5D7FA

X-ray structure of ca(2+)-s100b with human rage-derived w72 peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
b'MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
molecule tags Protein binding
source organism Homo sapiens
publication title X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
rcsb
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d7fA00
2FJUB 3RM1A 1YUUA 1PALA 2Q91A 1F54A 1LINA 2BBMA 2EGDA 2L50A 3KPXA 1YTZC 3NSIA 2BCBA 1IWQA 2JZIA 3JTDC 1CNPA 5GQQC 4OVNF 1SY9A 2LVIA 2F33A 1XFXO 5AANA 2LMVA 3AAJA 2K61A 1IKUA 2JNXA 1JSAA 3D0YB 3NSLA 1RWYA 1QLKA 1TCOB 3BUOB 2R2IA 1YRTB 2JULA 1S5GY 2KAXA 2KNEA 3PATA 2F2OA 1JFKA 2ZN8A 4HSZA 1GGZA 2LMTA 5CSJA 2WNDA 3FWBA 1UHNA 2F3YA 1YUTA 4JPZB 2COLB 3I5IC 4DIRA 2L51A 4ORAB 3OP0A 4HREE 3WHUB 3SG4A 1RJVA 2H61C 2HQ8A 4N5XA 3KF9A 1DJHA 2BCAA 3CLNA 3LCPC 4MSPA 2KDHA 2JXCA 4MBEA 2GGMA 3OB1B 4F0ZB 1QXPA 1Y6WA 5ER4X 1BLQA 4MLWA 1XFZO 1KQMB 1S26D 1CDPA 1JF2A 4D1EA 5HLOA 1Y1XA 1IRJA 4P2YB 5KTYA 1B7TZ 2A4JA 2LVKA 2OTGB 4XJKA 1B1GA 2LVVA 4FTGA 1SL8A 1V1FA 1CB1A 2KFGA 1IJ6A 4MRXA 3TUYB 1CM1A 4YGCB 4PHKA 1MHOA 4GFTA 3I5FB 2L0PA 2NXQA 3QRXA 2EC6C 2B1UA 1SNLA 2HF5A 2JWWA 2KI6D 2LUCA 1LA3A 1KCYA 1XK4A 2MLEC 1R2UA 1OMVA 4NQGA 5KU1A 1C7WA 1IG5A 4PDZA 2F3ZA 1CFPA 3CR2A 2M1UA 1NX2A 1IJ5A 1B8RA 2H61A 1NX3A 1MF8B 2LM5A 1ZACA 4C0JA 1PSRA 5HKYA 3SIAA 2CNPA 4YGBB 5DKNA 1C07A 1KK7Y 1SCMB 1J7RA 4DRWA 4BY4A 3FS7A 4MVFA 1BG1A 1NPQA 2AUCA 2JTTA 1TTXA 1S6JA 1EL4A 1YR5A 4M2PA 1A29A 1NYAA 2M7NA 2MAZA 3JTDB 1TIZA 1ZUZA 5HLVA 2ZRSA 3I5FC 1NX1A 2JQ6A 3BOWA 4DCKA 2VRGA 1DF0A 1WLMA 1FF1A 1W7JB 1K94A 1SKTA 3NSOA 2PALA 2Y1NA 1XVJA 2PRUA 1RFJA 2CTNA 3IF7A 2JTZA 2BECA 4PCWA 2AMIA 1CKKA 1Y1UA 1WLZA 2FOTA 4E68A 1PVAA 3H4SE 4CFQA 2HQWA 1LA0A 2LHIA 2M0RA 1AUIB 1SK6D 2NCPA 2BL0B 1YRUB 1IQ3A 1QTXA 1K93D 5I2QA 2DOQA 1KFXS 4PALA 2KGRA 2WCBA 4UPGA 4TNCA 2KQYA 1KK8B 2JC2A 3TZ1A 1FBVA 5CSIA 2CT9A 5AXIA 1YX8A 4JWQA 1CMGA 5K89A 1K96A 1NCZA 1LVCD 1K8UA 1OZOA 4NDDA 4A4BA 2OS8B 1KSMA 5J3XA 1ALVA 3CR5X 1WY9A 1BT6A 1FI6A 1E8AA 1S36A 3BUXB 3CR4X 2KOTA 2PASA 1QV0A 1MR8A 1WDCB 4DUQA 1MQ1A 5AERA 2E6WA 2LUXA 2M97A 2QACA 1UUSA 4PE7A 3SIBA 2MJWB 3DVKA 3CS1A 5G08A 4OV2A 1YURA 3EK4A 1F70A 2IS9A 1BMOA 1XA5A 2MHHA 5JOLA 5ER5A 4MN0A 2CCMA 1WDCC 2HPSA 4JQ0D 1PSBA 2LLUA 1QASA 3I5HC 1KWOB 1CDLA 1W7IB 1S5GZ 5HYDA 1Y0VH 2JT3A 2SASA 2KI4C 2NZ0A 4GNKB 1OMRA 2JNFA 1QV1A 1XYDA 2F2PA 2ZKMX 5JJGA 3FIAA 1GGWA 1F55A 5PALA 3AKBA 1CFFA 3GK2A 1CTRA 1XFYO 3KHEA 1BJFA 3GK4X 1J7OA 2KI4B 1QX5B 2K8MB 2O60A 1L2OC 2LE9B 1NCXA 3PSRA 1NSHA 1CLLA 2OTGC 3BUNB 3LK0A 3O2PA 2LAPA 3A8RA 2G2BA 2KFFA 1DMOA 4HRGA 4GUKA 4YI8A 1B9AA 1QVIY 2KGBC 5B8IB 1QS7A 5TNCA 1KFXL 3OB2B 2MBXA 4I5NB 4CPVA 1SR6B 2JXLA 3JVTB 3SG6A 2E30A 2BBNA 1YUSA 5IBWA 3CTNA 3GOFA 1J1DA 2F8PA 3SG5A 1CFDA 1WRLA 2M29A 2KYCA 1ODBA 1WRKA 1SBJA 2FCDA 1A03A 1N65A 2WORA 1QLSA 2L98A 3DF0A 3TDZA 2ZRTA 2H2KA 1AHRA 4MZJA 1VRKA 3D0YA 1NX0A 1QVIZ 4GBAA 1DJWA 1A2XA 2ZNDA 2K0JA 1NWDA 3OX6A 3FWCA 1N2DA 1MXEA 3PFVA 1K2HA 3O4YA 1S6CA 2Y1MA 1FW4A 4N1FA 1DJGA 4PE1A 2MLFC 1NP8A 3VROA 3AAKA 1CLBA 3O78A 4YGAA 1MUXA 1TRFA 2K7DA 1J7PA 3TDUA 2LP3A 1PK0D 2CXJA 1F8HA 3TUYC 1A75B 2EC6B 1WRZA 2K2AA 1JWDA 2Y5IA 3CZTX 1G4YR 4C0KA 1BODA 4WRIA 2BCXA 4XJKB 1OSAA 2M8UA 2D8NA 1OQPA 1K90D 4GAOA 1DGVA 1OMDA 1QX7A 3WXAA 2I7AA 3EVUA 1YVLA 2G9BA 3KEVA 1GQMA 1S3PA 2KQ6A 2WCEA 2JT8A 3PN7C 2LP2A 4AOMA 4ORBB 2K2FA 1XO5A 5DKQA 1L2OB 1DJYA 1MXLC 3GK1A 3DD4A 5CPVA 1F71A 4ICBA 3VRPA 4NDCA 1TOPA 1S6IA 2WC8A 4DS7A 1UURA 1MWNA 2K7CA 1UWOA 1UHJA 1M46A 1G33A 1LKJA 2K7OA 2Y4QA 3PLFB 4YGDB 1K9UA 4GPLB 2LV7A 3BUMB 2L2EA 1AJ5A 1F4OA 1UHIA 1ZFSA 3DF0B 1DJZA 1M39A 1PVBA 5D7FA 1KK8C 1AP4A 4PE0A 1RROA 2V53A 1H8BA 1M45A 1TN4A 1LXFC 1NCYA 3PN7B 2M49B 2HETA 3CWGA 3PALA 3BQ3A 4XYNA 1FPWA 1KFUS 2ZFDA 1D1OA 4HRHA 1FI5A 4ETOA 1SCVA 3EKHA 4PHMA 1U5IA 4YBHB 1BR1B 4L9MA 3VGOA 2ZNEA 1PRWA 2M3WA 1DT7B 1CDNA 1SCMC 4PHNA 2KBMA 3EK7A 4N1GA 1RTP1 3I5IB 3RLZA 3K21A 2AAOA 3WNXB 3ZWHA 2LMUA 4OR9B 2LANA 1JBAA 1A75A 2TN4A 4FQOA 1NUBA 3HCMA 3KO0A 4U8DA 4MZLA 2BL0C 4ORCB 1EG3A 1K9PA 2KSPA 1V1GA 1TNWA 2BKHB 2I94A 2KBIA 3BXKA 1GJYA 2EHBA 1AVSA 2M9GA 2LVJA 1Y1AA 1J55A 1JC2A 1J1EA 1SPYA 3TS5B 1K95A 1DGUA 1SMGA 2BE4A 2NLNA 3VRNA 5BPJA 1B4CA 1HT9A 4AQJA 1JF0A 1IGVA 3SG3A 1YVHA 4GGFC 1QATA 2PVBA 4M2QA 1QIVA 4YI9A 3TS5C 3DVMA 2JPTA 4AQIA 1KQVA 1RECA 2K7BA 1J7QA 3BUWB 3TDIA 5FYXA 4YRUA 2LLTA 4CLNA 1UHKA 2PSRA 1SL9A 4R1EA 1UHHA 4WQ3A 4MEWA 5KSZA 4PHJA 3D10A 1F4QA 5I2LA 3I5HB 1AK8A 1B8LA 2CBLA 2P6BB 2KYFA 3ZNIA 4MRYA 5D69A 1DJXA 3SJSA 1CDMA 5DKRA 1SRAA 1BR4B 3NXAA 4ZCVA 1U5IB 5HKZA 2ISDA 1NIWA 2LC5A 4PE4A 4I5KA 1BF5A 1DJIA 3I5GB 1ALWA 2WOSA 1N0YA 1EH2A 1IQ5A 1DVIA 5AFPA 3HX4A 1DTLA 3EK8A 3MSEB 4C0LA 2NCOA 1PULA 1KQMC 1B8CA 3A4UB 2MRDA 2LHLA 2JU0A 2KFHA 1QJTA 1TCFA 2Q4UA 1C7VA 1M63B 1SR6C 2LNKA 3C1VA 3JVTC 2RGIA 1G8IA 1KFUL 2SCPA 1KK7Z 3BYAA 2L5XB 4QJ4B 1XK4C 2LLSA 3EVRA 4OKHA 1CM4A 2WCFA 3LLEA 2KHNA 3NSKA 1BOCA 2L4IA 4M2OA 1EXRA 3EVVA 1S1EA 4QJ3B 1OE9B 1QIWA 4BY5A 1R6PA 1L7ZA 3IQOA 1YX7A 2O5GA 4I5JA 2KAVA 1OZSA 4QJ5B 2KI6C 1Q80A 1SYMA 3E3RA 5I8NA 1ZOTB 1JFJA 1KSOA 3PM8A 4WQ2A 2LCPA 1M31A 4USLA 4GGFA 4A4CA 2FCEA 1XFWO 2L4HA 4YGEB 4CIDA 5I2OA 1OOJA 3OX5A 3LK1A 2I2RE 3AKAA 1AJ4A 2GGZA 3VRRA 1H4BA 1JUOA 3M0WA 4P5OE 2BKIB 1KWOC 1QX2A 1XFUO 3CGAA 1IH0A 1SL7A 2OS8C 1TNXA 3VRQA 5F6TA 1ZMZA 2ZN9A 3WHTB 2QPTA 1SW8A 1X02A 3I5GC 5CSFA 3SG2A 3SG7A 1CLMA 2OPOA 4ZCUA 2GV5A 1XFVO 1CMFA 2JOJA 3OHMB 4IL1A 3IQQA 1TNQA 4OCIA 2I18A 3BOWB 1A4PA 4GGNA 1DF0B 4I5LB 2BE6A 1EG4A 3DVEA 2MA2A 1B7TY 1BU3A 1UP5A 1EJ3A 1CFCA 4Q04A 4MZKA 1K9KA 3EKJA 4CFRA 1HQVA 2JT0A 4NDBA 3ICBA 3F45A 2M7LA 3DVJA 2KAYA 1B47A 1TNPA 3O6BA 2M1KB 5HKWA 1RK9A 2PMYA 3LL8B 2JRFA 5AEQA 5CSNA
chains in the Genus database with same CATH superfamily
2FJUB 3RM1A 1YUUA 1PALA 2Q91A 1F54A 3D75A 1LINA 2BBMA 2EGDA 2L50A 3KPXA 1YTZC 3NSIA 2BCBA 1IWQA 2JZIA 3JTDC 1CNPA 5GQQC 3BFBA 4OVNF 1SY9A 2LVIA 2F33A 1XFXO 5AANA 2LMVA 4IJ7A 3AAJA 2WCMA 2K61A 2WCLA 2JNXA 3SIBA 3D0YB 1IKUA 1JSAA 3NSLA 1RWYA 1QLKA 1TCOB 1QWVA 3BUOB 2R2IA 1YRTB 2JULA 1S5GY 2KAXA 2KNEA 3PATA 2F2OA 1JFKA 2ZN8A 3BFAA 4HSZA 1GGZA 1XFRA 2LMTA 5CSJA 2WNDA 3FWBA 1UHNA 2F3YA 1YUTA 4JPZB 2COLB 1OOIX 3I5IC 2L51A 4ORAB 3OP0A 4HREE 4DIRA 3WHUB 1ORGA 1RJVA 2H61C 2HQ8A 3DZTA 4N5XA 3KF9A 1DJHA 2BCAA 3CLNA 3LCPC 4MSPA 2KDHA 2JXCA 4MBEA 2GGMA 3OB1B 4F0ZB 1QXPA 1Y6WA 5ER4X 1BLQA 4MLWA 1XFZO 1KQMB 1S26D 1CDPA 1JF2A 4D1EA 5HLOA 1Y1XA 1IRJA 4P2YB 3DXLA 5KTYA 1B7TZ 2A4JA 2LVKA 2OTGB 4XJKA 1B1GA 2LVVA 4FTGA 5EL2A 1SL8A 1V1FA 1CB1A 1Z4HA 2L5YA 2KFGA 2YGUA 1IJ6A 4MRXA 3TUYB 1CM1A 5FI7A 4YGCB 4PHKA 1MHOA 2WCKA 4GFTA 3I5FB 2L0PA 2NXQA 3QRXA 2EC6C 2B1UA 1SNLA 2HF5A 2JWWA 2KI6D 2LUCA 1LA3A 1KCYA 1XK4A 2MLEC 1R2UA 1OMVA 4NQGA 5KU1A 1C7WA 1IG5A 3B86A 2F3ZA 3BJHA 4PDZA 3CR2A 1CFPA 2M1UA 1NX2A 1IJ5A 1B8RA 2H61A 1NX3A 1MF8B 2LM5A 1ZACA 2KLEA 2BAPA 5HL1A 2QEHA 4C0JA 1PSRA 1SSEB 5HKYA 3SIAA 2CNPA 4YGBB 3OBVA 1Z2CB 5DKNA 1C07A 1KK7Y 1SCMB 1J7RA 4DRWA 4BY4A 3FS7A 4MVFA 1BG1A 1NPQA 2AUCA 2JTTA 1DC1A 1DELA 1TTXA 3V2LA 1S6JA 1EL4A 1YR5A 4M2PA 1A29A 1NYAA 2M7NA 2MAZA 3JTDB 1TIZA 1ZUZA 3R72A 3CABA 3L4LA 3OGNA 2QDIA 5HLVA 2ZRSA 3I5FC 1C3ZA 1NX1A 2JQ6A 3BOWA 3IVTA 4FQTA 4DCKA 2P71A 2VRGA 1DF0A 1WLMA 1FF1A 1W7JB 1K94A 1SKTA 3NSOA 2PALA 2Y1NA 1XVJA 2PRUA 1RFJA 2CTNA 3IF7A 2JTZA 2BECA 4PCWA 2AMIA 1CKKA 1Y1UA 1WLZA 2FOTA 1OOGA 4E68A 1PVAA 3H4SE 4CFQA 2HQWA 1LA0A 1P28A 2LHIA 2M0RA 1AUIB 1SK6D 2NCPA 2BL0B 4OZDA 1YRUB 1IQ3A 1QTXA 1K93D 3K1EA 5I2QA 2DOQA 1KFXS 4PALA 2KGRA 2WCBA 1OOFA 3S0EA 4UPGA 1DQEA 2KQYA 1KK8B 4TNCA 2JC2A 3TZ1A 1FBVA 5CSIA 2CT9A 5AXIA 1YX8A 4JWQA 4PT1A 1CMGA 5K89A 1K96A 1TUZA 5FI6A 1NCZA 1LVCD 1K8UA 1OZOA 4NDDA 4A4BA 2OS8B 1KSMA 5J3XA 1ALVA 3CR5X 1WY9A 1BT6A 1FI6A 1E8AA 1S36A 3BUXB 3CR4X 2KOTA 2PASA 1QV0A 1MR8A 1WDCB 4DUQA 1MQ1A 5AERA 2E6WA 2LUXA 2M97A 2QACA 1UUSA 3B87A 3FE9A 2MJWB 3DVKA 3CS1A 3PM2A 4PE7A 5G08A 4OV2A 1YURA 3EK4A 1F70A 2IS9A 1BMOA 1XA5A 2MHHA 5JOLA 5ER5A 4MN0A 2CCMA 1WDCC 2HPSA 4JQ0D 1PSBA 2LLUA 1QASA 3I5HC 1KWOB 1CDLA 1W7IB 1S5GZ 3BFHA 5HYDA 5I94A 1Y0VH 2JT3A 1OW4A 3DYEA 2SASA 2KI4C 2NZ0A 4GNKB 1OMRA 2JNFA 1QV1A 1XYDA 2F2PA 2WC6A 2ZKMX 3FIAA 5JJGA 1GGWA 1F55A 5PALA 3AKBA 1CFFA 3GK2A 1CTRA 2PYQA 1XFYO 3KHEA 2H8VA 3S0GA 3SS3A 1BJFA 3GK4X 1J7OA 2KI4B 1QX5B 2K8MB 2O60A 1L2OC 2LE9B 1NCXA 3PSRA 1NSHA 2WCHA 1CLLA 2OTGC 3BUNB 3LK0A 3O2PA 2LAPA 3A8RA 2G2BA 2KFFA 1DMOA 4HRGA 4GUKA 4YI8A 1B9AA 1QVIY 2KGBC 5B8IB 1QS7A 5TNCA 1KFXL 3OB2B 2MBXA 4I5NB 4CPVA 1SR6B 2JXLA 3JVTB 3SG6A 2E30A 2BBNA 1YUSA 5IBWA 3CTNA 3GOFA 1J1DA 2F8PA 3SG5A 1CFDA 1WRLA 2M29A 2KYCA 1ODBA 1WRKA 1SBJA 3VB1A 2FCDA 1A03A 1N65A 2WORA 1QLSA 2L98A 3DF0A 3TDZA 2ZRTA 5DICA 2H2KA 1AHRA 3UNWA 4MZJA 1VRKA 3CYZA 1NX0A 1QVIZ 3D0YA 1DJWA 1A2XA 2ZNDA 3EG5B 4GBAA 2K0JA 1NWDA 3OX6A 3R1OA 3FWCA 1N2DA 3DY9A 1MXEA 3PFVA 1K2HA 3O4YA 1S6CA 2Y1MA 1FW4A 4N1FA 1DJGA 1TWOA 4PE1A 3SS4A 2MLFC 1NP8A 3Q8IA 3R1VA 3VROA 3AAKA 3NHTA 1CLBA 3O78A 4YGAA 1MUXA 1TRFA 2K7DA 1J7PA 3TDUA 2LP3A 1PK0D 2CXJA 3CZ2A 3TUYC 1F8HA 1A75B 2EC6B 1WRZA 2K2AA 1JWDA 2Y5IA 3CZTX 1G4YR 2BNXA 4C0KA 1BODA 4WRIA 2BCXA 4XJKB 3RZSA 1OSAA 2M8UA 2D8NA 1OQPA 1K90D 4GAOA 1DGVA 1OMDA 1QX7A 3WXAA 2I7AA 3EVUA 1YVLA 2G9BA 3KEVA 1GQMA 1S3PA 2KQ6A 2WCEA 2JT8A 3PN7C 3D77A 2LP2A 4AOMA 4ORBB 2K2FA 1XO5A 5DKQA 1L2OB 1DJYA 1MXLC 3GK1A 3DD4A 5CPVA 1F71A 1C3YA 4ICBA 3VRPA 4NDCA 3FE6A 2K60A 1TOPA 1S6IA 2JPOA 2WC8A 4DS7A 1UURA 1MWNA 2K7CA 2QEVA 1OOHA 1DEKA 1UWOA 1UHJA 1M46A 1G33A 1LKJA 2K7OA 2Y4QA 3PLFB 4YGDB 1K9UA 4GPLB 2LV7A 3BUMB 2L2EA 1AJ5A 1F4OA 3PJIA 1UHIA 1ZFSA 3DF0B 1DJZA 1M39A 1PVBA 3B7AA 5D7FA 1KK8C 1AP4A 1IIOA 2ERBA 4PE0A 1RROA 2V53A 1H8BA 3N7HA 1M45A 1TN4A 1LXFC 1NCYA 3PN7B 2M49B 2HETA 3CWGA 3PALA 3BQ3A 4XYNA 1FPWA 1KFUS 2ZFDA 1D1OA 4HRHA 1FI5A 2L2CA 3D78A 4ETOA 1SCVA 3EKHA 4PHMA 1U5IA 4YBHB 1BR1B 2PQLA 4L9MA 3VGOA 2ZNEA 1PRWA 2M3WA 1DT7B 1CDNA 1SCMC 4PHNA 2KBMA 3EK7A 3FE8A 4N1GA 1RTP1 3I5IB 3RLZA 3K21A 2AAOA 1W9ZA 1GM0A 3WNXB 3ZWHA 2LMUA 4OR9B 2LANA 1JBAA 1A75A 2TN4A 4FQOA 4JKTA 1NUBA 3HCMA 3KO0A 4U8DA 4MZLA 2BL0C 4ORCB 3B6XA 1EG3A 1K9PA 2KSPA 1V1GA 1TNWA 2BKHB 3SS5A 2I94A 2KBIA 5D3OA 3BXKA 1GJYA 3B88A 2EHBA 1AVSA 2M9GA 2LVJA 1LS8A 1Y1AA 1J55A 1JC2A 1J1EA 1SPYA 3TS5B 1K95A 1DGUA 1SMGA 2BE4A 2NLNA 3VRNA 5BPJA 1B4CA 1HT9A 4AQJA 1JF0A 1IGVA 3SG3A 1YVHA 3CZ1A 4GGFC 1QATA 2PVBA 4M2QA 1QIVA 4YI9A 3TS5C 3DVMA 2JPTA 4AQIA 1KQVA 1RECA 2K7BA 1J7QA 3BUWB 3TDIA 5FYXA 4YRUA 2LLTA 4CLNA 1UHKA 3SG4A 2PSRA 1SL9A 4R1EA 1UHHA 4WQ3A 4MEWA 5KSZA 4PHJA 3D10A 1F4QA 5I2LA 3I5HB 1AK8A 1B8LA 2CBLA 2P6BB 2KYFA 3ZNIA 4F7FA 1TUJA 4MRYA 5D69A 1DJXA 3R1PA 3SJSA 1CDMA 5DKRA 1SRAA 1BR4B 3NXAA 4ZCVA 1U5IB 5FI2A 3D76A 5HKZA 2ISDA 1NIWA 2LC5A 2GTEA 4PE4A 4I5KA 1BF5A 1DJIA 3I5GB 1ALWA 2WOSA 1N0YA 1EH2A 1IQ5A 1DVIA 5AFPA 3HX4A 2QEOA 1DTLA 4JD9A 3EK8A 3MSEB 4C0LA 2P70A 2NCOA 1PULA 1KQMC 1B8CA 3A4UB 3QMEA 2MRDA 3NHIA 2LHLA 2JU0A 2KFHA 1QJTA 1TCFA 2WC5A 2Q4UA 1C7VA 1M63B 1SR6C 2LNKA 3C1VA 3JVTC 2RGIA 1G8IA 1KFUL 2SCPA 1KK7Z 3BYAA 2L5XB 4QJ4B 1XK4C 2LLSA 3EVRA 3S0AA 4OKHA 1CM4A 2WCFA 3D74A 3LLEA 2KHNA 3NSKA 1BOCA 2WCJA 2L4IA 4M2OA 1EXRA 3EVVA 1S1EA 2FJYA 1OE9B 1QIWA 4QJ3B 4BY5A 1R6PA 1L7ZA 3IQOA 2KLDA 1YX7A 2O5GA 4I5JA 2KAVA 1OZSA 4QJ5B 2KI6C 1Q80A 1SYMA 3E3RA 5I8NA 1ZOTB 1T14A 1KSOA 1JFJA 3PM8A 4INWA 4WQ2A 2LCPA 1M31A 4USLA 4GGFA 4A4CA 2FCEA 1XFWO 2L4HA 4YGEB 4CIDA 5I2OA 1OOJA 3CDNA 3LK1A 2I2RE 3OX5A 3AKAA 1AJ4A 2GGZA 3VRRA 1H4BA 1JUOA 3M0WA 4P5OE 2BKIB 1KWOC 1QX2A 1XFUO 3CGAA 3L47A 1SL7A 2OS8C 1IH0A 1TNXA 3VRQA 5F6TA 1ZMZA 2ZN9A 3WHTB 2QPTA 2KPHA 1SW8A 1X02A 3I5GC 5CSFA 3SG2A 3O4XA 3SG7A 1CLMA 2OPOA 4ZCUA 2GV5A 1XFVO 1CMFA 2JOJA 3S0BA 3OHMB 4IL1A 3IQQA 1TNQA 4OCIA 2I18A 3BOWB 1A4PA 4GGNA 1DF0B 4I5LB 2BE6A 1EG4A 3DVEA 2MA2A 1B7TY 1BU3A 1UP5A 1EJ3A 3NGVA 3S0DA 1CFCA 4Q04A 3S0FA 4MZKA 1K9KA 3EKJA 3UO9A 2QEBA 4KYNA 4CFRA 1HQVA 2JT0A 4NDBA 3ICBA 3F45A 3L4AA 3D73A 2M7LA 3DVJA 2KAYA 1B47A 1TNPA 3O6BA 2M1KB 5HKWA 1RK9A 4INXA 2PMYA 3LL8B 2JRFA 5AEQA 5CSNA 3CZ0A
chains in the Genus database with same CATH topology
2FJUB 3RM1A 1YUUA 1PALA 2Q91A 1F54A 1LINA 2BBMA 2EGDA 2L50A 3KPXA 1YTZC 3NSIA 2BCBA 1IWQA 2JZIA 3JTDC 1CNPA 5GQQC 4OVNF 1SY9A 2LVIA 2F33A 1XFXO 5AANA 2LMVA 3AAJA 2K61A 1IKUA 2JNXA 1JSAA 3D0YB 3NSLA 1RWYA 1QLKA 1TCOB 3BUOB 2R2IA 1YRTB 2JULA 1S5GY 2KAXA 2KNEA 3PATA 2F2OA 1JFKA 2ZN8A 4HSZA 1GGZA 2LMTA 5CSJA 2WNDA 3FWBA 1UHNA 2F3YA 1YUTA 4JPZB 2COLB 3I5IC 4DIRA 2L51A 4ORAB 3OP0A 4HREE 3WHUB 3SG4A 1RJVA 2H61C 2HQ8A 4N5XA 3KF9A 1DJHA 2BCAA 3CLNA 3LCPC 4MSPA 2KDHA 2JXCA 4MBEA 2GGMA 3OB1B 4F0ZB 1QXPA 1Y6WA 5ER4X 1BLQA 4MLWA 1XFZO 1KQMB 1S26D 1CDPA 1JF2A 4D1EA 5HLOA 1Y1XA 1IRJA 4P2YB 5KTYA 1B7TZ 2A4JA 2LVKA 2OTGB 4XJKA 1B1GA 2LVVA 4FTGA 1SL8A 1V1FA 1CB1A 2KFGA 1IJ6A 4MRXA 3TUYB 1CM1A 4YGCB 4PHKA 1MHOA 4GFTA 3I5FB 2L0PA 2NXQA 3QRXA 2EC6C 2B1UA 1SNLA 2HF5A 2JWWA 2KI6D 2LUCA 1LA3A 1KCYA 1XK4A 2MLEC 1R2UA 1OMVA 4NQGA 5KU1A 1C7WA 1IG5A 4PDZA 2F3ZA 1CFPA 3CR2A 2M1UA 1NX2A 1IJ5A 1B8RA 2H61A 1NX3A 1MF8B 2LM5A 1ZACA 4C0JA 1PSRA 5HKYA 3SIAA 2CNPA 4YGBB 5DKNA 1C07A 1KK7Y 1SCMB 1J7RA 4DRWA 4BY4A 3FS7A 4MVFA 1BG1A 1NPQA 2AUCA 2JTTA 1TTXA 1S6JA 1EL4A 1YR5A 4M2PA 1A29A 1NYAA 2M7NA 2MAZA 3JTDB 1TIZA 1ZUZA 5HLVA 2ZRSA 3I5FC 1NX1A 2JQ6A 3BOWA 4DCKA 2VRGA 1DF0A 1WLMA 1FF1A 1W7JB 1K94A 1SKTA 3NSOA 2PALA 2Y1NA 1XVJA 2PRUA 1RFJA 2CTNA 3IF7A 2JTZA 2BECA 4PCWA 2AMIA 1CKKA 1Y1UA 1WLZA 2FOTA 4E68A 1PVAA 3H4SE 4CFQA 2HQWA 1LA0A 2LHIA 2M0RA 1AUIB 1SK6D 2NCPA 2BL0B 1YRUB 1IQ3A 1QTXA 1K93D 5I2QA 2DOQA 1KFXS 4PALA 2KGRA 2WCBA 4UPGA 4TNCA 2KQYA 1KK8B 2JC2A 3TZ1A 1FBVA 5CSIA 2CT9A 5AXIA 1YX8A 4JWQA 1CMGA 5K89A 1K96A 1NCZA 1LVCD 1K8UA 1OZOA 4NDDA 4A4BA 2OS8B 1KSMA 5J3XA 1ALVA 3CR5X 1WY9A 1BT6A 1FI6A 1E8AA 1S36A 3BUXB 3CR4X 2KOTA 2PASA 1QV0A 1MR8A 1WDCB 4DUQA 1MQ1A 5AERA 2E6WA 2LUXA 2M97A 2QACA 1UUSA 4PE7A 3SIBA 2MJWB 3DVKA 3CS1A 5G08A 4OV2A 1YURA 3EK4A 1F70A 2IS9A 1BMOA 1XA5A 2MHHA 5JOLA 5ER5A 4MN0A 2CCMA 1WDCC 2HPSA 4JQ0D 1PSBA 2LLUA 1QASA 3I5HC 1KWOB 1CDLA 1W7IB 1S5GZ 5HYDA 1Y0VH 2JT3A 2SASA 2KI4C 2NZ0A 4GNKB 1OMRA 2JNFA 1QV1A 1XYDA 2F2PA 2ZKMX 5JJGA 3FIAA 1GGWA 1F55A 5PALA 3AKBA 1CFFA 3GK2A 1CTRA 1XFYO 3KHEA 1BJFA 3GK4X 1J7OA 2KI4B 1QX5B 2K8MB 2O60A 1L2OC 2LE9B 1NCXA 3PSRA 1NSHA 1CLLA 2OTGC 3BUNB 3LK0A 3O2PA 2LAPA 3A8RA 2G2BA 2KFFA 1DMOA 4HRGA 4GUKA 4YI8A 1B9AA 1QVIY 2KGBC 5B8IB 1QS7A 5TNCA 1KFXL 3OB2B 2MBXA 4I5NB 4CPVA 1SR6B 2JXLA 3JVTB 3SG6A 2E30A 2BBNA 1YUSA 5IBWA 3CTNA 3GOFA 1J1DA 2F8PA 3SG5A 1CFDA 1WRLA 2M29A 2KYCA 1ODBA 1WRKA 1SBJA 2FCDA 1A03A 1N65A 2WORA 1QLSA 2L98A 3DF0A 3TDZA 2ZRTA 2H2KA 1AHRA 4MZJA 1VRKA 3D0YA 1NX0A 1QVIZ 4GBAA 1DJWA 1A2XA 2ZNDA 2K0JA 1NWDA 3OX6A 3FWCA 1N2DA 1MXEA 3PFVA 1K2HA 3O4YA 1S6CA 2Y1MA 1FW4A 4N1FA 1DJGA 4PE1A 2MLFC 1NP8A 3VROA 3AAKA 1CLBA 3O78A 4YGAA 1MUXA 1TRFA 2K7DA 1J7PA 3TDUA 2LP3A 1PK0D 2CXJA 1F8HA 3TUYC 1A75B 2EC6B 1WRZA 2K2AA 1JWDA 2Y5IA 3CZTX 1G4YR 4C0KA 1BODA 4WRIA 2BCXA 4XJKB 1OSAA 2M8UA 2D8NA 1OQPA 1K90D 4GAOA 1DGVA 1OMDA 1QX7A 3WXAA 2I7AA 3EVUA 1YVLA 2G9BA 3KEVA 1GQMA 1S3PA 2KQ6A 2WCEA 2JT8A 3PN7C 2LP2A 4AOMA 4ORBB 2K2FA 1XO5A 5DKQA 1L2OB 1DJYA 1MXLC 3GK1A 3DD4A 5CPVA 1F71A 4ICBA 3VRPA 4NDCA 1TOPA 1S6IA 2WC8A 4DS7A 1UURA 1MWNA 2K7CA 1UWOA 1UHJA 1M46A 1G33A 1LKJA 2K7OA 2Y4QA 3PLFB 4YGDB 1K9UA 4GPLB 2LV7A 3BUMB 2L2EA 1AJ5A 1F4OA 1UHIA 1ZFSA 3DF0B 1DJZA 1M39A 1PVBA 5D7FA 1KK8C 1AP4A 4PE0A 1RROA 2V53A 1H8BA 1M45A 1TN4A 1LXFC 1NCYA 3PN7B 2M49B 2HETA 3CWGA 3PALA 3BQ3A 4XYNA 1FPWA 1KFUS 2ZFDA 1D1OA 4HRHA 1FI5A 4ETOA 1SCVA 3EKHA 4PHMA 1U5IA 4YBHB 1BR1B 4L9MA 3VGOA 2ZNEA 1PRWA 2M3WA 1DT7B 1CDNA 1SCMC 4PHNA 2KBMA 3EK7A 4N1GA 1RTP1 3I5IB 3RLZA 3K21A 2AAOA 3WNXB 3ZWHA 2LMUA 4OR9B 2LANA 1JBAA 1A75A 2TN4A 4FQOA 1NUBA 3HCMA 3KO0A 4U8DA 4MZLA 2BL0C 4ORCB 1EG3A 1K9PA 2KSPA 1V1GA 1TNWA 2BKHB 2I94A 2KBIA 3BXKA 1GJYA 2EHBA 1AVSA 2M9GA 2LVJA 1Y1AA 1J55A 1JC2A 1J1EA 1SPYA 3TS5B 1K95A 1DGUA 1SMGA 2BE4A 2NLNA 3VRNA 5BPJA 1B4CA 1HT9A 4AQJA 1JF0A 1IGVA 3SG3A 1YVHA 4GGFC 1QATA 2PVBA 4M2QA 1QIVA 4YI9A 3TS5C 3DVMA 2JPTA 4AQIA 1KQVA 1RECA 2K7BA 1J7QA 3BUWB 3TDIA 5FYXA 4YRUA 2LLTA 4CLNA 1UHKA 2PSRA 1SL9A 4R1EA 1UHHA 4WQ3A 4MEWA 5KSZA 4PHJA 3D10A 1F4QA 5I2LA 3I5HB 1AK8A 1B8LA 2CBLA 2P6BB 2KYFA 3ZNIA 4MRYA 5D69A 1DJXA 3SJSA 1CDMA 5DKRA 1SRAA 1BR4B 3NXAA 4ZCVA 1U5IB 5HKZA 2ISDA 1NIWA 2LC5A 4PE4A 4I5KA 1BF5A 1DJIA 3I5GB 1ALWA 2WOSA 1N0YA 1EH2A 1IQ5A 1DVIA 5AFPA 3HX4A 1DTLA 3EK8A 3MSEB 4C0LA 2NCOA 1PULA 1KQMC 1B8CA 3A4UB 2MRDA 2LHLA 2JU0A 2KFHA 1QJTA 1TCFA 2Q4UA 1C7VA 1M63B 1SR6C 2LNKA 3C1VA 3JVTC 2RGIA 1G8IA 1KFUL 2SCPA 1KK7Z 3BYAA 2L5XB 4QJ4B 1XK4C 2LLSA 3EVRA 4OKHA 1CM4A 2WCFA 3LLEA 2KHNA 3NSKA 1BOCA 2L4IA 4M2OA 1EXRA 3EVVA 1S1EA 4QJ3B 1OE9B 1QIWA 4BY5A 1R6PA 1L7ZA 3IQOA 1YX7A 2O5GA 4I5JA 2KAVA 1OZSA 4QJ5B 2KI6C 1Q80A 1SYMA 3E3RA 5I8NA 1ZOTB 1JFJA 1KSOA 3PM8A 4WQ2A 2LCPA 1M31A 4USLA 4GGFA 4A4CA 2FCEA 1XFWO 2L4HA 4YGEB 4CIDA 5I2OA 1OOJA 3OX5A 3LK1A 2I2RE 3AKAA 1AJ4A 2GGZA 3VRRA 1H4BA 1JUOA 3M0WA 4P5OE 2BKIB 1KWOC 1QX2A 1XFUO 3CGAA 1IH0A 1SL7A 2OS8C 1TNXA 3VRQA 5F6TA 1ZMZA 2ZN9A 3WHTB 2QPTA 1SW8A 1X02A 3I5GC 5CSFA 3SG2A 3SG7A 1CLMA 2OPOA 4ZCUA 2GV5A 1XFVO 1CMFA 2JOJA 3OHMB 4IL1A 3IQQA 1TNQA 4OCIA 2I18A 3BOWB 1A4PA 4GGNA 1DF0B 4I5LB 2BE6A 1EG4A 3DVEA 2MA2A 1B7TY 1BU3A 1UP5A 1EJ3A 1CFCA 4Q04A 4MZKA 1K9KA 3EKJA 4CFRA 1HQVA 2JT0A 4NDBA 3ICBA 3F45A 2M7LA 3DVJA 2KAYA 1B47A 1TNPA 3O6BA 2M1KB 5HKWA 1RK9A 2PMYA 3LL8B 2JRFA 5AEQA 5CSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJU B;  3RM1 A;  1YUU A;  1PAL A;  2Q91 A;  1F54 A;  1LIN A;  2BBM A;  2EGD A;  2L50 A;  3KPX A;  1YTZ C;  3NSI A;  2BCB A;  1IWQ A;  2JZI A;  3JTD C;  1CNP A;  5GQQ C;  4OVN F;  1SY9 A;  2LVI A;  2F33 A;  1XFX O;  5AAN A;  2LMV A;  3AAJ A;  2K61 A;  1IKU A;  2JNX A;  1JSA A;  3D0Y B;  3NSL A;  1RWY A;  1QLK A;  1TCO B;  3BUO B;  2R2I A;  1YRT B;  2JUL A;  1S5G Y;  2KAX A;  2KNE A;  3PAT A;  2F2O A;  1JFK A;  2ZN8 A;  4HSZ A;  1GGZ A;  2LMT A;  5CSJ A;  2WND A;  3FWB A;  1UHN A;  2F3Y A;  1YUT A;  4JPZ B;  2COL B;  3I5I C;  4DIR A;  2L51 A;  4ORA B;  3OP0 A;  4HRE E;  3WHU B;  3SG4 A;  1RJV A;  2H61 C;  2HQ8 A;  4N5X A;  3KF9 A;  1DJH A;  2BCA A;  3CLN A;  3LCP C;  4MSP A;  2KDH A;  2JXC A;  4MBE A;  2GGM A;  3OB1 B;  4F0Z B;  1QXP A;  1Y6W A;  5ER4 X;  1BLQ A;  4MLW A;  1XFZ O;  1KQM B;  1S26 D;  1CDP A;  1JF2 A;  4D1E A;  5HLO A;  1Y1X A;  1IRJ A;  4P2Y B;  5KTY A;  1B7T Z;  2A4J A;  2LVK A;  2OTG B;  4XJK A;  1B1G A;  2LVV A;  4FTG A;  1SL8 A;  1V1F A;  1CB1 A;  2KFG A;  1IJ6 A;  4MRX A;  3TUY B;  1CM1 A;  4YGC B;  4PHK A;  1MHO A;  4GFT A;  3I5F B;  2L0P A;  2NXQ A;  3QRX A;  2EC6 C;  2B1U A;  1SNL A;  2HF5 A;  2JWW A;  2KI6 D;  2LUC A;  1LA3 A;  1KCY A;  1XK4 A;  2MLE C;  1R2U A;  1OMV A;  4NQG A;  5KU1 A;  1C7W A;  1IG5 A;  4PDZ A;  2F3Z A;  1CFP A;  3CR2 A;  2M1U A;  1NX2 A;  1IJ5 A;  1B8R A;  2H61 A;  1NX3 A;  1MF8 B;  2LM5 A;  1ZAC A;  4C0J A;  1PSR A;  5HKY A;  3SIA A;  2CNP A;  4YGB B;  5DKN A;  1C07 A;  1KK7 Y;  1SCM B;  1J7R A;  4DRW A;  4BY4 A;  3FS7 A;  4MVF A;  1BG1 A;  1NPQ A;  2AUC A;  2JTT A;  1TTX A;  1S6J A;  1EL4 A;  1YR5 A;  4M2P A;  1A29 A;  1NYA A;  2M7N A;  2MAZ A;  3JTD B;  1TIZ A;  1ZUZ A;  5HLV A;  2ZRS A;  3I5F C;  1NX1 A;  2JQ6 A;  3BOW A;  4DCK A;  2VRG A;  1DF0 A;  1WLM A;  1FF1 A;  1W7J B;  1K94 A;  1SKT A;  3NSO A;  2PAL A;  2Y1N A;  1XVJ A;  2PRU A;  1RFJ A;  2CTN A;  3IF7 A;  2JTZ A;  2BEC A;  4PCW A;  2AMI A;  1CKK A;  1Y1U A;  1WLZ A;  2FOT A;  4E68 A;  1PVA A;  3H4S E;  4CFQ A;  2HQW A;  1LA0 A;  2LHI A;  2M0R A;  1AUI B;  1SK6 D;  2NCP A;  2BL0 B;  1YRU B;  1IQ3 A;  1QTX A;  1K93 D;  5I2Q A;  2DOQ A;  1KFX S;  4PAL A;  2KGR A;  2WCB A;  4UPG A;  4TNC A;  2KQY A;  1KK8 B;  2JC2 A;  3TZ1 A;  1FBV A;  5CSI A;  2CT9 A;  5AXI A;  1YX8 A;  4JWQ A;  1CMG A;  5K89 A;  1K96 A;  1NCZ A;  1LVC D;  1K8U A;  1OZO A;  4NDD A;  4A4B A;  2OS8 B;  1KSM A;  5J3X A;  1ALV A;  3CR5 X;  1WY9 A;  1BT6 A;  1FI6 A;  1E8A A;  1S36 A;  3BUX B;  3CR4 X;  2KOT A;  2PAS A;  1QV0 A;  1MR8 A;  1WDC B;  4DUQ A;  1MQ1 A;  5AER A;  2E6W A;  2LUX A;  2M97 A;  2QAC A;  1UUS A;  4PE7 A;  3SIB A;  2MJW B;  3DVK A;  3CS1 A;  5G08 A;  4OV2 A;  1YUR A;  3EK4 A;  1F70 A;  2IS9 A;  1BMO A;  1XA5 A;  2MHH A;  5JOL A;  5ER5 A;  4MN0 A;  2CCM A;  1WDC C;  2HPS A;  4JQ0 D;  1PSB A;  2LLU A;  1QAS A;  3I5H C;  1KWO B;  1CDL A;  1W7I B;  1S5G Z;  5HYD A;  1Y0V H;  2JT3 A;  2SAS A;  2KI4 C;  2NZ0 A;  4GNK B;  1OMR A;  2JNF A;  1QV1 A;  1XYD A;  2F2P A;  2ZKM X;  5JJG A;  3FIA A;  1GGW A;  1F55 A;  5PAL A;  3AKB A;  1CFF A;  3GK2 A;  1CTR A;  1XFY O;  3KHE A;  1BJF A;  3GK4 X;  1J7O A;  2KI4 B;  1QX5 B;  2K8M B;  2O60 A;  1L2O C;  2LE9 B;  1NCX A;  3PSR A;  1NSH A;  1CLL A;  2OTG C;  3BUN B;  3LK0 A;  3O2P A;  2LAP A;  3A8R A;  2G2B A;  2KFF A;  1DMO A;  4HRG A;  4GUK A;  4YI8 A;  1B9A A;  1QVI Y;  2KGB C;  5B8I B;  1QS7 A;  5TNC A;  1KFX L;  3OB2 B;  2MBX A;  4I5N B;  4CPV A;  1SR6 B;  2JXL A;  3JVT B;  3SG6 A;  2E30 A;  2BBN A;  1YUS A;  5IBW A;  3CTN A;  3GOF A;  1J1D A;  2F8P A;  3SG5 A;  1CFD A;  1WRL A;  2M29 A;  2KYC A;  1ODB A;  1WRK A;  1SBJ A;  2FCD A;  1A03 A;  1N65 A;  2WOR A;  1QLS A;  2L98 A;  3DF0 A;  3TDZ A;  2ZRT A;  2H2K A;  1AHR A;  4MZJ A;  1VRK A;  3D0Y A;  1NX0 A;  1QVI Z;  4GBA A;  1DJW A;  1A2X A;  2ZND A;  2K0J A;  1NWD A;  3OX6 A;  3FWC A;  1N2D A;  1MXE A;  3PFV A;  1K2H A;  3O4Y A;  1S6C A;  2Y1M A;  1FW4 A;  4N1F A;  1DJG A;  4PE1 A;  2MLF C;  1NP8 A;  3VRO A;  3AAK A;  1CLB A;  3O78 A;  4YGA A;  1MUX A;  1TRF A;  2K7D A;  1J7P A;  3TDU A;  2LP3 A;  1PK0 D;  2CXJ A;  1F8H A;  3TUY C;  1A75 B;  2EC6 B;  1WRZ A;  2K2A A;  1JWD A;  2Y5I A;  3CZT X;  1G4Y R;  4C0K A;  1BOD A;  4WRI A;  2BCX A;  4XJK B;  1OSA A;  2M8U A;  2D8N A;  1OQP A;  1K90 D;  4GAO A;  1DGV A;  1OMD A;  1QX7 A;  3WXA A;  2I7A A;  3EVU A;  1YVL A;  2G9B A;  3KEV A;  1GQM A;  1S3P A;  2KQ6 A;  2WCE A;  2JT8 A;  3PN7 C;  2LP2 A;  4AOM A;  4ORB B;  2K2F A;  1XO5 A;  5DKQ A;  1L2O B;  1DJY A;  1MXL C;  3GK1 A;  3DD4 A;  5CPV A;  1F71 A;  4ICB A;  3VRP A;  4NDC A;  1TOP A;  1S6I A;  2WC8 A;  4DS7 A;  1UUR A;  1MWN A;  2K7C A;  1UWO A;  1UHJ A;  1M46 A;  1G33 A;  1LKJ A;  2K7O A;  2Y4Q A;  3PLF B;  4YGD B;  1K9U A;  4GPL B;  2LV7 A;  3BUM B;  2L2E A;  1AJ5 A;  1F4O A;  1UHI A;  1ZFS A;  3DF0 B;  1DJZ A;  1M39 A;  1PVB A;  5D7F A;  1KK8 C;  1AP4 A;  4PE0 A;  1RRO A;  2V53 A;  1H8B A;  1M45 A;  1TN4 A;  1LXF C;  1NCY A;  3PN7 B;  2M49 B;  2HET A;  3CWG A;  3PAL A;  3BQ3 A;  4XYN A;  1FPW A;  1KFU S;  2ZFD A;  1D1O A;  4HRH A;  1FI5 A;  4ETO A;  1SCV A;  3EKH A;  4PHM A;  1U5I A;  4YBH B;  1BR1 B;  4L9M A;  3VGO A;  2ZNE A;  1PRW A;  2M3W A;  1DT7 B;  1CDN A;  1SCM C;  4PHN A;  2KBM A;  3EK7 A;  4N1G A;  1RTP 1;  3I5I B;  3RLZ A;  3K21 A;  2AAO A;  3WNX B;  3ZWH A;  2LMU A;  4OR9 B;  2LAN A;  1JBA A;  1A75 A;  2TN4 A;  4FQO A;  1NUB A;  3HCM A;  3KO0 A;  4U8D A;  4MZL A;  2BL0 C;  4ORC B;  1EG3 A;  1K9P A;  2KSP A;  1V1G A;  1TNW A;  2BKH B;  2I94 A;  2KBI A;  3BXK A;  1GJY A;  2EHB A;  1AVS A;  2M9G A;  2LVJ A;  1Y1A A;  1J55 A;  1JC2 A;  1J1E A;  1SPY A;  3TS5 B;  1K95 A;  1DGU A;  1SMG A;  2BE4 A;  2NLN A;  3VRN A;  5BPJ A;  1B4C A;  1HT9 A;  4AQJ A;  1JF0 A;  1IGV A;  3SG3 A;  1YVH A;  4GGF C;  1QAT A;  2PVB A;  4M2Q A;  1QIV A;  4YI9 A;  3TS5 C;  3DVM A;  2JPT A;  4AQI A;  1KQV A;  1REC A;  2K7B A;  1J7Q A;  3BUW B;  3TDI A;  5FYX A;  4YRU A;  2LLT A;  4CLN A;  1UHK A;  2PSR A;  1SL9 A;  4R1E A;  1UHH A;  4WQ3 A;  4MEW A;  5KSZ A;  4PHJ A;  3D10 A;  1F4Q A;  5I2L A;  3I5H B;  1AK8 A;  1B8L A;  2CBL A;  2P6B B;  2KYF A;  3ZNI A;  4MRY A;  5D69 A;  1DJX A;  3SJS A;  1CDM A;  5DKR A;  1SRA A;  1BR4 B;  3NXA A;  4ZCV A;  1U5I B;  5HKZ A;  2ISD A;  1NIW A;  2LC5 A;  4PE4 A;  4I5K A;  1BF5 A;  1DJI A;  3I5G B;  1ALW A;  2WOS A;  1N0Y A;  1EH2 A;  1IQ5 A;  1DVI A;  5AFP A;  3HX4 A;  1DTL A;  3EK8 A;  3MSE B;  4C0L A;  2NCO A;  1PUL A;  1KQM C;  1B8C A;  3A4U B;  2MRD A;  2LHL A;  2JU0 A;  2KFH A;  1QJT A;  1TCF A;  2Q4U A;  1C7V A;  1M63 B;  1SR6 C;  2LNK A;  3C1V A;  3JVT C;  2RGI A;  1G8I A;  1KFU L;  2SCP A;  1KK7 Z;  3BYA A;  2L5X B;  4QJ4 B;  1XK4 C;  2LLS A;  3EVR A;  4OKH A;  1CM4 A;  2WCF A;  3LLE A;  2KHN A;  3NSK A;  1BOC A;  2L4I A;  4M2O A;  1EXR A;  3EVV A;  1S1E A;  4QJ3 B;  1OE9 B;  1QIW A;  4BY5 A;  1R6P A;  1L7Z A;  3IQO A;  1YX7 A;  2O5G A;  4I5J A;  2KAV A;  1OZS A;  4QJ5 B;  2KI6 C;  1Q80 A;  1SYM A;  3E3R A;  5I8N A;  1ZOT B;  1JFJ A;  1KSO A;  3PM8 A;  4WQ2 A;  2LCP A;  1M31 A;  4USL A;  4GGF A;  4A4C A;  2FCE A;  1XFW O;  2L4H A;  4YGE B;  4CID A;  5I2O A;  1OOJ A;  3OX5 A;  3LK1 A;  2I2R E;  3AKA A;  1AJ4 A;  2GGZ A;  3VRR A;  1H4B A;  1JUO A;  3M0W A;  4P5O E;  2BKI B;  1KWO C;  1QX2 A;  1XFU O;  3CGA A;  1IH0 A;  1SL7 A;  2OS8 C;  1TNX A;  3VRQ A;  5F6T A;  1ZMZ A;  2ZN9 A;  3WHT B;  2QPT A;  1SW8 A;  1X02 A;  3I5G C;  5CSF A;  3SG2 A;  3SG7 A;  1CLM A;  2OPO A;  4ZCU A;  2GV5 A;  1XFV O;  1CMF A;  2JOJ A;  3OHM B;  4IL1 A;  3IQQ A;  1TNQ A;  4OCI A;  2I18 A;  3BOW B;  1A4P A;  4GGN A;  1DF0 B;  4I5L B;  2BE6 A;  1EG4 A;  3DVE A;  2MA2 A;  1B7T Y;  1BU3 A;  1UP5 A;  1EJ3 A;  1CFC A;  4Q04 A;  4MZK A;  1K9K A;  3EKJ A;  4CFR A;  1HQV A;  2JT0 A;  4NDB A;  3ICB A;  3F45 A;  2M7L A;  3DVJ A;  2KAY A;  1B47 A;  1TNP A;  3O6B A;  2M1K B;  5HKW A;  1RK9 A;  2PMY A;  3LL8 B;  2JRF A;  5AEQ A;  5CSN A; 
#chains in the Genus database with same CATH topology
 2FJU B;  3RM1 A;  1YUU A;  1PAL A;  2Q91 A;  1F54 A;  3D75 A;  1LIN A;  2BBM A;  2EGD A;  2L50 A;  3KPX A;  1YTZ C;  3NSI A;  2BCB A;  1IWQ A;  2JZI A;  3JTD C;  1CNP A;  5GQQ C;  3BFB A;  4OVN F;  1SY9 A;  2LVI A;  2F33 A;  1XFX O;  5AAN A;  2LMV A;  4IJ7 A;  3AAJ A;  2WCM A;  2K61 A;  2WCL A;  2JNX A;  3SIB A;  3D0Y B;  1IKU A;  1JSA A;  3NSL A;  1RWY A;  1QLK A;  1TCO B;  1QWV A;  3BUO B;  2R2I A;  1YRT B;  2JUL A;  1S5G Y;  2KAX A;  2KNE A;  3PAT A;  2F2O A;  1JFK A;  2ZN8 A;  3BFA A;  4HSZ A;  1GGZ A;  1XFR A;  2LMT A;  5CSJ A;  2WND A;  3FWB A;  1UHN A;  2F3Y A;  1YUT A;  4JPZ B;  2COL B;  1OOI X;  3I5I C;  2L51 A;  4ORA B;  3OP0 A;  4HRE E;  4DIR A;  3WHU B;  1ORG A;  1RJV A;  2H61 C;  2HQ8 A;  3DZT A;  4N5X A;  3KF9 A;  1DJH A;  2BCA A;  3CLN A;  3LCP C;  4MSP A;  2KDH A;  2JXC A;  4MBE A;  2GGM A;  3OB1 B;  4F0Z B;  1QXP A;  1Y6W A;  5ER4 X;  1BLQ A;  4MLW A;  1XFZ O;  1KQM B;  1S26 D;  1CDP A;  1JF2 A;  4D1E A;  5HLO A;  1Y1X A;  1IRJ A;  4P2Y B;  3DXL A;  5KTY A;  1B7T Z;  2A4J A;  2LVK A;  2OTG B;  4XJK A;  1B1G A;  2LVV A;  4FTG A;  5EL2 A;  1SL8 A;  1V1F A;  1CB1 A;  1Z4H A;  2L5Y A;  2KFG A;  2YGU A;  1IJ6 A;  4MRX A;  3TUY B;  1CM1 A;  5FI7 A;  4YGC B;  4PHK A;  1MHO A;  2WCK A;  4GFT A;  3I5F B;  2L0P A;  2NXQ A;  3QRX A;  2EC6 C;  2B1U A;  1SNL A;  2HF5 A;  2JWW A;  2KI6 D;  2LUC A;  1LA3 A;  1KCY A;  1XK4 A;  2MLE C;  1R2U A;  1OMV A;  4NQG A;  5KU1 A;  1C7W A;  1IG5 A;  3B86 A;  2F3Z A;  3BJH A;  4PDZ A;  3CR2 A;  1CFP A;  2M1U A;  1NX2 A;  1IJ5 A;  1B8R A;  2H61 A;  1NX3 A;  1MF8 B;  2LM5 A;  1ZAC A;  2KLE A;  2BAP A;  5HL1 A;  2QEH A;  4C0J A;  1PSR A;  1SSE B;  5HKY A;  3SIA A;  2CNP A;  4YGB B;  3OBV A;  1Z2C B;  5DKN A;  1C07 A;  1KK7 Y;  1SCM B;  1J7R A;  4DRW A;  4BY4 A;  3FS7 A;  4MVF A;  1BG1 A;  1NPQ A;  2AUC A;  2JTT A;  1DC1 A;  1DEL A;  1TTX A;  3V2L A;  1S6J A;  1EL4 A;  1YR5 A;  4M2P A;  1A29 A;  1NYA A;  2M7N A;  2MAZ A;  3JTD B;  1TIZ A;  1ZUZ A;  3R72 A;  3CAB A;  3L4L A;  3OGN A;  2QDI A;  5HLV A;  2ZRS A;  3I5F C;  1C3Z A;  1NX1 A;  2JQ6 A;  3BOW A;  3IVT A;  4FQT A;  4DCK A;  2P71 A;  2VRG A;  1DF0 A;  1WLM A;  1FF1 A;  1W7J B;  1K94 A;  1SKT A;  3NSO A;  2PAL A;  2Y1N A;  1XVJ A;  2PRU A;  1RFJ A;  2CTN A;  3IF7 A;  2JTZ A;  2BEC A;  4PCW A;  2AMI A;  1CKK A;  1Y1U A;  1WLZ A;  2FOT A;  1OOG A;  4E68 A;  1PVA A;  3H4S E;  4CFQ A;  2HQW A;  1LA0 A;  1P28 A;  2LHI A;  2M0R A;  1AUI B;  1SK6 D;  2NCP A;  2BL0 B;  4OZD A;  1YRU B;  1IQ3 A;  1QTX A;  1K93 D;  3K1E A;  5I2Q A;  2DOQ A;  1KFX S;  4PAL A;  2KGR A;  2WCB A;  1OOF A;  3S0E A;  4UPG A;  1DQE A;  2KQY A;  1KK8 B;  4TNC A;  2JC2 A;  3TZ1 A;  1FBV A;  5CSI A;  2CT9 A;  5AXI A;  1YX8 A;  4JWQ A;  4PT1 A;  1CMG A;  5K89 A;  1K96 A;  1TUZ A;  5FI6 A;  1NCZ A;  1LVC D;  1K8U A;  1OZO A;  4NDD A;  4A4B A;  2OS8 B;  1KSM A;  5J3X A;  1ALV A;  3CR5 X;  1WY9 A;  1BT6 A;  1FI6 A;  1E8A A;  1S36 A;  3BUX B;  3CR4 X;  2KOT A;  2PAS A;  1QV0 A;  1MR8 A;  1WDC B;  4DUQ A;  1MQ1 A;  5AER A;  2E6W A;  2LUX A;  2M97 A;  2QAC A;  1UUS A;  3B87 A;  3FE9 A;  2MJW B;  3DVK A;  3CS1 A;  3PM2 A;  4PE7 A;  5G08 A;  4OV2 A;  1YUR A;  3EK4 A;  1F70 A;  2IS9 A;  1BMO A;  1XA5 A;  2MHH A;  5JOL A;  5ER5 A;  4MN0 A;  2CCM A;  1WDC C;  2HPS A;  4JQ0 D;  1PSB A;  2LLU A;  1QAS A;  3I5H C;  1KWO B;  1CDL A;  1W7I B;  1S5G Z;  3BFH A;  5HYD A;  5I94 A;  1Y0V H;  2JT3 A;  1OW4 A;  3DYE A;  2SAS A;  2KI4 C;  2NZ0 A;  4GNK B;  1OMR A;  2JNF A;  1QV1 A;  1XYD A;  2F2P A;  2WC6 A;  2ZKM X;  3FIA A;  5JJG A;  1GGW A;  1F55 A;  5PAL A;  3AKB A;  1CFF A;  3GK2 A;  1CTR A;  2PYQ A;  1XFY O;  3KHE A;  2H8V A;  3S0G A;  3SS3 A;  1BJF A;  3GK4 X;  1J7O A;  2KI4 B;  1QX5 B;  2K8M B;  2O60 A;  1L2O C;  2LE9 B;  1NCX A;  3PSR A;  1NSH A;  2WCH A;  1CLL A;  2OTG C;  3BUN B;  3LK0 A;  3O2P A;  2LAP A;  3A8R A;  2G2B A;  2KFF A;  1DMO A;  4HRG A;  4GUK A;  4YI8 A;  1B9A A;  1QVI Y;  2KGB C;  5B8I B;  1QS7 A;  5TNC A;  1KFX L;  3OB2 B;  2MBX A;  4I5N B;  4CPV A;  1SR6 B;  2JXL A;  3JVT B;  3SG6 A;  2E30 A;  2BBN A;  1YUS A;  5IBW A;  3CTN A;  3GOF A;  1J1D A;  2F8P A;  3SG5 A;  1CFD A;  1WRL A;  2M29 A;  2KYC A;  1ODB A;  1WRK A;  1SBJ A;  3VB1 A;  2FCD A;  1A03 A;  1N65 A;  2WOR A;  1QLS A;  2L98 A;  3DF0 A;  3TDZ A;  2ZRT A;  5DIC A;  2H2K A;  1AHR A;  3UNW A;  4MZJ A;  1VRK A;  3CYZ A;  1NX0 A;  1QVI Z;  3D0Y A;  1DJW A;  1A2X A;  2ZND A;  3EG5 B;  4GBA A;  2K0J A;  1NWD A;  3OX6 A;  3R1O A;  3FWC A;  1N2D A;  3DY9 A;  1MXE A;  3PFV A;  1K2H A;  3O4Y A;  1S6C A;  2Y1M A;  1FW4 A;  4N1F A;  1DJG A;  1TWO A;  4PE1 A;  3SS4 A;  2MLF C;  1NP8 A;  3Q8I A;  3R1V A;  3VRO A;  3AAK A;  3NHT A;  1CLB A;  3O78 A;  4YGA A;  1MUX A;  1TRF A;  2K7D A;  1J7P A;  3TDU A;  2LP3 A;  1PK0 D;  2CXJ A;  3CZ2 A;  3TUY C;  1F8H A;  1A75 B;  2EC6 B;  1WRZ A;  2K2A A;  1JWD A;  2Y5I A;  3CZT X;  1G4Y R;  2BNX A;  4C0K A;  1BOD A;  4WRI A;  2BCX A;  4XJK B;  3RZS A;  1OSA A;  2M8U A;  2D8N A;  1OQP A;  1K90 D;  4GAO A;  1DGV A;  1OMD A;  1QX7 A;  3WXA A;  2I7A A;  3EVU A;  1YVL A;  2G9B A;  3KEV A;  1GQM A;  1S3P A;  2KQ6 A;  2WCE A;  2JT8 A;  3PN7 C;  3D77 A;  2LP2 A;  4AOM A;  4ORB B;  2K2F A;  1XO5 A;  5DKQ A;  1L2O B;  1DJY A;  1MXL C;  3GK1 A;  3DD4 A;  5CPV A;  1F71 A;  1C3Y A;  4ICB A;  3VRP A;  4NDC A;  3FE6 A;  2K60 A;  1TOP A;  1S6I A;  2JPO A;  2WC8 A;  4DS7 A;  1UUR A;  1MWN A;  2K7C A;  2QEV A;  1OOH A;  1DEK A;  1UWO A;  1UHJ A;  1M46 A;  1G33 A;  1LKJ A;  2K7O A;  2Y4Q A;  3PLF B;  4YGD B;  1K9U A;  4GPL B;  2LV7 A;  3BUM B;  2L2E A;  1AJ5 A;  1F4O A;  3PJI A;  1UHI A;  1ZFS A;  3DF0 B;  1DJZ A;  1M39 A;  1PVB A;  3B7A A;  5D7F A;  1KK8 C;  1AP4 A;  1IIO A;  2ERB A;  4PE0 A;  1RRO A;  2V53 A;  1H8B A;  3N7H A;  1M45 A;  1TN4 A;  1LXF C;  1NCY A;  3PN7 B;  2M49 B;  2HET A;  3CWG A;  3PAL A;  3BQ3 A;  4XYN A;  1FPW A;  1KFU S;  2ZFD A;  1D1O A;  4HRH A;  1FI5 A;  2L2C A;  3D78 A;  4ETO A;  1SCV A;  3EKH A;  4PHM A;  1U5I A;  4YBH B;  1BR1 B;  2PQL A;  4L9M A;  3VGO A;  2ZNE A;  1PRW A;  2M3W A;  1DT7 B;  1CDN A;  1SCM C;  4PHN A;  2KBM A;  3EK7 A;  3FE8 A;  4N1G A;  1RTP 1;  3I5I B;  3RLZ A;  3K21 A;  2AAO A;  1W9Z A;  1GM0 A;  3WNX B;  3ZWH A;  2LMU A;  4OR9 B;  2LAN A;  1JBA A;  1A75 A;  2TN4 A;  4FQO A;  4JKT A;  1NUB A;  3HCM A;  3KO0 A;  4U8D A;  4MZL A;  2BL0 C;  4ORC B;  3B6X A;  1EG3 A;  1K9P A;  2KSP A;  1V1G A;  1TNW A;  2BKH B;  3SS5 A;  2I94 A;  2KBI A;  5D3O A;  3BXK A;  1GJY A;  3B88 A;  2EHB A;  1AVS A;  2M9G A;  2LVJ A;  1LS8 A;  1Y1A A;  1J55 A;  1JC2 A;  1J1E A;  1SPY A;  3TS5 B;  1K95 A;  1DGU A;  1SMG A;  2BE4 A;  2NLN A;  3VRN A;  5BPJ A;  1B4C A;  1HT9 A;  4AQJ A;  1JF0 A;  1IGV A;  3SG3 A;  1YVH A;  3CZ1 A;  4GGF C;  1QAT A;  2PVB A;  4M2Q A;  1QIV A;  4YI9 A;  3TS5 C;  3DVM A;  2JPT A;  4AQI A;  1KQV A;  1REC A;  2K7B A;  1J7Q A;  3BUW B;  3TDI A;  5FYX A;  4YRU A;  2LLT A;  4CLN A;  1UHK A;  3SG4 A;  2PSR A;  1SL9 A;  4R1E A;  1UHH A;  4WQ3 A;  4MEW A;  5KSZ A;  4PHJ A;  3D10 A;  1F4Q A;  5I2L A;  3I5H B;  1AK8 A;  1B8L A;  2CBL A;  2P6B B;  2KYF A;  3ZNI A;  4F7F A;  1TUJ A;  4MRY A;  5D69 A;  1DJX A;  3R1P A;  3SJS A;  1CDM A;  5DKR A;  1SRA A;  1BR4 B;  3NXA A;  4ZCV A;  1U5I B;  5FI2 A;  3D76 A;  5HKZ A;  2ISD A;  1NIW A;  2LC5 A;  2GTE A;  4PE4 A;  4I5K A;  1BF5 A;  1DJI A;  3I5G B;  1ALW A;  2WOS A;  1N0Y A;  1EH2 A;  1IQ5 A;  1DVI A;  5AFP A;  3HX4 A;  2QEO A;  1DTL A;  4JD9 A;  3EK8 A;  3MSE B;  4C0L A;  2P70 A;  2NCO A;  1PUL A;  1KQM C;  1B8C A;  3A4U B;  3QME A;  2MRD A;  3NHI A;  2LHL A;  2JU0 A;  2KFH A;  1QJT A;  1TCF A;  2WC5 A;  2Q4U A;  1C7V A;  1M63 B;  1SR6 C;  2LNK A;  3C1V A;  3JVT C;  2RGI A;  1G8I A;  1KFU L;  2SCP A;  1KK7 Z;  3BYA A;  2L5X B;  4QJ4 B;  1XK4 C;  2LLS A;  3EVR A;  3S0A A;  4OKH A;  1CM4 A;  2WCF A;  3D74 A;  3LLE A;  2KHN A;  3NSK A;  1BOC A;  2WCJ A;  2L4I A;  4M2O A;  1EXR A;  3EVV A;  1S1E A;  2FJY A;  1OE9 B;  1QIW A;  4QJ3 B;  4BY5 A;  1R6P A;  1L7Z A;  3IQO A;  2KLD A;  1YX7 A;  2O5G A;  4I5J A;  2KAV A;  1OZS A;  4QJ5 B;  2KI6 C;  1Q80 A;  1SYM A;  3E3R A;  5I8N A;  1ZOT B;  1T14 A;  1KSO A;  1JFJ A;  3PM8 A;  4INW A;  4WQ2 A;  2LCP A;  1M31 A;  4USL A;  4GGF A;  4A4C A;  2FCE A;  1XFW O;  2L4H A;  4YGE B;  4CID A;  5I2O A;  1OOJ A;  3CDN A;  3LK1 A;  2I2R E;  3OX5 A;  3AKA A;  1AJ4 A;  2GGZ A;  3VRR A;  1H4B A;  1JUO A;  3M0W A;  4P5O E;  2BKI B;  1KWO C;  1QX2 A;  1XFU O;  3CGA A;  3L47 A;  1SL7 A;  2OS8 C;  1IH0 A;  1TNX A;  3VRQ A;  5F6T A;  1ZMZ A;  2ZN9 A;  3WHT B;  2QPT A;  2KPH A;  1SW8 A;  1X02 A;  3I5G C;  5CSF A;  3SG2 A;  3O4X A;  3SG7 A;  1CLM A;  2OPO A;  4ZCU A;  2GV5 A;  1XFV O;  1CMF A;  2JOJ A;  3S0B A;  3OHM B;  4IL1 A;  3IQQ A;  1TNQ A;  4OCI A;  2I18 A;  3BOW B;  1A4P A;  4GGN A;  1DF0 B;  4I5L B;  2BE6 A;  1EG4 A;  3DVE A;  2MA2 A;  1B7T Y;  1BU3 A;  1UP5 A;  1EJ3 A;  3NGV A;  3S0D A;  1CFC A;  4Q04 A;  3S0F A;  4MZK A;  1K9K A;  3EKJ A;  3UO9 A;  2QEB A;  4KYN A;  4CFR A;  1HQV A;  2JT0 A;  4NDB A;  3ICB A;  3F45 A;  3L4A A;  3D73 A;  2M7L A;  3DVJ A;  2KAY A;  1B47 A;  1TNP A;  3O6B A;  2M1K B;  5HKW A;  1RK9 A;  4INX A;  2PMY A;  3LL8 B;  2JRF A;  5AEQ A;  5CSN A;  3CZ0 A; 
#chains in the Genus database with same CATH homology
 2FJU B;  3RM1 A;  1YUU A;  1PAL A;  2Q91 A;  1F54 A;  1LIN A;  2BBM A;  2EGD A;  2L50 A;  3KPX A;  1YTZ C;  3NSI A;  2BCB A;  1IWQ A;  2JZI A;  3JTD C;  1CNP A;  5GQQ C;  4OVN F;  1SY9 A;  2LVI A;  2F33 A;  1XFX O;  5AAN A;  2LMV A;  3AAJ A;  2K61 A;  1IKU A;  2JNX A;  1JSA A;  3D0Y B;  3NSL A;  1RWY A;  1QLK A;  1TCO B;  3BUO B;  2R2I A;  1YRT B;  2JUL A;  1S5G Y;  2KAX A;  2KNE A;  3PAT A;  2F2O A;  1JFK A;  2ZN8 A;  4HSZ A;  1GGZ A;  2LMT A;  5CSJ A;  2WND A;  3FWB A;  1UHN A;  2F3Y A;  1YUT A;  4JPZ B;  2COL B;  3I5I C;  4DIR A;  2L51 A;  4ORA B;  3OP0 A;  4HRE E;  3WHU B;  3SG4 A;  1RJV A;  2H61 C;  2HQ8 A;  4N5X A;  3KF9 A;  1DJH A;  2BCA A;  3CLN A;  3LCP C;  4MSP A;  2KDH A;  2JXC A;  4MBE A;  2GGM A;  3OB1 B;  4F0Z B;  1QXP A;  1Y6W A;  5ER4 X;  1BLQ A;  4MLW A;  1XFZ O;  1KQM B;  1S26 D;  1CDP A;  1JF2 A;  4D1E A;  5HLO A;  1Y1X A;  1IRJ A;  4P2Y B;  5KTY A;  1B7T Z;  2A4J A;  2LVK A;  2OTG B;  4XJK A;  1B1G A;  2LVV A;  4FTG A;  1SL8 A;  1V1F A;  1CB1 A;  2KFG A;  1IJ6 A;  4MRX A;  3TUY B;  1CM1 A;  4YGC B;  4PHK A;  1MHO A;  4GFT A;  3I5F B;  2L0P A;  2NXQ A;  3QRX A;  2EC6 C;  2B1U A;  1SNL A;  2HF5 A;  2JWW A;  2KI6 D;  2LUC A;  1LA3 A;  1KCY A;  1XK4 A;  2MLE C;  1R2U A;  1OMV A;  4NQG A;  5KU1 A;  1C7W A;  1IG5 A;  4PDZ A;  2F3Z A;  1CFP A;  3CR2 A;  2M1U A;  1NX2 A;  1IJ5 A;  1B8R A;  2H61 A;  1NX3 A;  1MF8 B;  2LM5 A;  1ZAC A;  4C0J A;  1PSR A;  5HKY A;  3SIA A;  2CNP A;  4YGB B;  5DKN A;  1C07 A;  1KK7 Y;  1SCM B;  1J7R A;  4DRW A;  4BY4 A;  3FS7 A;  4MVF A;  1BG1 A;  1NPQ A;  2AUC A;  2JTT A;  1TTX A;  1S6J A;  1EL4 A;  1YR5 A;  4M2P A;  1A29 A;  1NYA A;  2M7N A;  2MAZ A;  3JTD B;  1TIZ A;  1ZUZ A;  5HLV A;  2ZRS A;  3I5F C;  1NX1 A;  2JQ6 A;  3BOW A;  4DCK A;  2VRG A;  1DF0 A;  1WLM A;  1FF1 A;  1W7J B;  1K94 A;  1SKT A;  3NSO A;  2PAL A;  2Y1N A;  1XVJ A;  2PRU A;  1RFJ A;  2CTN A;  3IF7 A;  2JTZ A;  2BEC A;  4PCW A;  2AMI A;  1CKK A;  1Y1U A;  1WLZ A;  2FOT A;  4E68 A;  1PVA A;  3H4S E;  4CFQ A;  2HQW A;  1LA0 A;  2LHI A;  2M0R A;  1AUI B;  1SK6 D;  2NCP A;  2BL0 B;  1YRU B;  1IQ3 A;  1QTX A;  1K93 D;  5I2Q A;  2DOQ A;  1KFX S;  4PAL A;  2KGR A;  2WCB A;  4UPG A;  4TNC A;  2KQY A;  1KK8 B;  2JC2 A;  3TZ1 A;  1FBV A;  5CSI A;  2CT9 A;  5AXI A;  1YX8 A;  4JWQ A;  1CMG A;  5K89 A;  1K96 A;  1NCZ A;  1LVC D;  1K8U A;  1OZO A;  4NDD A;  4A4B A;  2OS8 B;  1KSM A;  5J3X A;  1ALV A;  3CR5 X;  1WY9 A;  1BT6 A;  1FI6 A;  1E8A A;  1S36 A;  3BUX B;  3CR4 X;  2KOT A;  2PAS A;  1QV0 A;  1MR8 A;  1WDC B;  4DUQ A;  1MQ1 A;  5AER A;  2E6W A;  2LUX A;  2M97 A;  2QAC A;  1UUS A;  4PE7 A;  3SIB A;  2MJW B;  3DVK A;  3CS1 A;  5G08 A;  4OV2 A;  1YUR A;  3EK4 A;  1F70 A;  2IS9 A;  1BMO A;  1XA5 A;  2MHH A;  5JOL A;  5ER5 A;  4MN0 A;  2CCM A;  1WDC C;  2HPS A;  4JQ0 D;  1PSB A;  2LLU A;  1QAS A;  3I5H C;  1KWO B;  1CDL A;  1W7I B;  1S5G Z;  5HYD A;  1Y0V H;  2JT3 A;  2SAS A;  2KI4 C;  2NZ0 A;  4GNK B;  1OMR A;  2JNF A;  1QV1 A;  1XYD A;  2F2P A;  2ZKM X;  5JJG A;  3FIA A;  1GGW A;  1F55 A;  5PAL A;  3AKB A;  1CFF A;  3GK2 A;  1CTR A;  1XFY O;  3KHE A;  1BJF A;  3GK4 X;  1J7O A;  2KI4 B;  1QX5 B;  2K8M B;  2O60 A;  1L2O C;  2LE9 B;  1NCX A;  3PSR A;  1NSH A;  1CLL A;  2OTG C;  3BUN B;  3LK0 A;  3O2P A;  2LAP A;  3A8R A;  2G2B A;  2KFF A;  1DMO A;  4HRG A;  4GUK A;  4YI8 A;  1B9A A;  1QVI Y;  2KGB C;  5B8I B;  1QS7 A;  5TNC A;  1KFX L;  3OB2 B;  2MBX A;  4I5N B;  4CPV A;  1SR6 B;  2JXL A;  3JVT B;  3SG6 A;  2E30 A;  2BBN A;  1YUS A;  5IBW A;  3CTN A;  3GOF A;  1J1D A;  2F8P A;  3SG5 A;  1CFD A;  1WRL A;  2M29 A;  2KYC A;  1ODB A;  1WRK A;  1SBJ A;  2FCD A;  1A03 A;  1N65 A;  2WOR A;  1QLS A;  2L98 A;  3DF0 A;  3TDZ A;  2ZRT A;  2H2K A;  1AHR A;  4MZJ A;  1VRK A;  3D0Y A;  1NX0 A;  1QVI Z;  4GBA A;  1DJW A;  1A2X A;  2ZND A;  2K0J A;  1NWD A;  3OX6 A;  3FWC A;  1N2D A;  1MXE A;  3PFV A;  1K2H A;  3O4Y A;  1S6C A;  2Y1M A;  1FW4 A;  4N1F A;  1DJG A;  4PE1 A;  2MLF C;  1NP8 A;  3VRO A;  3AAK A;  1CLB A;  3O78 A;  4YGA A;  1MUX A;  1TRF A;  2K7D A;  1J7P A;  3TDU A;  2LP3 A;  1PK0 D;  2CXJ A;  1F8H A;  3TUY C;  1A75 B;  2EC6 B;  1WRZ A;  2K2A A;  1JWD A;  2Y5I A;  3CZT X;  1G4Y R;  4C0K A;  1BOD A;  4WRI A;  2BCX A;  4XJK B;  1OSA A;  2M8U A;  2D8N A;  1OQP A;  1K90 D;  4GAO A;  1DGV A;  1OMD A;  1QX7 A;  3WXA A;  2I7A A;  3EVU A;  1YVL A;  2G9B A;  3KEV A;  1GQM A;  1S3P A;  2KQ6 A;  2WCE A;  2JT8 A;  3PN7 C;  2LP2 A;  4AOM A;  4ORB B;  2K2F A;  1XO5 A;  5DKQ A;  1L2O B;  1DJY A;  1MXL C;  3GK1 A;  3DD4 A;  5CPV A;  1F71 A;  4ICB A;  3VRP A;  4NDC A;  1TOP A;  1S6I A;  2WC8 A;  4DS7 A;  1UUR A;  1MWN A;  2K7C A;  1UWO A;  1UHJ A;  1M46 A;  1G33 A;  1LKJ A;  2K7O A;  2Y4Q A;  3PLF B;  4YGD B;  1K9U A;  4GPL B;  2LV7 A;  3BUM B;  2L2E A;  1AJ5 A;  1F4O A;  1UHI A;  1ZFS A;  3DF0 B;  1DJZ A;  1M39 A;  1PVB A;  5D7F A;  1KK8 C;  1AP4 A;  4PE0 A;  1RRO A;  2V53 A;  1H8B A;  1M45 A;  1TN4 A;  1LXF C;  1NCY A;  3PN7 B;  2M49 B;  2HET A;  3CWG A;  3PAL A;  3BQ3 A;  4XYN A;  1FPW A;  1KFU S;  2ZFD A;  1D1O A;  4HRH A;  1FI5 A;  4ETO A;  1SCV A;  3EKH A;  4PHM A;  1U5I A;  4YBH B;  1BR1 B;  4L9M A;  3VGO A;  2ZNE A;  1PRW A;  2M3W A;  1DT7 B;  1CDN A;  1SCM C;  4PHN A;  2KBM A;  3EK7 A;  4N1G A;  1RTP 1;  3I5I B;  3RLZ A;  3K21 A;  2AAO A;  3WNX B;  3ZWH A;  2LMU A;  4OR9 B;  2LAN A;  1JBA A;  1A75 A;  2TN4 A;  4FQO A;  1NUB A;  3HCM A;  3KO0 A;  4U8D A;  4MZL A;  2BL0 C;  4ORC B;  1EG3 A;  1K9P A;  2KSP A;  1V1G A;  1TNW A;  2BKH B;  2I94 A;  2KBI A;  3BXK A;  1GJY A;  2EHB A;  1AVS A;  2M9G A;  2LVJ A;  1Y1A A;  1J55 A;  1JC2 A;  1J1E A;  1SPY A;  3TS5 B;  1K95 A;  1DGU A;  1SMG A;  2BE4 A;  2NLN A;  3VRN A;  5BPJ A;  1B4C A;  1HT9 A;  4AQJ A;  1JF0 A;  1IGV A;  3SG3 A;  1YVH A;  4GGF C;  1QAT A;  2PVB A;  4M2Q A;  1QIV A;  4YI9 A;  3TS5 C;  3DVM A;  2JPT A;  4AQI A;  1KQV A;  1REC A;  2K7B A;  1J7Q A;  3BUW B;  3TDI A;  5FYX A;  4YRU A;  2LLT A;  4CLN A;  1UHK A;  2PSR A;  1SL9 A;  4R1E A;  1UHH A;  4WQ3 A;  4MEW A;  5KSZ A;  4PHJ A;  3D10 A;  1F4Q A;  5I2L A;  3I5H B;  1AK8 A;  1B8L A;  2CBL A;  2P6B B;  2KYF A;  3ZNI A;  4MRY A;  5D69 A;  1DJX A;  3SJS A;  1CDM A;  5DKR A;  1SRA A;  1BR4 B;  3NXA A;  4ZCV A;  1U5I B;  5HKZ A;  2ISD A;  1NIW A;  2LC5 A;  4PE4 A;  4I5K A;  1BF5 A;  1DJI A;  3I5G B;  1ALW A;  2WOS A;  1N0Y A;  1EH2 A;  1IQ5 A;  1DVI A;  5AFP A;  3HX4 A;  1DTL A;  3EK8 A;  3MSE B;  4C0L A;  2NCO A;  1PUL A;  1KQM C;  1B8C A;  3A4U B;  2MRD A;  2LHL A;  2JU0 A;  2KFH A;  1QJT A;  1TCF A;  2Q4U A;  1C7V A;  1M63 B;  1SR6 C;  2LNK A;  3C1V A;  3JVT C;  2RGI A;  1G8I A;  1KFU L;  2SCP A;  1KK7 Z;  3BYA A;  2L5X B;  4QJ4 B;  1XK4 C;  2LLS A;  3EVR A;  4OKH A;  1CM4 A;  2WCF A;  3LLE A;  2KHN A;  3NSK A;  1BOC A;  2L4I A;  4M2O A;  1EXR A;  3EVV A;  1S1E A;  4QJ3 B;  1OE9 B;  1QIW A;  4BY5 A;  1R6P A;  1L7Z A;  3IQO A;  1YX7 A;  2O5G A;  4I5J A;  2KAV A;  1OZS A;  4QJ5 B;  2KI6 C;  1Q80 A;  1SYM A;  3E3R A;  5I8N A;  1ZOT B;  1JFJ A;  1KSO A;  3PM8 A;  4WQ2 A;  2LCP A;  1M31 A;  4USL A;  4GGF A;  4A4C A;  2FCE A;  1XFW O;  2L4H A;  4YGE B;  4CID A;  5I2O A;  1OOJ A;  3OX5 A;  3LK1 A;  2I2R E;  3AKA A;  1AJ4 A;  2GGZ A;  3VRR A;  1H4B A;  1JUO A;  3M0W A;  4P5O E;  2BKI B;  1KWO C;  1QX2 A;  1XFU O;  3CGA A;  1IH0 A;  1SL7 A;  2OS8 C;  1TNX A;  3VRQ A;  5F6T A;  1ZMZ A;  2ZN9 A;  3WHT B;  2QPT A;  1SW8 A;  1X02 A;  3I5G C;  5CSF A;  3SG2 A;  3SG7 A;  1CLM A;  2OPO A;  4ZCU A;  2GV5 A;  1XFV O;  1CMF A;  2JOJ A;  3OHM B;  4IL1 A;  3IQQ A;  1TNQ A;  4OCI A;  2I18 A;  3BOW B;  1A4P A;  4GGN A;  1DF0 B;  4I5L B;  2BE6 A;  1EG4 A;  3DVE A;  2MA2 A;  1B7T Y;  1BU3 A;  1UP5 A;  1EJ3 A;  1CFC A;  4Q04 A;  4MZK A;  1K9K A;  3EKJ A;  4CFR A;  1HQV A;  2JT0 A;  4NDB A;  3ICB A;  3F45 A;  2M7L A;  3DVJ A;  2KAY A;  1B47 A;  1TNP A;  3O6B A;  2M1K B;  5HKW A;  1RK9 A;  2PMY A;  3LL8 B;  2JRF A;  5AEQ A;  5CSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...