1RJVA

Solution structure of human alpha-parvalbumin refined with a paramagnetism-based strategy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Parvalbumin alpha
publication title Paramagnetism-Based Refinement Strategy for the Solution Structure of Human alpha-Parvalbumin.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rjvA00
1EG4A 2L98A 2Q4UA 3BUNB 5KU1A 2MLEC 1K9PA 1Y1XA 1CLMA 1AHRA 2F2OA 2F33A 1PSRA 1LINA 1XK4A 2LVIA 1CFPA 1S6JA 1N2DA 5J3XA 1KCYA 4N5XA 2I2RE 1CM4A 2L2EA 2LHIA 3EVUA 1UP5A 3I5HB 4C0LA 3HX4A 1WRKA 1SL8A 3TDIA 3DVEA 4GBAA 3PFVA 3M0WA 1R6PA 2NXQA 1QS7A 1XFUO 1IRJA 1AP4A 1ODBA 1UWOA 2D8NA 2JNFA 1F8HA 4L9MA 3BOWA 1PSBA 2FCEA 1DMOA 2KGBC 2H61C 1GQMA 5G08A 1LKJA 2I94A 2ZNEA 4HSZA 5CSNA 1ZOTB 1TCOB 1YRUB 3D10A 2KI4B 1SR6B 1YUSA 3DF0B 4GPLB 1QIWA 1QTXA 2LC5A 3I5FB 4FQOA 1CNPA 2I7AA 4CIDA 1QIVA 1CM1A 1M63B 1SMGA 3TUYB 1QX2A 1M39A 2F8PA 3SIBA 2BE4A 1KWOC 1KK7Y 3GOFA 1QX5B 1A4PA 4BY4A 1NCYA 1IGVA 1LA0A 3TS5C 1UHKA 1BMOA 2OTGC 4ORAB 1SCMB 1KFXL 1B9AA 3BXKA 1TNWA 1SL7A 2FJUB 4D1EA 1OMDA 2VRGA 3PN7C 1FBVA 1Y0VH 3TZ1A 1NUBA 1EH2A 2JT3A 2MAZA 1SW8A 1EG3A 3CGAA 2K2FA 1L2OC 3SG7A 1OZOA 1ZACA 5IBWA 1QV1A 3BQ3A 1AVSA 1XO5A 2JTTA 1K9UA 2G9BA 1DJGA 3SJSA 4PHKA 2L0PA 2LLUA 1UHJA 1C07A 2COLB 2QACA 4ZCUA 1XFVO 2K61A 2M1KB 2LHLA 1CDLA 2CXJA 1IG5A 1IKUA 4GAOA 1SCVA 2K2AA 2KFFA 2K7CA 1Y1AA 3BUXB 5I2QA 1YRTB 3O6BA 2O5GA 3DVJA 1ZMZA 3I5HC 3VRRA 4CLNA 1WLZA 2E30A 1DJHA 4WRIA 1J7OA 5I2OA 1SBJA 2KFGA 4C0KA 1KK7Z 3GK4X 3CLNA 3KEVA 1UHNA 5BPJA 3LK1A 1S26D 1WRZA 3AKAA 1LXFC 5CSJA 3EKJA 4C0JA 5HLOA 1RECA 2M49B 1KWOB 2LM5A 4MZKA 2LAPA 2MJWB 2KBMA 1OZSA 2PASA 1WDCB 5AEQA 1JSAA 1YUTA 2KI4C 1SR6C 1RK9A 1QLSA 2M9GA 1UURA 2OS8B 2WCFA 4DS7A 2M1UA 4MZLA 1JF0A 3CS1A 2QPTA 2ZRSA 2BECA 2GGMA 5DKRA 2L4IA 2L50A 3SG3A 1QASA 2M3WA 1K96A 2F3YA 4USLA 3TUYC 1CLBA 2L4HA 3PATA 1QX7A 3F45A 2HPSA 3NSKA 2BBMA 1WLMA 2JRFA 2PMYA 1K9KA 1KFUS 1SCMC 3PSRA 1M31A 1MXEA 1A75A 1OSAA 1NCZA 2EHBA 4GUKA 4P5OE 1DJXA 1F55A 3VRQA 1J1EA 1K94A 1NCXA 2M97A 1S3PA 2LLTA 2KFHA 1FW4A 1NX2A 3JVTC 3FWBA 2JZIA 1NX3A 1NWDA 1OMVA 3IQQA 4MN0A 2WCBA 1X02A 3CTNA 2PRUA 2K0JA 3RM1A 1JBAA 1RTP1 2R2IA 4DUQA 2NCPA 1XA5A 1EL4A 1BOCA 3BUWB 1RROA 1B7TY 3SG2A 2LUCA 4CPVA 1CTRA 4NDDA 1V1GA 3OHMB 4MLWA 1K8UA 3BOWB 5KTYA 1S5GY 1IH0A 3A4UB 1H4BA 1SKTA 2BCBA 1K93D 2ZN8A 3BUMB 5JOLA 1IJ5A 3IF7A 4GNKB 1B8LA 1OQPA 1J7PA 3LCPC 1UHIA 3WXAA 3KHEA 4FTGA 2P6BB 4I5JA 3ZWHA 2SCPA 1KQVA 1A29A 4MRXA 1A03A 1IQ3A 4PHMA 4ZCVA 2NLNA 1S6IA 1WDCC 2EGDA 3D0YA 3VGOA 2PALA 4HREE 2G2BA 3CR4X 1KFXS 4MVFA 2OS8C 2FOTA 3EVRA 4TNCA 4MBEA 2KQYA 5JJGA 1FI5A 2EC6B 1KQMB 1YUUA 1QVIY 1Y1UA 4OVNF 4DRWA 2BL0B 2IS9A 1TNPA 5FYXA 3NSOA 4HRHA 1MWNA 2AAOA 1G33A 4PE4A 1TCFA 3C1VA 1NSHA 2ZNDA 4QJ3B 5DKQA 2BBNA 2WNDA 1DVIA 2LE9B 2CCMA 1SNLA 4Q04A 2H2KA 4YGDB 3JVTB 1GGZA 1B7TZ 1YX8A 3O78A 5CSFA 4BY5A 2HF5A 1KK8B 2M7NA 4I5LB 3OX6A 2HETA 4AOMA 4NDBA 3LLEA 4YBHB 1XK4C 1S5GZ 5ER5A 1DGVA 2MHHA 1QV0A 3WHUB 2KQ6A 2Q91A 3DVMA 2OPOA 3LL8B 1QJTA 3EK8A 1C7VA 1R2UA 4A4CA 1NP8A 1DJWA 2L51A 2Y4QA 4NDCA 1EXRA 1SYMA 1XFYO 1YX7A 3O2PA 1RWYA 3K21A 2KI6D 3TDUA 1G4YR 3CR2A 1PALA 5AXIA 5HKZA 3SG5A 2ISDA 1U5IA 4NQGA 4I5NB 5F6TA 1HQVA 4PHNA 3VROA 4PHJA 2JPTA 2BCXA 3A8RA 2M29A 1TTXA 5TNCA 5HLVA 3I5GC 3TDZA 1YVHA 1DF0A 1K2HA 1QVIZ 2LNKA 2MRDA 3CR5X 5DKNA 1KFUL 1DGUA 1BG1A 1MF8B 2LUXA 3QRXA 1CKKA 1F54A 3VRPA 4MZJA 4JPZB 4QJ5B 2H61A 1W7JB 2BE6A 5D7FA 2LMTA 2BKHB 1DJIA 3WHTB 5KSZA 2K7BA 4ORBB 2NCOA 2KAYA 1YR5A 1XFWO 4M2QA 4XJKA 2EC6C 1IJ6A 1KQMC 1OE9B 1A75B 3SG6A 1YTZC 4A4BA 1D1OA 3BUOB 2B1UA 2KDHA 2LV7A 1E8AA 2BL0C 2JNXA 1FPWA 1VRKA 1NPQA 1G8IA 1JFJA 2RGIA 3I5IB 4ETOA 3OB2B 1DJZA 4HRGA 1PVAA 3OP0A 2JU0A 2GGZA 2Y1NA 4WQ2A 2LCPA 4XYNA 1JWDA 1BR1B 2M8UA 1F4OA 1K90D 4MRYA 4ICBA 1IQ5A 1KK8C 1CDPA 2LVVA 2JTZA 1A2XA 1XFZO 2K7OA 5CSIA 1DT7B 2K7DA 3ZNIA 2JT8A 1CFFA 2ZFDA 2F3ZA 1TNQA 2MA2A 3OX5A 4YI8A 1DJYA 1BF5A 1AK8A 4I5KA 4N1GA 1AJ5A 2KAXA 1S36A 2WCEA 1F4QA 2LMUA 4YGAA 3CZTX 1W7IB 3I5GB 4PE0A 2LMVA 3SG4A 4WQ3A 1CDMA 1TOPA 1PULA 2NZ0A 3EK7A 3KO0A 5HKYA 4OR9B 1BLQA 2KOTA 2KYFA 4PDZA 3BYAA 1BT6A 1MXLC 2KHNA 1CLLA 2Y5IA 3D0YB 3KPXA 4N1FA 2GV5A 1CFDA 2JT0A 2O60A 5GQQC 5CPVA 3NSLA 1ALWA 2HQ8A 4MEWA 2CBLA 3AAKA 3DD4A 3NXAA 3DVKA 1MR8A 1HT9A 1XYDA 1N0YA 2ZRTA 1KSMA 1B8CA 1BU3A 2KGRA 4M2PA 4DCKA 1NX1A 1WRLA 2L5XB 2JXCA 4GGNA 4GGFA 2LANA 3FS7A 1C7WA 2JULA 4YGBB 1NYAA 5I8NA 1RFJA 1J55A 2JC2A 2PSRA 4AQIA 4OV2A 4M2OA 4UPGA 5AFPA 1NIWA 1K95A 1ZUZA 1CMGA 3DF0A 4PE7A 5AERA 2AUCA 3GK2A 2WC8A 1AUIB 1LA3A 1EJ3A 3CWGA 1SL9A 3PALA 1H8BA 3FIAA 3H4SE 3RLZA 4YGCB 3I5IC 4PALA 4E68A 1Y6WA 4OKHA 1CMFA 2I18A 3WNXB 1F71A 1B47A 1QATA 2MLFC 1MHOA 1S1EA 3JTDC 1S6CA 2KYCA 3GK1A 2BCAA 1MUXA 3VRNA 1LVCD 1M46A 2KI6C 3EK4A 1BJFA 2JWWA 2LLSA 3ICBA 2JQ6A 3KF9A 2MBXA 3IQOA 2M0RA 1U5IB 1XVJA 2KAVA 1YVLA 3EKHA 2HQWA 5HYDA 1N65A 1ZFSA 1ALVA 2FCDA 3O4YA 1OOJA 2TN4A 3MSEB 1QLKA 3SIAA 1YURA 4YRUA 1F70A 2E6WA 2LP3A 4IL1A 1JC2A 1DF0B 3NSIA 5K89A 1B4CA 2ZKMX 1FF1A 4AQJA 1TIZA 1TN4A 2F2PA 2ZN9A 1RJVA 1UHHA 4R1EA 2CT9A 1B1GA 1BODA 4P2YB 4PCWA 4F0ZB 1GJYA 1DTLA 1SRAA 2A4JA 2CTNA 3FWCA 1JFKA 5B8IB 1J1DA 1SK6D 1AJ4A 1BR4B 3PLFB 4JQ0D 2KBIA 4JWQA 3HCMA 4MSPA 2AMIA 4XJKB 4OCIA 1J7RA 1QXPA 3LK0A 4GGFC 5D69A 1CDNA 2V53A 1WY9A 4YGEB 4PE1A 2DOQA 3OB1B 2LP2A 2CNPA 2M7LA 4GFTA 1OMRA 1TRFA 2SASA 1M45A 1MQ1A 2PVBA 2WORA 3TS5B 1IWQA 2JOJA 4ORCB 3I5FC 3E3RA 1PVBA 2OTGB 4CFRA 4DIRA 2JXLA 2WOSA 2Y1MA 2K8MB 1B8RA 2LVKA 3PN7B 5ER4X 4CFQA 3JTDB 2LVJA 3PM8A 1CB1A 1JF2A 1Q80A 4YI9A 3EVVA 1L2OB 5I2LA 1PRWA 1SPYA 3AKBA 1V1FA 1XFXO 3AAJA 5HKWA 1UUSA 1NX0A 2KNEA 2BKIB 1CFCA 1J7QA 1FI6A 4QJ4B 1L7ZA 1KSOA 5PALA 2KSPA 1GGWA 4U8DA 1PK0D 1TNXA 1SY9A 5AANA 1JUOA
chains in the Genus database with same CATH superfamily
1EG4A 2L98A 2Q4UA 3BUNB 5KU1A 2MLEC 1K9PA 1Y1XA 1CLMA 1AHRA 2F2OA 2F33A 1PSRA 1LINA 1XK4A 2LVIA 2WCHA 1CFPA 1S6JA 1N2DA 5J3XA 1KCYA 4N5XA 2I2RE 1CM4A 2L2EA 3S0AA 2K60A 2LHIA 3EVUA 1UP5A 3I5HB 4C0LA 3HX4A 1WRKA 3R1OA 1SL8A 3SS3A 3TDIA 3DVEA 4GBAA 3PFVA 3M0WA 1R6PA 2NXQA 1QS7A 1XFUO 1IRJA 2QEOA 1AP4A 1ODBA 1UWOA 2D8NA 2JNFA 1F8HA 4L9MA 3BOWA 1PSBA 5HL1A 2FCEA 1DMOA 1W9ZA 2KGBC 2H61C 1GQMA 3D75A 5G08A 1LKJA 2I94A 2ZNEA 4HSZA 5CSNA 1ZOTB 1TCOB 1YRUB 3D10A 2KI4B 1SR6B 2WC6A 1YUSA 3DF0B 4GPLB 1QIWA 1QTXA 2LC5A 3I5FB 4FQOA 1CNPA 2I7AA 4CIDA 1QIVA 1CM1A 1M63B 1SMGA 3TUYB 1QX2A 1M39A 2F8PA 2KLEA 3SIBA 2BE4A 1KWOC 1KK7Y 3GOFA 1QX5B 1A4PA 4BY4A 1NCYA 3BJHA 1IGVA 1LA0A 3TS5C 3L4LA 1UHKA 1BMOA 2OTGC 4ORAB 1SCMB 1KFXL 1TUZA 1B9AA 3BXKA 3S0EA 1TNWA 1SL7A 2FJUB 4D1EA 1OMDA 2VRGA 3PN7C 1FBVA 1Y0VH 3TZ1A 1NUBA 1EH2A 2JT3A 2MAZA 1SW8A 1EG3A 3CGAA 2K2FA 1DQEA 1L2OC 3SG7A 1OZOA 1ZACA 5IBWA 1QV1A 3BQ3A 2WCKA 1AVSA 1XO5A 2JTTA 1K9UA 2G9BA 1DJGA 3SJSA 4PHKA 3VB1A 2L0PA 2LLUA 1UHJA 1C07A 2COLB 2QACA 4ZCUA 1XFVO 2K61A 2M1KB 2LHLA 1CDLA 2CXJA 1IG5A 1IKUA 4GAOA 1SCVA 2K2AA 2KFFA 2K7CA 3D77A 1Y1AA 3BUXB 5I2QA 1YRTB 3R1VA 2QEVA 3O6BA 3S0BA 2O5GA 3DVJA 1ZMZA 3I5HC 3VRRA 4CLNA 1WLZA 2E30A 1DJHA 4WRIA 1J7OA 5I2OA 1SBJA 2KFGA 4C0KA 1KK7Z 3GK4X 3CLNA 3KEVA 1UHNA 3PM2A 3LK1A 3R72A 4F7FA 1S26D 5BPJA 1WRZA 3AKAA 1LXFC 5CSJA 3EKJA 4C0JA 5HLOA 1RECA 2M49B 1KWOB 2LM5A 4MZKA 2LAPA 2MJWB 2KBMA 1OZSA 2PASA 1WDCB 3L47A 5AEQA 1JSAA 1YUTA 1OOHA 2KI4C 1SR6C 1RK9A 1QLSA 2M9GA 1UURA 2OS8B 2WCFA 3FE8A 4DS7A 2M1UA 4MZLA 1JF0A 3CS1A 2QPTA 2ZRSA 2BECA 2GGMA 5DKRA 2L4IA 4INXA 2L50A 3SG3A 1QASA 2M3WA 1K96A 2F3YA 3CZ2A 4USLA 3TUYC 1CLBA 1GM0A 1Z2CB 2L4HA 3PATA 1QX7A 3F45A 2HPSA 3CZ1A 2GTEA 3NSKA 3DY9A 2BBMA 1WLMA 2JRFA 3NGVA 2PMYA 1K9KA 1KFUS 1ORGA 1SCMC 3PSRA 1M31A 1MXEA 1A75A 1OSAA 1NCZA 2EHBA 4GUKA 4P5OE 1DJXA 2ERBA 1F55A 3VRQA 1J1EA 1K94A 1NCXA 2M97A 1S3PA 2LLTA 1DC1A 1C3ZA 3S0DA 2KFHA 1FW4A 3D74A 1NX2A 3JVTC 3FWBA 2JZIA 1NX3A 1NWDA 1OMVA 3IQQA 3Q8IA 2WCBA 2PYQA 4MN0A 3PJIA 1X02A 3CTNA 2PRUA 2K0JA 3RM1A 1JBAA 1RTP1 2R2IA 4DUQA 2NCPA 1XA5A 1EL4A 2JPOA 3BUWB 1BOCA 1RROA 1B7TY 3B7AA 2QEBA 3SG2A 2LUCA 3CZ0A 4CPVA 1CTRA 4NDDA 1V1GA 3OHMB 4MLWA 1K8UA 3BOWB 5KTYA 1S5GY 1IH0A 3A4UB 1H4BA 2FJYA 1SKTA 2BCBA 1K93D 2ZN8A 3BUMB 5JOLA 1IJ5A 3IF7A 4GNKB 1B8LA 2P71A 1OQPA 1J7PA 1SSEB 3LCPC 1UHIA 3WXAA 3KHEA 4FTGA 3DYEA 2P6BB 4I5JA 3ZWHA 2SCPA 1KQVA 1A29A 4MRXA 1A03A 1IQ3A 4PHMA 4JD9A 3NHIA 4ZCVA 2NLNA 1S6IA 1WDCC 2EGDA 3D0YA 3VGOA 2PALA 4HREE 2G2BA 3CR4X 1KFXS 4MVFA 2OS8C 2FOTA 3EVRA 4TNCA 1LS8A 4MBEA 2KQYA 5JJGA 1FI5A 2EC6B 1KQMB 1YUUA 1QVIY 1Y1UA 3B86A 4OVNF 4DRWA 2KPHA 2BL0B 2IS9A 1TNPA 5FYXA 3NSOA 3L4AA 4HRHA 1MWNA 2AAOA 1G33A 4PE4A 1TCFA 2YGUA 3C1VA 1NSHA 2ZNDA 4QJ3B 5DKQA 2BBNA 2WNDA 4IJ7A 1DVIA 3S0GA 2LE9B 2CCMA 1SNLA 4Q04A 2H2KA 4YGDB 3JVTB 1GGZA 5FI7A 2WCLA 1B7TZ 1YX8A 3O78A 5CSFA 4BY5A 2HF5A 1KK8B 2M7NA 4I5LB 3OX6A 2HETA 4AOMA 4NDBA 3LLEA 4YBHB 1XK4C 1S5GZ 5ER5A 1DGVA 2MHHA 1QV0A 3WHUB 2KQ6A 2Q91A 3DVMA 4PT1A 2OPOA 3LL8B 1QJTA 3EK8A 4INWA 1C7VA 2WC5A 1R2UA 4A4CA 1NP8A 1DJWA 2L51A 2Y4QA 4NDCA 1EXRA 1SYMA 1XFYO 1YX7A 2L5YA 3O2PA 1RWYA 3K21A 2KI6D 3TDUA 1G4YR 3CR2A 1PALA 5AXIA 5HKZA 3SG5A 2ISDA 1U5IA 4NQGA 4I5NB 5F6TA 1HQVA 4PHNA 3VROA 4PHJA 2JPTA 2L2CA 5I94A 2BCXA 3A8RA 2M29A 1TTXA 5TNCA 5HLVA 3I5GC 3TDZA 3SS5A 1TUJA 1YVHA 1DF0A 3N7HA 1K2HA 1QVIZ 2LNKA 3V2LA 1OOGA 2MRDA 3CR5X 5DKNA 1KFUL 3B87A 1DGUA 1BG1A 1MF8B 2LUXA 1C3YA 3QRXA 1CKKA 1F54A 3VRPA 4MZJA 4JPZB 4QJ5B 1OW4A 2H61A 1W7JB 2BE6A 5D7FA 2LMTA 1Z4HA 2BKHB 1DJIA 3WHTB 5KSZA 2K7BA 4ORBB 2NCOA 2KAYA 1YR5A 1XFWO 2H8VA 4M2QA 4XJKA 2EC6C 1IJ6A 1KQMC 1OE9B 1A75B 5FI2A 1YTZC 3SG6A 4A4BA 1D1OA 3BUOB 2B1UA 2KDHA 2LV7A 1E8AA 2BL0C 2JNXA 2PQLA 2BNXA 1P28A 3EG5B 1FPWA 1VRKA 2KLDA 1NPQA 1G8IA 1JFJA 2RGIA 3I5IB 4ETOA 3OB2B 1DJZA 4HRGA 1PVAA 3OP0A 2JU0A 3O4XA 2GGZA 2Y1NA 1QWVA 3DZTA 4WQ2A 5FI6A 2LCPA 4XYNA 1JWDA 1BR1B 2M8UA 1F4OA 1K90D 4MRYA 4ICBA 1IQ5A 1KK8C 1CDPA 2LVVA 3CYZA 2JTZA 1A2XA 1XFZO 2K7OA 5CSIA 1DT7B 2K7DA 3ZNIA 3UO9A 2JT8A 1CFFA 3R1PA 2ZFDA 2F3ZA 1TNQA 2MA2A 3OX5A 4YI8A 1DJYA 1BF5A 1AK8A 2QDIA 4I5KA 4N1GA 1AJ5A 2QEHA 2KAXA 1S36A 2WCEA 1F4QA 2LMUA 4YGAA 3CZTX 3D76A 1W7IB 3I5GB 4PE0A 2LMVA 3SG4A 4WQ3A 1CDMA 1TOPA 4JKTA 1PULA 2NZ0A 3EK7A 3KO0A 5DICA 5HKYA 1DELA 4OR9B 1BLQA 2KOTA 2KYFA 4PDZA 3BYAA 1BT6A 1MXLC 2KHNA 3OGNA 1CLLA 2Y5IA 3D0YB 3KPXA 4N1FA 2BAPA 2GV5A 1CFDA 2JT0A 2O60A 5D3OA 5GQQC 5CPVA 3NSLA 1ALWA 2HQ8A 4MEWA 3SS4A 2CBLA 3AAKA 3DD4A 3FE9A 3NXAA 3DVKA 1MR8A 1HT9A 4FQTA 1XYDA 1N0YA 2ZRTA 1KSMA 1B8CA 1BU3A 2KGRA 4M2PA 4DCKA 1NX1A 1WRLA 2L5XB 2JXCA 4GGNA 4GGFA 2LANA 3D73A 3FS7A 1C7WA 2JULA 4YGBB 3DXLA 1NYAA 5I8NA 1RFJA 1J55A 2JC2A 2PSRA 4AQIA 4OV2A 4M2OA 4UPGA 5AFPA 1NIWA 1K95A 1ZUZA 1CMGA 3DF0A 4PE7A 1OOIX 5AERA 2AUCA 3GK2A 3RZSA 2WC8A 1AUIB 1LA3A 1EJ3A 2WCJA 3CWGA 1OOFA 1SL9A 3PALA 3S0FA 1H8BA 3FIAA 3H4SE 3NHTA 3B88A 3RLZA 4YGCB 1IIOA 3I5IC 3B6XA 4PALA 4E68A 1Y6WA 4OKHA 1CMFA 2I18A 1T14A 3WNXB 1B47A 1F71A 3K1EA 1QATA 2MLFC 1MHOA 1S1EA 3JTDC 1S6CA 2KYCA 3GK1A 2BCAA 1MUXA 3VRNA 1LVCD 1M46A 2KI6C 3EK4A 1BJFA 2JWWA 2LLSA 3ICBA 2JQ6A 3KF9A 1XFRA 3IQOA 2M0RA 2MBXA 1U5IB 1XVJA 2KAVA 1YVLA 3BFAA 1DEKA 3EKHA 2HQWA 5HYDA 1N65A 1ZFSA 1ALVA 2FCDA 3O4YA 4OZDA 1OOJA 2TN4A 3MSEB 1QLKA 3SIAA 1YURA 4YRUA 1F70A 2E6WA 2LP3A 4IL1A 1JC2A 1DF0B 3NSIA 5K89A 1B4CA 2ZKMX 1FF1A 4AQJA 1TIZA 1TN4A 2F2PA 2ZN9A 1RJVA 1UHHA 4R1EA 2CT9A 1B1GA 1BODA 4P2YB 2WCMA 4PCWA 3CABA 4F0ZB 1GJYA 1DTLA 1SRAA 2A4JA 2CTNA 2P70A 3FWCA 1JFKA 5B8IB 3OBVA 1J1DA 1SK6D 1AJ4A 1BR4B 3QMEA 3PLFB 4JQ0D 2KBIA 4JWQA 3HCMA 4MSPA 2AMIA 4XJKB 4OCIA 1J7RA 1QXPA 3LK0A 4GGFC 5D69A 1CDNA 2V53A 1WY9A 4YGEB 4PE1A 2DOQA 3OB1B 2LP2A 2CNPA 2M7LA 4GFTA 1OMRA 1TRFA 3BFHA 2SASA 1M45A 1MQ1A 2PVBA 2WORA 3TS5B 1IWQA 3CDNA 5EL2A 2JOJA 4ORCB 3I5FC 3IVTA 3E3RA 3FE6A 1PVBA 2OTGB 4CFRA 4DIRA 2JXLA 2WOSA 2Y1MA 2K8MB 1B8RA 2LVKA 3PN7B 5ER4X 4CFQA 3JTDB 2LVJA 1TWOA 3PM8A 1CB1A 1JF2A 1Q80A 4YI9A 3EVVA 1L2OB 5I2LA 1PRWA 1SPYA 3AKBA 1V1FA 1XFXO 3AAJA 5HKWA 1UUSA 1NX0A 2KNEA 2BKIB 4KYNA 1CFCA 3D78A 1J7QA 3BFBA 4QJ4B 1FI6A 1L7ZA 1KSOA 5PALA 3UNWA 2KSPA 1GGWA 4U8DA 1PK0D 1TNXA 1SY9A 5AANA 1JUOA
chains in the Genus database with same CATH topology
1EG4A 2L98A 2Q4UA 3BUNB 5KU1A 2MLEC 1K9PA 1Y1XA 1CLMA 1AHRA 2F2OA 2F33A 1PSRA 1LINA 1XK4A 2LVIA 1CFPA 1S6JA 1N2DA 5J3XA 1KCYA 4N5XA 2I2RE 1CM4A 2L2EA 2LHIA 3EVUA 1UP5A 3I5HB 4C0LA 3HX4A 1WRKA 1SL8A 3TDIA 3DVEA 4GBAA 3PFVA 3M0WA 1R6PA 2NXQA 1QS7A 1XFUO 1IRJA 1AP4A 1ODBA 1UWOA 2D8NA 2JNFA 1F8HA 4L9MA 3BOWA 1PSBA 2FCEA 1DMOA 2KGBC 2H61C 1GQMA 5G08A 1LKJA 2I94A 2ZNEA 4HSZA 5CSNA 1ZOTB 1TCOB 1YRUB 3D10A 2KI4B 1SR6B 1YUSA 3DF0B 4GPLB 1QIWA 1QTXA 2LC5A 3I5FB 4FQOA 1CNPA 2I7AA 4CIDA 1QIVA 1CM1A 1M63B 1SMGA 3TUYB 1QX2A 1M39A 2F8PA 3SIBA 2BE4A 1KWOC 1KK7Y 3GOFA 1QX5B 1A4PA 4BY4A 1NCYA 1IGVA 1LA0A 3TS5C 1UHKA 1BMOA 2OTGC 4ORAB 1SCMB 1KFXL 1B9AA 3BXKA 1TNWA 1SL7A 2FJUB 4D1EA 1OMDA 2VRGA 3PN7C 1FBVA 1Y0VH 3TZ1A 1NUBA 1EH2A 2JT3A 2MAZA 1SW8A 1EG3A 3CGAA 2K2FA 1L2OC 3SG7A 1OZOA 1ZACA 5IBWA 1QV1A 3BQ3A 1AVSA 1XO5A 2JTTA 1K9UA 2G9BA 1DJGA 3SJSA 4PHKA 2L0PA 2LLUA 1UHJA 1C07A 2COLB 2QACA 4ZCUA 1XFVO 2K61A 2M1KB 2LHLA 1CDLA 2CXJA 1IG5A 1IKUA 4GAOA 1SCVA 2K2AA 2KFFA 2K7CA 1Y1AA 3BUXB 5I2QA 1YRTB 3O6BA 2O5GA 3DVJA 1ZMZA 3I5HC 3VRRA 4CLNA 1WLZA 2E30A 1DJHA 4WRIA 1J7OA 5I2OA 1SBJA 2KFGA 4C0KA 1KK7Z 3GK4X 3CLNA 3KEVA 1UHNA 5BPJA 3LK1A 1S26D 1WRZA 3AKAA 1LXFC 5CSJA 3EKJA 4C0JA 5HLOA 1RECA 2M49B 1KWOB 2LM5A 4MZKA 2LAPA 2MJWB 2KBMA 1OZSA 2PASA 1WDCB 5AEQA 1JSAA 1YUTA 2KI4C 1SR6C 1RK9A 1QLSA 2M9GA 1UURA 2OS8B 2WCFA 4DS7A 2M1UA 4MZLA 1JF0A 3CS1A 2QPTA 2ZRSA 2BECA 2GGMA 5DKRA 2L4IA 2L50A 3SG3A 1QASA 2M3WA 1K96A 2F3YA 4USLA 3TUYC 1CLBA 2L4HA 3PATA 1QX7A 3F45A 2HPSA 3NSKA 2BBMA 1WLMA 2JRFA 2PMYA 1K9KA 1KFUS 1SCMC 3PSRA 1M31A 1MXEA 1A75A 1OSAA 1NCZA 2EHBA 4GUKA 4P5OE 1DJXA 1F55A 3VRQA 1J1EA 1K94A 1NCXA 2M97A 1S3PA 2LLTA 2KFHA 1FW4A 1NX2A 3JVTC 3FWBA 2JZIA 1NX3A 1NWDA 1OMVA 3IQQA 4MN0A 2WCBA 1X02A 3CTNA 2PRUA 2K0JA 3RM1A 1JBAA 1RTP1 2R2IA 4DUQA 2NCPA 1XA5A 1EL4A 1BOCA 3BUWB 1RROA 1B7TY 3SG2A 2LUCA 4CPVA 1CTRA 4NDDA 1V1GA 3OHMB 4MLWA 1K8UA 3BOWB 5KTYA 1S5GY 1IH0A 3A4UB 1H4BA 1SKTA 2BCBA 1K93D 2ZN8A 3BUMB 5JOLA 1IJ5A 3IF7A 4GNKB 1B8LA 1OQPA 1J7PA 3LCPC 1UHIA 3WXAA 3KHEA 4FTGA 2P6BB 4I5JA 3ZWHA 2SCPA 1KQVA 1A29A 4MRXA 1A03A 1IQ3A 4PHMA 4ZCVA 2NLNA 1S6IA 1WDCC 2EGDA 3D0YA 3VGOA 2PALA 4HREE 2G2BA 3CR4X 1KFXS 4MVFA 2OS8C 2FOTA 3EVRA 4TNCA 4MBEA 2KQYA 5JJGA 1FI5A 2EC6B 1KQMB 1YUUA 1QVIY 1Y1UA 4OVNF 4DRWA 2BL0B 2IS9A 1TNPA 5FYXA 3NSOA 4HRHA 1MWNA 2AAOA 1G33A 4PE4A 1TCFA 3C1VA 1NSHA 2ZNDA 4QJ3B 5DKQA 2BBNA 2WNDA 1DVIA 2LE9B 2CCMA 1SNLA 4Q04A 2H2KA 4YGDB 3JVTB 1GGZA 1B7TZ 1YX8A 3O78A 5CSFA 4BY5A 2HF5A 1KK8B 2M7NA 4I5LB 3OX6A 2HETA 4AOMA 4NDBA 3LLEA 4YBHB 1XK4C 1S5GZ 5ER5A 1DGVA 2MHHA 1QV0A 3WHUB 2KQ6A 2Q91A 3DVMA 2OPOA 3LL8B 1QJTA 3EK8A 1C7VA 1R2UA 4A4CA 1NP8A 1DJWA 2L51A 2Y4QA 4NDCA 1EXRA 1SYMA 1XFYO 1YX7A 3O2PA 1RWYA 3K21A 2KI6D 3TDUA 1G4YR 3CR2A 1PALA 5AXIA 5HKZA 3SG5A 2ISDA 1U5IA 4NQGA 4I5NB 5F6TA 1HQVA 4PHNA 3VROA 4PHJA 2JPTA 2BCXA 3A8RA 2M29A 1TTXA 5TNCA 5HLVA 3I5GC 3TDZA 1YVHA 1DF0A 1K2HA 1QVIZ 2LNKA 2MRDA 3CR5X 5DKNA 1KFUL 1DGUA 1BG1A 1MF8B 2LUXA 3QRXA 1CKKA 1F54A 3VRPA 4MZJA 4JPZB 4QJ5B 2H61A 1W7JB 2BE6A 5D7FA 2LMTA 2BKHB 1DJIA 3WHTB 5KSZA 2K7BA 4ORBB 2NCOA 2KAYA 1YR5A 1XFWO 4M2QA 4XJKA 2EC6C 1IJ6A 1KQMC 1OE9B 1A75B 3SG6A 1YTZC 4A4BA 1D1OA 3BUOB 2B1UA 2KDHA 2LV7A 1E8AA 2BL0C 2JNXA 1FPWA 1VRKA 1NPQA 1G8IA 1JFJA 2RGIA 3I5IB 4ETOA 3OB2B 1DJZA 4HRGA 1PVAA 3OP0A 2JU0A 2GGZA 2Y1NA 4WQ2A 2LCPA 4XYNA 1JWDA 1BR1B 2M8UA 1F4OA 1K90D 4MRYA 4ICBA 1IQ5A 1KK8C 1CDPA 2LVVA 2JTZA 1A2XA 1XFZO 2K7OA 5CSIA 1DT7B 2K7DA 3ZNIA 2JT8A 1CFFA 2ZFDA 2F3ZA 1TNQA 2MA2A 3OX5A 4YI8A 1DJYA 1BF5A 1AK8A 4I5KA 4N1GA 1AJ5A 2KAXA 1S36A 2WCEA 1F4QA 2LMUA 4YGAA 3CZTX 1W7IB 3I5GB 4PE0A 2LMVA 3SG4A 4WQ3A 1CDMA 1TOPA 1PULA 2NZ0A 3EK7A 3KO0A 5HKYA 4OR9B 1BLQA 2KOTA 2KYFA 4PDZA 3BYAA 1BT6A 1MXLC 2KHNA 1CLLA 2Y5IA 3D0YB 3KPXA 4N1FA 2GV5A 1CFDA 2JT0A 2O60A 5GQQC 5CPVA 3NSLA 1ALWA 2HQ8A 4MEWA 2CBLA 3AAKA 3DD4A 3NXAA 3DVKA 1MR8A 1HT9A 1XYDA 1N0YA 2ZRTA 1KSMA 1B8CA 1BU3A 2KGRA 4M2PA 4DCKA 1NX1A 1WRLA 2L5XB 2JXCA 4GGNA 4GGFA 2LANA 3FS7A 1C7WA 2JULA 4YGBB 1NYAA 5I8NA 1RFJA 1J55A 2JC2A 2PSRA 4AQIA 4OV2A 4M2OA 4UPGA 5AFPA 1NIWA 1K95A 1ZUZA 1CMGA 3DF0A 4PE7A 5AERA 2AUCA 3GK2A 2WC8A 1AUIB 1LA3A 1EJ3A 3CWGA 1SL9A 3PALA 1H8BA 3FIAA 3H4SE 3RLZA 4YGCB 3I5IC 4PALA 4E68A 1Y6WA 4OKHA 1CMFA 2I18A 3WNXB 1F71A 1B47A 1QATA 2MLFC 1MHOA 1S1EA 3JTDC 1S6CA 2KYCA 3GK1A 2BCAA 1MUXA 3VRNA 1LVCD 1M46A 2KI6C 3EK4A 1BJFA 2JWWA 2LLSA 3ICBA 2JQ6A 3KF9A 2MBXA 3IQOA 2M0RA 1U5IB 1XVJA 2KAVA 1YVLA 3EKHA 2HQWA 5HYDA 1N65A 1ZFSA 1ALVA 2FCDA 3O4YA 1OOJA 2TN4A 3MSEB 1QLKA 3SIAA 1YURA 4YRUA 1F70A 2E6WA 2LP3A 4IL1A 1JC2A 1DF0B 3NSIA 5K89A 1B4CA 2ZKMX 1FF1A 4AQJA 1TIZA 1TN4A 2F2PA 2ZN9A 1RJVA 1UHHA 4R1EA 2CT9A 1B1GA 1BODA 4P2YB 4PCWA 4F0ZB 1GJYA 1DTLA 1SRAA 2A4JA 2CTNA 3FWCA 1JFKA 5B8IB 1J1DA 1SK6D 1AJ4A 1BR4B 3PLFB 4JQ0D 2KBIA 4JWQA 3HCMA 4MSPA 2AMIA 4XJKB 4OCIA 1J7RA 1QXPA 3LK0A 4GGFC 5D69A 1CDNA 2V53A 1WY9A 4YGEB 4PE1A 2DOQA 3OB1B 2LP2A 2CNPA 2M7LA 4GFTA 1OMRA 1TRFA 2SASA 1M45A 1MQ1A 2PVBA 2WORA 3TS5B 1IWQA 2JOJA 4ORCB 3I5FC 3E3RA 1PVBA 2OTGB 4CFRA 4DIRA 2JXLA 2WOSA 2Y1MA 2K8MB 1B8RA 2LVKA 3PN7B 5ER4X 4CFQA 3JTDB 2LVJA 3PM8A 1CB1A 1JF2A 1Q80A 4YI9A 3EVVA 1L2OB 5I2LA 1PRWA 1SPYA 3AKBA 1V1FA 1XFXO 3AAJA 5HKWA 1UUSA 1NX0A 2KNEA 2BKIB 1CFCA 1J7QA 1FI6A 4QJ4B 1L7ZA 1KSOA 5PALA 2KSPA 1GGWA 4U8DA 1PK0D 1TNXA 1SY9A 5AANA 1JUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG4 A;  2L98 A;  2Q4U A;  3BUN B;  5KU1 A;  2MLE C;  1K9P A;  1Y1X A;  1CLM A;  1AHR A;  2F2O A;  2F33 A;  1PSR A;  1LIN A;  1XK4 A;  2LVI A;  1CFP A;  1S6J A;  1N2D A;  5J3X A;  1KCY A;  4N5X A;  2I2R E;  1CM4 A;  2L2E A;  2LHI A;  3EVU A;  1UP5 A;  3I5H B;  4C0L A;  3HX4 A;  1WRK A;  1SL8 A;  3TDI A;  3DVE A;  4GBA A;  3PFV A;  3M0W A;  1R6P A;  2NXQ A;  1QS7 A;  1XFU O;  1IRJ A;  1AP4 A;  1ODB A;  1UWO A;  2D8N A;  2JNF A;  1F8H A;  4L9M A;  3BOW A;  1PSB A;  2FCE A;  1DMO A;  2KGB C;  2H61 C;  1GQM A;  5G08 A;  1LKJ A;  2I94 A;  2ZNE A;  4HSZ A;  5CSN A;  1ZOT B;  1TCO B;  1YRU B;  3D10 A;  2KI4 B;  1SR6 B;  1YUS A;  3DF0 B;  4GPL B;  1QIW A;  1QTX A;  2LC5 A;  3I5F B;  4FQO A;  1CNP A;  2I7A A;  4CID A;  1QIV A;  1CM1 A;  1M63 B;  1SMG A;  3TUY B;  1QX2 A;  1M39 A;  2F8P A;  3SIB A;  2BE4 A;  1KWO C;  1KK7 Y;  3GOF A;  1QX5 B;  1A4P A;  4BY4 A;  1NCY A;  1IGV A;  1LA0 A;  3TS5 C;  1UHK A;  1BMO A;  2OTG C;  4ORA B;  1SCM B;  1KFX L;  1B9A A;  3BXK A;  1TNW A;  1SL7 A;  2FJU B;  4D1E A;  1OMD A;  2VRG A;  3PN7 C;  1FBV A;  1Y0V H;  3TZ1 A;  1NUB A;  1EH2 A;  2JT3 A;  2MAZ A;  1SW8 A;  1EG3 A;  3CGA A;  2K2F A;  1L2O C;  3SG7 A;  1OZO A;  1ZAC A;  5IBW A;  1QV1 A;  3BQ3 A;  1AVS A;  1XO5 A;  2JTT A;  1K9U A;  2G9B A;  1DJG A;  3SJS A;  4PHK A;  2L0P A;  2LLU A;  1UHJ A;  1C07 A;  2COL B;  2QAC A;  4ZCU A;  1XFV O;  2K61 A;  2M1K B;  2LHL A;  1CDL A;  2CXJ A;  1IG5 A;  1IKU A;  4GAO A;  1SCV A;  2K2A A;  2KFF A;  2K7C A;  1Y1A A;  3BUX B;  5I2Q A;  1YRT B;  3O6B A;  2O5G A;  3DVJ A;  1ZMZ A;  3I5H C;  3VRR A;  4CLN A;  1WLZ A;  2E30 A;  1DJH A;  4WRI A;  1J7O A;  5I2O A;  1SBJ A;  2KFG A;  4C0K A;  1KK7 Z;  3GK4 X;  3CLN A;  3KEV A;  1UHN A;  5BPJ A;  3LK1 A;  1S26 D;  1WRZ A;  3AKA A;  1LXF C;  5CSJ A;  3EKJ A;  4C0J A;  5HLO A;  1REC A;  2M49 B;  1KWO B;  2LM5 A;  4MZK A;  2LAP A;  2MJW B;  2KBM A;  1OZS A;  2PAS A;  1WDC B;  5AEQ A;  1JSA A;  1YUT A;  2KI4 C;  1SR6 C;  1RK9 A;  1QLS A;  2M9G A;  1UUR A;  2OS8 B;  2WCF A;  4DS7 A;  2M1U A;  4MZL A;  1JF0 A;  3CS1 A;  2QPT A;  2ZRS A;  2BEC A;  2GGM A;  5DKR A;  2L4I A;  2L50 A;  3SG3 A;  1QAS A;  2M3W A;  1K96 A;  2F3Y A;  4USL A;  3TUY C;  1CLB A;  2L4H A;  3PAT A;  1QX7 A;  3F45 A;  2HPS A;  3NSK A;  2BBM A;  1WLM A;  2JRF A;  2PMY A;  1K9K A;  1KFU S;  1SCM C;  3PSR A;  1M31 A;  1MXE A;  1A75 A;  1OSA A;  1NCZ A;  2EHB A;  4GUK A;  4P5O E;  1DJX A;  1F55 A;  3VRQ A;  1J1E A;  1K94 A;  1NCX A;  2M97 A;  1S3P A;  2LLT A;  2KFH A;  1FW4 A;  1NX2 A;  3JVT C;  3FWB A;  2JZI A;  1NX3 A;  1NWD A;  1OMV A;  3IQQ A;  4MN0 A;  2WCB A;  1X02 A;  3CTN A;  2PRU A;  2K0J A;  3RM1 A;  1JBA A;  1RTP 1;  2R2I A;  4DUQ A;  2NCP A;  1XA5 A;  1EL4 A;  1BOC A;  3BUW B;  1RRO A;  1B7T Y;  3SG2 A;  2LUC A;  4CPV A;  1CTR A;  4NDD A;  1V1G A;  3OHM B;  4MLW A;  1K8U A;  3BOW B;  5KTY A;  1S5G Y;  1IH0 A;  3A4U B;  1H4B A;  1SKT A;  2BCB A;  1K93 D;  2ZN8 A;  3BUM B;  5JOL A;  1IJ5 A;  3IF7 A;  4GNK B;  1B8L A;  1OQP A;  1J7P A;  3LCP C;  1UHI A;  3WXA A;  3KHE A;  4FTG A;  2P6B B;  4I5J A;  3ZWH A;  2SCP A;  1KQV A;  1A29 A;  4MRX A;  1A03 A;  1IQ3 A;  4PHM A;  4ZCV A;  2NLN A;  1S6I A;  1WDC C;  2EGD A;  3D0Y A;  3VGO A;  2PAL A;  4HRE E;  2G2B A;  3CR4 X;  1KFX S;  4MVF A;  2OS8 C;  2FOT A;  3EVR A;  4TNC A;  4MBE A;  2KQY A;  5JJG A;  1FI5 A;  2EC6 B;  1KQM B;  1YUU A;  1QVI Y;  1Y1U A;  4OVN F;  4DRW A;  2BL0 B;  2IS9 A;  1TNP A;  5FYX A;  3NSO A;  4HRH A;  1MWN A;  2AAO A;  1G33 A;  4PE4 A;  1TCF A;  3C1V A;  1NSH A;  2ZND A;  4QJ3 B;  5DKQ A;  2BBN A;  2WND A;  1DVI A;  2LE9 B;  2CCM A;  1SNL A;  4Q04 A;  2H2K A;  4YGD B;  3JVT B;  1GGZ A;  1B7T Z;  1YX8 A;  3O78 A;  5CSF A;  4BY5 A;  2HF5 A;  1KK8 B;  2M7N A;  4I5L B;  3OX6 A;  2HET A;  4AOM A;  4NDB A;  3LLE A;  4YBH B;  1XK4 C;  1S5G Z;  5ER5 A;  1DGV A;  2MHH A;  1QV0 A;  3WHU B;  2KQ6 A;  2Q91 A;  3DVM A;  2OPO A;  3LL8 B;  1QJT A;  3EK8 A;  1C7V A;  1R2U A;  4A4C A;  1NP8 A;  1DJW A;  2L51 A;  2Y4Q A;  4NDC A;  1EXR A;  1SYM A;  1XFY O;  1YX7 A;  3O2P A;  1RWY A;  3K21 A;  2KI6 D;  3TDU A;  1G4Y R;  3CR2 A;  1PAL A;  5AXI A;  5HKZ A;  3SG5 A;  2ISD A;  1U5I A;  4NQG A;  4I5N B;  5F6T A;  1HQV A;  4PHN A;  3VRO A;  4PHJ A;  2JPT A;  2BCX A;  3A8R A;  2M29 A;  1TTX A;  5TNC A;  5HLV A;  3I5G C;  3TDZ A;  1YVH A;  1DF0 A;  1K2H A;  1QVI Z;  2LNK A;  2MRD A;  3CR5 X;  5DKN A;  1KFU L;  1DGU A;  1BG1 A;  1MF8 B;  2LUX A;  3QRX A;  1CKK A;  1F54 A;  3VRP A;  4MZJ A;  4JPZ B;  4QJ5 B;  2H61 A;  1W7J B;  2BE6 A;  5D7F A;  2LMT A;  2BKH B;  1DJI A;  3WHT B;  5KSZ A;  2K7B A;  4ORB B;  2NCO A;  2KAY A;  1YR5 A;  1XFW O;  4M2Q A;  4XJK A;  2EC6 C;  1IJ6 A;  1KQM C;  1OE9 B;  1A75 B;  3SG6 A;  1YTZ C;  4A4B A;  1D1O A;  3BUO B;  2B1U A;  2KDH A;  2LV7 A;  1E8A A;  2BL0 C;  2JNX A;  1FPW A;  1VRK A;  1NPQ A;  1G8I A;  1JFJ A;  2RGI A;  3I5I B;  4ETO A;  3OB2 B;  1DJZ A;  4HRG A;  1PVA A;  3OP0 A;  2JU0 A;  2GGZ A;  2Y1N A;  4WQ2 A;  2LCP A;  4XYN A;  1JWD A;  1BR1 B;  2M8U A;  1F4O A;  1K90 D;  4MRY A;  4ICB A;  1IQ5 A;  1KK8 C;  1CDP A;  2LVV A;  2JTZ A;  1A2X A;  1XFZ O;  2K7O A;  5CSI A;  1DT7 B;  2K7D A;  3ZNI A;  2JT8 A;  1CFF A;  2ZFD A;  2F3Z A;  1TNQ A;  2MA2 A;  3OX5 A;  4YI8 A;  1DJY A;  1BF5 A;  1AK8 A;  4I5K A;  4N1G A;  1AJ5 A;  2KAX A;  1S36 A;  2WCE A;  1F4Q A;  2LMU A;  4YGA A;  3CZT X;  1W7I B;  3I5G B;  4PE0 A;  2LMV A;  3SG4 A;  4WQ3 A;  1CDM A;  1TOP A;  1PUL A;  2NZ0 A;  3EK7 A;  3KO0 A;  5HKY A;  4OR9 B;  1BLQ A;  2KOT A;  2KYF A;  4PDZ A;  3BYA A;  1BT6 A;  1MXL C;  2KHN A;  1CLL A;  2Y5I A;  3D0Y B;  3KPX A;  4N1F A;  2GV5 A;  1CFD A;  2JT0 A;  2O60 A;  5GQQ C;  5CPV A;  3NSL A;  1ALW A;  2HQ8 A;  4MEW A;  2CBL A;  3AAK A;  3DD4 A;  3NXA A;  3DVK A;  1MR8 A;  1HT9 A;  1XYD A;  1N0Y A;  2ZRT A;  1KSM A;  1B8C A;  1BU3 A;  2KGR A;  4M2P A;  4DCK A;  1NX1 A;  1WRL A;  2L5X B;  2JXC A;  4GGN A;  4GGF A;  2LAN A;  3FS7 A;  1C7W A;  2JUL A;  4YGB B;  1NYA A;  5I8N A;  1RFJ A;  1J55 A;  2JC2 A;  2PSR A;  4AQI A;  4OV2 A;  4M2O A;  4UPG A;  5AFP A;  1NIW A;  1K95 A;  1ZUZ A;  1CMG A;  3DF0 A;  4PE7 A;  5AER A;  2AUC A;  3GK2 A;  2WC8 A;  1AUI B;  1LA3 A;  1EJ3 A;  3CWG A;  1SL9 A;  3PAL A;  1H8B A;  3FIA A;  3H4S E;  3RLZ A;  4YGC B;  3I5I C;  4PAL A;  4E68 A;  1Y6W A;  4OKH A;  1CMF A;  2I18 A;  3WNX B;  1F71 A;  1B47 A;  1QAT A;  2MLF C;  1MHO A;  1S1E A;  3JTD C;  1S6C A;  2KYC A;  3GK1 A;  2BCA A;  1MUX A;  3VRN A;  1LVC D;  1M46 A;  2KI6 C;  3EK4 A;  1BJF A;  2JWW A;  2LLS A;  3ICB A;  2JQ6 A;  3KF9 A;  2MBX A;  3IQO A;  2M0R A;  1U5I B;  1XVJ A;  2KAV A;  1YVL A;  3EKH A;  2HQW A;  5HYD A;  1N65 A;  1ZFS A;  1ALV A;  2FCD A;  3O4Y A;  1OOJ A;  2TN4 A;  3MSE B;  1QLK A;  3SIA A;  1YUR A;  4YRU A;  1F70 A;  2E6W A;  2LP3 A;  4IL1 A;  1JC2 A;  1DF0 B;  3NSI A;  5K89 A;  1B4C A;  2ZKM X;  1FF1 A;  4AQJ A;  1TIZ A;  1TN4 A;  2F2P A;  2ZN9 A;  1RJV A;  1UHH A;  4R1E A;  2CT9 A;  1B1G A;  1BOD A;  4P2Y B;  4PCW A;  4F0Z B;  1GJY A;  1DTL A;  1SRA A;  2A4J A;  2CTN A;  3FWC A;  1JFK A;  5B8I B;  1J1D A;  1SK6 D;  1AJ4 A;  1BR4 B;  3PLF B;  4JQ0 D;  2KBI A;  4JWQ A;  3HCM A;  4MSP A;  2AMI A;  4XJK B;  4OCI A;  1J7R A;  1QXP A;  3LK0 A;  4GGF C;  5D69 A;  1CDN A;  2V53 A;  1WY9 A;  4YGE B;  4PE1 A;  2DOQ A;  3OB1 B;  2LP2 A;  2CNP A;  2M7L A;  4GFT A;  1OMR A;  1TRF A;  2SAS A;  1M45 A;  1MQ1 A;  2PVB A;  2WOR A;  3TS5 B;  1IWQ A;  2JOJ A;  4ORC B;  3I5F C;  3E3R A;  1PVB A;  2OTG B;  4CFR A;  4DIR A;  2JXL A;  2WOS A;  2Y1M A;  2K8M B;  1B8R A;  2LVK A;  3PN7 B;  5ER4 X;  4CFQ A;  3JTD B;  2LVJ A;  3PM8 A;  1CB1 A;  1JF2 A;  1Q80 A;  4YI9 A;  3EVV A;  1L2O B;  5I2L A;  1PRW A;  1SPY A;  3AKB A;  1V1F A;  1XFX O;  3AAJ A;  5HKW A;  1UUS A;  1NX0 A;  2KNE A;  2BKI B;  1CFC A;  1J7Q A;  1FI6 A;  4QJ4 B;  1L7Z A;  1KSO A;  5PAL A;  2KSP A;  1GGW A;  4U8D A;  1PK0 D;  1TNX A;  1SY9 A;  5AAN A;  1JUO A; 
#chains in the Genus database with same CATH topology
 1EG4 A;  2L98 A;  2Q4U A;  3BUN B;  5KU1 A;  2MLE C;  1K9P A;  1Y1X A;  1CLM A;  1AHR A;  2F2O A;  2F33 A;  1PSR A;  1LIN A;  1XK4 A;  2LVI A;  2WCH A;  1CFP A;  1S6J A;  1N2D A;  5J3X A;  1KCY A;  4N5X A;  2I2R E;  1CM4 A;  2L2E A;  3S0A A;  2K60 A;  2LHI A;  3EVU A;  1UP5 A;  3I5H B;  4C0L A;  3HX4 A;  1WRK A;  3R1O A;  1SL8 A;  3SS3 A;  3TDI A;  3DVE A;  4GBA A;  3PFV A;  3M0W A;  1R6P A;  2NXQ A;  1QS7 A;  1XFU O;  1IRJ A;  2QEO A;  1AP4 A;  1ODB A;  1UWO A;  2D8N A;  2JNF A;  1F8H A;  4L9M A;  3BOW A;  1PSB A;  5HL1 A;  2FCE A;  1DMO A;  1W9Z A;  2KGB C;  2H61 C;  1GQM A;  3D75 A;  5G08 A;  1LKJ A;  2I94 A;  2ZNE A;  4HSZ A;  5CSN A;  1ZOT B;  1TCO B;  1YRU B;  3D10 A;  2KI4 B;  1SR6 B;  2WC6 A;  1YUS A;  3DF0 B;  4GPL B;  1QIW A;  1QTX A;  2LC5 A;  3I5F B;  4FQO A;  1CNP A;  2I7A A;  4CID A;  1QIV A;  1CM1 A;  1M63 B;  1SMG A;  3TUY B;  1QX2 A;  1M39 A;  2F8P A;  2KLE A;  3SIB A;  2BE4 A;  1KWO C;  1KK7 Y;  3GOF A;  1QX5 B;  1A4P A;  4BY4 A;  1NCY A;  3BJH A;  1IGV A;  1LA0 A;  3TS5 C;  3L4L A;  1UHK A;  1BMO A;  2OTG C;  4ORA B;  1SCM B;  1KFX L;  1TUZ A;  1B9A A;  3BXK A;  3S0E A;  1TNW A;  1SL7 A;  2FJU B;  4D1E A;  1OMD A;  2VRG A;  3PN7 C;  1FBV A;  1Y0V H;  3TZ1 A;  1NUB A;  1EH2 A;  2JT3 A;  2MAZ A;  1SW8 A;  1EG3 A;  3CGA A;  2K2F A;  1DQE A;  1L2O C;  3SG7 A;  1OZO A;  1ZAC A;  5IBW A;  1QV1 A;  3BQ3 A;  2WCK A;  1AVS A;  1XO5 A;  2JTT A;  1K9U A;  2G9B A;  1DJG A;  3SJS A;  4PHK A;  3VB1 A;  2L0P A;  2LLU A;  1UHJ A;  1C07 A;  2COL B;  2QAC A;  4ZCU A;  1XFV O;  2K61 A;  2M1K B;  2LHL A;  1CDL A;  2CXJ A;  1IG5 A;  1IKU A;  4GAO A;  1SCV A;  2K2A A;  2KFF A;  2K7C A;  3D77 A;  1Y1A A;  3BUX B;  5I2Q A;  1YRT B;  3R1V A;  2QEV A;  3O6B A;  3S0B A;  2O5G A;  3DVJ A;  1ZMZ A;  3I5H C;  3VRR A;  4CLN A;  1WLZ A;  2E30 A;  1DJH A;  4WRI A;  1J7O A;  5I2O A;  1SBJ A;  2KFG A;  4C0K A;  1KK7 Z;  3GK4 X;  3CLN A;  3KEV A;  1UHN A;  3PM2 A;  3LK1 A;  3R72 A;  4F7F A;  1S26 D;  5BPJ A;  1WRZ A;  3AKA A;  1LXF C;  5CSJ A;  3EKJ A;  4C0J A;  5HLO A;  1REC A;  2M49 B;  1KWO B;  2LM5 A;  4MZK A;  2LAP A;  2MJW B;  2KBM A;  1OZS A;  2PAS A;  1WDC B;  3L47 A;  5AEQ A;  1JSA A;  1YUT A;  1OOH A;  2KI4 C;  1SR6 C;  1RK9 A;  1QLS A;  2M9G A;  1UUR A;  2OS8 B;  2WCF A;  3FE8 A;  4DS7 A;  2M1U A;  4MZL A;  1JF0 A;  3CS1 A;  2QPT A;  2ZRS A;  2BEC A;  2GGM A;  5DKR A;  2L4I A;  4INX A;  2L50 A;  3SG3 A;  1QAS A;  2M3W A;  1K96 A;  2F3Y A;  3CZ2 A;  4USL A;  3TUY C;  1CLB A;  1GM0 A;  1Z2C B;  2L4H A;  3PAT A;  1QX7 A;  3F45 A;  2HPS A;  3CZ1 A;  2GTE A;  3NSK A;  3DY9 A;  2BBM A;  1WLM A;  2JRF A;  3NGV A;  2PMY A;  1K9K A;  1KFU S;  1ORG A;  1SCM C;  3PSR A;  1M31 A;  1MXE A;  1A75 A;  1OSA A;  1NCZ A;  2EHB A;  4GUK A;  4P5O E;  1DJX A;  2ERB A;  1F55 A;  3VRQ A;  1J1E A;  1K94 A;  1NCX A;  2M97 A;  1S3P A;  2LLT A;  1DC1 A;  1C3Z A;  3S0D A;  2KFH A;  1FW4 A;  3D74 A;  1NX2 A;  3JVT C;  3FWB A;  2JZI A;  1NX3 A;  1NWD A;  1OMV A;  3IQQ A;  3Q8I A;  2WCB A;  2PYQ A;  4MN0 A;  3PJI A;  1X02 A;  3CTN A;  2PRU A;  2K0J A;  3RM1 A;  1JBA A;  1RTP 1;  2R2I A;  4DUQ A;  2NCP A;  1XA5 A;  1EL4 A;  2JPO A;  3BUW B;  1BOC A;  1RRO A;  1B7T Y;  3B7A A;  2QEB A;  3SG2 A;  2LUC A;  3CZ0 A;  4CPV A;  1CTR A;  4NDD A;  1V1G A;  3OHM B;  4MLW A;  1K8U A;  3BOW B;  5KTY A;  1S5G Y;  1IH0 A;  3A4U B;  1H4B A;  2FJY A;  1SKT A;  2BCB A;  1K93 D;  2ZN8 A;  3BUM B;  5JOL A;  1IJ5 A;  3IF7 A;  4GNK B;  1B8L A;  2P71 A;  1OQP A;  1J7P A;  1SSE B;  3LCP C;  1UHI A;  3WXA A;  3KHE A;  4FTG A;  3DYE A;  2P6B B;  4I5J A;  3ZWH A;  2SCP A;  1KQV A;  1A29 A;  4MRX A;  1A03 A;  1IQ3 A;  4PHM A;  4JD9 A;  3NHI A;  4ZCV A;  2NLN A;  1S6I A;  1WDC C;  2EGD A;  3D0Y A;  3VGO A;  2PAL A;  4HRE E;  2G2B A;  3CR4 X;  1KFX S;  4MVF A;  2OS8 C;  2FOT A;  3EVR A;  4TNC A;  1LS8 A;  4MBE A;  2KQY A;  5JJG A;  1FI5 A;  2EC6 B;  1KQM B;  1YUU A;  1QVI Y;  1Y1U A;  3B86 A;  4OVN F;  4DRW A;  2KPH A;  2BL0 B;  2IS9 A;  1TNP A;  5FYX A;  3NSO A;  3L4A A;  4HRH A;  1MWN A;  2AAO A;  1G33 A;  4PE4 A;  1TCF A;  2YGU A;  3C1V A;  1NSH A;  2ZND A;  4QJ3 B;  5DKQ A;  2BBN A;  2WND A;  4IJ7 A;  1DVI A;  3S0G A;  2LE9 B;  2CCM A;  1SNL A;  4Q04 A;  2H2K A;  4YGD B;  3JVT B;  1GGZ A;  5FI7 A;  2WCL A;  1B7T Z;  1YX8 A;  3O78 A;  5CSF A;  4BY5 A;  2HF5 A;  1KK8 B;  2M7N A;  4I5L B;  3OX6 A;  2HET A;  4AOM A;  4NDB A;  3LLE A;  4YBH B;  1XK4 C;  1S5G Z;  5ER5 A;  1DGV A;  2MHH A;  1QV0 A;  3WHU B;  2KQ6 A;  2Q91 A;  3DVM A;  4PT1 A;  2OPO A;  3LL8 B;  1QJT A;  3EK8 A;  4INW A;  1C7V A;  2WC5 A;  1R2U A;  4A4C A;  1NP8 A;  1DJW A;  2L51 A;  2Y4Q A;  4NDC A;  1EXR A;  1SYM A;  1XFY O;  1YX7 A;  2L5Y A;  3O2P A;  1RWY A;  3K21 A;  2KI6 D;  3TDU A;  1G4Y R;  3CR2 A;  1PAL A;  5AXI A;  5HKZ A;  3SG5 A;  2ISD A;  1U5I A;  4NQG A;  4I5N B;  5F6T A;  1HQV A;  4PHN A;  3VRO A;  4PHJ A;  2JPT A;  2L2C A;  5I94 A;  2BCX A;  3A8R A;  2M29 A;  1TTX A;  5TNC A;  5HLV A;  3I5G C;  3TDZ A;  3SS5 A;  1TUJ A;  1YVH A;  1DF0 A;  3N7H A;  1K2H A;  1QVI Z;  2LNK A;  3V2L A;  1OOG A;  2MRD A;  3CR5 X;  5DKN A;  1KFU L;  3B87 A;  1DGU A;  1BG1 A;  1MF8 B;  2LUX A;  1C3Y A;  3QRX A;  1CKK A;  1F54 A;  3VRP A;  4MZJ A;  4JPZ B;  4QJ5 B;  1OW4 A;  2H61 A;  1W7J B;  2BE6 A;  5D7F A;  2LMT A;  1Z4H A;  2BKH B;  1DJI A;  3WHT B;  5KSZ A;  2K7B A;  4ORB B;  2NCO A;  2KAY A;  1YR5 A;  1XFW O;  2H8V A;  4M2Q A;  4XJK A;  2EC6 C;  1IJ6 A;  1KQM C;  1OE9 B;  1A75 B;  5FI2 A;  1YTZ C;  3SG6 A;  4A4B A;  1D1O A;  3BUO B;  2B1U A;  2KDH A;  2LV7 A;  1E8A A;  2BL0 C;  2JNX A;  2PQL A;  2BNX A;  1P28 A;  3EG5 B;  1FPW A;  1VRK A;  2KLD A;  1NPQ A;  1G8I A;  1JFJ A;  2RGI A;  3I5I B;  4ETO A;  3OB2 B;  1DJZ A;  4HRG A;  1PVA A;  3OP0 A;  2JU0 A;  3O4X A;  2GGZ A;  2Y1N A;  1QWV A;  3DZT A;  4WQ2 A;  5FI6 A;  2LCP A;  4XYN A;  1JWD A;  1BR1 B;  2M8U A;  1F4O A;  1K90 D;  4MRY A;  4ICB A;  1IQ5 A;  1KK8 C;  1CDP A;  2LVV A;  3CYZ A;  2JTZ A;  1A2X A;  1XFZ O;  2K7O A;  5CSI A;  1DT7 B;  2K7D A;  3ZNI A;  3UO9 A;  2JT8 A;  1CFF A;  3R1P A;  2ZFD A;  2F3Z A;  1TNQ A;  2MA2 A;  3OX5 A;  4YI8 A;  1DJY A;  1BF5 A;  1AK8 A;  2QDI A;  4I5K A;  4N1G A;  1AJ5 A;  2QEH A;  2KAX A;  1S36 A;  2WCE A;  1F4Q A;  2LMU A;  4YGA A;  3CZT X;  3D76 A;  1W7I B;  3I5G B;  4PE0 A;  2LMV A;  3SG4 A;  4WQ3 A;  1CDM A;  1TOP A;  4JKT A;  1PUL A;  2NZ0 A;  3EK7 A;  3KO0 A;  5DIC A;  5HKY A;  1DEL A;  4OR9 B;  1BLQ A;  2KOT A;  2KYF A;  4PDZ A;  3BYA A;  1BT6 A;  1MXL C;  2KHN A;  3OGN A;  1CLL A;  2Y5I A;  3D0Y B;  3KPX A;  4N1F A;  2BAP A;  2GV5 A;  1CFD A;  2JT0 A;  2O60 A;  5D3O A;  5GQQ C;  5CPV A;  3NSL A;  1ALW A;  2HQ8 A;  4MEW A;  3SS4 A;  2CBL A;  3AAK A;  3DD4 A;  3FE9 A;  3NXA A;  3DVK A;  1MR8 A;  1HT9 A;  4FQT A;  1XYD A;  1N0Y A;  2ZRT A;  1KSM A;  1B8C A;  1BU3 A;  2KGR A;  4M2P A;  4DCK A;  1NX1 A;  1WRL A;  2L5X B;  2JXC A;  4GGN A;  4GGF A;  2LAN A;  3D73 A;  3FS7 A;  1C7W A;  2JUL A;  4YGB B;  3DXL A;  1NYA A;  5I8N A;  1RFJ A;  1J55 A;  2JC2 A;  2PSR A;  4AQI A;  4OV2 A;  4M2O A;  4UPG A;  5AFP A;  1NIW A;  1K95 A;  1ZUZ A;  1CMG A;  3DF0 A;  4PE7 A;  1OOI X;  5AER A;  2AUC A;  3GK2 A;  3RZS A;  2WC8 A;  1AUI B;  1LA3 A;  1EJ3 A;  2WCJ A;  3CWG A;  1OOF A;  1SL9 A;  3PAL A;  3S0F A;  1H8B A;  3FIA A;  3H4S E;  3NHT A;  3B88 A;  3RLZ A;  4YGC B;  1IIO A;  3I5I C;  3B6X A;  4PAL A;  4E68 A;  1Y6W A;  4OKH A;  1CMF A;  2I18 A;  1T14 A;  3WNX B;  1B47 A;  1F71 A;  3K1E A;  1QAT A;  2MLF C;  1MHO A;  1S1E A;  3JTD C;  1S6C A;  2KYC A;  3GK1 A;  2BCA A;  1MUX A;  3VRN A;  1LVC D;  1M46 A;  2KI6 C;  3EK4 A;  1BJF A;  2JWW A;  2LLS A;  3ICB A;  2JQ6 A;  3KF9 A;  1XFR A;  3IQO A;  2M0R A;  2MBX A;  1U5I B;  1XVJ A;  2KAV A;  1YVL A;  3BFA A;  1DEK A;  3EKH A;  2HQW A;  5HYD A;  1N65 A;  1ZFS A;  1ALV A;  2FCD A;  3O4Y A;  4OZD A;  1OOJ A;  2TN4 A;  3MSE B;  1QLK A;  3SIA A;  1YUR A;  4YRU A;  1F70 A;  2E6W A;  2LP3 A;  4IL1 A;  1JC2 A;  1DF0 B;  3NSI A;  5K89 A;  1B4C A;  2ZKM X;  1FF1 A;  4AQJ A;  1TIZ A;  1TN4 A;  2F2P A;  2ZN9 A;  1RJV A;  1UHH A;  4R1E A;  2CT9 A;  1B1G A;  1BOD A;  4P2Y B;  2WCM A;  4PCW A;  3CAB A;  4F0Z B;  1GJY A;  1DTL A;  1SRA A;  2A4J A;  2CTN A;  2P70 A;  3FWC A;  1JFK A;  5B8I B;  3OBV A;  1J1D A;  1SK6 D;  1AJ4 A;  1BR4 B;  3QME A;  3PLF B;  4JQ0 D;  2KBI A;  4JWQ A;  3HCM A;  4MSP A;  2AMI A;  4XJK B;  4OCI A;  1J7R A;  1QXP A;  3LK0 A;  4GGF C;  5D69 A;  1CDN A;  2V53 A;  1WY9 A;  4YGE B;  4PE1 A;  2DOQ A;  3OB1 B;  2LP2 A;  2CNP A;  2M7L A;  4GFT A;  1OMR A;  1TRF A;  3BFH A;  2SAS A;  1M45 A;  1MQ1 A;  2PVB A;  2WOR A;  3TS5 B;  1IWQ A;  3CDN A;  5EL2 A;  2JOJ A;  4ORC B;  3I5F C;  3IVT A;  3E3R A;  3FE6 A;  1PVB A;  2OTG B;  4CFR A;  4DIR A;  2JXL A;  2WOS A;  2Y1M A;  2K8M B;  1B8R A;  2LVK A;  3PN7 B;  5ER4 X;  4CFQ A;  3JTD B;  2LVJ A;  1TWO A;  3PM8 A;  1CB1 A;  1JF2 A;  1Q80 A;  4YI9 A;  3EVV A;  1L2O B;  5I2L A;  1PRW A;  1SPY A;  3AKB A;  1V1F A;  1XFX O;  3AAJ A;  5HKW A;  1UUS A;  1NX0 A;  2KNE A;  2BKI B;  4KYN A;  1CFC A;  3D78 A;  1J7Q A;  3BFB A;  4QJ4 B;  1FI6 A;  1L7Z A;  1KSO A;  5PAL A;  3UNW A;  2KSP A;  1GGW A;  4U8D A;  1PK0 D;  1TNX A;  1SY9 A;  5AAN A;  1JUO A; 
#chains in the Genus database with same CATH homology
 1EG4 A;  2L98 A;  2Q4U A;  3BUN B;  5KU1 A;  2MLE C;  1K9P A;  1Y1X A;  1CLM A;  1AHR A;  2F2O A;  2F33 A;  1PSR A;  1LIN A;  1XK4 A;  2LVI A;  1CFP A;  1S6J A;  1N2D A;  5J3X A;  1KCY A;  4N5X A;  2I2R E;  1CM4 A;  2L2E A;  2LHI A;  3EVU A;  1UP5 A;  3I5H B;  4C0L A;  3HX4 A;  1WRK A;  1SL8 A;  3TDI A;  3DVE A;  4GBA A;  3PFV A;  3M0W A;  1R6P A;  2NXQ A;  1QS7 A;  1XFU O;  1IRJ A;  1AP4 A;  1ODB A;  1UWO A;  2D8N A;  2JNF A;  1F8H A;  4L9M A;  3BOW A;  1PSB A;  2FCE A;  1DMO A;  2KGB C;  2H61 C;  1GQM A;  5G08 A;  1LKJ A;  2I94 A;  2ZNE A;  4HSZ A;  5CSN A;  1ZOT B;  1TCO B;  1YRU B;  3D10 A;  2KI4 B;  1SR6 B;  1YUS A;  3DF0 B;  4GPL B;  1QIW A;  1QTX A;  2LC5 A;  3I5F B;  4FQO A;  1CNP A;  2I7A A;  4CID A;  1QIV A;  1CM1 A;  1M63 B;  1SMG A;  3TUY B;  1QX2 A;  1M39 A;  2F8P A;  3SIB A;  2BE4 A;  1KWO C;  1KK7 Y;  3GOF A;  1QX5 B;  1A4P A;  4BY4 A;  1NCY A;  1IGV A;  1LA0 A;  3TS5 C;  1UHK A;  1BMO A;  2OTG C;  4ORA B;  1SCM B;  1KFX L;  1B9A A;  3BXK A;  1TNW A;  1SL7 A;  2FJU B;  4D1E A;  1OMD A;  2VRG A;  3PN7 C;  1FBV A;  1Y0V H;  3TZ1 A;  1NUB A;  1EH2 A;  2JT3 A;  2MAZ A;  1SW8 A;  1EG3 A;  3CGA A;  2K2F A;  1L2O C;  3SG7 A;  1OZO A;  1ZAC A;  5IBW A;  1QV1 A;  3BQ3 A;  1AVS A;  1XO5 A;  2JTT A;  1K9U A;  2G9B A;  1DJG A;  3SJS A;  4PHK A;  2L0P A;  2LLU A;  1UHJ A;  1C07 A;  2COL B;  2QAC A;  4ZCU A;  1XFV O;  2K61 A;  2M1K B;  2LHL A;  1CDL A;  2CXJ A;  1IG5 A;  1IKU A;  4GAO A;  1SCV A;  2K2A A;  2KFF A;  2K7C A;  1Y1A A;  3BUX B;  5I2Q A;  1YRT B;  3O6B A;  2O5G A;  3DVJ A;  1ZMZ A;  3I5H C;  3VRR A;  4CLN A;  1WLZ A;  2E30 A;  1DJH A;  4WRI A;  1J7O A;  5I2O A;  1SBJ A;  2KFG A;  4C0K A;  1KK7 Z;  3GK4 X;  3CLN A;  3KEV A;  1UHN A;  5BPJ A;  3LK1 A;  1S26 D;  1WRZ A;  3AKA A;  1LXF C;  5CSJ A;  3EKJ A;  4C0J A;  5HLO A;  1REC A;  2M49 B;  1KWO B;  2LM5 A;  4MZK A;  2LAP A;  2MJW B;  2KBM A;  1OZS A;  2PAS A;  1WDC B;  5AEQ A;  1JSA A;  1YUT A;  2KI4 C;  1SR6 C;  1RK9 A;  1QLS A;  2M9G A;  1UUR A;  2OS8 B;  2WCF A;  4DS7 A;  2M1U A;  4MZL A;  1JF0 A;  3CS1 A;  2QPT A;  2ZRS A;  2BEC A;  2GGM A;  5DKR A;  2L4I A;  2L50 A;  3SG3 A;  1QAS A;  2M3W A;  1K96 A;  2F3Y A;  4USL A;  3TUY C;  1CLB A;  2L4H A;  3PAT A;  1QX7 A;  3F45 A;  2HPS A;  3NSK A;  2BBM A;  1WLM A;  2JRF A;  2PMY A;  1K9K A;  1KFU S;  1SCM C;  3PSR A;  1M31 A;  1MXE A;  1A75 A;  1OSA A;  1NCZ A;  2EHB A;  4GUK A;  4P5O E;  1DJX A;  1F55 A;  3VRQ A;  1J1E A;  1K94 A;  1NCX A;  2M97 A;  1S3P A;  2LLT A;  2KFH A;  1FW4 A;  1NX2 A;  3JVT C;  3FWB A;  2JZI A;  1NX3 A;  1NWD A;  1OMV A;  3IQQ A;  4MN0 A;  2WCB A;  1X02 A;  3CTN A;  2PRU A;  2K0J A;  3RM1 A;  1JBA A;  1RTP 1;  2R2I A;  4DUQ A;  2NCP A;  1XA5 A;  1EL4 A;  1BOC A;  3BUW B;  1RRO A;  1B7T Y;  3SG2 A;  2LUC A;  4CPV A;  1CTR A;  4NDD A;  1V1G A;  3OHM B;  4MLW A;  1K8U A;  3BOW B;  5KTY A;  1S5G Y;  1IH0 A;  3A4U B;  1H4B A;  1SKT A;  2BCB A;  1K93 D;  2ZN8 A;  3BUM B;  5JOL A;  1IJ5 A;  3IF7 A;  4GNK B;  1B8L A;  1OQP A;  1J7P A;  3LCP C;  1UHI A;  3WXA A;  3KHE A;  4FTG A;  2P6B B;  4I5J A;  3ZWH A;  2SCP A;  1KQV A;  1A29 A;  4MRX A;  1A03 A;  1IQ3 A;  4PHM A;  4ZCV A;  2NLN A;  1S6I A;  1WDC C;  2EGD A;  3D0Y A;  3VGO A;  2PAL A;  4HRE E;  2G2B A;  3CR4 X;  1KFX S;  4MVF A;  2OS8 C;  2FOT A;  3EVR A;  4TNC A;  4MBE A;  2KQY A;  5JJG A;  1FI5 A;  2EC6 B;  1KQM B;  1YUU A;  1QVI Y;  1Y1U A;  4OVN F;  4DRW A;  2BL0 B;  2IS9 A;  1TNP A;  5FYX A;  3NSO A;  4HRH A;  1MWN A;  2AAO A;  1G33 A;  4PE4 A;  1TCF A;  3C1V A;  1NSH A;  2ZND A;  4QJ3 B;  5DKQ A;  2BBN A;  2WND A;  1DVI A;  2LE9 B;  2CCM A;  1SNL A;  4Q04 A;  2H2K A;  4YGD B;  3JVT B;  1GGZ A;  1B7T Z;  1YX8 A;  3O78 A;  5CSF A;  4BY5 A;  2HF5 A;  1KK8 B;  2M7N A;  4I5L B;  3OX6 A;  2HET A;  4AOM A;  4NDB A;  3LLE A;  4YBH B;  1XK4 C;  1S5G Z;  5ER5 A;  1DGV A;  2MHH A;  1QV0 A;  3WHU B;  2KQ6 A;  2Q91 A;  3DVM A;  2OPO A;  3LL8 B;  1QJT A;  3EK8 A;  1C7V A;  1R2U A;  4A4C A;  1NP8 A;  1DJW A;  2L51 A;  2Y4Q A;  4NDC A;  1EXR A;  1SYM A;  1XFY O;  1YX7 A;  3O2P A;  1RWY A;  3K21 A;  2KI6 D;  3TDU A;  1G4Y R;  3CR2 A;  1PAL A;  5AXI A;  5HKZ A;  3SG5 A;  2ISD A;  1U5I A;  4NQG A;  4I5N B;  5F6T A;  1HQV A;  4PHN A;  3VRO A;  4PHJ A;  2JPT A;  2BCX A;  3A8R A;  2M29 A;  1TTX A;  5TNC A;  5HLV A;  3I5G C;  3TDZ A;  1YVH A;  1DF0 A;  1K2H A;  1QVI Z;  2LNK A;  2MRD A;  3CR5 X;  5DKN A;  1KFU L;  1DGU A;  1BG1 A;  1MF8 B;  2LUX A;  3QRX A;  1CKK A;  1F54 A;  3VRP A;  4MZJ A;  4JPZ B;  4QJ5 B;  2H61 A;  1W7J B;  2BE6 A;  5D7F A;  2LMT A;  2BKH B;  1DJI A;  3WHT B;  5KSZ A;  2K7B A;  4ORB B;  2NCO A;  2KAY A;  1YR5 A;  1XFW O;  4M2Q A;  4XJK A;  2EC6 C;  1IJ6 A;  1KQM C;  1OE9 B;  1A75 B;  3SG6 A;  1YTZ C;  4A4B A;  1D1O A;  3BUO B;  2B1U A;  2KDH A;  2LV7 A;  1E8A A;  2BL0 C;  2JNX A;  1FPW A;  1VRK A;  1NPQ A;  1G8I A;  1JFJ A;  2RGI A;  3I5I B;  4ETO A;  3OB2 B;  1DJZ A;  4HRG A;  1PVA A;  3OP0 A;  2JU0 A;  2GGZ A;  2Y1N A;  4WQ2 A;  2LCP A;  4XYN A;  1JWD A;  1BR1 B;  2M8U A;  1F4O A;  1K90 D;  4MRY A;  4ICB A;  1IQ5 A;  1KK8 C;  1CDP A;  2LVV A;  2JTZ A;  1A2X A;  1XFZ O;  2K7O A;  5CSI A;  1DT7 B;  2K7D A;  3ZNI A;  2JT8 A;  1CFF A;  2ZFD A;  2F3Z A;  1TNQ A;  2MA2 A;  3OX5 A;  4YI8 A;  1DJY A;  1BF5 A;  1AK8 A;  4I5K A;  4N1G A;  1AJ5 A;  2KAX A;  1S36 A;  2WCE A;  1F4Q A;  2LMU A;  4YGA A;  3CZT X;  1W7I B;  3I5G B;  4PE0 A;  2LMV A;  3SG4 A;  4WQ3 A;  1CDM A;  1TOP A;  1PUL A;  2NZ0 A;  3EK7 A;  3KO0 A;  5HKY A;  4OR9 B;  1BLQ A;  2KOT A;  2KYF A;  4PDZ A;  3BYA A;  1BT6 A;  1MXL C;  2KHN A;  1CLL A;  2Y5I A;  3D0Y B;  3KPX A;  4N1F A;  2GV5 A;  1CFD A;  2JT0 A;  2O60 A;  5GQQ C;  5CPV A;  3NSL A;  1ALW A;  2HQ8 A;  4MEW A;  2CBL A;  3AAK A;  3DD4 A;  3NXA A;  3DVK A;  1MR8 A;  1HT9 A;  1XYD A;  1N0Y A;  2ZRT A;  1KSM A;  1B8C A;  1BU3 A;  2KGR A;  4M2P A;  4DCK A;  1NX1 A;  1WRL A;  2L5X B;  2JXC A;  4GGN A;  4GGF A;  2LAN A;  3FS7 A;  1C7W A;  2JUL A;  4YGB B;  1NYA A;  5I8N A;  1RFJ A;  1J55 A;  2JC2 A;  2PSR A;  4AQI A;  4OV2 A;  4M2O A;  4UPG A;  5AFP A;  1NIW A;  1K95 A;  1ZUZ A;  1CMG A;  3DF0 A;  4PE7 A;  5AER A;  2AUC A;  3GK2 A;  2WC8 A;  1AUI B;  1LA3 A;  1EJ3 A;  3CWG A;  1SL9 A;  3PAL A;  1H8B A;  3FIA A;  3H4S E;  3RLZ A;  4YGC B;  3I5I C;  4PAL A;  4E68 A;  1Y6W A;  4OKH A;  1CMF A;  2I18 A;  3WNX B;  1F71 A;  1B47 A;  1QAT A;  2MLF C;  1MHO A;  1S1E A;  3JTD C;  1S6C A;  2KYC A;  3GK1 A;  2BCA A;  1MUX A;  3VRN A;  1LVC D;  1M46 A;  2KI6 C;  3EK4 A;  1BJF A;  2JWW A;  2LLS A;  3ICB A;  2JQ6 A;  3KF9 A;  2MBX A;  3IQO A;  2M0R A;  1U5I B;  1XVJ A;  2KAV A;  1YVL A;  3EKH A;  2HQW A;  5HYD A;  1N65 A;  1ZFS A;  1ALV A;  2FCD A;  3O4Y A;  1OOJ A;  2TN4 A;  3MSE B;  1QLK A;  3SIA A;  1YUR A;  4YRU A;  1F70 A;  2E6W A;  2LP3 A;  4IL1 A;  1JC2 A;  1DF0 B;  3NSI A;  5K89 A;  1B4C A;  2ZKM X;  1FF1 A;  4AQJ A;  1TIZ A;  1TN4 A;  2F2P A;  2ZN9 A;  1RJV A;  1UHH A;  4R1E A;  2CT9 A;  1B1G A;  1BOD A;  4P2Y B;  4PCW A;  4F0Z B;  1GJY A;  1DTL A;  1SRA A;  2A4J A;  2CTN A;  3FWC A;  1JFK A;  5B8I B;  1J1D A;  1SK6 D;  1AJ4 A;  1BR4 B;  3PLF B;  4JQ0 D;  2KBI A;  4JWQ A;  3HCM A;  4MSP A;  2AMI A;  4XJK B;  4OCI A;  1J7R A;  1QXP A;  3LK0 A;  4GGF C;  5D69 A;  1CDN A;  2V53 A;  1WY9 A;  4YGE B;  4PE1 A;  2DOQ A;  3OB1 B;  2LP2 A;  2CNP A;  2M7L A;  4GFT A;  1OMR A;  1TRF A;  2SAS A;  1M45 A;  1MQ1 A;  2PVB A;  2WOR A;  3TS5 B;  1IWQ A;  2JOJ A;  4ORC B;  3I5F C;  3E3R A;  1PVB A;  2OTG B;  4CFR A;  4DIR A;  2JXL A;  2WOS A;  2Y1M A;  2K8M B;  1B8R A;  2LVK A;  3PN7 B;  5ER4 X;  4CFQ A;  3JTD B;  2LVJ A;  3PM8 A;  1CB1 A;  1JF2 A;  1Q80 A;  4YI9 A;  3EVV A;  1L2O B;  5I2L A;  1PRW A;  1SPY A;  3AKB A;  1V1F A;  1XFX O;  3AAJ A;  5HKW A;  1UUS A;  1NX0 A;  2KNE A;  2BKI B;  1CFC A;  1J7Q A;  1FI6 A;  4QJ4 B;  1L7Z A;  1KSO A;  5PAL A;  2KSP A;  1GGW A;  4U8D A;  1PK0 D;  1TNX A;  1SY9 A;  5AAN A;  1JUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...