1RJVA

Solution structure of human alpha-parvalbumin refined with a paramagnetism-based strategy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Paramagnetism-Based Refinement Strategy for the Solution Structure of Human alpha-Parvalbumin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rjvA00
1Y1UA 1SL9A 5CSFA 4DIRA 2LLTA 1YTZC 2ZRSA 4I5JA 2E6WA 2ISDA 1GJYA 4A4CA 1E8AA 1S1EA 1XFZO 4C0LA 3GK2A 3D0YA 4GPLB 2EGDA 1B9AA 3DVEA 3EVRA 1A03A 4Q04A 1FF1A 4USLA 2NCOA 4GFTA 2LVJA 2LE9B 2NLNA 1FW4A 3I5GB 3CR4X 1A75B 4D1EA 1BU3A 1SBJA 2JT8A 1MUXA 3PATA 2K2FA 2PALA 2JNFA 1UHHA 2R2IA 1C7VA 1K9PA 3EK4A 1LKJA 1D1OA 1C7WA 1AJ4A 3IF7A 3OB1B 3K21A 2FCEA 2LLSA 3BUWB 1ZUZA 3PALA 4N1GA 4CIDA 1UURA 2QPTA 1SPYA 2CNPA 2WORA 3IQQA 1AVSA 4NDCA 1VRKA 4HRGA 4WQ3A 1KK8B 2Q4UA 1A4PA 2VRGA 2F33A 5FYXA 1JBAA 1DJGA 4GGFC 3BUMB 3I5HB 3BYAA 2KAXA 4HRHA 2LUXA 4OCIA 3KF9A 2KSPA 1KFXS 1TNQA 5HKYA 2BKIB 1J55A 2ZNEA 3WXAA 1ZMZA 1FI5A 3NSLA 1B7TY 1CM4A 2KI6D 5KSZA 2BBMA 1F71A 4IL1A 2BL0C 2KOTA 3SG6A 4GAOA 1NX3A 1OMDA 3DD4A 1RTP1 3OHMB 2JPTA 1QVIZ 5DKRA 3PLFB 2LMTA 2F3ZA 4GUKA 3TUYC 2FOTA 1MR8A 4AQJA 2K61A 5AXIA 2M1UA 3D0YB 3H4SE 1EG4A 1MWNA 2KI4B 2LVKA 3I5FC 1BODA 1DMOA 3SG5A 3SG2A 1IJ5A 2KAVA 3CWGA 2MLEC 3LK0A 2JTTA 1WDCB 4JQ0D 5AEQA 4QJ4B 5G08A 1OE9B 1S26D 1XVJA 3PFVA 1CB1A 3EK8A 1DT7B 4BY4A 4OR9B 3RM1A 1DVIA 2CBLA 4AOMA 2H2KA 2LAPA 1XFVO 3PN7C 4MEWA 1K90D 1UUSA 2JRFA 2KBMA 5BPJA 1Y1XA 2V53A 5IBWA 1MXLC 2MRDA 1QX7A 2M7LA 1NUBA 1ZFSA 1R6PA 1PULA 2HQWA 1CMGA 3AKAA 4MZKA 3TDZA 1A75A 4U8DA 1NYAA 4CLNA 2MAZA 2JZIA 1CDMA 3JVTC 1AHRA 1Q80A 3C1VA 1JFKA 4PDZA 2MA2A 2I7AA 3KO0A 1S36A 2BE6A 2TN4A 1L2OC 1Y6WA 1SKTA 2HF5A 1PSRA 1RWYA 1W7JB 3D10A 1B47A 2LNKA 4JWQA 4WQ2A 5K89A 1XFYO 2KQ6A 1KWOC 4NDBA 5F6TA 1B8CA 1OMVA 5TNCA 1S5GZ 4M2QA 1MHOA 1F4OA 1UP5A 4YI8A 1YX8A 2JXLA 3VRPA 2H61C 1BOCA 3O4YA 2KNEA 4HREE 2LP3A 3EVVA 2OS8C 1JC2A 1F8HA 2M49B 1QLKA 2EC6C 2LM5A 1J7QA 2LMVA 2L98A 4ETOA 2BE4A 3SG3A 2K7DA 1GGZA 1UHJA 3E3RA 1MXEA 1QLSA 1IQ3A 2BL0B 1V1GA 1QV1A 2KAYA 1SR6C 1KSMA 1WRLA 2HQ8A 3O2PA 4YGCB 3LLEA 2KDHA 5PALA 2KBIA 1FBVA 1M31A 2LC5A 3TUYB 1YUTA 1QIVA 2JWWA 3I5FB 2FCDA 3GOFA 4DCKA 2DOQA 2WC8A 3CLNA 5I2OA 1SL8A 3NSIA 1M63B 2F8PA 2K0JA 1S6IA 1M39A 3QRXA 4HSZA 4YGDB 3CTNA 3VRNA 5I2LA 4MVFA 1RROA 3O78A 5DKNA 1X02A 1KQMC 1NP8A 1CLMA 1XFXO 3DVJA 1RECA 1RJVA 3PN7B 3O6BA 1QS7A 1XO5A 2IS9A 3TZ1A 1QTXA 2A4JA 1IQ5A 1PRWA 1CM1A 3F45A 1ALVA 4MZLA 3NSOA 3LL8B 1LA3A 4M2PA 2I18A 4ORCB 1WRZA 2KGBC 1A29A 1KK7Z 1CFDA 1PSBA 2WNDA 3JVTB 3TDIA 1TNWA 2B1UA 2BECA 3BQ3A 3ZNIA 2L50A 4XJKB 1L2OB 3PSRA 2JXCA 3NSKA 2JU0A 2O60A 1B8LA 1NCXA 2QACA 1OOJA 4I5KA 3EKHA 1KWOB 4PCWA 2LP2A 3EKJA 1CTRA 4ORBB 3KPXA 1DJIA 2KI6C 3FWBA 3PM8A 1CLLA 4P2YB 1B8RA 1WY9A 3WHUB 1DF0B 2KYCA 4PE4A 1LINA 2JT3A 4GGFA 1F55A 3MSEB 1M46A 1W7IB 2NZ0A 1MF8B 1CDNA 2NXQA 1DGVA 2M0RA 4FTGA 2OS8B 2JOJA 2KFFA 1SW8A 1XA5A 2ZRTA 2EC6B 1C07A 1U5IB 4QJ3B 1IRJA 5B8IB 1F70A 1XK4C 2HPSA 2L0PA 1IH0A 2D8NA 4MN0A 1Y1AA 5CPVA 2M3WA 1BF5A 2CCMA 1IG5A 1NCYA 1PVBA 3ICBA 4GGNA 1SCMC 4N5XA 5DKQA 3OX5A 4PHMA 1J1DA 2M9GA 3CR2A 1JSAA 1XYDA 5AFPA 1OZOA 1QJTA 2L2EA 3FS7A 2JTZA 1SYMA 3ZWHA 1DJYA 4E68A 2LVIA 1K93D 3TDUA 3IQOA 3DVKA 3OP0A 5KU1A 2MLFC 1R2UA 5HKWA 1LA0A 1KQMB 3A8RA 2NCPA 3FIAA 3AKBA 2L5XB 1KK7Y 1YUSA 2BCAA 3AAKA 1TCOB 1CFFA 1YX7A 1FI6A 1F4QA 2GV5A 1S6CA 4DRWA 1BJFA 4GBAA 1J7PA 3KEVA 4C0JA 1IGVA 3EK7A 5JJGA 1QATA 3SIBA 4XJKA 2MJWB 4YI9A 4CFQA 5AERA 1S6JA 1M45A 3OB2B 4MRYA 3DF0B 2AAOA 4BY5A 3AAJA 1K8UA 1JF2A 1EH2A 1NCZA 1QX5B 3FWCA 1QVIY 1V1FA 4L9MA 1EJ3A 4OV2A 4MBEA 1UHKA 3VGOA 2GGZA 1S3PA 5KTYA 2PSRA 1YVHA 1CDPA 3CGAA 2LMUA 2BCXA 1DF0A 1TTXA 5GQQC 4DS7A 1AJ5A 5AANA 1DTLA 3LCPC 1OMRA 1QV0A 2SCPA 1NX1A 4I5LB 1GGWA 2H61A 3NXAA 1A2XA 1BR1B 1YR5A 1NPQA 2OPOA 3GK4X 2Y1NA 2SASA 3OX6A 2K7BA 5I8NA 3SG4A 1U5IA 1ZACA 1WLZA 2Y4QA 3HCMA 2PVBA 4GNKB 4QJ5B 1FPWA 1KFUL 1OQPA 1DJHA 4YGEB 1BMOA 1NIWA 3BXKA 1J7OA 3WNXB 4ORAB 2KQYA 1K95A 2ZN8A 1QASA 1SCMB 2LHIA 1YVLA 3I5IC 2LUCA 1K96A 3SG7A 1QX2A 2BCBA 1PK0D 2JNXA 1ZOTB 2LHLA 2P6BB 3BUXB 2K7OA 1H4BA 1G8IA 2M29A 1CMFA 3RLZA 1B4CA 4P5OE 2PRUA 1UHNA 1EL4A 2PMYA 4YBHB 5D7FA 2MBXA 3VROA 1K2HA 2ZFDA 3JTDC 4JPZB 4MRXA 2LANA 2G2BA 1WLMA 2K2AA 4YGAA 3CR5X 4MSPA 1CLBA 5D69A 1RFJA 1RK9A 1WRKA 4PHNA 1AK8A 1YRUB 3TS5C 3DVMA 1F54A 1NSHA 1IJ6A 1S5GY 2ZNDA 3CZTX 3HX4A 2WCEA 2FJUB 2WCBA 5HLOA 2GGMA 4M2OA 1YUUA 4OVNF 4A4BA 1G4YR 1H8BA 1B1GA 1UHIA 1MQ1A 1NWDA 2KFHA 2Y5IA 2PASA 3BOWA 2OTGC 3LK1A 1BT6A 4CPVA 1TRFA 2L4IA 2O5GA 1SRAA 1NX0A 1XFWO 3SIAA 4C0KA 5CSIA 1J1EA 2KYFA 5ER4X 1PVAA 4F0ZB 1N2DA 4PE7A 4ZCVA 1SMGA 3VRRA 3DF0A 1BG1A 4AQIA 2F3YA 1CFCA 1ODBA 3M0WA 2K8MB 1K94A 2CT9A 1HT9A 4DUQA 2K7CA 1TCFA 2HETA 1BR4B 2L4HA 4ICBA 1SY9A 1L7ZA 1TNXA 1SR6B 2AMIA 2F2OA 1AUIB 1K9KA 2I2RE 5J3XA 1EG3A 2BKHB 2LVVA 3BUNB 1CNPA 2MHHA 1DJXA 4OKHA 2WCFA 1SCVA 1EXRA 4PE0A 1XK4A 2LLUA 4TNCA 3WHTB 1DJZA 1N65A 1ALWA 3KHEA 1CDLA 3I5GC 1TN4A 4UPGA 1DGUA 4PHKA 1BLQA 1JWDA 1KFXL 4FQOA 4NQGA 1K9UA 1NX2A 2JT0A 2I94A 3I5IB 4XYNA 1KCYA 4MZJA 2AUCA 2M97A 2ZN9A 2JULA 1N0YA 2WOSA 1G33A 2F2PA 4N1FA 2M8UA 1PALA 1XFUO 3BOWB 4PALA 4NDDA 1SNLA 3JTDB 2EHBA 1UWOA 1KK8C 2COLB 1IKUA 1LXFC 2ZKMX 2KHNA 3EVUA 2E30A 4CFRA 2KGRA 2L51A 1QIWA 3BUOB 1AP4A 1KSOA 1JF0A 1J7RA 1KFUS 1YURA 2M7NA 5HYDA 3I5HC 2Q91A 2JC2A 3VRQA 3TS5B 2RGIA 1TIZA 4MLWA 1Y0VH 1YRTB 1CKKA 2JQ6A 5CSJA 1CFPA 1IWQA 4PHJA 2KFGA 5HLVA 4PE1A 2Y1MA 1QXPA 2M1KB 1SK6D 2OTGB 4R1EA 3A4UB 4WRIA 5ER5A 4YRUA 5CSNA 4YGBB 2G9BA 2CTNA 2CXJA 1B7TZ 2LCPA 4ZCUA 5JOLA 3SJSA 1DJWA 1TNPA 2LV7A 2KI4C 1GQMA 1JFJA 2BBNA 3GK1A 1WDCC 1OSAA 1HQVA 5HKZA 4I5NB 1KQVA 1SL7A 1JUOA 1OZSA 3CS1A 5I2QA 1LVCD 1TOPA
chains in the Genus database with same CATH superfamily
1Y1UA 1SL9A 5CSFA 4DIRA 2LLTA 1YTZC 2ZRSA 4I5JA 2E6WA 2ISDA 1GJYA 4A4CA 1E8AA 1S1EA 1XFZO 4C0LA 3GK2A 3D0YA 4GPLB 2EGDA 3CZ1A 1B9AA 3DVEA 3EVRA 3R1PA 4Q04A 1A03A 1FF1A 4USLA 2NCOA 4GFTA 2LVJA 2LE9B 3SS3A 2NLNA 1FW4A 3I5GB 3CR4X 1A75B 4D1EA 1BU3A 1SBJA 2JT8A 1MUXA 3PATA 2K2FA 2PALA 2JNFA 1OOIX 1UHHA 3B7AA 2R2IA 1C7VA 1K9PA 1C3ZA 3EK4A 1LKJA 1D1OA 1C7WA 1AJ4A 3IF7A 3OB1B 3K21A 2FCEA 2LLSA 3BUWB 1ZUZA 3PALA 4N1GA 4CIDA 1UURA 2QPTA 1SPYA 2CNPA 2WORA 1TUZA 3DZTA 3IQQA 1DC1A 1AVSA 4NDCA 1VRKA 4HRGA 4WQ3A 1KK8B 2Q4UA 1A4PA 2VRGA 2F33A 5FYXA 1JBAA 1DJGA 3S0AA 4GGFC 3BUMB 3PM2A 3I5HB 3BYAA 2KAXA 4HRHA 2LUXA 4OCIA 3KF9A 2KSPA 1KFXS 1DEKA 1TNQA 5HKYA 2BKIB 1J55A 2ZNEA 3WXAA 1ZMZA 3S0FA 3NSLA 1FI5A 1B7TY 4INWA 3B6XA 1CM4A 2KI6D 5KSZA 2BBMA 1F71A 4IL1A 2BL0C 2KOTA 3SG6A 4GAOA 1NX3A 1OMDA 2QEVA 1RTP1 3D74A 3DD4A 2JPTA 1QVIZ 3OHMB 3PLFB 5DKRA 2LMTA 2F3ZA 4GUKA 3TUYC 2FOTA 3O4XA 1MR8A 4AQJA 2K61A 2WCLA 5AXIA 2M1UA 3D0YB 3H4SE 1EG4A 1MWNA 2KI4B 2LVKA 3I5FC 3NHTA 3SS5A 1BODA 3SG5A 3SG2A 1DMOA 1IJ5A 2KAVA 3CWGA 2MLEC 3LK0A 2JTTA 1WDCB 4JQ0D 3D77A 5AEQA 4QJ4B 3FE6A 5G08A 1XFRA 1OE9B 1S26D 3UNWA 1XVJA 3DY9A 3PFVA 1CB1A 3EK8A 1W9ZA 1DT7B 4BY4A 4OR9B 2ERBA 3B86A 3RM1A 1LS8A 1DVIA 3R72A 2CBLA 4AOMA 2H2KA 2LAPA 1XFVO 3D76A 4JKTA 3PN7C 4MEWA 1K90D 1UUSA 2JRFA 2KBMA 4PT1A 5BPJA 1Y1XA 2V53A 5IBWA 1MXLC 2MRDA 1QX7A 3FE9A 1NUBA 2M7LA 1ZFSA 1R6PA 1PULA 2HQWA 1CMGA 3AKAA 4MZKA 3TDZA 1A75A 4U8DA 1NYAA 4CLNA 2MAZA 2JZIA 1CDMA 2WCKA 3JVTC 3VB1A 1AHRA 1Q80A 3C1VA 2QDIA 1JFKA 4PDZA 2MA2A 2I7AA 3KO0A 4KYNA 1S36A 2BE6A 2TN4A 1L2OC 5FI7A 1Y6WA 1SKTA 2HF5A 1C3YA 1PSRA 1RWYA 1W7JB 3D10A 1B47A 2LNKA 3K1EA 4JWQA 4WQ2A 1XFYO 5K89A 2KQ6A 1KWOC 3RZSA 4NDBA 5F6TA 2KLEA 1B8CA 1OMVA 5TNCA 1S5GZ 4M2QA 1MHOA 1F4OA 1UP5A 4YI8A 3S0EA 1YX8A 2JXLA 3VRPA 2H61C 1BOCA 3DXLA 3O4YA 2KNEA 4HREE 2GTEA 2LP3A 3EVVA 2OS8C 1JC2A 1F8HA 2M49B 1QLKA 3B87A 2EC6C 2LM5A 1J7QA 2LMVA 2L98A 4ETOA 2BE4A 3SG3A 2K7DA 1GGZA 1UHJA 3E3RA 1MXEA 1QLSA 1IQ3A 2BL0B 1V1GA 1QV1A 2KAYA 1SR6C 1KSMA 1WRLA 2HQ8A 3O2PA 4YGCB 3LLEA 2KDHA 5PALA 2KBIA 1FBVA 1M31A 2LC5A 3TUYB 1YUTA 1QIVA 2JWWA 3BFHA 3I5FB 2FCDA 3GOFA 4DCKA 2DOQA 2WC8A 3CLNA 5I2OA 1SL8A 3NSIA 1M63B 4FQTA 2F8PA 3N7HA 2K0JA 2WCHA 1S6IA 1M39A 3QRXA 4HSZA 4YGDB 3CTNA 3VRNA 5I2LA 4MVFA 1RROA 2L2CA 3O78A 5DKNA 1X02A 1KQMC 1NP8A 1CLMA 1XFXO 3DVJA 1RECA 1RJVA 3PN7B 3O6BA 3D78A 2KLDA 1QS7A 1XO5A 2IS9A 3TZ1A 1QTXA 2A4JA 1IQ5A 1PRWA 1CM1A 3F45A 1ALVA 4MZLA 3NSOA 3LL8B 1LA3A 4M2PA 2I18A 4ORCB 3S0BA 1WRZA 2KGBC 1A29A 1KK7Z 1CFDA 1PSBA 2WNDA 3JVTB 3TDIA 4INXA 1TNWA 2B1UA 2BECA 3BQ3A 3ZNIA 2L50A 4XJKB 1L2OB 1Z4HA 3PSRA 2JXCA 3NSKA 2JU0A 2O60A 1B8LA 1NCXA 2QACA 1OOJA 4I5KA 3EKHA 1KWOB 2BAPA 4PCWA 2LP2A 3EKJA 1CTRA 4ORBB 3KPXA 1DJIA 2KI6C 3FWBA 3PJIA 3PM8A 1CLLA 4P2YB 1B8RA 1WY9A 3WHUB 1DF0B 2KYCA 4PE4A 2P71A 1OW4A 3L47A 1LINA 2JT3A 4GGFA 1F55A 1TUJA 3MSEB 1M46A 1W7IB 2NZ0A 1MF8B 1CDNA 2NXQA 1DGVA 2M0RA 4FTGA 2OS8B 2JOJA 2KFFA 1SW8A 1XA5A 2ZRTA 2EC6B 1C07A 1U5IB 4QJ3B 1IRJA 5B8IB 1F70A 1XK4C 2K60A 2HPSA 2L0PA 1IH0A 2D8NA 4MN0A 2WCMA 1Y1AA 3EG5B 2M3WA 5CPVA 1BF5A 2CCMA 1IG5A 1NCYA 1PVBA 3ICBA 4GGNA 1SCMC 4N5XA 5DKQA 3OX5A 4PHMA 1J1DA 2M9GA 3CR2A 3SS4A 1JSAA 1XYDA 5AFPA 1OZOA 1QJTA 2L2EA 3FS7A 2JTZA 1SYMA 3ZWHA 1DJYA 4E68A 3V2LA 2LVIA 1K93D 3TDUA 3IQOA 3DVKA 3OP0A 5EL2A 5KU1A 2MLFC 1R2UA 5HKWA 1OOGA 1LA0A 1KQMB 3A8RA 2NCPA 3FIAA 3AKBA 2L5XB 5FI2A 1KK7Y 1YUSA 2BCAA 3AAKA 1TCOB 1CFFA 1IIOA 1YX7A 1FI6A 1F4QA 1TWOA 2GV5A 3OBVA 1S6CA 3QMEA 4DRWA 1BJFA 1OOHA 4GBAA 1J7PA 3KEVA 4C0JA 1IGVA 3EK7A 5JJGA 1QATA 3SIBA 4XJKA 2MJWB 4YI9A 4CFQA 5AERA 1S6JA 3D73A 1M45A 3OB2B 4MRYA 3DF0B 2AAOA 1T14A 4BY5A 3AAJA 1K8UA 1JF2A 1EH2A 1NCZA 1QX5B 3FWCA 1QVIY 2WC6A 1V1FA 2H8VA 1EJ3A 4L9MA 4OV2A 4MBEA 1UHKA 3VGOA 2GGZA 1S3PA 5KTYA 2PSRA 1YVHA 1CDPA 3CYZA 3CGAA 2LMUA 3B88A 1Z2CB 2BCXA 1DF0A 1TTXA 5GQQC 4DS7A 3L4AA 1AJ5A 5AANA 1DTLA 2YGUA 3LCPC 3L4LA 1OMRA 1QV0A 2SCPA 1NX1A 4I5LB 1GGWA 2H61A 3NXAA 1A2XA 1BR1B 1YR5A 1NPQA 2OPOA 3GK4X 5DICA 2Y1NA 2SASA 3OX6A 2K7BA 1DQEA 5I8NA 3SG4A 1U5IA 1ZACA 1WLZA 2Y4QA 3HCMA 3NGVA 2PVBA 4GNKB 4QJ5B 1FPWA 1KFUL 1OQPA 1DJHA 4YGEB 1BMOA 1NIWA 3BXKA 1J7OA 3WNXB 4ORAB 2KQYA 1K95A 2ZN8A 1QASA 1SCMB 2LHIA 1YVLA 3I5IC 2LUCA 2QEHA 1K96A 3SG7A 1QX2A 3D75A 2BCBA 1PK0D 2JNXA 1ZOTB 2LHLA 2P6BB 3BUXB 2K7OA 1H4BA 1G8IA 2M29A 4JD9A 1CMFA 3RLZA 1B4CA 4P5OE 2PRUA 1UHNA 1EL4A 2PMYA 4YBHB 5D7FA 2MBXA 3VROA 4F7FA 1K2HA 2ZFDA 3JTDC 4JPZB 4MRXA 2LANA 3S0DA 2G2BA 1WLMA 2K2AA 4YGAA 3CR5X 4MSPA 1CLBA 5D69A 4OZDA 1RFJA 1RK9A 1WRKA 4PHNA 2WC5A 1AK8A 1YRUB 2JPOA 3TS5C 3DVMA 1F54A 1NSHA 1IJ6A 1S5GY 2ZNDA 3R1VA 3CZTX 3HX4A 2WCEA 2FJUB 2WCBA 5HLOA 2GGMA 4M2OA 1YUUA 4OVNF 4A4BA 1G4YR 1H8BA 5I94A 1B1GA 1UHIA 1MQ1A 1NWDA 2KFHA 2Y5IA 2PASA 3BOWA 2OTGC 3CABA 3CZ2A 3LK1A 1BT6A 3S0GA 1QWVA 4CPVA 1TRFA 1ORGA 2L4IA 1SRAA 1NX0A 1XFWO 2O5GA 3SIAA 4C0KA 3NHIA 5CSIA 1J1EA 2KYFA 5ER4X 1PVAA 4F0ZB 1N2DA 3CZ0A 4PE7A 1SMGA 4ZCVA 3DF0A 3VRRA 1BG1A 4AQIA 2F3YA 1CFCA 1ODBA 3M0WA 2K8MB 2FJYA 1K94A 2CT9A 2QEBA 1HT9A 4DUQA 2K7CA 1TCFA 1P28A 2HETA 1BR4B 2L4HA 4ICBA 1SY9A 1L7ZA 1TNXA 1SR6B 2AMIA 2F2OA 1OOFA 1AUIB 1K9KA 2I2RE 3OGNA 1EG3A 5J3XA 2BKHB 2LVVA 3BUNB 1CNPA 2MHHA 4IJ7A 1DJXA 2KPHA 4OKHA 2WCFA 1DELA 1SCVA 1EXRA 4PE0A 1XK4A 2LLUA 4TNCA 3WHTB 1DJZA 1N65A 1ALWA 3KHEA 1CDLA 3I5GC 1TN4A 2WCJA 4UPGA 1DGUA 4PHKA 1BLQA 1GM0A 1JWDA 1KFXL 4FQOA 3FE8A 3DYEA 4NQGA 1K9UA 1NX2A 2JT0A 2I94A 3I5IB 4XYNA 1KCYA 4MZJA 2AUCA 2M97A 2ZN9A 2PQLA 2JULA 1N0YA 2WOSA 1G33A 3Q8IA 2BNXA 2F2PA 4N1FA 3UO9A 2M8UA 1PALA 1XFUO 3BOWB 4PALA 4NDDA 1SNLA 3JTDB 2EHBA 1UWOA 1KK8C 2COLB 1IKUA 1LXFC 2ZKMX 2KHNA 3EVUA 2E30A 4CFRA 2KGRA 2L51A 1QIWA 3BUOB 3BFBA 1AP4A 1KSOA 1JF0A 1J7RA 1KFUS 1YURA 2M7NA 5HYDA 3I5HC 2Q91A 2JC2A 3VRQA 2PYQA 3TS5B 2RGIA 1TIZA 4MLWA 1Y0VH 1YRTB 1CKKA 2L5YA 2JQ6A 5CSJA 1CFPA 1IWQA 4PHJA 2KFGA 5HLVA 4PE1A 2Y1MA 5D3OA 1QXPA 2M1KB 1SK6D 2QEOA 2OTGB 4R1EA 5FI6A 3A4UB 4WRIA 5ER5A 4YRUA 5CSNA 4YGBB 2G9BA 2CTNA 2CXJA 3CDNA 1B7TZ 2LCPA 4ZCUA 5JOLA 3SJSA 1DJWA 1TNPA 2LV7A 2KI4C 1GQMA 1JFJA 2BBNA 3IVTA 3GK1A 1WDCC 1OSAA 1HQVA 5HKZA 4I5NB 1KQVA 1SSEB 1SL7A 1JUOA 5HL1A 1OZSA 3BJHA 3CS1A 3BFAA 3R1OA 1LVCD 5I2QA 1TOPA 2P70A
chains in the Genus database with same CATH topology
1Y1UA 1SL9A 5CSFA 4DIRA 2LLTA 1YTZC 2ZRSA 4I5JA 2E6WA 2ISDA 1GJYA 4A4CA 1E8AA 1S1EA 1XFZO 4C0LA 3GK2A 3D0YA 4GPLB 2EGDA 1B9AA 3DVEA 3EVRA 1A03A 4Q04A 1FF1A 4USLA 2NCOA 4GFTA 2LVJA 2LE9B 2NLNA 1FW4A 3I5GB 3CR4X 1A75B 4D1EA 1BU3A 1SBJA 2JT8A 1MUXA 3PATA 2K2FA 2PALA 2JNFA 1UHHA 2R2IA 1C7VA 1K9PA 3EK4A 1LKJA 1D1OA 1C7WA 1AJ4A 3IF7A 3OB1B 3K21A 2FCEA 2LLSA 3BUWB 1ZUZA 3PALA 4N1GA 4CIDA 1UURA 2QPTA 1SPYA 2CNPA 2WORA 3IQQA 1AVSA 4NDCA 1VRKA 4HRGA 4WQ3A 1KK8B 2Q4UA 1A4PA 2VRGA 2F33A 5FYXA 1JBAA 1DJGA 4GGFC 3BUMB 3I5HB 3BYAA 2KAXA 4HRHA 2LUXA 4OCIA 3KF9A 2KSPA 1KFXS 1TNQA 5HKYA 2BKIB 1J55A 2ZNEA 3WXAA 1ZMZA 1FI5A 3NSLA 1B7TY 1CM4A 2KI6D 5KSZA 2BBMA 1F71A 4IL1A 2BL0C 2KOTA 3SG6A 4GAOA 1NX3A 1OMDA 3DD4A 1RTP1 3OHMB 2JPTA 1QVIZ 5DKRA 3PLFB 2LMTA 2F3ZA 4GUKA 3TUYC 2FOTA 1MR8A 4AQJA 2K61A 5AXIA 2M1UA 3D0YB 3H4SE 1EG4A 1MWNA 2KI4B 2LVKA 3I5FC 1BODA 1DMOA 3SG5A 3SG2A 1IJ5A 2KAVA 3CWGA 2MLEC 3LK0A 2JTTA 1WDCB 4JQ0D 5AEQA 4QJ4B 5G08A 1OE9B 1S26D 1XVJA 3PFVA 1CB1A 3EK8A 1DT7B 4BY4A 4OR9B 3RM1A 1DVIA 2CBLA 4AOMA 2H2KA 2LAPA 1XFVO 3PN7C 4MEWA 1K90D 1UUSA 2JRFA 2KBMA 5BPJA 1Y1XA 2V53A 5IBWA 1MXLC 2MRDA 1QX7A 2M7LA 1NUBA 1ZFSA 1R6PA 1PULA 2HQWA 1CMGA 3AKAA 4MZKA 3TDZA 1A75A 4U8DA 1NYAA 4CLNA 2MAZA 2JZIA 1CDMA 3JVTC 1AHRA 1Q80A 3C1VA 1JFKA 4PDZA 2MA2A 2I7AA 3KO0A 1S36A 2BE6A 2TN4A 1L2OC 1Y6WA 1SKTA 2HF5A 1PSRA 1RWYA 1W7JB 3D10A 1B47A 2LNKA 4JWQA 4WQ2A 5K89A 1XFYO 2KQ6A 1KWOC 4NDBA 5F6TA 1B8CA 1OMVA 5TNCA 1S5GZ 4M2QA 1MHOA 1F4OA 1UP5A 4YI8A 1YX8A 2JXLA 3VRPA 2H61C 1BOCA 3O4YA 2KNEA 4HREE 2LP3A 3EVVA 2OS8C 1JC2A 1F8HA 2M49B 1QLKA 2EC6C 2LM5A 1J7QA 2LMVA 2L98A 4ETOA 2BE4A 3SG3A 2K7DA 1GGZA 1UHJA 3E3RA 1MXEA 1QLSA 1IQ3A 2BL0B 1V1GA 1QV1A 2KAYA 1SR6C 1KSMA 1WRLA 2HQ8A 3O2PA 4YGCB 3LLEA 2KDHA 5PALA 2KBIA 1FBVA 1M31A 2LC5A 3TUYB 1YUTA 1QIVA 2JWWA 3I5FB 2FCDA 3GOFA 4DCKA 2DOQA 2WC8A 3CLNA 5I2OA 1SL8A 3NSIA 1M63B 2F8PA 2K0JA 1S6IA 1M39A 3QRXA 4HSZA 4YGDB 3CTNA 3VRNA 5I2LA 4MVFA 1RROA 3O78A 5DKNA 1X02A 1KQMC 1NP8A 1CLMA 1XFXO 3DVJA 1RECA 1RJVA 3PN7B 3O6BA 1QS7A 1XO5A 2IS9A 3TZ1A 1QTXA 2A4JA 1IQ5A 1PRWA 1CM1A 3F45A 1ALVA 4MZLA 3NSOA 3LL8B 1LA3A 4M2PA 2I18A 4ORCB 1WRZA 2KGBC 1A29A 1KK7Z 1CFDA 1PSBA 2WNDA 3JVTB 3TDIA 1TNWA 2B1UA 2BECA 3BQ3A 3ZNIA 2L50A 4XJKB 1L2OB 3PSRA 2JXCA 3NSKA 2JU0A 2O60A 1B8LA 1NCXA 2QACA 1OOJA 4I5KA 3EKHA 1KWOB 4PCWA 2LP2A 3EKJA 1CTRA 4ORBB 3KPXA 1DJIA 2KI6C 3FWBA 3PM8A 1CLLA 4P2YB 1B8RA 1WY9A 3WHUB 1DF0B 2KYCA 4PE4A 1LINA 2JT3A 4GGFA 1F55A 3MSEB 1M46A 1W7IB 2NZ0A 1MF8B 1CDNA 2NXQA 1DGVA 2M0RA 4FTGA 2OS8B 2JOJA 2KFFA 1SW8A 1XA5A 2ZRTA 2EC6B 1C07A 1U5IB 4QJ3B 1IRJA 5B8IB 1F70A 1XK4C 2HPSA 2L0PA 1IH0A 2D8NA 4MN0A 1Y1AA 5CPVA 2M3WA 1BF5A 2CCMA 1IG5A 1NCYA 1PVBA 3ICBA 4GGNA 1SCMC 4N5XA 5DKQA 3OX5A 4PHMA 1J1DA 2M9GA 3CR2A 1JSAA 1XYDA 5AFPA 1OZOA 1QJTA 2L2EA 3FS7A 2JTZA 1SYMA 3ZWHA 1DJYA 4E68A 2LVIA 1K93D 3TDUA 3IQOA 3DVKA 3OP0A 5KU1A 2MLFC 1R2UA 5HKWA 1LA0A 1KQMB 3A8RA 2NCPA 3FIAA 3AKBA 2L5XB 1KK7Y 1YUSA 2BCAA 3AAKA 1TCOB 1CFFA 1YX7A 1FI6A 1F4QA 2GV5A 1S6CA 4DRWA 1BJFA 4GBAA 1J7PA 3KEVA 4C0JA 1IGVA 3EK7A 5JJGA 1QATA 3SIBA 4XJKA 2MJWB 4YI9A 4CFQA 5AERA 1S6JA 1M45A 3OB2B 4MRYA 3DF0B 2AAOA 4BY5A 3AAJA 1K8UA 1JF2A 1EH2A 1NCZA 1QX5B 3FWCA 1QVIY 1V1FA 4L9MA 1EJ3A 4OV2A 4MBEA 1UHKA 3VGOA 2GGZA 1S3PA 5KTYA 2PSRA 1YVHA 1CDPA 3CGAA 2LMUA 2BCXA 1DF0A 1TTXA 5GQQC 4DS7A 1AJ5A 5AANA 1DTLA 3LCPC 1OMRA 1QV0A 2SCPA 1NX1A 4I5LB 1GGWA 2H61A 3NXAA 1A2XA 1BR1B 1YR5A 1NPQA 2OPOA 3GK4X 2Y1NA 2SASA 3OX6A 2K7BA 5I8NA 3SG4A 1U5IA 1ZACA 1WLZA 2Y4QA 3HCMA 2PVBA 4GNKB 4QJ5B 1FPWA 1KFUL 1OQPA 1DJHA 4YGEB 1BMOA 1NIWA 3BXKA 1J7OA 3WNXB 4ORAB 2KQYA 1K95A 2ZN8A 1QASA 1SCMB 2LHIA 1YVLA 3I5IC 2LUCA 1K96A 3SG7A 1QX2A 2BCBA 1PK0D 2JNXA 1ZOTB 2LHLA 2P6BB 3BUXB 2K7OA 1H4BA 1G8IA 2M29A 1CMFA 3RLZA 1B4CA 4P5OE 2PRUA 1UHNA 1EL4A 2PMYA 4YBHB 5D7FA 2MBXA 3VROA 1K2HA 2ZFDA 3JTDC 4JPZB 4MRXA 2LANA 2G2BA 1WLMA 2K2AA 4YGAA 3CR5X 4MSPA 1CLBA 5D69A 1RFJA 1RK9A 1WRKA 4PHNA 1AK8A 1YRUB 3TS5C 3DVMA 1F54A 1NSHA 1IJ6A 1S5GY 2ZNDA 3CZTX 3HX4A 2WCEA 2FJUB 2WCBA 5HLOA 2GGMA 4M2OA 1YUUA 4OVNF 4A4BA 1G4YR 1H8BA 1B1GA 1UHIA 1MQ1A 1NWDA 2KFHA 2Y5IA 2PASA 3BOWA 2OTGC 3LK1A 1BT6A 4CPVA 1TRFA 2L4IA 2O5GA 1SRAA 1NX0A 1XFWO 3SIAA 4C0KA 5CSIA 1J1EA 2KYFA 5ER4X 1PVAA 4F0ZB 1N2DA 4PE7A 4ZCVA 1SMGA 3VRRA 3DF0A 1BG1A 4AQIA 2F3YA 1CFCA 1ODBA 3M0WA 2K8MB 1K94A 2CT9A 1HT9A 4DUQA 2K7CA 1TCFA 2HETA 1BR4B 2L4HA 4ICBA 1SY9A 1L7ZA 1TNXA 1SR6B 2AMIA 2F2OA 1AUIB 1K9KA 2I2RE 5J3XA 1EG3A 2BKHB 2LVVA 3BUNB 1CNPA 2MHHA 1DJXA 4OKHA 2WCFA 1SCVA 1EXRA 4PE0A 1XK4A 2LLUA 4TNCA 3WHTB 1DJZA 1N65A 1ALWA 3KHEA 1CDLA 3I5GC 1TN4A 4UPGA 1DGUA 4PHKA 1BLQA 1JWDA 1KFXL 4FQOA 4NQGA 1K9UA 1NX2A 2JT0A 2I94A 3I5IB 4XYNA 1KCYA 4MZJA 2AUCA 2M97A 2ZN9A 2JULA 1N0YA 2WOSA 1G33A 2F2PA 4N1FA 2M8UA 1PALA 1XFUO 3BOWB 4PALA 4NDDA 1SNLA 3JTDB 2EHBA 1UWOA 1KK8C 2COLB 1IKUA 1LXFC 2ZKMX 2KHNA 3EVUA 2E30A 4CFRA 2KGRA 2L51A 1QIWA 3BUOB 1AP4A 1KSOA 1JF0A 1J7RA 1KFUS 1YURA 2M7NA 5HYDA 3I5HC 2Q91A 2JC2A 3VRQA 3TS5B 2RGIA 1TIZA 4MLWA 1Y0VH 1YRTB 1CKKA 2JQ6A 5CSJA 1CFPA 1IWQA 4PHJA 2KFGA 5HLVA 4PE1A 2Y1MA 1QXPA 2M1KB 1SK6D 2OTGB 4R1EA 3A4UB 4WRIA 5ER5A 4YRUA 5CSNA 4YGBB 2G9BA 2CTNA 2CXJA 1B7TZ 2LCPA 4ZCUA 5JOLA 3SJSA 1DJWA 1TNPA 2LV7A 2KI4C 1GQMA 1JFJA 2BBNA 3GK1A 1WDCC 1OSAA 1HQVA 5HKZA 4I5NB 1KQVA 1SL7A 1JUOA 1OZSA 3CS1A 5I2QA 1LVCD 1TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1U A;  1SL9 A;  5CSF A;  4DIR A;  2LLT A;  1YTZ C;  2ZRS A;  4I5J A;  2E6W A;  2ISD A;  1GJY A;  4A4C A;  1E8A A;  1S1E A;  1XFZ O;  4C0L A;  3GK2 A;  3D0Y A;  4GPL B;  2EGD A;  1B9A A;  3DVE A;  3EVR A;  1A03 A;  4Q04 A;  1FF1 A;  4USL A;  2NCO A;  4GFT A;  2LVJ A;  2LE9 B;  2NLN A;  1FW4 A;  3I5G B;  3CR4 X;  1A75 B;  4D1E A;  1BU3 A;  1SBJ A;  2JT8 A;  1MUX A;  3PAT A;  2K2F A;  2PAL A;  2JNF A;  1UHH A;  2R2I A;  1C7V A;  1K9P A;  3EK4 A;  1LKJ A;  1D1O A;  1C7W A;  1AJ4 A;  3IF7 A;  3OB1 B;  3K21 A;  2FCE A;  2LLS A;  3BUW B;  1ZUZ A;  3PAL A;  4N1G A;  4CID A;  1UUR A;  2QPT A;  1SPY A;  2CNP A;  2WOR A;  3IQQ A;  1AVS A;  4NDC A;  1VRK A;  4HRG A;  4WQ3 A;  1KK8 B;  2Q4U A;  1A4P A;  2VRG A;  2F33 A;  5FYX A;  1JBA A;  1DJG A;  4GGF C;  3BUM B;  3I5H B;  3BYA A;  2KAX A;  4HRH A;  2LUX A;  4OCI A;  3KF9 A;  2KSP A;  1KFX S;  1TNQ A;  5HKY A;  2BKI B;  1J55 A;  2ZNE A;  3WXA A;  1ZMZ A;  1FI5 A;  3NSL A;  1B7T Y;  1CM4 A;  2KI6 D;  5KSZ A;  2BBM A;  1F71 A;  4IL1 A;  2BL0 C;  2KOT A;  3SG6 A;  4GAO A;  1NX3 A;  1OMD A;  3DD4 A;  1RTP 1;  3OHM B;  2JPT A;  1QVI Z;  5DKR A;  3PLF B;  2LMT A;  2F3Z A;  4GUK A;  3TUY C;  2FOT A;  1MR8 A;  4AQJ A;  2K61 A;  5AXI A;  2M1U A;  3D0Y B;  3H4S E;  1EG4 A;  1MWN A;  2KI4 B;  2LVK A;  3I5F C;  1BOD A;  1DMO A;  3SG5 A;  3SG2 A;  1IJ5 A;  2KAV A;  3CWG A;  2MLE C;  3LK0 A;  2JTT A;  1WDC B;  4JQ0 D;  5AEQ A;  4QJ4 B;  5G08 A;  1OE9 B;  1S26 D;  1XVJ A;  3PFV A;  1CB1 A;  3EK8 A;  1DT7 B;  4BY4 A;  4OR9 B;  3RM1 A;  1DVI A;  2CBL A;  4AOM A;  2H2K A;  2LAP A;  1XFV O;  3PN7 C;  4MEW A;  1K90 D;  1UUS A;  2JRF A;  2KBM A;  5BPJ A;  1Y1X A;  2V53 A;  5IBW A;  1MXL C;  2MRD A;  1QX7 A;  2M7L A;  1NUB A;  1ZFS A;  1R6P A;  1PUL A;  2HQW A;  1CMG A;  3AKA A;  4MZK A;  3TDZ A;  1A75 A;  4U8D A;  1NYA A;  4CLN A;  2MAZ A;  2JZI A;  1CDM A;  3JVT C;  1AHR A;  1Q80 A;  3C1V A;  1JFK A;  4PDZ A;  2MA2 A;  2I7A A;  3KO0 A;  1S36 A;  2BE6 A;  2TN4 A;  1L2O C;  1Y6W A;  1SKT A;  2HF5 A;  1PSR A;  1RWY A;  1W7J B;  3D10 A;  1B47 A;  2LNK A;  4JWQ A;  4WQ2 A;  5K89 A;  1XFY O;  2KQ6 A;  1KWO C;  4NDB A;  5F6T A;  1B8C A;  1OMV A;  5TNC A;  1S5G Z;  4M2Q A;  1MHO A;  1F4O A;  1UP5 A;  4YI8 A;  1YX8 A;  2JXL A;  3VRP A;  2H61 C;  1BOC A;  3O4Y A;  2KNE A;  4HRE E;  2LP3 A;  3EVV A;  2OS8 C;  1JC2 A;  1F8H A;  2M49 B;  1QLK A;  2EC6 C;  2LM5 A;  1J7Q A;  2LMV A;  2L98 A;  4ETO A;  2BE4 A;  3SG3 A;  2K7D A;  1GGZ A;  1UHJ A;  3E3R A;  1MXE A;  1QLS A;  1IQ3 A;  2BL0 B;  1V1G A;  1QV1 A;  2KAY A;  1SR6 C;  1KSM A;  1WRL A;  2HQ8 A;  3O2P A;  4YGC B;  3LLE A;  2KDH A;  5PAL A;  2KBI A;  1FBV A;  1M31 A;  2LC5 A;  3TUY B;  1YUT A;  1QIV A;  2JWW A;  3I5F B;  2FCD A;  3GOF A;  4DCK A;  2DOQ A;  2WC8 A;  3CLN A;  5I2O A;  1SL8 A;  3NSI A;  1M63 B;  2F8P A;  2K0J A;  1S6I A;  1M39 A;  3QRX A;  4HSZ A;  4YGD B;  3CTN A;  3VRN A;  5I2L A;  4MVF A;  1RRO A;  3O78 A;  5DKN A;  1X02 A;  1KQM C;  1NP8 A;  1CLM A;  1XFX O;  3DVJ A;  1REC A;  1RJV A;  3PN7 B;  3O6B A;  1QS7 A;  1XO5 A;  2IS9 A;  3TZ1 A;  1QTX A;  2A4J A;  1IQ5 A;  1PRW A;  1CM1 A;  3F45 A;  1ALV A;  4MZL A;  3NSO A;  3LL8 B;  1LA3 A;  4M2P A;  2I18 A;  4ORC B;  1WRZ A;  2KGB C;  1A29 A;  1KK7 Z;  1CFD A;  1PSB A;  2WND A;  3JVT B;  3TDI A;  1TNW A;  2B1U A;  2BEC A;  3BQ3 A;  3ZNI A;  2L50 A;  4XJK B;  1L2O B;  3PSR A;  2JXC A;  3NSK A;  2JU0 A;  2O60 A;  1B8L A;  1NCX A;  2QAC A;  1OOJ A;  4I5K A;  3EKH A;  1KWO B;  4PCW A;  2LP2 A;  3EKJ A;  1CTR A;  4ORB B;  3KPX A;  1DJI A;  2KI6 C;  3FWB A;  3PM8 A;  1CLL A;  4P2Y B;  1B8R A;  1WY9 A;  3WHU B;  1DF0 B;  2KYC A;  4PE4 A;  1LIN A;  2JT3 A;  4GGF A;  1F55 A;  3MSE B;  1M46 A;  1W7I B;  2NZ0 A;  1MF8 B;  1CDN A;  2NXQ A;  1DGV A;  2M0R A;  4FTG A;  2OS8 B;  2JOJ A;  2KFF A;  1SW8 A;  1XA5 A;  2ZRT A;  2EC6 B;  1C07 A;  1U5I B;  4QJ3 B;  1IRJ A;  5B8I B;  1F70 A;  1XK4 C;  2HPS A;  2L0P A;  1IH0 A;  2D8N A;  4MN0 A;  1Y1A A;  5CPV A;  2M3W A;  1BF5 A;  2CCM A;  1IG5 A;  1NCY A;  1PVB A;  3ICB A;  4GGN A;  1SCM C;  4N5X A;  5DKQ A;  3OX5 A;  4PHM A;  1J1D A;  2M9G A;  3CR2 A;  1JSA A;  1XYD A;  5AFP A;  1OZO A;  1QJT A;  2L2E A;  3FS7 A;  2JTZ A;  1SYM A;  3ZWH A;  1DJY A;  4E68 A;  2LVI A;  1K93 D;  3TDU A;  3IQO A;  3DVK A;  3OP0 A;  5KU1 A;  2MLF C;  1R2U A;  5HKW A;  1LA0 A;  1KQM B;  3A8R A;  2NCP A;  3FIA A;  3AKB A;  2L5X B;  1KK7 Y;  1YUS A;  2BCA A;  3AAK A;  1TCO B;  1CFF A;  1YX7 A;  1FI6 A;  1F4Q A;  2GV5 A;  1S6C A;  4DRW A;  1BJF A;  4GBA A;  1J7P A;  3KEV A;  4C0J A;  1IGV A;  3EK7 A;  5JJG A;  1QAT A;  3SIB A;  4XJK A;  2MJW B;  4YI9 A;  4CFQ A;  5AER A;  1S6J A;  1M45 A;  3OB2 B;  4MRY A;  3DF0 B;  2AAO A;  4BY5 A;  3AAJ A;  1K8U A;  1JF2 A;  1EH2 A;  1NCZ A;  1QX5 B;  3FWC A;  1QVI Y;  1V1F A;  4L9M A;  1EJ3 A;  4OV2 A;  4MBE A;  1UHK A;  3VGO A;  2GGZ A;  1S3P A;  5KTY A;  2PSR A;  1YVH A;  1CDP A;  3CGA A;  2LMU A;  2BCX A;  1DF0 A;  1TTX A;  5GQQ C;  4DS7 A;  1AJ5 A;  5AAN A;  1DTL A;  3LCP C;  1OMR A;  1QV0 A;  2SCP A;  1NX1 A;  4I5L B;  1GGW A;  2H61 A;  3NXA A;  1A2X A;  1BR1 B;  1YR5 A;  1NPQ A;  2OPO A;  3GK4 X;  2Y1N A;  2SAS A;  3OX6 A;  2K7B A;  5I8N A;  3SG4 A;  1U5I A;  1ZAC A;  1WLZ A;  2Y4Q A;  3HCM A;  2PVB A;  4GNK B;  4QJ5 B;  1FPW A;  1KFU L;  1OQP A;  1DJH A;  4YGE B;  1BMO A;  1NIW A;  3BXK A;  1J7O A;  3WNX B;  4ORA B;  2KQY A;  1K95 A;  2ZN8 A;  1QAS A;  1SCM B;  2LHI A;  1YVL A;  3I5I C;  2LUC A;  1K96 A;  3SG7 A;  1QX2 A;  2BCB A;  1PK0 D;  2JNX A;  1ZOT B;  2LHL A;  2P6B B;  3BUX B;  2K7O A;  1H4B A;  1G8I A;  2M29 A;  1CMF A;  3RLZ A;  1B4C A;  4P5O E;  2PRU A;  1UHN A;  1EL4 A;  2PMY A;  4YBH B;  5D7F A;  2MBX A;  3VRO A;  1K2H A;  2ZFD A;  3JTD C;  4JPZ B;  4MRX A;  2LAN A;  2G2B A;  1WLM A;  2K2A A;  4YGA A;  3CR5 X;  4MSP A;  1CLB A;  5D69 A;  1RFJ A;  1RK9 A;  1WRK A;  4PHN A;  1AK8 A;  1YRU B;  3TS5 C;  3DVM A;  1F54 A;  1NSH A;  1IJ6 A;  1S5G Y;  2ZND A;  3CZT X;  3HX4 A;  2WCE A;  2FJU B;  2WCB A;  5HLO A;  2GGM A;  4M2O A;  1YUU A;  4OVN F;  4A4B A;  1G4Y R;  1H8B A;  1B1G A;  1UHI A;  1MQ1 A;  1NWD A;  2KFH A;  2Y5I A;  2PAS A;  3BOW A;  2OTG C;  3LK1 A;  1BT6 A;  4CPV A;  1TRF A;  2L4I A;  2O5G A;  1SRA A;  1NX0 A;  1XFW O;  3SIA A;  4C0K A;  5CSI A;  1J1E A;  2KYF A;  5ER4 X;  1PVA A;  4F0Z B;  1N2D A;  4PE7 A;  4ZCV A;  1SMG A;  3VRR A;  3DF0 A;  1BG1 A;  4AQI A;  2F3Y A;  1CFC A;  1ODB A;  3M0W A;  2K8M B;  1K94 A;  2CT9 A;  1HT9 A;  4DUQ A;  2K7C A;  1TCF A;  2HET A;  1BR4 B;  2L4H A;  4ICB A;  1SY9 A;  1L7Z A;  1TNX A;  1SR6 B;  2AMI A;  2F2O A;  1AUI B;  1K9K A;  2I2R E;  5J3X A;  1EG3 A;  2BKH B;  2LVV A;  3BUN B;  1CNP A;  2MHH A;  1DJX A;  4OKH A;  2WCF A;  1SCV A;  1EXR A;  4PE0 A;  1XK4 A;  2LLU A;  4TNC A;  3WHT B;  1DJZ A;  1N65 A;  1ALW A;  3KHE A;  1CDL A;  3I5G C;  1TN4 A;  4UPG A;  1DGU A;  4PHK A;  1BLQ A;  1JWD A;  1KFX L;  4FQO A;  4NQG A;  1K9U A;  1NX2 A;  2JT0 A;  2I94 A;  3I5I B;  4XYN A;  1KCY A;  4MZJ A;  2AUC A;  2M97 A;  2ZN9 A;  2JUL A;  1N0Y A;  2WOS A;  1G33 A;  2F2P A;  4N1F A;  2M8U A;  1PAL A;  1XFU O;  3BOW B;  4PAL A;  4NDD A;  1SNL A;  3JTD B;  2EHB A;  1UWO A;  1KK8 C;  2COL B;  1IKU A;  1LXF C;  2ZKM X;  2KHN A;  3EVU A;  2E30 A;  4CFR A;  2KGR A;  2L51 A;  1QIW A;  3BUO B;  1AP4 A;  1KSO A;  1JF0 A;  1J7R A;  1KFU S;  1YUR A;  2M7N A;  5HYD A;  3I5H C;  2Q91 A;  2JC2 A;  3VRQ A;  3TS5 B;  2RGI A;  1TIZ A;  4MLW A;  1Y0V H;  1YRT B;  1CKK A;  2JQ6 A;  5CSJ A;  1CFP A;  1IWQ A;  4PHJ A;  2KFG A;  5HLV A;  4PE1 A;  2Y1M A;  1QXP A;  2M1K B;  1SK6 D;  2OTG B;  4R1E A;  3A4U B;  4WRI A;  5ER5 A;  4YRU A;  5CSN A;  4YGB B;  2G9B A;  2CTN A;  2CXJ A;  1B7T Z;  2LCP A;  4ZCU A;  5JOL A;  3SJS A;  1DJW A;  1TNP A;  2LV7 A;  2KI4 C;  1GQM A;  1JFJ A;  2BBN A;  3GK1 A;  1WDC C;  1OSA A;  1HQV A;  5HKZ A;  4I5N B;  1KQV A;  1SL7 A;  1JUO A;  1OZS A;  3CS1 A;  5I2Q A;  1LVC D;  1TOP A; 
#chains in the Genus database with same CATH topology
 1Y1U A;  1SL9 A;  5CSF A;  4DIR A;  2LLT A;  1YTZ C;  2ZRS A;  4I5J A;  2E6W A;  2ISD A;  1GJY A;  4A4C A;  1E8A A;  1S1E A;  1XFZ O;  4C0L A;  3GK2 A;  3D0Y A;  4GPL B;  2EGD A;  3CZ1 A;  1B9A A;  3DVE A;  3EVR A;  3R1P A;  4Q04 A;  1A03 A;  1FF1 A;  4USL A;  2NCO A;  4GFT A;  2LVJ A;  2LE9 B;  3SS3 A;  2NLN A;  1FW4 A;  3I5G B;  3CR4 X;  1A75 B;  4D1E A;  1BU3 A;  1SBJ A;  2JT8 A;  1MUX A;  3PAT A;  2K2F A;  2PAL A;  2JNF A;  1OOI X;  1UHH A;  3B7A A;  2R2I A;  1C7V A;  1K9P A;  1C3Z A;  3EK4 A;  1LKJ A;  1D1O A;  1C7W A;  1AJ4 A;  3IF7 A;  3OB1 B;  3K21 A;  2FCE A;  2LLS A;  3BUW B;  1ZUZ A;  3PAL A;  4N1G A;  4CID A;  1UUR A;  2QPT A;  1SPY A;  2CNP A;  2WOR A;  1TUZ A;  3DZT A;  3IQQ A;  1DC1 A;  1AVS A;  4NDC A;  1VRK A;  4HRG A;  4WQ3 A;  1KK8 B;  2Q4U A;  1A4P A;  2VRG A;  2F33 A;  5FYX A;  1JBA A;  1DJG A;  3S0A A;  4GGF C;  3BUM B;  3PM2 A;  3I5H B;  3BYA A;  2KAX A;  4HRH A;  2LUX A;  4OCI A;  3KF9 A;  2KSP A;  1KFX S;  1DEK A;  1TNQ A;  5HKY A;  2BKI B;  1J55 A;  2ZNE A;  3WXA A;  1ZMZ A;  3S0F A;  3NSL A;  1FI5 A;  1B7T Y;  4INW A;  3B6X A;  1CM4 A;  2KI6 D;  5KSZ A;  2BBM A;  1F71 A;  4IL1 A;  2BL0 C;  2KOT A;  3SG6 A;  4GAO A;  1NX3 A;  1OMD A;  2QEV A;  1RTP 1;  3D74 A;  3DD4 A;  2JPT A;  1QVI Z;  3OHM B;  3PLF B;  5DKR A;  2LMT A;  2F3Z A;  4GUK A;  3TUY C;  2FOT A;  3O4X A;  1MR8 A;  4AQJ A;  2K61 A;  2WCL A;  5AXI A;  2M1U A;  3D0Y B;  3H4S E;  1EG4 A;  1MWN A;  2KI4 B;  2LVK A;  3I5F C;  3NHT A;  3SS5 A;  1BOD A;  3SG5 A;  3SG2 A;  1DMO A;  1IJ5 A;  2KAV A;  3CWG A;  2MLE C;  3LK0 A;  2JTT A;  1WDC B;  4JQ0 D;  3D77 A;  5AEQ A;  4QJ4 B;  3FE6 A;  5G08 A;  1XFR A;  1OE9 B;  1S26 D;  3UNW A;  1XVJ A;  3DY9 A;  3PFV A;  1CB1 A;  3EK8 A;  1W9Z A;  1DT7 B;  4BY4 A;  4OR9 B;  2ERB A;  3B86 A;  3RM1 A;  1LS8 A;  1DVI A;  3R72 A;  2CBL A;  4AOM A;  2H2K A;  2LAP A;  1XFV O;  3D76 A;  4JKT A;  3PN7 C;  4MEW A;  1K90 D;  1UUS A;  2JRF A;  2KBM A;  4PT1 A;  5BPJ A;  1Y1X A;  2V53 A;  5IBW A;  1MXL C;  2MRD A;  1QX7 A;  3FE9 A;  1NUB A;  2M7L A;  1ZFS A;  1R6P A;  1PUL A;  2HQW A;  1CMG A;  3AKA A;  4MZK A;  3TDZ A;  1A75 A;  4U8D A;  1NYA A;  4CLN A;  2MAZ A;  2JZI A;  1CDM A;  2WCK A;  3JVT C;  3VB1 A;  1AHR A;  1Q80 A;  3C1V A;  2QDI A;  1JFK A;  4PDZ A;  2MA2 A;  2I7A A;  3KO0 A;  4KYN A;  1S36 A;  2BE6 A;  2TN4 A;  1L2O C;  5FI7 A;  1Y6W A;  1SKT A;  2HF5 A;  1C3Y A;  1PSR A;  1RWY A;  1W7J B;  3D10 A;  1B47 A;  2LNK A;  3K1E A;  4JWQ A;  4WQ2 A;  1XFY O;  5K89 A;  2KQ6 A;  1KWO C;  3RZS A;  4NDB A;  5F6T A;  2KLE A;  1B8C A;  1OMV A;  5TNC A;  1S5G Z;  4M2Q A;  1MHO A;  1F4O A;  1UP5 A;  4YI8 A;  3S0E A;  1YX8 A;  2JXL A;  3VRP A;  2H61 C;  1BOC A;  3DXL A;  3O4Y A;  2KNE A;  4HRE E;  2GTE A;  2LP3 A;  3EVV A;  2OS8 C;  1JC2 A;  1F8H A;  2M49 B;  1QLK A;  3B87 A;  2EC6 C;  2LM5 A;  1J7Q A;  2LMV A;  2L98 A;  4ETO A;  2BE4 A;  3SG3 A;  2K7D A;  1GGZ A;  1UHJ A;  3E3R A;  1MXE A;  1QLS A;  1IQ3 A;  2BL0 B;  1V1G A;  1QV1 A;  2KAY A;  1SR6 C;  1KSM A;  1WRL A;  2HQ8 A;  3O2P A;  4YGC B;  3LLE A;  2KDH A;  5PAL A;  2KBI A;  1FBV A;  1M31 A;  2LC5 A;  3TUY B;  1YUT A;  1QIV A;  2JWW A;  3BFH A;  3I5F B;  2FCD A;  3GOF A;  4DCK A;  2DOQ A;  2WC8 A;  3CLN A;  5I2O A;  1SL8 A;  3NSI A;  1M63 B;  4FQT A;  2F8P A;  3N7H A;  2K0J A;  2WCH A;  1S6I A;  1M39 A;  3QRX A;  4HSZ A;  4YGD B;  3CTN A;  3VRN A;  5I2L A;  4MVF A;  1RRO A;  2L2C A;  3O78 A;  5DKN A;  1X02 A;  1KQM C;  1NP8 A;  1CLM A;  1XFX O;  3DVJ A;  1REC A;  1RJV A;  3PN7 B;  3O6B A;  3D78 A;  2KLD A;  1QS7 A;  1XO5 A;  2IS9 A;  3TZ1 A;  1QTX A;  2A4J A;  1IQ5 A;  1PRW A;  1CM1 A;  3F45 A;  1ALV A;  4MZL A;  3NSO A;  3LL8 B;  1LA3 A;  4M2P A;  2I18 A;  4ORC B;  3S0B A;  1WRZ A;  2KGB C;  1A29 A;  1KK7 Z;  1CFD A;  1PSB A;  2WND A;  3JVT B;  3TDI A;  4INX A;  1TNW A;  2B1U A;  2BEC A;  3BQ3 A;  3ZNI A;  2L50 A;  4XJK B;  1L2O B;  1Z4H A;  3PSR A;  2JXC A;  3NSK A;  2JU0 A;  2O60 A;  1B8L A;  1NCX A;  2QAC A;  1OOJ A;  4I5K A;  3EKH A;  1KWO B;  2BAP A;  4PCW A;  2LP2 A;  3EKJ A;  1CTR A;  4ORB B;  3KPX A;  1DJI A;  2KI6 C;  3FWB A;  3PJI A;  3PM8 A;  1CLL A;  4P2Y B;  1B8R A;  1WY9 A;  3WHU B;  1DF0 B;  2KYC A;  4PE4 A;  2P71 A;  1OW4 A;  3L47 A;  1LIN A;  2JT3 A;  4GGF A;  1F55 A;  1TUJ A;  3MSE B;  1M46 A;  1W7I B;  2NZ0 A;  1MF8 B;  1CDN A;  2NXQ A;  1DGV A;  2M0R A;  4FTG A;  2OS8 B;  2JOJ A;  2KFF A;  1SW8 A;  1XA5 A;  2ZRT A;  2EC6 B;  1C07 A;  1U5I B;  4QJ3 B;  1IRJ A;  5B8I B;  1F70 A;  1XK4 C;  2K60 A;  2HPS A;  2L0P A;  1IH0 A;  2D8N A;  4MN0 A;  2WCM A;  1Y1A A;  3EG5 B;  2M3W A;  5CPV A;  1BF5 A;  2CCM A;  1IG5 A;  1NCY A;  1PVB A;  3ICB A;  4GGN A;  1SCM C;  4N5X A;  5DKQ A;  3OX5 A;  4PHM A;  1J1D A;  2M9G A;  3CR2 A;  3SS4 A;  1JSA A;  1XYD A;  5AFP A;  1OZO A;  1QJT A;  2L2E A;  3FS7 A;  2JTZ A;  1SYM A;  3ZWH A;  1DJY A;  4E68 A;  3V2L A;  2LVI A;  1K93 D;  3TDU A;  3IQO A;  3DVK A;  3OP0 A;  5EL2 A;  5KU1 A;  2MLF C;  1R2U A;  5HKW A;  1OOG A;  1LA0 A;  1KQM B;  3A8R A;  2NCP A;  3FIA A;  3AKB A;  2L5X B;  5FI2 A;  1KK7 Y;  1YUS A;  2BCA A;  3AAK A;  1TCO B;  1CFF A;  1IIO A;  1YX7 A;  1FI6 A;  1F4Q A;  1TWO A;  2GV5 A;  3OBV A;  1S6C A;  3QME A;  4DRW A;  1BJF A;  1OOH A;  4GBA A;  1J7P A;  3KEV A;  4C0J A;  1IGV A;  3EK7 A;  5JJG A;  1QAT A;  3SIB A;  4XJK A;  2MJW B;  4YI9 A;  4CFQ A;  5AER A;  1S6J A;  3D73 A;  1M45 A;  3OB2 B;  4MRY A;  3DF0 B;  2AAO A;  1T14 A;  4BY5 A;  3AAJ A;  1K8U A;  1JF2 A;  1EH2 A;  1NCZ A;  1QX5 B;  3FWC A;  1QVI Y;  2WC6 A;  1V1F A;  2H8V A;  1EJ3 A;  4L9M A;  4OV2 A;  4MBE A;  1UHK A;  3VGO A;  2GGZ A;  1S3P A;  5KTY A;  2PSR A;  1YVH A;  1CDP A;  3CYZ A;  3CGA A;  2LMU A;  3B88 A;  1Z2C B;  2BCX A;  1DF0 A;  1TTX A;  5GQQ C;  4DS7 A;  3L4A A;  1AJ5 A;  5AAN A;  1DTL A;  2YGU A;  3LCP C;  3L4L A;  1OMR A;  1QV0 A;  2SCP A;  1NX1 A;  4I5L B;  1GGW A;  2H61 A;  3NXA A;  1A2X A;  1BR1 B;  1YR5 A;  1NPQ A;  2OPO A;  3GK4 X;  5DIC A;  2Y1N A;  2SAS A;  3OX6 A;  2K7B A;  1DQE A;  5I8N A;  3SG4 A;  1U5I A;  1ZAC A;  1WLZ A;  2Y4Q A;  3HCM A;  3NGV A;  2PVB A;  4GNK B;  4QJ5 B;  1FPW A;  1KFU L;  1OQP A;  1DJH A;  4YGE B;  1BMO A;  1NIW A;  3BXK A;  1J7O A;  3WNX B;  4ORA B;  2KQY A;  1K95 A;  2ZN8 A;  1QAS A;  1SCM B;  2LHI A;  1YVL A;  3I5I C;  2LUC A;  2QEH A;  1K96 A;  3SG7 A;  1QX2 A;  3D75 A;  2BCB A;  1PK0 D;  2JNX A;  1ZOT B;  2LHL A;  2P6B B;  3BUX B;  2K7O A;  1H4B A;  1G8I A;  2M29 A;  4JD9 A;  1CMF A;  3RLZ A;  1B4C A;  4P5O E;  2PRU A;  1UHN A;  1EL4 A;  2PMY A;  4YBH B;  5D7F A;  2MBX A;  3VRO A;  4F7F A;  1K2H A;  2ZFD A;  3JTD C;  4JPZ B;  4MRX A;  2LAN A;  3S0D A;  2G2B A;  1WLM A;  2K2A A;  4YGA A;  3CR5 X;  4MSP A;  1CLB A;  5D69 A;  4OZD A;  1RFJ A;  1RK9 A;  1WRK A;  4PHN A;  2WC5 A;  1AK8 A;  1YRU B;  2JPO A;  3TS5 C;  3DVM A;  1F54 A;  1NSH A;  1IJ6 A;  1S5G Y;  2ZND A;  3R1V A;  3CZT X;  3HX4 A;  2WCE A;  2FJU B;  2WCB A;  5HLO A;  2GGM A;  4M2O A;  1YUU A;  4OVN F;  4A4B A;  1G4Y R;  1H8B A;  5I94 A;  1B1G A;  1UHI A;  1MQ1 A;  1NWD A;  2KFH A;  2Y5I A;  2PAS A;  3BOW A;  2OTG C;  3CAB A;  3CZ2 A;  3LK1 A;  1BT6 A;  3S0G A;  1QWV A;  4CPV A;  1TRF A;  1ORG A;  2L4I A;  1SRA A;  1NX0 A;  1XFW O;  2O5G A;  3SIA A;  4C0K A;  3NHI A;  5CSI A;  1J1E A;  2KYF A;  5ER4 X;  1PVA A;  4F0Z B;  1N2D A;  3CZ0 A;  4PE7 A;  1SMG A;  4ZCV A;  3DF0 A;  3VRR A;  1BG1 A;  4AQI A;  2F3Y A;  1CFC A;  1ODB A;  3M0W A;  2K8M B;  2FJY A;  1K94 A;  2CT9 A;  2QEB A;  1HT9 A;  4DUQ A;  2K7C A;  1TCF A;  1P28 A;  2HET A;  1BR4 B;  2L4H A;  4ICB A;  1SY9 A;  1L7Z A;  1TNX A;  1SR6 B;  2AMI A;  2F2O A;  1OOF A;  1AUI B;  1K9K A;  2I2R E;  3OGN A;  1EG3 A;  5J3X A;  2BKH B;  2LVV A;  3BUN B;  1CNP A;  2MHH A;  4IJ7 A;  1DJX A;  2KPH A;  4OKH A;  2WCF A;  1DEL A;  1SCV A;  1EXR A;  4PE0 A;  1XK4 A;  2LLU A;  4TNC A;  3WHT B;  1DJZ A;  1N65 A;  1ALW A;  3KHE A;  1CDL A;  3I5G C;  1TN4 A;  2WCJ A;  4UPG A;  1DGU A;  4PHK A;  1BLQ A;  1GM0 A;  1JWD A;  1KFX L;  4FQO A;  3FE8 A;  3DYE A;  4NQG A;  1K9U A;  1NX2 A;  2JT0 A;  2I94 A;  3I5I B;  4XYN A;  1KCY A;  4MZJ A;  2AUC A;  2M97 A;  2ZN9 A;  2PQL A;  2JUL A;  1N0Y A;  2WOS A;  1G33 A;  3Q8I A;  2BNX A;  2F2P A;  4N1F A;  3UO9 A;  2M8U A;  1PAL A;  1XFU O;  3BOW B;  4PAL A;  4NDD A;  1SNL A;  3JTD B;  2EHB A;  1UWO A;  1KK8 C;  2COL B;  1IKU A;  1LXF C;  2ZKM X;  2KHN A;  3EVU A;  2E30 A;  4CFR A;  2KGR A;  2L51 A;  1QIW A;  3BUO B;  3BFB A;  1AP4 A;  1KSO A;  1JF0 A;  1J7R A;  1KFU S;  1YUR A;  2M7N A;  5HYD A;  3I5H C;  2Q91 A;  2JC2 A;  3VRQ A;  2PYQ A;  3TS5 B;  2RGI A;  1TIZ A;  4MLW A;  1Y0V H;  1YRT B;  1CKK A;  2L5Y A;  2JQ6 A;  5CSJ A;  1CFP A;  1IWQ A;  4PHJ A;  2KFG A;  5HLV A;  4PE1 A;  2Y1M A;  5D3O A;  1QXP A;  2M1K B;  1SK6 D;  2QEO A;  2OTG B;  4R1E A;  5FI6 A;  3A4U B;  4WRI A;  5ER5 A;  4YRU A;  5CSN A;  4YGB B;  2G9B A;  2CTN A;  2CXJ A;  3CDN A;  1B7T Z;  2LCP A;  4ZCU A;  5JOL A;  3SJS A;  1DJW A;  1TNP A;  2LV7 A;  2KI4 C;  1GQM A;  1JFJ A;  2BBN A;  3IVT A;  3GK1 A;  1WDC C;  1OSA A;  1HQV A;  5HKZ A;  4I5N B;  1KQV A;  1SSE B;  1SL7 A;  1JUO A;  5HL1 A;  1OZS A;  3BJH A;  3CS1 A;  3BFA A;  3R1O A;  1LVC D;  5I2Q A;  1TOP A;  2P70 A; 
#chains in the Genus database with same CATH homology
 1Y1U A;  1SL9 A;  5CSF A;  4DIR A;  2LLT A;  1YTZ C;  2ZRS A;  4I5J A;  2E6W A;  2ISD A;  1GJY A;  4A4C A;  1E8A A;  1S1E A;  1XFZ O;  4C0L A;  3GK2 A;  3D0Y A;  4GPL B;  2EGD A;  1B9A A;  3DVE A;  3EVR A;  1A03 A;  4Q04 A;  1FF1 A;  4USL A;  2NCO A;  4GFT A;  2LVJ A;  2LE9 B;  2NLN A;  1FW4 A;  3I5G B;  3CR4 X;  1A75 B;  4D1E A;  1BU3 A;  1SBJ A;  2JT8 A;  1MUX A;  3PAT A;  2K2F A;  2PAL A;  2JNF A;  1UHH A;  2R2I A;  1C7V A;  1K9P A;  3EK4 A;  1LKJ A;  1D1O A;  1C7W A;  1AJ4 A;  3IF7 A;  3OB1 B;  3K21 A;  2FCE A;  2LLS A;  3BUW B;  1ZUZ A;  3PAL A;  4N1G A;  4CID A;  1UUR A;  2QPT A;  1SPY A;  2CNP A;  2WOR A;  3IQQ A;  1AVS A;  4NDC A;  1VRK A;  4HRG A;  4WQ3 A;  1KK8 B;  2Q4U A;  1A4P A;  2VRG A;  2F33 A;  5FYX A;  1JBA A;  1DJG A;  4GGF C;  3BUM B;  3I5H B;  3BYA A;  2KAX A;  4HRH A;  2LUX A;  4OCI A;  3KF9 A;  2KSP A;  1KFX S;  1TNQ A;  5HKY A;  2BKI B;  1J55 A;  2ZNE A;  3WXA A;  1ZMZ A;  1FI5 A;  3NSL A;  1B7T Y;  1CM4 A;  2KI6 D;  5KSZ A;  2BBM A;  1F71 A;  4IL1 A;  2BL0 C;  2KOT A;  3SG6 A;  4GAO A;  1NX3 A;  1OMD A;  3DD4 A;  1RTP 1;  3OHM B;  2JPT A;  1QVI Z;  5DKR A;  3PLF B;  2LMT A;  2F3Z A;  4GUK A;  3TUY C;  2FOT A;  1MR8 A;  4AQJ A;  2K61 A;  5AXI A;  2M1U A;  3D0Y B;  3H4S E;  1EG4 A;  1MWN A;  2KI4 B;  2LVK A;  3I5F C;  1BOD A;  1DMO A;  3SG5 A;  3SG2 A;  1IJ5 A;  2KAV A;  3CWG A;  2MLE C;  3LK0 A;  2JTT A;  1WDC B;  4JQ0 D;  5AEQ A;  4QJ4 B;  5G08 A;  1OE9 B;  1S26 D;  1XVJ A;  3PFV A;  1CB1 A;  3EK8 A;  1DT7 B;  4BY4 A;  4OR9 B;  3RM1 A;  1DVI A;  2CBL A;  4AOM A;  2H2K A;  2LAP A;  1XFV O;  3PN7 C;  4MEW A;  1K90 D;  1UUS A;  2JRF A;  2KBM A;  5BPJ A;  1Y1X A;  2V53 A;  5IBW A;  1MXL C;  2MRD A;  1QX7 A;  2M7L A;  1NUB A;  1ZFS A;  1R6P A;  1PUL A;  2HQW A;  1CMG A;  3AKA A;  4MZK A;  3TDZ A;  1A75 A;  4U8D A;  1NYA A;  4CLN A;  2MAZ A;  2JZI A;  1CDM A;  3JVT C;  1AHR A;  1Q80 A;  3C1V A;  1JFK A;  4PDZ A;  2MA2 A;  2I7A A;  3KO0 A;  1S36 A;  2BE6 A;  2TN4 A;  1L2O C;  1Y6W A;  1SKT A;  2HF5 A;  1PSR A;  1RWY A;  1W7J B;  3D10 A;  1B47 A;  2LNK A;  4JWQ A;  4WQ2 A;  5K89 A;  1XFY O;  2KQ6 A;  1KWO C;  4NDB A;  5F6T A;  1B8C A;  1OMV A;  5TNC A;  1S5G Z;  4M2Q A;  1MHO A;  1F4O A;  1UP5 A;  4YI8 A;  1YX8 A;  2JXL A;  3VRP A;  2H61 C;  1BOC A;  3O4Y A;  2KNE A;  4HRE E;  2LP3 A;  3EVV A;  2OS8 C;  1JC2 A;  1F8H A;  2M49 B;  1QLK A;  2EC6 C;  2LM5 A;  1J7Q A;  2LMV A;  2L98 A;  4ETO A;  2BE4 A;  3SG3 A;  2K7D A;  1GGZ A;  1UHJ A;  3E3R A;  1MXE A;  1QLS A;  1IQ3 A;  2BL0 B;  1V1G A;  1QV1 A;  2KAY A;  1SR6 C;  1KSM A;  1WRL A;  2HQ8 A;  3O2P A;  4YGC B;  3LLE A;  2KDH A;  5PAL A;  2KBI A;  1FBV A;  1M31 A;  2LC5 A;  3TUY B;  1YUT A;  1QIV A;  2JWW A;  3I5F B;  2FCD A;  3GOF A;  4DCK A;  2DOQ A;  2WC8 A;  3CLN A;  5I2O A;  1SL8 A;  3NSI A;  1M63 B;  2F8P A;  2K0J A;  1S6I A;  1M39 A;  3QRX A;  4HSZ A;  4YGD B;  3CTN A;  3VRN A;  5I2L A;  4MVF A;  1RRO A;  3O78 A;  5DKN A;  1X02 A;  1KQM C;  1NP8 A;  1CLM A;  1XFX O;  3DVJ A;  1REC A;  1RJV A;  3PN7 B;  3O6B A;  1QS7 A;  1XO5 A;  2IS9 A;  3TZ1 A;  1QTX A;  2A4J A;  1IQ5 A;  1PRW A;  1CM1 A;  3F45 A;  1ALV A;  4MZL A;  3NSO A;  3LL8 B;  1LA3 A;  4M2P A;  2I18 A;  4ORC B;  1WRZ A;  2KGB C;  1A29 A;  1KK7 Z;  1CFD A;  1PSB A;  2WND A;  3JVT B;  3TDI A;  1TNW A;  2B1U A;  2BEC A;  3BQ3 A;  3ZNI A;  2L50 A;  4XJK B;  1L2O B;  3PSR A;  2JXC A;  3NSK A;  2JU0 A;  2O60 A;  1B8L A;  1NCX A;  2QAC A;  1OOJ A;  4I5K A;  3EKH A;  1KWO B;  4PCW A;  2LP2 A;  3EKJ A;  1CTR A;  4ORB B;  3KPX A;  1DJI A;  2KI6 C;  3FWB A;  3PM8 A;  1CLL A;  4P2Y B;  1B8R A;  1WY9 A;  3WHU B;  1DF0 B;  2KYC A;  4PE4 A;  1LIN A;  2JT3 A;  4GGF A;  1F55 A;  3MSE B;  1M46 A;  1W7I B;  2NZ0 A;  1MF8 B;  1CDN A;  2NXQ A;  1DGV A;  2M0R A;  4FTG A;  2OS8 B;  2JOJ A;  2KFF A;  1SW8 A;  1XA5 A;  2ZRT A;  2EC6 B;  1C07 A;  1U5I B;  4QJ3 B;  1IRJ A;  5B8I B;  1F70 A;  1XK4 C;  2HPS A;  2L0P A;  1IH0 A;  2D8N A;  4MN0 A;  1Y1A A;  5CPV A;  2M3W A;  1BF5 A;  2CCM A;  1IG5 A;  1NCY A;  1PVB A;  3ICB A;  4GGN A;  1SCM C;  4N5X A;  5DKQ A;  3OX5 A;  4PHM A;  1J1D A;  2M9G A;  3CR2 A;  1JSA A;  1XYD A;  5AFP A;  1OZO A;  1QJT A;  2L2E A;  3FS7 A;  2JTZ A;  1SYM A;  3ZWH A;  1DJY A;  4E68 A;  2LVI A;  1K93 D;  3TDU A;  3IQO A;  3DVK A;  3OP0 A;  5KU1 A;  2MLF C;  1R2U A;  5HKW A;  1LA0 A;  1KQM B;  3A8R A;  2NCP A;  3FIA A;  3AKB A;  2L5X B;  1KK7 Y;  1YUS A;  2BCA A;  3AAK A;  1TCO B;  1CFF A;  1YX7 A;  1FI6 A;  1F4Q A;  2GV5 A;  1S6C A;  4DRW A;  1BJF A;  4GBA A;  1J7P A;  3KEV A;  4C0J A;  1IGV A;  3EK7 A;  5JJG A;  1QAT A;  3SIB A;  4XJK A;  2MJW B;  4YI9 A;  4CFQ A;  5AER A;  1S6J A;  1M45 A;  3OB2 B;  4MRY A;  3DF0 B;  2AAO A;  4BY5 A;  3AAJ A;  1K8U A;  1JF2 A;  1EH2 A;  1NCZ A;  1QX5 B;  3FWC A;  1QVI Y;  1V1F A;  4L9M A;  1EJ3 A;  4OV2 A;  4MBE A;  1UHK A;  3VGO A;  2GGZ A;  1S3P A;  5KTY A;  2PSR A;  1YVH A;  1CDP A;  3CGA A;  2LMU A;  2BCX A;  1DF0 A;  1TTX A;  5GQQ C;  4DS7 A;  1AJ5 A;  5AAN A;  1DTL A;  3LCP C;  1OMR A;  1QV0 A;  2SCP A;  1NX1 A;  4I5L B;  1GGW A;  2H61 A;  3NXA A;  1A2X A;  1BR1 B;  1YR5 A;  1NPQ A;  2OPO A;  3GK4 X;  2Y1N A;  2SAS A;  3OX6 A;  2K7B A;  5I8N A;  3SG4 A;  1U5I A;  1ZAC A;  1WLZ A;  2Y4Q A;  3HCM A;  2PVB A;  4GNK B;  4QJ5 B;  1FPW A;  1KFU L;  1OQP A;  1DJH A;  4YGE B;  1BMO A;  1NIW A;  3BXK A;  1J7O A;  3WNX B;  4ORA B;  2KQY A;  1K95 A;  2ZN8 A;  1QAS A;  1SCM B;  2LHI A;  1YVL A;  3I5I C;  2LUC A;  1K96 A;  3SG7 A;  1QX2 A;  2BCB A;  1PK0 D;  2JNX A;  1ZOT B;  2LHL A;  2P6B B;  3BUX B;  2K7O A;  1H4B A;  1G8I A;  2M29 A;  1CMF A;  3RLZ A;  1B4C A;  4P5O E;  2PRU A;  1UHN A;  1EL4 A;  2PMY A;  4YBH B;  5D7F A;  2MBX A;  3VRO A;  1K2H A;  2ZFD A;  3JTD C;  4JPZ B;  4MRX A;  2LAN A;  2G2B A;  1WLM A;  2K2A A;  4YGA A;  3CR5 X;  4MSP A;  1CLB A;  5D69 A;  1RFJ A;  1RK9 A;  1WRK A;  4PHN A;  1AK8 A;  1YRU B;  3TS5 C;  3DVM A;  1F54 A;  1NSH A;  1IJ6 A;  1S5G Y;  2ZND A;  3CZT X;  3HX4 A;  2WCE A;  2FJU B;  2WCB A;  5HLO A;  2GGM A;  4M2O A;  1YUU A;  4OVN F;  4A4B A;  1G4Y R;  1H8B A;  1B1G A;  1UHI A;  1MQ1 A;  1NWD A;  2KFH A;  2Y5I A;  2PAS A;  3BOW A;  2OTG C;  3LK1 A;  1BT6 A;  4CPV A;  1TRF A;  2L4I A;  2O5G A;  1SRA A;  1NX0 A;  1XFW O;  3SIA A;  4C0K A;  5CSI A;  1J1E A;  2KYF A;  5ER4 X;  1PVA A;  4F0Z B;  1N2D A;  4PE7 A;  4ZCV A;  1SMG A;  3VRR A;  3DF0 A;  1BG1 A;  4AQI A;  2F3Y A;  1CFC A;  1ODB A;  3M0W A;  2K8M B;  1K94 A;  2CT9 A;  1HT9 A;  4DUQ A;  2K7C A;  1TCF A;  2HET A;  1BR4 B;  2L4H A;  4ICB A;  1SY9 A;  1L7Z A;  1TNX A;  1SR6 B;  2AMI A;  2F2O A;  1AUI B;  1K9K A;  2I2R E;  5J3X A;  1EG3 A;  2BKH B;  2LVV A;  3BUN B;  1CNP A;  2MHH A;  1DJX A;  4OKH A;  2WCF A;  1SCV A;  1EXR A;  4PE0 A;  1XK4 A;  2LLU A;  4TNC A;  3WHT B;  1DJZ A;  1N65 A;  1ALW A;  3KHE A;  1CDL A;  3I5G C;  1TN4 A;  4UPG A;  1DGU A;  4PHK A;  1BLQ A;  1JWD A;  1KFX L;  4FQO A;  4NQG A;  1K9U A;  1NX2 A;  2JT0 A;  2I94 A;  3I5I B;  4XYN A;  1KCY A;  4MZJ A;  2AUC A;  2M97 A;  2ZN9 A;  2JUL A;  1N0Y A;  2WOS A;  1G33 A;  2F2P A;  4N1F A;  2M8U A;  1PAL A;  1XFU O;  3BOW B;  4PAL A;  4NDD A;  1SNL A;  3JTD B;  2EHB A;  1UWO A;  1KK8 C;  2COL B;  1IKU A;  1LXF C;  2ZKM X;  2KHN A;  3EVU A;  2E30 A;  4CFR A;  2KGR A;  2L51 A;  1QIW A;  3BUO B;  1AP4 A;  1KSO A;  1JF0 A;  1J7R A;  1KFU S;  1YUR A;  2M7N A;  5HYD A;  3I5H C;  2Q91 A;  2JC2 A;  3VRQ A;  3TS5 B;  2RGI A;  1TIZ A;  4MLW A;  1Y0V H;  1YRT B;  1CKK A;  2JQ6 A;  5CSJ A;  1CFP A;  1IWQ A;  4PHJ A;  2KFG A;  5HLV A;  4PE1 A;  2Y1M A;  1QXP A;  2M1K B;  1SK6 D;  2OTG B;  4R1E A;  3A4U B;  4WRI A;  5ER5 A;  4YRU A;  5CSN A;  4YGB B;  2G9B A;  2CTN A;  2CXJ A;  1B7T Z;  2LCP A;  4ZCU A;  5JOL A;  3SJS A;  1DJW A;  1TNP A;  2LV7 A;  2KI4 C;  1GQM A;  1JFJ A;  2BBN A;  3GK1 A;  1WDC C;  1OSA A;  1HQV A;  5HKZ A;  4I5N B;  1KQV A;  1SL7 A;  1JUO A;  1OZS A;  3CS1 A;  5I2Q A;  1LVC D;  1TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...