4DIRA 3QRXA 3BUNB 1DVIA 1K2HA 1OSAA 1CB1A 1B8RA 1X02A 1XYDA 3KPXA 2ZKMX 1QIWA 3RZSA 1GJYA 2CCMA 2JXLA 4YGAA 2JRFA 2L5XB 1CLBA 1QVIZ 3LK0A 1JSAA 3O78A 1S1EA 3K1EA 1NCYA
chains in the Genus database with same CATH topology
3BOWB 1OMVA 5HYDA 1F70A 2B1UA 2JULA 2ZRTA 5AEQA 4GUKA 2LC5A 3EVVA 1UHIA 1G33A 2HF5A 3E3RA 4NDBA 1K93D 4R1EA 2LP2A 1MXEA 4CPVA 1M31A 2JQ6A 4MBEA 1JFJA 1DJGA 2JC2A 2F2OA 2O5GA 4MSPA 1S5GZ 2M97A 3PSRA 1A75A 1QTXA 1JFKA 4YGEB 2BBNA 4U8DA 2ZFDA 4HREE 2M7LA 1JWDA 2MJWB 1OZOA 1K96A 1AHRA 1FF1A 2MAZA 1TNQA 1JF2A 1QJTA 1U5IB 2NXQA 3PM8A 3VRRA 2CTNA 1PULA 2PMYA 2ZNDA 4MRXA 3D10A 3NSLA 2ISDA 1BF5A 3JVTB 1DTLA 3DF0A 2RGIA 1NPQA 2LLTA 1J7QA 1G8IA 2F8PA 1B4CA 3CR2A 2FCEA 4WRIA 2MHHA 4N1FA 1DJHA 2ZN9A 2M29A 4AOMA 3PATA 1N65A 4GFTA 2I94A 3O6BA 3SG6A 2K7CA 5JJGA 4P5OE 1CFPA 1L2OB 1KSOA 2KHNA 3GK2A 2MA2A 1CNPA 4YGBB 3PFVA 1FW4A 5AANA 1LINA 2IS9A 3RLZA 1K8UA 4A4BA 2M7NA 2HQ8A 1RECA 1JUOA 3TDUA 1Q80A 2AMIA 1EJ3A 3SG4A 2QACA 2GGZA 2K7OA 1SR6C 3OX6A 1XVJA 4C0KA 4ORAB 1F55A 3EK7A 1CMGA 1OQPA 1B7TZ 1F71A 2Q91A 2M1KB 5DKQA 2CBLA 1HT9A 1AJ4A 4TNCA 1SRAA 2K61A 1F4OA 2K7BA 4DS7A 1ALWA 3TS5C 3OB1B 5GQQC 1MF8B 4CFQA 4OCIA 5KU1A 1F8HA 1NYAA 2WOSA 2COLB 2ZNEA 3EVUA 1A75B 1RTP1 1K9PA 1OZSA 1QASA 4JPZB 1QS7A 1SY9A 2HQWA 5AXIA 1SW8A 3D0YA 3F45A 4I5LB 4MN0A 1UHNA 4OVNF 3VGOA 4N1GA 3KHEA 1YR5A 1D1OA 4L9MA 3DF0B 2KBIA 2HPSA 4I5NB 1TRFA 3GK1A 1KFUS 1XFZO 1M45A 3A8RA 3MSEB 2LNKA 4ZCVA 1C07A 2MBXA 1N2DA 2Y1MA 4FQOA 1IG5A 2KBMA 3WNXB 2TN4A 1MQ1A 2HETA 1M46A 1W7IB 3PN7B 4MLWA 1CLMA 2NCPA 1IH0A 3VRQA 1J7PA 4MZJA 2K2AA 1AUIB 2L0PA 2SCPA 4DRWA 1NX1A 2CXJA 1SPYA 3SG3A 5JOLA 4NDCA 4E68A 1R6PA 2LAPA 1Y6WA 3FWCA 1A2XA 2AAOA 1QX2A 4ZCUA 1MR8A 1S6JA 3TDZA 3C1VA 1S36A 1ZOTB 1FI6A 3WHUB 2NCOA 1LXFC 2L4IA 5I2QA 1BJFA 4I5JA 2PRUA 1RJVA 1NX3A 2P6BB 2D8NA 1K90D 2CT9A 1L2OC 3I5FC 1DJIA 2JPTA 3AKAA 2KAXA 3VROA 2L50A 2BL0C 2LHIA 2LVIA 1S3PA 2M3WA 1NUBA 1J55A 2Y5IA 1QX5B 1YVHA 3SG7A 1A03A 1B9AA 3VRNA 1BODA 4UPGA 1PVAA 4C0LA 3TUYC 1WY9A 1ZMZA 4PDZA 1WDCC 4QJ4B 1Y1XA 2JXCA 4N5XA 4XYNA 1XO5A 3CR4X 2KQYA 4F0ZB 3WHTB 3I5IC 1S6IA 2KAYA 4PHNA 5HKYA 2JT0A 2WCEA 3SIBA 1KK7Y 4PE0A 1XFVO 2E6WA 2F2PA 2GV5A 5ER4X 1AK8A 1NCXA 3O2PA 5AFPA 1B8LA 2I2RE 4PE7A 2MRDA 1RFJA 2JWWA 5TNCA 1DJXA 2I7AA 1GGWA 3EKJA 2LM5A 1C7WA 3IQQA 1KWOC 1E8AA 2F3ZA 2KYFA 2KFHA 1Y1AA 4PALA 1UHJA 2MLEC 4GBAA 1KFXL 2KYCA 1IJ6A 4I5KA 5I8NA 1UHHA 3VRPA 2R2IA 3I5FB 3GK4X 2NLNA 1PALA 2BL0B 1SCMC 2JU0A 2K7DA 1UHKA 2KQ6A 3BUMB 5I2OA 1XK4A 2KOTA 5PALA 1XFWO 2LCPA 2LUXA 4GNKB 3LL8B 5HLOA 3TUYB 2LMTA 3PN7C 1WDCB 3K21A 4GGFA 4QJ3B 3ZNIA 4BY5A 5F6TA 1H4BA 1QATA 1FPWA 1DJZA 1Y1UA 1XK4C 3I5IB 1B1GA 5I2LA 1YVLA 1YUTA 4P2YB 2EHBA 4GPLB 4HSZA 1S5GY 1TOPA 3LK1A 2KDHA 2BECA 2MLFC 5D7FA 5HKZA 1M63B 3DVJA 1K9KA 3BQ3A 2JNXA 1IKUA 1J7OA 3I5GC 4YI9A 2KI4C 5B8IB 1HQVA 1CDLA 1TNWA 2ZN8A 2OPOA 2SASA 3TDIA 2GGMA 1IWQA 1IJ5A 1KWOB 1EH2A 2E30A 2L51A 4CIDA 1KSMA 4YRUA 1EXRA 1MHOA 2FJUB 1J1DA 1NX0A 1CTRA 5ER5A 3SJSA 3SG2A 4ORBB 1KCYA 1GGZA 4NQGA 2H61A 1SCMB 1MWNA 1NWDA 4PHJA 2BE4A 2KI6C 5HKWA 3OB2B 1FBVA 2BCAA 1IQ3A 1MUXA 1F54A 2M1UA 3DVMA 1KK8C 1WLZA 5HLVA 1CKKA 1R2UA 1LA0A 2G9BA 1CMFA 1KQMC 3FIAA 1B8CA 3EVRA 3SIAA 1F4QA 4QJ5B 2I18A 4JWQA 4USLA 2LMVA 2Q4UA 5G08A 1K9UA 1U5IA 2BCBA 2F3YA 3KEVA 1CDPA 3CS1A 3EK4A 1RROA 1SMGA 1YX8A 2JT3A 2WCFA 1SYMA 1KK7Z 3KO0A 1N0YA 4MVFA 3I5GB 5BPJA 1DF0A 2KI4B 3HX4A 2PSRA 1QLSA 1YUUA 2QPTA 3BUWB 3CLNA 4HRHA 2JT8A 5CSFA 1BLQA 1ZACA 2V53A 2LMUA 3NSOA 2WNDA 2K8MB 5CSJA 1QV0A 3JTDC 3SG5A 1CDNA 1EG4A 1WRLA 3PLFB 2JTTA 3FWBA 2G2BA 1QXPA 2EGDA 1BR1B 1OOJA 3D0YB 4ICBA 3AKBA 3LCPC 4GGNA 1LA3A 3BYAA 2LLUA 2Y4QA 2K0JA 3A4UB 4NDDA 2LP3A 1WLMA 1CDMA 1KK8B 3BUOB 1S6CA 1DGVA 5K89A 4PCWA 4WQ3A 1DJYA 3IF7A 2LVJA 1KQMB 1RK9A 2KI6D 3CTNA 2LUCA 3FS7A 1SKTA 3EKHA 1K95A 4A4CA 3WXAA 2WC8A 3OP0A 4DUQA 2JZIA 4OR9B 3OX5A 1JC2A 1ALVA 1VRKA 2DOQA 1YRTB 2M9GA 5FYXA 2PVBA 1ZUZA 1FI5A 4MEWA 1WRKA 1A4PA 2M8UA 3CWGA 1CLLA 3M0WA 1YRUB 1OMRA 2BKIB 4D1EA 2Y1NA 2NZ0A 3TZ1A 4MRYA 2L4HA 4MZLA 1NIWA 1AP4A 3RM1A 4C0JA 1XA5A 1EG3A 2KSPA 1TIZA 5IBWA 1SNLA 1K94A 1QVIY 3DVKA 3NSIA 4ETOA 1CFFA 1NX2A 3HCMA 2OS8C 3PALA 2BCXA 1DF0B 2EC6C 3JTDB 4PHMA 4XJKA 3I5HB 5KTYA 1SBJA 2LV7A 1OMDA 3KF9A 1QX7A 2WCBA 4YBHB 1CM4A 1TCOB 1C7VA 1XFUO 2K2FA 4DCKA 2M49B 2CNPA 1OE9B 1GQMA 2PALA 2OTGC 2PASA 3BXKA 1A29A 1SL7A 1PVBA 5CSIA 1AVSA 1SL8A 2O60A 4GGFC 4M2PA 1IRJA 1SL9A 1QV1A 3O4YA 5KSZA 1LVCD 1DT7B 5DKRA 3DVEA 1XFXO 2JTZA 1BG1A 1QIVA 1IQ5A 1KFUL 3NSKA 3CZTX 2KNEA 2LANA 1KFXS 4M2QA 1YURA 1TTXA 1BT6A 2AUCA 2JOJA 1KQVA 2KAVA 4MZKA 1TNPA 2M0RA 2F33A 5CPVA 1PSRA 1PRWA 1V1FA 3AAJA 4AQJA 4Q04A 3BOWA 1YTZC 4AQIA 1TCFA 3OHMB 2LE9B 1BU3A 4JQ0D 3IQOA 2FCDA 2JNFA 2LVKA 1DMOA 2A4JA 5J3XA 3CGAA 4GAOA 1S26D 3BUXB 2BBMA 1UURA 2OS8B 3EK8A 2H2KA 1BMOA 1J7RA 4M2OA 1CM1A 1XFYO 2EC6B 3NXAA 1NP8A 1PSBA 5D69A 4YGCB 1ODBA 3ICBA 1RWYA 2KGBC 2L2EA 4FTGA 2L98A 3LLEA 4YGDB 2H61C 1SCVA 1SK6D 3CR5X 1W7JB 1H8BA 1DJWA 1Y0VH 1MXLC 1BOCA 1J1EA 1B7TY 2LHLA 1UWOA 1UUSA 2FOTA 2OTGB 1V1GA 1L7ZA 2LLSA 1YUSA 4XJKB 5CSNA 3ZWHA 3GOFA 4PE4A 1EL4A 2VRGA 4PE1A 2WORA 4HRGA 1UP5A 4CLNA 1WRZA 4OKHA 3DD4A 1JF0A 2KFFA 1G4YR 4YI8A 1AJ5A 2BKHB 1NSHA 1DGUA 1SR6B 4OV2A 1M39A 4WQ2A 1QLKA 2BE6A 4CFRA 1BR4B 1JBAA 2KGRA 3H4SE 2KFGA 1ZFSA 1B47A 4PHKA 1TN4A 3JVTC 1PK0D 1CFCA 1YX7A 2ZRSA 4BY4A 1IGVA 1TNXA 1LKJA 5DKNA 3TS5B 5AERA 4ORCB 1NCZA 2LVVA 3I5HC 4IL1A 3AAKA 1CFDA 4DIRA 3QRXA 3BUNB 1DVIA 1K2HA 1OSAA 1CB1A 1B8RA 1X02A 1XYDA 3KPXA 2ZKMX 1QIWA 1GJYA 2CCMA 2JXLA 4YGAA 2JRFA 2L5XB 1CLBA 1QVIZ 3LK0A 1JSAA 3O78A 1S1EA 1NCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BOW B;  1OMV A;  5HYD A;  1F70 A;  2B1U A;  2JUL A;  2ZRT A;  5AEQ A;  4GUK A;  2LC5 A;  3EVV A;  1UHI A;  1G33 A;  2HF5 A;  3E3R A;  4NDB A;  1K93 D;  4R1E A;  2LP2 A;  1MXE A;  4CPV A;  1M31 A;  2JQ6 A;  4MBE A;  1JFJ A;  1DJG A;  2JC2 A;  2F2O A;  2O5G A;  4MSP A;  1S5G Z;  2M97 A;  3PSR A;  1A75 A;  1QTX A;  1JFK A;  4YGE B;  2BBN A;  4U8D A;  2ZFD A;  4HRE E;  2M7L A;  1JWD A;  2MJW B;  1OZO A;  1K96 A;  1AHR A;  1FF1 A;  2MAZ A;  1TNQ A;  1JF2 A;  1QJT A;  1U5I B;  2NXQ A;  3PM8 A;  3VRR A;  2CTN A;  1PUL A;  2PMY A;  2ZND A;  4MRX A;  3D10 A;  3NSL A;  2ISD A;  1BF5 A;  3JVT B;  1DTL A;  3DF0 A;  2RGI A;  1NPQ A;  2LLT A;  1J7Q A;  1G8I A;  2F8P A;  1B4C A;  3CR2 A;  2FCE A;  4WRI A;  2MHH A;  4N1F A;  1DJH A;  2ZN9 A;  2M29 A;  4AOM A;  3PAT A;  1N65 A;  4GFT A;  2I94 A;  3O6B A;  3SG6 A;  2K7C A;  5JJG A;  4P5O E;  1CFP A;  1L2O B;  1KSO A;  2KHN A;  3GK2 A;  2MA2 A;  1CNP A;  4YGB B;  3PFV A;  1FW4 A;  5AAN A;  1LIN A;  2IS9 A;  3RLZ A;  1K8U A;  4A4B A;  2M7N A;  2HQ8 A;  1REC A;  1JUO A;  3TDU A;  1Q80 A;  2AMI A;  1EJ3 A;  3SG4 A;  2QAC A;  2GGZ A;  2K7O A;  1SR6 C;  3OX6 A;  1XVJ A;  4C0K A;  4ORA B;  1F55 A;  3EK7 A;  1CMG A;  1OQP A;  1B7T Z;  1F71 A;  2Q91 A;  2M1K B;  5DKQ A;  2CBL A;  1HT9 A;  1AJ4 A;  4TNC A;  1SRA A;  2K61 A;  1F4O A;  2K7B A;  4DS7 A;  1ALW A;  3TS5 C;  3OB1 B;  5GQQ C;  1MF8 B;  4CFQ A;  4OCI A;  5KU1 A;  1F8H A;  1NYA A;  2WOS A;  2COL B;  2ZNE A;  3EVU A;  1A75 B;  1RTP 1;  1K9P A;  1OZS A;  1QAS A;  4JPZ B;  1QS7 A;  1SY9 A;  2HQW A;  5AXI A;  1SW8 A;  3D0Y A;  3F45 A;  4I5L B;  4MN0 A;  1UHN A;  4OVN F;  3VGO A;  4N1G A;  3KHE A;  1YR5 A;  1D1O A;  4L9M A;  3DF0 B;  2KBI A;  2HPS A;  4I5N B;  1TRF A;  3GK1 A;  1KFU S;  1XFZ O;  1M45 A;  3A8R A;  3MSE B;  2LNK A;  4ZCV A;  1C07 A;  2MBX A;  1N2D A;  2Y1M A;  4FQO A;  1IG5 A;  2KBM A;  3WNX B;  2TN4 A;  1MQ1 A;  2HET A;  1M46 A;  1W7I B;  3PN7 B;  4MLW A;  1CLM A;  2NCP A;  1IH0 A;  3VRQ A;  1J7P A;  4MZJ A;  2K2A A;  1AUI B;  2L0P A;  2SCP A;  4DRW A;  1NX1 A;  2CXJ A;  1SPY A;  3SG3 A;  5JOL A;  4NDC A;  4E68 A;  1R6P A;  2LAP A;  1Y6W A;  3FWC A;  1A2X A;  2AAO A;  1QX2 A;  4ZCU A;  1MR8 A;  1S6J A;  3TDZ A;  3C1V A;  1S36 A;  1ZOT B;  1FI6 A;  3WHU B;  2NCO A;  1LXF C;  2L4I A;  5I2Q A;  1BJF A;  4I5J A;  2PRU A;  1RJV A;  1NX3 A;  2P6B B;  2D8N A;  1K90 D;  2CT9 A;  1L2O C;  3I5F C;  1DJI A;  2JPT A;  3AKA A;  2KAX A;  3VRO A;  2L50 A;  2BL0 C;  2LHI A;  2LVI A;  1S3P A;  2M3W A;  1NUB A;  1J55 A;  2Y5I A;  1QX5 B;  1YVH A;  3SG7 A;  1A03 A;  1B9A A;  3VRN A;  1BOD A;  4UPG A;  1PVA A;  4C0L A;  3TUY C;  1WY9 A;  1ZMZ A;  4PDZ A;  1WDC C;  4QJ4 B;  1Y1X A;  2JXC A;  4N5X A;  4XYN A;  1XO5 A;  3CR4 X;  2KQY A;  4F0Z B;  3WHT B;  3I5I C;  1S6I A;  2KAY A;  4PHN A;  5HKY A;  2JT0 A;  2WCE A;  3SIB A;  1KK7 Y;  4PE0 A;  1XFV O;  2E6W A;  2F2P A;  2GV5 A;  5ER4 X;  1AK8 A;  1NCX A;  3O2P A;  5AFP A;  1B8L A;  2I2R E;  4PE7 A;  2MRD A;  1RFJ A;  2JWW A;  5TNC A;  1DJX A;  2I7A A;  1GGW A;  3EKJ A;  2LM5 A;  1C7W A;  3IQQ A;  1KWO C;  1E8A A;  2F3Z A;  2KYF A;  2KFH A;  1Y1A A;  4PAL A;  1UHJ A;  2MLE C;  4GBA A;  1KFX L;  2KYC A;  1IJ6 A;  4I5K A;  5I8N A;  1UHH A;  3VRP A;  2R2I A;  3I5F B;  3GK4 X;  2NLN A;  1PAL A;  2BL0 B;  1SCM C;  2JU0 A;  2K7D A;  1UHK A;  2KQ6 A;  3BUM B;  5I2O A;  1XK4 A;  2KOT A;  5PAL A;  1XFW O;  2LCP A;  2LUX A;  4GNK B;  3LL8 B;  5HLO A;  3TUY B;  2LMT A;  3PN7 C;  1WDC B;  3K21 A;  4GGF A;  4QJ3 B;  3ZNI A;  4BY5 A;  5F6T A;  1H4B A;  1QAT A;  1FPW A;  1DJZ A;  1Y1U A;  1XK4 C;  3I5I B;  1B1G A;  5I2L A;  1YVL A;  1YUT A;  4P2Y B;  2EHB A;  4GPL B;  4HSZ A;  1S5G Y;  1TOP A;  3LK1 A;  2KDH A;  2BEC A;  2MLF C;  5D7F A;  5HKZ A;  1M63 B;  3DVJ A;  1K9K A;  3BQ3 A;  2JNX A;  1IKU A;  1J7O A;  3I5G C;  4YI9 A;  2KI4 C;  5B8I B;  1HQV A;  1CDL A;  1TNW A;  2ZN8 A;  2OPO A;  2SAS A;  3TDI A;  2GGM A;  1IWQ A;  1IJ5 A;  1KWO B;  1EH2 A;  2E30 A;  2L51 A;  4CID A;  1KSM A;  4YRU A;  1EXR A;  1MHO A;  2FJU B;  1J1D A;  1NX0 A;  1CTR A;  5ER5 A;  3SJS A;  3SG2 A;  4ORB B;  1KCY A;  1GGZ A;  4NQG A;  2H61 A;  1SCM B;  1MWN A;  1NWD A;  4PHJ A;  2BE4 A;  2KI6 C;  5HKW A;  3OB2 B;  1FBV A;  2BCA A;  1IQ3 A;  1MUX A;  1F54 A;  2M1U A;  3DVM A;  1KK8 C;  1WLZ A;  5HLV A;  1CKK A;  1R2U A;  1LA0 A;  2G9B A;  1CMF A;  1KQM C;  3FIA A;  1B8C A;  3EVR A;  3SIA A;  1F4Q A;  4QJ5 B;  2I18 A;  4JWQ A;  4USL A;  2LMV A;  2Q4U A;  5G08 A;  1K9U A;  1U5I A;  2BCB A;  2F3Y A;  3KEV A;  1CDP A;  3CS1 A;  3EK4 A;  1RRO A;  1SMG A;  1YX8 A;  2JT3 A;  2WCF A;  1SYM A;  1KK7 Z;  3KO0 A;  1N0Y A;  4MVF A;  3I5G B;  5BPJ A;  1DF0 A;  2KI4 B;  3HX4 A;  2PSR A;  1QLS A;  1YUU A;  2QPT A;  3BUW B;  3CLN A;  4HRH A;  2JT8 A;  5CSF A;  1BLQ A;  1ZAC A;  2V53 A;  2LMU A;  3NSO A;  2WND A;  2K8M B;  5CSJ A;  1QV0 A;  3JTD C;  3SG5 A;  1CDN A;  1EG4 A;  1WRL A;  3PLF B;  2JTT A;  3FWB A;  2G2B A;  1QXP A;  2EGD A;  1BR1 B;  1OOJ A;  3D0Y B;  4ICB A;  3AKB A;  3LCP C;  4GGN A;  1LA3 A;  3BYA A;  2LLU A;  2Y4Q A;  2K0J A;  3A4U B;  4NDD A;  2LP3 A;  1WLM A;  1CDM A;  1KK8 B;  3BUO B;  1S6C A;  1DGV A;  5K89 A;  4PCW A;  4WQ3 A;  1DJY A;  3IF7 A;  2LVJ A;  1KQM B;  1RK9 A;  2KI6 D;  3CTN A;  2LUC A;  3FS7 A;  1SKT A;  3EKH A;  1K95 A;  4A4C A;  3WXA A;  2WC8 A;  3OP0 A;  4DUQ A;  2JZI A;  4OR9 B;  3OX5 A;  1JC2 A;  1ALV A;  1VRK A;  2DOQ A;  1YRT B;  2M9G A;  5FYX A;  2PVB A;  1ZUZ A;  1FI5 A;  4MEW A;  1WRK A;  1A4P A;  2M8U A;  3CWG A;  1CLL A;  3M0W A;  1YRU B;  1OMR A;  2BKI B;  4D1E A;  2Y1N A;  2NZ0 A;  3TZ1 A;  4MRY A;  2L4H A;  4MZL A;  1NIW A;  1AP4 A;  3RM1 A;  4C0J A;  1XA5 A;  1EG3 A;  2KSP A;  1TIZ A;  5IBW A;  1SNL A;  1K94 A;  1QVI Y;  3DVK A;  3NSI A;  4ETO A;  1CFF A;  1NX2 A;  3HCM A;  2OS8 C;  3PAL A;  2BCX A;  1DF0 B;  2EC6 C;  3JTD B;  4PHM A;  4XJK A;  3I5H B;  5KTY A;  1SBJ A;  2LV7 A;  1OMD A;  3KF9 A;  1QX7 A;  2WCB A;  4YBH B;  1CM4 A;  1TCO B;  1C7V A;  1XFU O;  2K2F A;  4DCK A;  2M49 B;  2CNP A;  1OE9 B;  1GQM A;  2PAL A;  2OTG C;  2PAS A;  3BXK A;  1A29 A;  1SL7 A;  1PVB A;  5CSI A;  1AVS A;  1SL8 A;  2O60 A;  4GGF C;  4M2P A;  1IRJ A;  1SL9 A;  1QV1 A;  3O4Y A;  5KSZ A;  1LVC D;  1DT7 B;  5DKR A;  3DVE A;  1XFX O;  2JTZ A;  1BG1 A;  1QIV A;  1IQ5 A;  1KFU L;  3NSK A;  3CZT X;  2KNE A;  2LAN A;  1KFX S;  4M2Q A;  1YUR A;  1TTX A;  1BT6 A;  2AUC A;  2JOJ A;  1KQV A;  2KAV A;  4MZK A;  1TNP A;  2M0R A;  2F33 A;  5CPV A;  1PSR A;  1PRW A;  1V1F A;  3AAJ A;  4AQJ A;  4Q04 A;  3BOW A;  1YTZ C;  4AQI A;  1TCF A;  3OHM B;  2LE9 B;  1BU3 A;  4JQ0 D;  3IQO A;  2FCD A;  2JNF A;  2LVK A;  1DMO A;  2A4J A;  5J3X A;  3CGA A;  4GAO A;  1S26 D;  3BUX B;  2BBM A;  1UUR A;  2OS8 B;  3EK8 A;  2H2K A;  1BMO A;  1J7R A;  4M2O A;  1CM1 A;  1XFY O;  2EC6 B;  3NXA A;  1NP8 A;  1PSB A;  5D69 A;  4YGC B;  1ODB A;  3ICB A;  1RWY A;  2KGB C;  2L2E A;  4FTG A;  2L98 A;  3LLE A;  4YGD B;  2H61 C;  1SCV A;  1SK6 D;  3CR5 X;  1W7J B;  1H8B A;  1DJW A;  1Y0V H;  1MXL C;  1BOC A;  1J1E A;  1B7T Y;  2LHL A;  1UWO A;  1UUS A;  2FOT A;  2OTG B;  1V1G A;  1L7Z A;  2LLS A;  1YUS A;  4XJK B;  5CSN A;  3ZWH A;  3GOF A;  4PE4 A;  1EL4 A;  2VRG A;  4PE1 A;  2WOR A;  4HRG A;  1UP5 A;  4CLN A;  1WRZ A;  4OKH A;  3DD4 A;  1JF0 A;  2KFF A;  1G4Y R;  4YI8 A;  1AJ5 A;  2BKH B;  1NSH A;  1DGU A;  1SR6 B;  4OV2 A;  1M39 A;  4WQ2 A;  1QLK A;  2BE6 A;  4CFR A;  1BR4 B;  1JBA A;  2KGR A;  3H4S E;  2KFG A;  1ZFS A;  1B47 A;  4PHK A;  1TN4 A;  3JVT C;  1PK0 D;  1CFC A;  1YX7 A;  2ZRS A;  4BY4 A;  1IGV A;  1TNX A;  1LKJ A;  5DKN A;  3TS5 B;  5AER A;  4ORC B;  1NCZ A;  2LVV A;  3I5H C;  4IL1 A;  3AAK A;  1CFD A;  4DIR A;  3QRX A;  3BUN B;  1DVI A;  1K2H A;  1OSA A;  1CB1 A;  1B8R A;  1X02 A;  1XYD A;  3KPX A;  2ZKM X;  1QIW A;  1GJY A;  2CCM A;  2JXL A;  4YGA A;  2JRF A;  2L5X B;  1CLB A;  1QVI Z;  3LK0 A;  1JSA A;  3O78 A;  1S1E A;  1NCY A; 
#chains in the Genus database with same CATH topology
 3BOW B;  1OMV A;  5HYD A;  1F70 A;  1TWO A;  2B1U A;  2JUL A;  2ZRT A;  5AEQ A;  4F7F A;  4GUK A;  2LC5 A;  3EVV A;  1UHI A;  1G33 A;  2HF5 A;  3E3R A;  4NDB A;  3S0F A;  1K93 D;  4R1E A;  2LP2 A;  1MXE A;  4CPV A;  1M31 A;  2JQ6 A;  3FE8 A;  4MBE A;  1DJG A;  1JFJ A;  2JC2 A;  2F2O A;  2O5G A;  4MSP A;  1S5G Z;  2M97 A;  3PSR A;  1A75 A;  1QTX A;  1JFK A;  4YGE B;  2BBN A;  4U8D A;  2ZFD A;  4HRE E;  2M7L A;  1JWD A;  2KPH A;  1OZO A;  2MJW B;  1K96 A;  1AHR A;  1FF1 A;  2MAZ A;  1TNQ A;  1JF2 A;  1QJT A;  1U5I B;  2NXQ A;  3PM8 A;  3VRR A;  2CTN A;  3NHT A;  1PUL A;  2PMY A;  2ZND A;  4INX A;  4MRX A;  3D10 A;  3NSL A;  5FI2 A;  2ISD A;  1GM0 A;  1BF5 A;  3JVT B;  1DTL A;  3DF0 A;  2RGI A;  1NPQ A;  2LLT A;  1J7Q A;  1G8I A;  2F8P A;  1B4C A;  3CR2 A;  2FCE A;  4WRI A;  2MHH A;  4N1F A;  3OBV A;  1DJH A;  2ZN9 A;  2M29 A;  4AOM A;  3PAT A;  1N65 A;  4GFT A;  2I94 A;  3O6B A;  3SG6 A;  2K7C A;  5JJG A;  1Z2C B;  4P5O E;  1CFP A;  1L2O B;  1KSO A;  2KHN A;  2PQL A;  3GK2 A;  2MA2 A;  1CNP A;  4YGB B;  3PFV A;  1FW4 A;  5AAN A;  1LIN A;  2IS9 A;  3RLZ A;  1K8U A;  4A4B A;  2M7N A;  2HQ8 A;  1REC A;  1JUO A;  3TDU A;  1Q80 A;  2AMI A;  1EJ3 A;  4OZD A;  3SG4 A;  2QAC A;  2GGZ A;  2K7O A;  1SR6 C;  3FE6 A;  3OX6 A;  1TUJ A;  1XVJ A;  3B87 A;  4C0K A;  4ORA B;  1F55 A;  3EK7 A;  1CMG A;  1OQP A;  3NHI A;  1B7T Z;  1F71 A;  2Q91 A;  2M1K B;  5DKQ A;  2CBL A;  1HT9 A;  1AJ4 A;  4TNC A;  1SRA A;  2K61 A;  1F4O A;  2K7B A;  4DS7 A;  1ALW A;  3TS5 C;  3OB1 B;  5GQQ C;  1MF8 B;  4CFQ A;  4OCI A;  5KU1 A;  1F8H A;  1NYA A;  2WOS A;  2COL B;  2ZNE A;  3EVU A;  1A75 B;  1RTP 1;  1K9P A;  5D3O A;  1OZS A;  1QAS A;  4JPZ B;  1QS7 A;  1SY9 A;  2HQW A;  5AXI A;  2WCL A;  1SW8 A;  3D0Y A;  3F45 A;  4I5L B;  4MN0 A;  1UHN A;  3S0E A;  4OVN F;  3VGO A;  4N1G A;  2ERB A;  3CZ2 A;  3KHE A;  1YR5 A;  1D1O A;  3S0D A;  4L9M A;  3DF0 B;  2KBI A;  2HPS A;  4I5N B;  1TRF A;  3GK1 A;  1KFU S;  1XFZ O;  1M45 A;  3A8R A;  4INW A;  3MSE B;  2LNK A;  1DEK A;  3D73 A;  3L4L A;  4ZCV A;  3D75 A;  1C07 A;  2MBX A;  1N2D A;  2Y1M A;  4FQO A;  1IG5 A;  2KBM A;  2KLE A;  3WNX B;  2TN4 A;  1MQ1 A;  2HET A;  1M46 A;  1W7I B;  3PN7 B;  4MLW A;  1CLM A;  2NCP A;  3B86 A;  1IH0 A;  3VRQ A;  1J7P A;  4MZJ A;  2K2A A;  1AUI B;  2L0P A;  2SCP A;  3CZ1 A;  3DYE A;  1NX1 A;  4DRW A;  2CXJ A;  1XFR A;  1SPY A;  3SG3 A;  2WC5 A;  5JOL A;  4NDC A;  4E68 A;  1R6P A;  2LAP A;  4IJ7 A;  1Y6W A;  3FWC A;  1A2X A;  2AAO A;  1QX2 A;  4ZCU A;  1MR8 A;  1S6J A;  3TDZ A;  3C1V A;  2JPO A;  1S36 A;  1ZOT B;  1FI6 A;  3WHU B;  2NCO A;  1LXF C;  2L4I A;  5I2Q A;  1BJF A;  4I5J A;  2PRU A;  1RJV A;  1NX3 A;  2P6B B;  2D8N A;  1K90 D;  2CT9 A;  1L2O C;  3I5F C;  3N7H A;  1DJI A;  2JPT A;  3AKA A;  5FI7 A;  2KAX A;  3VRO A;  2L50 A;  2BL0 C;  2LHI A;  2LVI A;  1S3P A;  2M3W A;  3CYZ A;  1NUB A;  1J55 A;  2Y5I A;  1QX5 B;  1OW4 A;  1YVH A;  3SG7 A;  1A03 A;  1B9A A;  3VRN A;  1BOD A;  4UPG A;  1PVA A;  4C0L A;  3TUY C;  3SS3 A;  1WY9 A;  1ZMZ A;  4PDZ A;  1WDC C;  4QJ4 B;  1Y1X A;  2JXC A;  4N5X A;  4XYN A;  1XO5 A;  2P71 A;  2KQY A;  3CR4 X;  4F0Z B;  3WHT B;  3SS4 A;  3I5I C;  5I94 A;  1S6I A;  3DXL A;  3NGV A;  2KAY A;  4PHN A;  5HKY A;  2JT0 A;  2KLD A;  3L4A A;  3R1V A;  2WCE A;  3PM2 A;  3SIB A;  1KK7 Y;  4PE0 A;  1XFV O;  2E6W A;  2F2P A;  2GV5 A;  4KYN A;  5ER4 X;  1NCX A;  3DZT A;  1AK8 A;  3O2P A;  5AFP A;  1B8L A;  2I2R E;  4PE7 A;  2MRD A;  1RFJ A;  2JWW A;  2WC6 A;  5TNC A;  1DJX A;  2I7A A;  1GGW A;  3EKJ A;  2LM5 A;  1C7W A;  3IQQ A;  1KWO C;  2WCJ A;  1E8A A;  2F3Z A;  2KYF A;  2QDI A;  2KFH A;  1Y1A A;  4PAL A;  1UHJ A;  2MLE C;  4GBA A;  1KFX L;  2KYC A;  1DEL A;  1IJ6 A;  4I5K A;  5I8N A;  1UHH A;  3VRP A;  2R2I A;  3I5F B;  3GK4 X;  2NLN A;  1PAL A;  1SCM C;  2BL0 B;  2JU0 A;  2K7D A;  1UHK A;  2KQ6 A;  3BUM B;  5I2O A;  1XK4 A;  2KOT A;  5PAL A;  2K60 A;  2QEB A;  3EG5 B;  1XFW O;  2LCP A;  2LUX A;  4GNK B;  3LL8 B;  5HLO A;  3L47 A;  3TUY B;  5HL1 A;  2LMT A;  5EL2 A;  2WCH A;  3PN7 C;  1WDC B;  3K21 A;  4GGF A;  4QJ3 B;  3ZNI A;  4BY5 A;  5F6T A;  1H4B A;  1QAT A;  1FPW A;  1DJZ A;  1Y1U A;  1XK4 C;  3I5I B;  1B1G A;  5I2L A;  1YVL A;  1YUT A;  4P2Y B;  2EHB A;  4GPL B;  4HSZ A;  1S5G Y;  1DQE A;  1TOP A;  3LK1 A;  2KDH A;  3PJI A;  2BEC A;  3D76 A;  2MLF C;  5D7F A;  5HKZ A;  1M63 B;  3DVJ A;  1OOG A;  1K9K A;  3BQ3 A;  2JNX A;  1IKU A;  1J7O A;  5FI6 A;  3I5G C;  4FQT A;  4YI9 A;  2GTE A;  2KI4 C;  2WCK A;  5B8I B;  4PT1 A;  1HQV A;  1Z4H A;  1CDL A;  1TNW A;  2ZN8 A;  2OPO A;  2SAS A;  3TDI A;  2GGM A;  1IWQ A;  1IJ5 A;  1KWO B;  1EH2 A;  2E30 A;  2L51 A;  3UNW A;  4CID A;  1KSM A;  4YRU A;  1EXR A;  1MHO A;  2FJU B;  3V2L A;  1J1D A;  1NX0 A;  1CTR A;  5ER5 A;  3SJS A;  3SG2 A;  4ORB B;  1KCY A;  1GGZ A;  4NQG A;  2H61 A;  1SCM B;  1MWN A;  1NWD A;  4PHJ A;  2BE4 A;  2KI6 C;  5HKW A;  3BFH A;  3OB2 B;  1FBV A;  2BCA A;  1IQ3 A;  2H8V A;  1MUX A;  1F54 A;  2M1U A;  3DVM A;  1KK8 C;  1WLZ A;  5HLV A;  1CKK A;  1R2U A;  1LA0 A;  2G9B A;  1CMF A;  1KQM C;  3FIA A;  1B8C A;  3EVR A;  3SIA A;  1F4Q A;  4QJ5 B;  2I18 A;  4JWQ A;  4USL A;  2FJY A;  2LMV A;  2Q4U A;  5G08 A;  1K9U A;  1U5I A;  2BCB A;  2F3Y A;  3KEV A;  1CDP A;  3CS1 A;  3EK4 A;  1RRO A;  1SMG A;  1YX8 A;  2BAP A;  2JT3 A;  2WCF A;  1SYM A;  3CZ0 A;  3FE9 A;  1LS8 A;  1KK7 Z;  2QEO A;  3KO0 A;  1N0Y A;  4MVF A;  3I5G B;  5BPJ A;  2WCM A;  1DF0 A;  2KI4 B;  3HX4 A;  2PSR A;  1QLS A;  1YUU A;  2QPT A;  3BUW B;  3CLN A;  4HRH A;  2JT8 A;  1T14 A;  3BJH A;  5CSF A;  1BLQ A;  1ORG A;  1ZAC A;  2V53 A;  2LMU A;  3NSO A;  2WND A;  1C3Y A;  3R1O A;  2K8M B;  5CSJ A;  1QV0 A;  3JTD C;  3SG5 A;  1CDN A;  3D77 A;  1EG4 A;  1WRL A;  5DIC A;  3PLF B;  2JTT A;  3FWB A;  2G2B A;  1QXP A;  2EGD A;  1BR1 B;  1OOJ A;  3D0Y B;  4ICB A;  3AKB A;  3LCP C;  4GGN A;  1LA3 A;  3BYA A;  2LLU A;  2Y4Q A;  2K0J A;  3A4U B;  4NDD A;  2LP3 A;  3S0G A;  1WLM A;  1CDM A;  1KK8 B;  3BUO B;  1S6C A;  1DGV A;  5K89 A;  4PCW A;  4WQ3 A;  1DJY A;  3IF7 A;  2LVJ A;  1OOI X;  1KQM B;  1RK9 A;  2KI6 D;  3CTN A;  2LUC A;  3DY9 A;  1SKT A;  3EKH A;  3FS7 A;  1K95 A;  4A4C A;  3WXA A;  2WC8 A;  3OP0 A;  4DUQ A;  2JZI A;  4OR9 B;  3OX5 A;  1JC2 A;  1ALV A;  1VRK A;  2DOQ A;  1YRT B;  2M9G A;  5FYX A;  2PVB A;  4JKT A;  1ZUZ A;  2PYQ A;  1FI5 A;  4MEW A;  1WRK A;  1A4P A;  2M8U A;  3CWG A;  1CLL A;  3M0W A;  3QME A;  3B7A A;  2P70 A;  1YRU B;  1OMR A;  2BKI B;  4D1E A;  2Y1N A;  2NZ0 A;  1DC1 A;  3TZ1 A;  4MRY A;  2L4H A;  4MZL A;  1NIW A;  1AP4 A;  3RM1 A;  1OOH A;  4C0J A;  1XA5 A;  1EG3 A;  3Q8I A;  1QWV A;  3CAB A;  2KSP A;  1TIZ A;  5IBW A;  1SNL A;  1K94 A;  1QVI Y;  3DVK A;  3NSI A;  4ETO A;  1CFF A;  1NX2 A;  3HCM A;  2OS8 C;  3PAL A;  4JD9 A;  3O4X A;  2BCX A;  1DF0 B;  2EC6 C;  3JTD B;  3R1P A;  4PHM A;  4XJK A;  3I5H B;  5KTY A;  1SBJ A;  2LV7 A;  1OMD A;  3KF9 A;  1P28 A;  1QX7 A;  2WCB A;  4YBH B;  1CM4 A;  1TCO B;  1C7V A;  1XFU O;  2K2F A;  4DCK A;  2M49 B;  3BFA A;  2CNP A;  1OE9 B;  1GQM A;  2QEH A;  2PAL A;  2OTG C;  2PAS A;  3BXK A;  1A29 A;  1SL7 A;  1PVB A;  3OGN A;  5CSI A;  1AVS A;  1SL8 A;  2O60 A;  2QEV A;  1OOF A;  4GGF C;  4M2P A;  1IIO A;  1IRJ A;  1SL9 A;  2YGU A;  1QV1 A;  3O4Y A;  5KSZ A;  1LVC D;  1DT7 B;  5DKR A;  3DVE A;  3S0B A;  1XFX O;  2JTZ A;  3B6X A;  1QIV A;  1BG1 A;  1IQ5 A;  1KFU L;  3NSK A;  3CZT X;  2KNE A;  3D78 A;  2LAN A;  3UO9 A;  1KFX S;  4M2Q A;  1YUR A;  1SSE B;  1TTX A;  1BT6 A;  2AUC A;  2JOJ A;  3S0A A;  1KQV A;  2KAV A;  4MZK A;  1TNP A;  2M0R A;  2F33 A;  5CPV A;  1PSR A;  1PRW A;  1V1F A;  3AAJ A;  4AQJ A;  4Q04 A;  1W9Z A;  1YTZ C;  3BOW A;  4AQI A;  1TCF A;  3OHM B;  2LE9 B;  1BU3 A;  4JQ0 D;  3IQO A;  1TUZ A;  2FCD A;  2JNF A;  2LVK A;  1DMO A;  2A4J A;  5J3X A;  1C3Z A;  3CGA A;  4GAO A;  1S26 D;  3BUX B;  2BBM A;  1UUR A;  2OS8 B;  3EK8 A;  2H2K A;  1BMO A;  1J7R A;  4M2O A;  1CM1 A;  1XFY O;  2EC6 B;  3NXA A;  1NP8 A;  1PSB A;  3R72 A;  2BNX A;  5D69 A;  4YGC B;  1ODB A;  3ICB A;  1RWY A;  2KGB C;  2L2E A;  4FTG A;  2L98 A;  3BFB A;  3LLE A;  4YGD B;  2H61 C;  1SCV A;  1SK6 D;  3CR5 X;  1W7J B;  1H8B A;  1DJW A;  1Y0V H;  1MXL C;  1BOC A;  1J1E A;  1B7T Y;  2LHL A;  1UWO A;  1UUS A;  2FOT A;  2L5Y A;  2OTG B;  1V1G A;  1L7Z A;  2LLS A;  1YUS A;  4XJK B;  5CSN A;  3ZWH A;  3GOF A;  4PE4 A;  1EL4 A;  2VRG A;  3CDN A;  4PE1 A;  2WOR A;  3SS5 A;  4HRG A;  1UP5 A;  2L2C A;  1WRZ A;  4OKH A;  4CLN A;  3DD4 A;  1JF0 A;  2KFF A;  1G4Y R;  4YI8 A;  1AJ5 A;  1NSH A;  2BKH B;  3D74 A;  1DGU A;  1SR6 B;  4OV2 A;  1M39 A;  4WQ2 A;  1QLK A;  2BE6 A;  3VB1 A;  4CFR A;  1BR4 B;  1JBA A;  2KGR A;  3H4S E;  2KFG A;  1ZFS A;  1B47 A;  4PHK A;  3IVT A;  1TN4 A;  3B88 A;  1PK0 D;  3JVT C;  1CFC A;  1YX7 A;  2ZRS A;  4BY4 A;  1IGV A;  1TNX A;  1LKJ A;  5DKN A;  3TS5 B;  5AER A;  4ORC B;  1NCZ A;  2LVV A;  3I5H C;  4IL1 A;  3AAK A;  1CFD A;  4DIR A;  3QRX A;  3BUN B;  1DVI A;  1K2H A;  1OSA A;  1CB1 A;  1B8R A;  1X02 A;  1XYD A;  3KPX A;  2ZKM X;  1QIW A;  3RZS A;  1GJY A;  2CCM A;  2JXL A;  4YGA A;  2JRF A;  2L5X B;  1CLB A;  1QVI Z;  3LK0 A;  1JSA A;  3O78 A;  1S1E A;  3K1E A;  1NCY A; 
#chains in the Genus database with same CATH homology
 3BOW B;  1OMV A;  5HYD A;  1F70 A;  2B1U A;  2JUL A;  2ZRT A;  5AEQ A;  4GUK A;  2LC5 A;  3EVV A;  1UHI A;  1G33 A;  2HF5 A;  3E3R A;  4NDB A;  1K93 D;  4R1E A;  2LP2 A;  1MXE A;  4CPV A;  1M31 A;  2JQ6 A;  4MBE A;  1JFJ A;  1DJG A;  2JC2 A;  2F2O A;  2O5G A;  4MSP A;  1S5G Z;  2M97 A;  3PSR A;  1A75 A;  1QTX A;  1JFK A;  4YGE B;  2BBN A;  4U8D A;  2ZFD A;  4HRE E;  2M7L A;  1JWD A;  2MJW B;  1OZO A;  1K96 A;  1AHR A;  1FF1 A;  2MAZ A;  1TNQ A;  1JF2 A;  1QJT A;  1U5I B;  2NXQ A;  3PM8 A;  3VRR A;  2CTN A;  1PUL A;  2PMY A;  2ZND A;  4MRX A;  3D10 A;  3NSL A;  2ISD A;  1BF5 A;  3JVT B;  1DTL A;  3DF0 A;  2RGI A;  1NPQ A;  2LLT A;  1J7Q A;  1G8I A;  2F8P A;  1B4C A;  3CR2 A;  2FCE A;  4WRI A;  2MHH A;  4N1F A;  1DJH A;  2ZN9 A;  2M29 A;  4AOM A;  3PAT A;  1N65 A;  4GFT A;  2I94 A;  3O6B A;  3SG6 A;  2K7C A;  5JJG A;  4P5O E;  1CFP A;  1L2O B;  1KSO A;  2KHN A;  3GK2 A;  2MA2 A;  1CNP A;  4YGB B;  3PFV A;  1FW4 A;  5AAN A;  1LIN A;  2IS9 A;  3RLZ A;  1K8U A;  4A4B A;  2M7N A;  2HQ8 A;  1REC A;  1JUO A;  3TDU A;  1Q80 A;  2AMI A;  1EJ3 A;  3SG4 A;  2QAC A;  2GGZ A;  2K7O A;  1SR6 C;  3OX6 A;  1XVJ A;  4C0K A;  4ORA B;  1F55 A;  3EK7 A;  1CMG A;  1OQP A;  1B7T Z;  1F71 A;  2Q91 A;  2M1K B;  5DKQ A;  2CBL A;  1HT9 A;  1AJ4 A;  4TNC A;  1SRA A;  2K61 A;  1F4O A;  2K7B A;  4DS7 A;  1ALW A;  3TS5 C;  3OB1 B;  5GQQ C;  1MF8 B;  4CFQ A;  4OCI A;  5KU1 A;  1F8H A;  1NYA A;  2WOS A;  2COL B;  2ZNE A;  3EVU A;  1A75 B;  1RTP 1;  1K9P A;  1OZS A;  1QAS A;  4JPZ B;  1QS7 A;  1SY9 A;  2HQW A;  5AXI A;  1SW8 A;  3D0Y A;  3F45 A;  4I5L B;  4MN0 A;  1UHN A;  4OVN F;  3VGO A;  4N1G A;  3KHE A;  1YR5 A;  1D1O A;  4L9M A;  3DF0 B;  2KBI A;  2HPS A;  4I5N B;  1TRF A;  3GK1 A;  1KFU S;  1XFZ O;  1M45 A;  3A8R A;  3MSE B;  2LNK A;  4ZCV A;  1C07 A;  2MBX A;  1N2D A;  2Y1M A;  4FQO A;  1IG5 A;  2KBM A;  3WNX B;  2TN4 A;  1MQ1 A;  2HET A;  1M46 A;  1W7I B;  3PN7 B;  4MLW A;  1CLM A;  2NCP A;  1IH0 A;  3VRQ A;  1J7P A;  4MZJ A;  2K2A A;  1AUI B;  2L0P A;  2SCP A;  4DRW A;  1NX1 A;  2CXJ A;  1SPY A;  3SG3 A;  5JOL A;  4NDC A;  4E68 A;  1R6P A;  2LAP A;  1Y6W A;  3FWC A;  1A2X A;  2AAO A;  1QX2 A;  4ZCU A;  1MR8 A;  1S6J A;  3TDZ A;  3C1V A;  1S36 A;  1ZOT B;  1FI6 A;  3WHU B;  2NCO A;  1LXF C;  2L4I A;  5I2Q A;  1BJF A;  4I5J A;  2PRU A;  1RJV A;  1NX3 A;  2P6B B;  2D8N A;  1K90 D;  2CT9 A;  1L2O C;  3I5F C;  1DJI A;  2JPT A;  3AKA A;  2KAX A;  3VRO A;  2L50 A;  2BL0 C;  2LHI A;  2LVI A;  1S3P A;  2M3W A;  1NUB A;  1J55 A;  2Y5I A;  1QX5 B;  1YVH A;  3SG7 A;  1A03 A;  1B9A A;  3VRN A;  1BOD A;  4UPG A;  1PVA A;  4C0L A;  3TUY C;  1WY9 A;  1ZMZ A;  4PDZ A;  1WDC C;  4QJ4 B;  1Y1X A;  2JXC A;  4N5X A;  4XYN A;  1XO5 A;  3CR4 X;  2KQY A;  4F0Z B;  3WHT B;  3I5I C;  1S6I A;  2KAY A;  4PHN A;  5HKY A;  2JT0 A;  2WCE A;  3SIB A;  1KK7 Y;  4PE0 A;  1XFV O;  2E6W A;  2F2P A;  2GV5 A;  5ER4 X;  1AK8 A;  1NCX A;  3O2P A;  5AFP A;  1B8L A;  2I2R E;  4PE7 A;  2MRD A;  1RFJ A;  2JWW A;  5TNC A;  1DJX A;  2I7A A;  1GGW A;  3EKJ A;  2LM5 A;  1C7W A;  3IQQ A;  1KWO C;  1E8A A;  2F3Z A;  2KYF A;  2KFH A;  1Y1A A;  4PAL A;  1UHJ A;  2MLE C;  4GBA A;  1KFX L;  2KYC A;  1IJ6 A;  4I5K A;  5I8N A;  1UHH A;  3VRP A;  2R2I A;  3I5F B;  3GK4 X;  2NLN A;  1PAL A;  2BL0 B;  1SCM C;  2JU0 A;  2K7D A;  1UHK A;  2KQ6 A;  3BUM B;  5I2O A;  1XK4 A;  2KOT A;  5PAL A;  1XFW O;  2LCP A;  2LUX A;  4GNK B;  3LL8 B;  5HLO A;  3TUY B;  2LMT A;  3PN7 C;  1WDC B;  3K21 A;  4GGF A;  4QJ3 B;  3ZNI A;  4BY5 A;  5F6T A;  1H4B A;  1QAT A;  1FPW A;  1DJZ A;  1Y1U A;  1XK4 C;  3I5I B;  1B1G A;  5I2L A;  1YVL A;  1YUT A;  4P2Y B;  2EHB A;  4GPL B;  4HSZ A;  1S5G Y;  1TOP A;  3LK1 A;  2KDH A;  2BEC A;  2MLF C;  5D7F A;  5HKZ A;  1M63 B;  3DVJ A;  1K9K A;  3BQ3 A;  2JNX A;  1IKU A;  1J7O A;  3I5G C;  4YI9 A;  2KI4 C;  5B8I B;  1HQV A;  1CDL A;  1TNW A;  2ZN8 A;  2OPO A;  2SAS A;  3TDI A;  2GGM A;  1IWQ A;  1IJ5 A;  1KWO B;  1EH2 A;  2E30 A;  2L51 A;  4CID A;  1KSM A;  4YRU A;  1EXR A;  1MHO A;  2FJU B;  1J1D A;  1NX0 A;  1CTR A;  5ER5 A;  3SJS A;  3SG2 A;  4ORB B;  1KCY A;  1GGZ A;  4NQG A;  2H61 A;  1SCM B;  1MWN A;  1NWD A;  4PHJ A;  2BE4 A;  2KI6 C;  5HKW A;  3OB2 B;  1FBV A;  2BCA A;  1IQ3 A;  1MUX A;  1F54 A;  2M1U A;  3DVM A;  1KK8 C;  1WLZ A;  5HLV A;  1CKK A;  1R2U A;  1LA0 A;  2G9B A;  1CMF A;  1KQM C;  3FIA A;  1B8C A;  3EVR A;  3SIA A;  1F4Q A;  4QJ5 B;  2I18 A;  4JWQ A;  4USL A;  2LMV A;  2Q4U A;  5G08 A;  1K9U A;  1U5I A;  2BCB A;  2F3Y A;  3KEV A;  1CDP A;  3CS1 A;  3EK4 A;  1RRO A;  1SMG A;  1YX8 A;  2JT3 A;  2WCF A;  1SYM A;  1KK7 Z;  3KO0 A;  1N0Y A;  4MVF A;  3I5G B;  5BPJ A;  1DF0 A;  2KI4 B;  3HX4 A;  2PSR A;  1QLS A;  1YUU A;  2QPT A;  3BUW B;  3CLN A;  4HRH A;  2JT8 A;  5CSF A;  1BLQ A;  1ZAC A;  2V53 A;  2LMU A;  3NSO A;  2WND A;  2K8M B;  5CSJ A;  1QV0 A;  3JTD C;  3SG5 A;  1CDN A;  1EG4 A;  1WRL A;  3PLF B;  2JTT A;  3FWB A;  2G2B A;  1QXP A;  2EGD A;  1BR1 B;  1OOJ A;  3D0Y B;  4ICB A;  3AKB A;  3LCP C;  4GGN A;  1LA3 A;  3BYA A;  2LLU A;  2Y4Q A;  2K0J A;  3A4U B;  4NDD A;  2LP3 A;  1WLM A;  1CDM A;  1KK8 B;  3BUO B;  1S6C A;  1DGV A;  5K89 A;  4PCW A;  4WQ3 A;  1DJY A;  3IF7 A;  2LVJ A;  1KQM B;  1RK9 A;  2KI6 D;  3CTN A;  2LUC A;  3FS7 A;  1SKT A;  3EKH A;  1K95 A;  4A4C A;  3WXA A;  2WC8 A;  3OP0 A;  4DUQ A;  2JZI A;  4OR9 B;  3OX5 A;  1JC2 A;  1ALV A;  1VRK A;  2DOQ A;  1YRT B;  2M9G A;  5FYX A;  2PVB A;  1ZUZ A;  1FI5 A;  4MEW A;  1WRK A;  1A4P A;  2M8U A;  3CWG A;  1CLL A;  3M0W A;  1YRU B;  1OMR A;  2BKI B;  4D1E A;  2Y1N A;  2NZ0 A;  3TZ1 A;  4MRY A;  2L4H A;  4MZL A;  1NIW A;  1AP4 A;  3RM1 A;  4C0J A;  1XA5 A;  1EG3 A;  2KSP A;  1TIZ A;  5IBW A;  1SNL A;  1K94 A;  1QVI Y;  3DVK A;  3NSI A;  4ETO A;  1CFF A;  1NX2 A;  3HCM A;  2OS8 C;  3PAL A;  2BCX A;  1DF0 B;  2EC6 C;  3JTD B;  4PHM A;  4XJK A;  3I5H B;  5KTY A;  1SBJ A;  2LV7 A;  1OMD A;  3KF9 A;  1QX7 A;  2WCB A;  4YBH B;  1CM4 A;  1TCO B;  1C7V A;  1XFU O;  2K2F A;  4DCK A;  2M49 B;  2CNP A;  1OE9 B;  1GQM A;  2PAL A;  2OTG C;  2PAS A;  3BXK A;  1A29 A;  1SL7 A;  1PVB A;  5CSI A;  1AVS A;  1SL8 A;  2O60 A;  4GGF C;  4M2P A;  1IRJ A;  1SL9 A;  1QV1 A;  3O4Y A;  5KSZ A;  1LVC D;  1DT7 B;  5DKR A;  3DVE A;  1XFX O;  2JTZ A;  1BG1 A;  1QIV A;  1IQ5 A;  1KFU L;  3NSK A;  3CZT X;  2KNE A;  2LAN A;  1KFX S;  4M2Q A;  1YUR A;  1TTX A;  1BT6 A;  2AUC A;  2JOJ A;  1KQV A;  2KAV A;  4MZK A;  1TNP A;  2M0R A;  2F33 A;  5CPV A;  1PSR A;  1PRW A;  1V1F A;  3AAJ A;  4AQJ A;  4Q04 A;  3BOW A;  1YTZ C;  4AQI A;  1TCF A;  3OHM B;  2LE9 B;  1BU3 A;  4JQ0 D;  3IQO A;  2FCD A;  2JNF A;  2LVK A;  1DMO A;  2A4J A;  5J3X A;  3CGA A;  4GAO A;  1S26 D;  3BUX B;  2BBM A;  1UUR A;  2OS8 B;  3EK8 A;  2H2K A;  1BMO A;  1J7R A;  4M2O A;  1CM1 A;  1XFY O;  2EC6 B;  3NXA A;  1NP8 A;  1PSB A;  5D69 A;  4YGC B;  1ODB A;  3ICB A;  1RWY A;  2KGB C;  2L2E A;  4FTG A;  2L98 A;  3LLE A;  4YGD B;  2H61 C;  1SCV A;  1SK6 D;  3CR5 X;  1W7J B;  1H8B A;  1DJW A;  1Y0V H;  1MXL C;  1BOC A;  1J1E A;  1B7T Y;  2LHL A;  1UWO A;  1UUS A;  2FOT A;  2OTG B;  1V1G A;  1L7Z A;  2LLS A;  1YUS A;  4XJK B;  5CSN A;  3ZWH A;  3GOF A;  4PE4 A;  1EL4 A;  2VRG A;  4PE1 A;  2WOR A;  4HRG A;  1UP5 A;  4CLN A;  1WRZ A;  4OKH A;  3DD4 A;  1JF0 A;  2KFF A;  1G4Y R;  4YI8 A;  1AJ5 A;  2BKH B;  1NSH A;  1DGU A;  1SR6 B;  4OV2 A;  1M39 A;  4WQ2 A;  1QLK A;  2BE6 A;  4CFR A;  1BR4 B;  1JBA A;  2KGR A;  3H4S E;  2KFG A;  1ZFS A;  1B47 A;  4PHK A;  1TN4 A;  3JVT C;  1PK0 D;  1CFC A;  1YX7 A;  2ZRS A;  4BY4 A;  1IGV A;  1TNX A;  1LKJ A;  5DKN A;  3TS5 B;  5AER A;  4ORC B;  1NCZ A;  2LVV A;  3I5H C;  4IL1 A;  3AAK A;  1CFD A;  4DIR A;  3QRX A;  3BUN B;  1DVI A;  1K2H A;  1OSA A;  1CB1 A;  1B8R A;  1X02 A;  1XYD A;  3KPX A;  2ZKM X;  1QIW A;  1GJY A;  2CCM A;  2JXL A;  4YGA A;  2JRF A;  2L5X B;  1CLB A;  1QVI Z;  3LK0 A;  1JSA A;  3O78 A;  1S1E A;  1NCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...