5D7FA

X-ray structure of ca(2+)-s100b with human rage-derived w72 peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein S100-B
publication title X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
rcsb
source organism Homo sapiens
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d7fA00
4DS7A 1KCYA 3SG4A 1QS7A 2PASA 3M0WA 4YGBB 2LUCA 1TNXA 4ICBA 2NXQA 2OS8C 2L51A 3A4UB 4NDCA 3BUMB 4AQIA 5HYDA 1CTRA 2MHHA 1SY9A 4JWQA 2E6WA 2HQWA 1SMGA 2K0JA 2WOSA 3F45A 1KQMB 1WDCB 4WQ3A 1J7OA 1IJ6A 2M8UA 1N65A 2PMYA 1IKUA 3ICBA 2NCPA 1V1FA 5HLVA 2AAOA 4I5LB 1L2OB 1FPWA 4M2PA 1C7WA 1KK7Y 2K2FA 3BUOB 3NSIA 2BCAA 5J3XA 1CLLA 1TNWA 2QPTA 4R1EA 1MF8B 2F3YA 4PALA 4YGEB 1AHRA 2OTGC 1WRLA 3AKBA 2LE9B 1SW8A 1S6IA 1TIZA 1YUSA 4MBEA 3OP0A 2PSRA 4PHKA 1NP8A 1QLKA 1S36A 2KI4C 3QRXA 3IF7A 1X02A 1M39A 1SL9A 2LMVA 1BR4B 1RTP1 1UURA 1B4CA 4C0LA 2I18A 2NZ0A 4GGFA 1BF5A 2FJUB 5PALA 1B7TY 4TNCA 2KBIA 3TS5C 3EK8A 1ALVA 1PSBA 1PRWA 1DGVA 1J7PA 2MBXA 1UHKA 3E3RA 1DJIA 2JTZA 4PE1A 2EHBA 3HX4A 1Y1XA 3KPXA 1AJ5A 2O5GA 4DIRA 2BBNA 2FCDA 3RM1A 2F8PA 1XFVO 3DVEA 4ORAB 3BYAA 3WHTB 2IS9A 3I5FC 1PK0D 2M29A 1K9PA 1CMFA 1IQ5A 2H2KA 2A4JA 1CFDA 1NCXA 2KAVA 2COLB 1S5GY 2GGMA 1W7JB 2JT8A 2CTNA 1XFYO 2O60A 2L4IA 1YR5A 1BLQA 3D0YA 3OX6A 4MN0A 1LA3A 1SL7A 1WLZA 4AOMA 4GAOA 1AK8A 2KSPA 1CLBA 1DJHA 1RROA 1KWOB 2JU0A 3I5IB 2DOQA 3EVRA 4MLWA 1XFXO 1IQ3A 1MHOA 1ZOTB 2D8NA 3DF0A 2K8MB 4XJKA 5CSFA 3TDZA 3SG3A 4CFQA 1MWNA 4DRWA 2JXLA 4YI9A 3LL8B 2KI6C 1W7IB 2NCOA 2HPSA 5GQQC 2M1UA 1BR1B 3CTNA 1PVBA 1B8CA 1EL4A 1C07A 4NDDA 1OQPA 1IGVA 1A75B 5CSIA 3MSEB 4HRHA 4QJ5B 1FW4A 1UHJA 2WCEA 1BJFA 3TUYB 1YX8A 1QX7A 5HKZA 1DT7B 1SK6D 1AVSA 1CM1A 3I5HC 5HLOA 3NSKA 2G2BA 1CFCA 1QX2A 1ALWA 1DJYA 2BCBA 1H4BA 4OCIA 1KSOA 1CFFA 3O78A 5DKNA 3C1VA 2LP3A 2GGZA 1K93D 1G8IA 1SR6B 2F2OA 2K2AA 1BU3A 1MUXA 2ZNEA 1OMVA 4UPGA 1NWDA 1CMGA 1C7VA 1SL8A 2OS8B 4ZCUA 5AERA 1JBAA 2H61A 1IG5A 1OOJA 1F4OA 2MAZA 1S6JA 1EJ3A 2LMUA 2EGDA 3DF0B 4XJKB 1TTXA 3DVMA 1N2DA 2LVKA 4A4BA 1QLSA 2LLUA 1NUBA 4GGNA 4OKHA 1CLMA 3PN7C 1HT9A 2L98A 4GUKA 5I8NA 2MRDA 5BPJA 1QVIZ 1TOPA 2JNXA 5G08A 1B8RA 2I94A 1ZACA 2KHNA 2BL0C 1DTLA 2WORA 4YRUA 3SJSA 1DJZA 5JOLA 1KFXS 2JTTA 1MXLC 2TN4A 1Y6WA 3VRQA 1B7TZ 4CIDA 5IBWA 4QJ3B 3GK2A 2OTGB 1KK8C 1F55A 1IJ5A 1CKKA 1M46A 3AKAA 1XK4A 3KO0A 3BOWA 3O2PA 1TN4A 2Y1MA 4ETOA 4GPLB 2KI4B 1H8BA 4BY4A 1GGWA 3TDUA 1S1EA 4PCWA 1SCVA 4I5NB 1KFUL 2NLNA 1QV0A 3FIAA 1CDLA 2ZN8A 4PHNA 1M45A 4PE0A 3SG7A 2OPOA 2LHIA 4ORBB 1GGZA 1NX3A 2B1UA 1TCOB 3TS5B 1S5GZ 2F3ZA 4MZLA 3OX5A 2H61C 2HF5A 2KBMA 3CS1A 4QJ4B 2KQ6A 3EKJA 1NX0A 3SG5A 4DUQA 2ZN9A 3DVJA 2CT9A 3KF9A 1LA0A 1CDPA 1YVHA 1QIVA 5KU1A 1V1GA 2BKIB 1S26D 5HKYA 4P2YB 1A4PA 1TNPA 1S6CA 2SASA 3I5FB 4WRIA 1XYDA 3WNXB 3DVKA 3BOWB 1Y1UA 1A2XA 4N1GA 5DKQA 4MEWA 2CCMA 3FWBA 2LVJA 2L50A 3PM8A 1QX5B 2LNKA 1J1DA 4IL1A 3TZ1A 1E8AA 2HQ8A 4NQGA 2K61A 1CB1A 4Q04A 1FI6A 4USLA 1JWDA 3D10A 3CR4X 1MXEA 3OB1B 4OR9B 5K89A 1SCMC 1EH2A 1XK4C 2KAYA 3HCMA 5ER4X 3K21A 3PALA 4L9MA 2KQYA 1NCZA 1J7QA 4I5JA 4GNKB 1JFKA 1OMRA 2Y4QA 4GBAA 5I2LA 1K2HA 2M7LA 1YURA 1PVAA 1DF0A 3GK4X 3TDIA 2BBMA 4YGAA 1EG3A 1XFZO 1RWYA 3SG2A 1J1EA 5ER5A 3VROA 2LVIA 4PE4A 1DJGA 5KSZA 1WRZA 1F70A 2M49B 4F0ZB 1K95A 3I5HB 1SPYA 1VRKA 3GOFA 1BOCA 2EC6C 2WCFA 4YI8A 2CNPA 4JPZB 4MSPA 5HKWA 1SYMA 3O4YA 3JVTC 2ISDA 1JF2A 1UWOA 3OHMB 3KHEA 3EKHA 5D69A 3CGAA 4MVFA 5F6TA 2MLFC 3VRNA 1QATA 1F54A 1GQMA 3CR5X 1NPQA 1IWQA 1QTXA 1IH0A 2LM5A 1BT6A 1XFUO 1NCYA 1J7RA 3CZTX 2KGRA 4MRYA 1LINA 2KDHA 2MA2A 4MZJA 1KQVA 4XYNA 1GJYA 3D0YB 3IQOA 1RFJA 1CM4A 2LAPA 4HRGA 5D7FA 3PN7B 4OVNF 1MR8A 1TRFA 1BODA 1JC2A 1SKTA 2BKHB 2F2PA 4FTGA 4PE7A 1JFJA 4HREE 3KEVA 1KK7Z 2JWWA 3CWGA 4N1FA 4YBHB 1QV1A 2LP2A 3CR2A 2LUXA 1YUUA 2F33A 1NX2A 2BL0B 2PVBA 1NX1A 1M63B 3EVUA 2Q91A 1LXFC 2KAXA 1PALA 1WRKA 2ZRSA 2JNFA 1D1OA 1QIWA 2MLEC 1KK8B 1FI5A 2KI6D 2LCPA 2M9GA 5KTYA 1WLMA 3WXAA 4YGDB 2K7OA 1SNLA 2CXJA 1AP4A 3VRRA 4JQ0D 3BUNB 1CDNA 1XO5A 2ZKMX 1YTZC 2JOJA 2CBLA 2KGBC 3OB2B 2K7BA 4GFTA 2MJWB 2JC2A 2WC8A 3ZWHA 2L0PA 1Q80A 1G4YR 4ZCVA 3EK7A 1YRUB 1U5IA 3PATA 3DD4A 1SRAA 2V53A 4M2QA 1FF1A 1YX7A 3I5GC 3JTDC 4DCKA 2KYFA 3RLZA 2KFFA 2JULA 3NSLA 2JPTA 2VRGA 5AXIA 2LC5A 3EK4A 3BQ3A 2Y5IA 3FWCA 2AUCA 1DGUA 2LLTA 3BXKA 4OV2A 5B8IB 1R2UA 2BE4A 1KSMA 2P6BB 1TNQA 1K8UA 2LLSA 1YUTA 2K7CA 5FYXA 1JUOA 2SCPA 3SG6A 3LK0A 2KOTA 1IRJA 3PFVA 1F8HA 1PULA 4PDZA 1NSHA 2KNEA 1OSAA 1SBJA 4CPVA 1KQMC 1A29A 1WDCC 1YRTB 1UP5A 3H4SE 3O6BA 1LKJA 1CFPA 3VRPA 1JSAA 2JT3A 1ODBA 2LVVA 1AUIB 1SCMB 4D1EA 3SIAA 2BECA 2LMTA 1U5IB 2M7NA 1L2OC 2M3WA 1QVIY 1OZOA 2Q4UA 3PLFB 5AFPA 1DVIA 3VGOA 2LANA 4CLNA 4AQJA 1UHNA 2L4HA 2ZNDA 2JZIA 1BMOA 1DJXA 1XVJA 5CPVA 1M31A 2E30A 4YGCB 5I2QA 2RGIA 3A8RA 4E68A 5JJGA 1ZUZA 2Y1NA 2EC6B 1RK9A 2ZRTA 1DJWA 3AAKA 5AEQA 3SIBA 1A03A 2HETA 2L2EA 3JVTB 1UUSA 1G33A 2FOTA 1UHHA 1AJ4A 2PALA 1Y1AA 3LCPC 1L7ZA 1K96A 3NXAA 2JRFA 1A75A 1F4QA 4U8DA 3ZNIA 5TNCA 1K9UA 2LV7A 4MZKA 1Y0VH 2M1KB 1ZMZA 2WNDA 4BY5A 1KFXL 1FBVA 2M0RA 1QASA 3BUXB 1QJTA 2BE6A 4PHMA 1B9AA 2FCEA 2AMIA 3GK1A 1EXRA 1K90D 2G9BA 2KFHA 2LHLA 4HSZA 1OE9B 2JXCA 1NIWA 2L5XB 3BUWB 1J55A 1KFUS 4A4CA 2GV5A 3IQQA 1DMOA 4PHJA 5CSNA 5AANA 1N0YA 2K7DA 1B8LA 3AAJA 1R6PA 2M97A 1MQ1A 1DF0B 4ORCB 4C0JA 5I2OA 3FS7A 1KWOC 1ZFSA 3I5IC 4GGFC 4N5XA 2I2RE 2R2IA 2ZFDA 2PRUA 4FQOA 3LLEA 1LVCD 1S3PA 1XFWO 4CFRA 4M2OA 4P5OE 1K9KA 1F71A 4MRXA 1B1GA 1PSRA 4NDBA 3WHUB 2I7AA 3LK1A 3PSRA 4C0KA 1HQVA 1OZSA 1RJVA 1WY9A 2QACA 2WCBA 3EVVA 2JT0A 5CSJA 2BCXA 3TUYC 1K94A 1NYAA 1OMDA 1BG1A 1EG4A 1XA5A 4WQ2A 1CNPA 1CDMA 3I5GB 3JTDB 1UHIA 2KFGA 3CLNA 3NSOA 4I5KA 5DKRA 2KYCA 2JQ6A 1JF0A 1YVLA 1TCFA 1RECA 1QXPA 1B47A 1SR6C
chains in the Genus database with same CATH superfamily
4DS7A 1KCYA 3SG4A 1QS7A 2PASA 3M0WA 4YGBB 2LUCA 1TNXA 4ICBA 2NXQA 2OS8C 2L51A 3A4UB 4NDCA 3BUMB 4AQIA 5HYDA 1CTRA 2MHHA 1SY9A 4JWQA 2E6WA 2HQWA 1SMGA 2K0JA 2WOSA 3F45A 1KQMB 1WDCB 2QEOA 3DY9A 4WQ3A 1J7OA 1IJ6A 2M8UA 1N65A 2PMYA 2JPOA 1IKUA 3ICBA 2NCPA 1V1FA 3SS4A 5HLVA 2AAOA 4I5LB 1L2OB 1FPWA 3CZ2A 4M2PA 3OBVA 1C7WA 1KK7Y 2K2FA 3BUOB 3NSIA 2BCAA 5J3XA 1CLLA 1TNWA 2QPTA 4R1EA 1MF8B 2F3YA 3DYEA 4PALA 4YGEB 1AHRA 2OTGC 1WRLA 3AKBA 2LE9B 1SW8A 1S6IA 1TIZA 1YUSA 4MBEA 3OP0A 2ERBA 2PSRA 4PHKA 1NP8A 1QLKA 1S36A 2KI4C 3QRXA 3IF7A 1X02A 1M39A 1SL9A 2LMVA 3CDNA 3S0AA 1BR4B 1RTP1 1UURA 1B4CA 4C0LA 2I18A 2NZ0A 3D74A 4GGFA 1BF5A 2FJUB 5PALA 1B7TY 4TNCA 2KBIA 3TS5C 3EK8A 1ALVA 1PSBA 1PRWA 1DGVA 2QEHA 3B86A 1J7PA 2MBXA 1UHKA 3E3RA 1DC1A 1DJIA 2JTZA 4PE1A 1C3ZA 2EHBA 3HX4A 1Y1XA 3KPXA 1AJ5A 2O5GA 4DIRA 3R1VA 2BBNA 2FCDA 3B6XA 2F8PA 3RM1A 1XFVO 3DVEA 4ORAB 3BYAA 3WHTB 2IS9A 2WCHA 3I5FC 1PK0D 2M29A 1K9PA 1CMFA 1IQ5A 2H2KA 2A4JA 3V2LA 1CFDA 1NCXA 2KAVA 2COLB 1S5GY 2GGMA 1W7JB 2JT8A 4F7FA 2CTNA 1XFYO 2O60A 1A03A 2L4IA 1YR5A 1BLQA 3D0YA 3OX6A 4MN0A 1LA3A 1SL7A 1WLZA 4AOMA 4GAOA 1AK8A 2KSPA 1CLBA 1DJHA 1RROA 1KWOB 2JU0A 3B88A 1OW4A 3I5IB 2DOQA 3EVRA 4MLWA 1TUZA 1XFXO 1IQ3A 1MHOA 1ZOTB 2D8NA 3DF0A 2K8MB 4XJKA 5CSFA 3TDZA 3SG3A 4CFQA 1MWNA 4DRWA 2JXLA 4YI9A 3LL8B 1TUJA 2KI6C 1W7IB 2NCOA 3N7HA 3NHIA 3R1OA 2HPSA 5GQQC 2M1UA 1BR1B 3CTNA 1PVBA 1B8CA 1EL4A 3QMEA 4NDDA 1OOHA 1OQPA 1C07A 1IGVA 1A75B 5CSIA 3D78A 3MSEB 4HRHA 4QJ5B 1FW4A 1UHJA 2WCEA 1BJFA 3TUYB 1YX8A 1QX7A 5HKZA 1DT7B 1SK6D 1AVSA 1CM1A 3I5HC 5HLOA 3NSKA 3NGVA 1OOFA 5FI2A 3SS3A 2G2BA 1CFCA 1QX2A 1ALWA 1DJYA 2BCBA 1H4BA 4OCIA 1KSOA 5FI6A 1CFFA 3O78A 3Q8IA 5DKNA 2FJYA 2LP3A 3C1VA 2GGZA 1K93D 1G8IA 1SR6B 1Z2CB 2F2OA 2K2AA 1BU3A 1MUXA 2ZNEA 1OMVA 4UPGA 1NWDA 1CMGA 1C7VA 1SL8A 2OS8B 3CYZA 4ZCUA 5AERA 2H61A 1JBAA 1IG5A 1OOJA 1F4OA 2MAZA 1S6JA 1EJ3A 2LMUA 2EGDA 2KLEA 3DF0B 3VB1A 4XJKB 1TTXA 3DVMA 3CZ1A 3S0EA 1N2DA 2LVKA 4A4BA 1QLSA 2LLUA 1DELA 1NUBA 4GGNA 4OKHA 1CLMA 3PN7C 1HT9A 2L98A 2WCMA 4GUKA 5I8NA 2MRDA 5BPJA 1QVIZ 3B87A 1TOPA 2JNXA 4OZDA 5G08A 1B8RA 2I94A 1ZACA 5HL1A 2KHNA 2BL0C 1DTLA 2WORA 4YRUA 3SJSA 1DJZA 5JOLA 1KFXS 2JTTA 1MXLC 2TN4A 1Y6WA 3VRQA 1B7TZ 4CIDA 5IBWA 4QJ3B 5EL2A 3GK2A 2OTGB 1KK8C 1F55A 1IJ5A 1CKKA 4PT1A 1M46A 3IVTA 1OOGA 3AKAA 1XK4A 3KO0A 3BOWA 3O2PA 1TN4A 2Y1MA 4ETOA 3B7AA 4GPLB 2KI4B 1H8BA 4BY4A 1GGWA 3RZSA 3TDUA 1S1EA 4PCWA 1SCVA 4I5NB 1KFUL 2NLNA 1QV0A 3FIAA 1CDLA 1ORGA 2ZN8A 1M45A 4PHNA 2WCLA 4PE0A 2WCKA 3SG7A 2OPOA 2LHIA 4ORBB 4JD9A 1GGZA 1NX3A 2B1UA 1TCOB 3TS5B 1S5GZ 4INWA 2F3ZA 4MZLA 3OX5A 2H61C 2HF5A 2KBMA 3CS1A 4QJ4B 2KQ6A 3EKJA 1NX0A 3SG5A 4DUQA 2ZN9A 3DVJA 2PYQA 2CT9A 3KF9A 1LA0A 1CDPA 1YVHA 1QIVA 5KU1A 1V1GA 2BKIB 1S26D 5HKYA 4P2YB 1A4PA 1TNPA 1S6CA 2SASA 3I5FB 4WRIA 1XYDA 3WNXB 3DZTA 3DXLA 3DVKA 3BOWB 1Y1UA 1A2XA 4N1GA 5DKQA 4MEWA 2CCMA 3FWBA 2LVJA 3EG5B 2P71A 2L50A 3PM8A 1QX5B 2LNKA 1J1DA 2QEVA 4IL1A 3TZ1A 1E8AA 2HQ8A 4NQGA 2K61A 1CB1A 4Q04A 1FI6A 4USLA 1JWDA 3D10A 3CR4X 1MXEA 3OB1B 4OR9B 5K89A 1SCMC 1EH2A 1XK4C 2KAYA 3HCMA 5ER4X 3K21A 3PALA 4L9MA 2KQYA 1NCZA 1J7QA 4I5JA 4GNKB 1JFKA 1OMRA 2Y4QA 4GBAA 5I2LA 1K2HA 2QDIA 2M7LA 1YURA 1PVAA 1DF0A 3GK4X 3TDIA 2BBMA 4YGAA 1EG3A 2WCJA 1XFZO 1RWYA 4JKTA 3SG2A 1J1EA 5ER5A 3VROA 2LVIA 4PE4A 1DJGA 5KSZA 1WRZA 1F70A 2M49B 4F0ZB 1K95A 1TWOA 3I5HB 1SPYA 1VRKA 3GOFA 1BOCA 1Z4HA 3BFHA 3OGNA 2EC6C 2WCFA 3BFBA 4YI8A 2CNPA 2L2CA 4JPZB 4MSPA 5HKWA 1SYMA 3O4YA 3JVTC 2ISDA 3S0FA 1JF2A 1UWOA 3OHMB 3KHEA 3EKHA 5D69A 1XFRA 3CGAA 4INXA 2BNXA 2BAPA 4MVFA 5F6TA 2MLFC 3VRNA 1QATA 3BJHA 1F54A 1GQMA 3CR5X 4KYNA 1NPQA 1IWQA 2KLDA 1QTXA 1IH0A 2LM5A 1BT6A 2KPHA 1XFUO 1NCYA 1J7RA 3CZTX 2KGRA 4MRYA 1LINA 1P28A 2KDHA 2MA2A 3D75A 4MZJA 4XYNA 1KQVA 3S0DA 1GJYA 3D0YB 3IQOA 1RFJA 3FE6A 1CM4A 2LAPA 4HRGA 5D7FA 3PN7B 4OVNF 1MR8A 1TRFA 1BODA 1JC2A 1SKTA 2BKHB 2F2PA 4FTGA 4PE7A 1JFJA 3D73A 4HREE 3KEVA 1KK7Z 2JWWA 3CWGA 4N1FA 4YBHB 1QV1A 2LP2A 3CR2A 2LUXA 3FE8A 1YUUA 2F33A 1NX2A 2BL0B 2PVBA 1NX1A 1M63B 3EVUA 2Q91A 1LXFC 2KAXA 1PALA 1WRKA 2K60A 2JNFA 2ZRSA 3S0GA 1QIWA 2MLEC 1D1OA 1KK8B 1FI5A 4FQTA 2KI6D 1DQEA 2LCPA 2M9GA 5KTYA 1WLMA 3WXAA 4YGDB 2K7OA 1SNLA 2CXJA 1AP4A 3VRRA 4JQ0D 3BUNB 1CDNA 1XO5A 2ZKMX 1YTZC 2JOJA 2CBLA 2KGBC 3OB2B 2K7BA 4GFTA 2MJWB 2JC2A 2WC8A 3ZWHA 2L0PA 1Q80A 1G4YR 4ZCVA 1T14A 3EK7A 1YRUB 1U5IA 3PATA 3DD4A 1SRAA 2V53A 4M2QA 1FF1A 1YX7A 3I5GC 3JTDC 1SSEB 4DCKA 1IIOA 3CABA 2KYFA 3RLZA 2KFFA 2JULA 2WC6A 2JPTA 2VRGA 3NSLA 5AXIA 2LC5A 3EK4A 3BQ3A 2Y5IA 3FWCA 2AUCA 1DGUA 2LLTA 3BXKA 4OV2A 5B8IB 1R2UA 2BE4A 2QEBA 1KSMA 2P6BB 1DEKA 1TNQA 1K8UA 2LLSA 1YUTA 2K7CA 5FYXA 3CZ0A 1JUOA 2SCPA 3SG6A 3LK0A 2KOTA 1IRJA 3PFVA 1F8HA 1PULA 4PDZA 1NSHA 2KNEA 1OSAA 1SBJA 4CPVA 1KQMC 1A29A 1WDCC 1YRTB 1UP5A 3H4SE 3O6BA 4IJ7A 1LKJA 1CFPA 3VRPA 1JSAA 2JT3A 1ODBA 2LVVA 1AUIB 1SCMB 4D1EA 3SIAA 2BECA 2LMTA 1U5IB 2M7NA 1L2OC 2M3WA 1QVIY 3R1PA 1OZOA 2Q4UA 3PLFB 5AFPA 1DVIA 3VGOA 3L4LA 2LANA 4CLNA 4AQJA 1UHNA 2L4HA 2ZNDA 3D77A 3S0BA 2JZIA 1BMOA 1DJXA 1XVJA 5CPVA 1M31A 2E30A 2GTEA 4YGCB 5I2QA 2RGIA 3A8RA 4E68A 5JJGA 1ZUZA 2Y1NA 2EC6B 1RK9A 2ZRTA 1DJWA 3AAKA 3R72A 5AEQA 1LS8A 2HETA 3SIBA 2L2EA 3JVTB 5I94A 1UUSA 1G33A 2FOTA 1UHHA 1AJ4A 2PALA 1W9ZA 1Y1AA 2PQLA 1L7ZA 3LCPC 1K96A 3NXAA 2JRFA 1A75A 1F4QA 3BFAA 4U8DA 3ZNIA 5TNCA 1K9UA 2LV7A 1C3YA 4MZKA 1Y0VH 2M1KB 1ZMZA 2WNDA 4BY5A 1KFXL 1FBVA 2M0RA 1QASA 3BUXB 1QJTA 5DICA 3UNWA 2BE6A 4PHMA 1B9AA 2FCEA 2AMIA 3GK1A 2WC5A 1QWVA 1EXRA 1K90D 5FI7A 2G9BA 2L5YA 2KFHA 2LHLA 4HSZA 1OE9B 2JXCA 1NIWA 3K1EA 2H8VA 2L5XB 3BUWB 1J55A 1KFUS 4A4CA 2GV5A 3IQQA 1DMOA 4PHJA 5CSNA 2P70A 1N0YA 2K7DA 5AANA 1B8LA 2YGUA 3AAJA 1R6PA 3L4AA 2M97A 1MQ1A 4C0KA 1DF0B 4ORCB 4C0JA 5I2OA 3FS7A 5CSJA 1KWOC 1ZFSA 3I5IC 4GGFC 4N5XA 2I2RE 2R2IA 2ZFDA 2PRUA 4FQOA 3LLEA 3L47A 3NHTA 1LVCD 5D3OA 1S3PA 3UO9A 1XFWO 4CFRA 4M2OA 4P5OE 3PJIA 1K9KA 1F71A 1OOIX 4MRXA 3SS5A 1B1GA 1PSRA 4NDBA 3WHUB 2I7AA 3LK1A 3PM2A 3PSRA 1HQVA 1OZSA 1RJVA 1WY9A 2QACA 2WCBA 3D76A 2JT0A 3EVVA 2BCXA 3TUYC 1K94A 1NYAA 1OMDA 1BG1A 1EG4A 1XA5A 1GM0A 3FE9A 4WQ2A 1CNPA 1CDMA 3I5GB 3JTDB 1UHIA 2KFGA 3CLNA 3NSOA 4I5KA 5DKRA 2KYCA 2JQ6A 1JF0A 1YVLA 1TCFA 1RECA 3O4XA 1QXPA 1B47A 1SR6C
chains in the Genus database with same CATH topology
4DS7A 1KCYA 3SG4A 1QS7A 2PASA 3M0WA 4YGBB 2LUCA 1TNXA 4ICBA 2NXQA 2OS8C 2L51A 3A4UB 4NDCA 3BUMB 4AQIA 5HYDA 1CTRA 2MHHA 1SY9A 4JWQA 2E6WA 2HQWA 1SMGA 2K0JA 2WOSA 3F45A 1KQMB 1WDCB 4WQ3A 1J7OA 1IJ6A 2M8UA 1N65A 2PMYA 1IKUA 3ICBA 2NCPA 1V1FA 5HLVA 2AAOA 4I5LB 1L2OB 1FPWA 4M2PA 1C7WA 1KK7Y 2K2FA 3BUOB 3NSIA 2BCAA 5J3XA 1CLLA 1TNWA 2QPTA 4R1EA 1MF8B 2F3YA 4PALA 4YGEB 1AHRA 2OTGC 1WRLA 3AKBA 2LE9B 1SW8A 1S6IA 1TIZA 1YUSA 4MBEA 3OP0A 2PSRA 4PHKA 1NP8A 1QLKA 1S36A 2KI4C 3QRXA 3IF7A 1X02A 1M39A 1SL9A 2LMVA 1BR4B 1RTP1 1UURA 1B4CA 4C0LA 2I18A 2NZ0A 4GGFA 1BF5A 2FJUB 5PALA 1B7TY 4TNCA 2KBIA 3TS5C 3EK8A 1ALVA 1PSBA 1PRWA 1DGVA 1J7PA 2MBXA 1UHKA 3E3RA 1DJIA 2JTZA 4PE1A 2EHBA 3HX4A 1Y1XA 3KPXA 1AJ5A 2O5GA 4DIRA 2BBNA 2FCDA 3RM1A 2F8PA 1XFVO 3DVEA 4ORAB 3BYAA 3WHTB 2IS9A 3I5FC 1PK0D 2M29A 1K9PA 1CMFA 1IQ5A 2H2KA 2A4JA 1CFDA 1NCXA 2KAVA 2COLB 1S5GY 2GGMA 1W7JB 2JT8A 2CTNA 1XFYO 2O60A 2L4IA 1YR5A 1BLQA 3D0YA 3OX6A 4MN0A 1LA3A 1SL7A 1WLZA 4AOMA 4GAOA 1AK8A 2KSPA 1CLBA 1DJHA 1RROA 1KWOB 2JU0A 3I5IB 2DOQA 3EVRA 4MLWA 1XFXO 1IQ3A 1MHOA 1ZOTB 2D8NA 3DF0A 2K8MB 4XJKA 5CSFA 3TDZA 3SG3A 4CFQA 1MWNA 4DRWA 2JXLA 4YI9A 3LL8B 2KI6C 1W7IB 2NCOA 2HPSA 5GQQC 2M1UA 1BR1B 3CTNA 1PVBA 1B8CA 1EL4A 1C07A 4NDDA 1OQPA 1IGVA 1A75B 5CSIA 3MSEB 4HRHA 4QJ5B 1FW4A 1UHJA 2WCEA 1BJFA 3TUYB 1YX8A 1QX7A 5HKZA 1DT7B 1SK6D 1AVSA 1CM1A 3I5HC 5HLOA 3NSKA 2G2BA 1CFCA 1QX2A 1ALWA 1DJYA 2BCBA 1H4BA 4OCIA 1KSOA 1CFFA 3O78A 5DKNA 3C1VA 2LP3A 2GGZA 1K93D 1G8IA 1SR6B 2F2OA 2K2AA 1BU3A 1MUXA 2ZNEA 1OMVA 4UPGA 1NWDA 1CMGA 1C7VA 1SL8A 2OS8B 4ZCUA 5AERA 1JBAA 2H61A 1IG5A 1OOJA 1F4OA 2MAZA 1S6JA 1EJ3A 2LMUA 2EGDA 3DF0B 4XJKB 1TTXA 3DVMA 1N2DA 2LVKA 4A4BA 1QLSA 2LLUA 1NUBA 4GGNA 4OKHA 1CLMA 3PN7C 1HT9A 2L98A 4GUKA 5I8NA 2MRDA 5BPJA 1QVIZ 1TOPA 2JNXA 5G08A 1B8RA 2I94A 1ZACA 2KHNA 2BL0C 1DTLA 2WORA 4YRUA 3SJSA 1DJZA 5JOLA 1KFXS 2JTTA 1MXLC 2TN4A 1Y6WA 3VRQA 1B7TZ 4CIDA 5IBWA 4QJ3B 3GK2A 2OTGB 1KK8C 1F55A 1IJ5A 1CKKA 1M46A 3AKAA 1XK4A 3KO0A 3BOWA 3O2PA 1TN4A 2Y1MA 4ETOA 4GPLB 2KI4B 1H8BA 4BY4A 1GGWA 3TDUA 1S1EA 4PCWA 1SCVA 4I5NB 1KFUL 2NLNA 1QV0A 3FIAA 1CDLA 2ZN8A 4PHNA 1M45A 4PE0A 3SG7A 2OPOA 2LHIA 4ORBB 1GGZA 1NX3A 2B1UA 1TCOB 3TS5B 1S5GZ 2F3ZA 4MZLA 3OX5A 2H61C 2HF5A 2KBMA 3CS1A 4QJ4B 2KQ6A 3EKJA 1NX0A 3SG5A 4DUQA 2ZN9A 3DVJA 2CT9A 3KF9A 1LA0A 1CDPA 1YVHA 1QIVA 5KU1A 1V1GA 2BKIB 1S26D 5HKYA 4P2YB 1A4PA 1TNPA 1S6CA 2SASA 3I5FB 4WRIA 1XYDA 3WNXB 3DVKA 3BOWB 1Y1UA 1A2XA 4N1GA 5DKQA 4MEWA 2CCMA 3FWBA 2LVJA 2L50A 3PM8A 1QX5B 2LNKA 1J1DA 4IL1A 3TZ1A 1E8AA 2HQ8A 4NQGA 2K61A 1CB1A 4Q04A 1FI6A 4USLA 1JWDA 3D10A 3CR4X 1MXEA 3OB1B 4OR9B 5K89A 1SCMC 1EH2A 1XK4C 2KAYA 3HCMA 5ER4X 3K21A 3PALA 4L9MA 2KQYA 1NCZA 1J7QA 4I5JA 4GNKB 1JFKA 1OMRA 2Y4QA 4GBAA 5I2LA 1K2HA 2M7LA 1YURA 1PVAA 1DF0A 3GK4X 3TDIA 2BBMA 4YGAA 1EG3A 1XFZO 1RWYA 3SG2A 1J1EA 5ER5A 3VROA 2LVIA 4PE4A 1DJGA 5KSZA 1WRZA 1F70A 2M49B 4F0ZB 1K95A 3I5HB 1SPYA 1VRKA 3GOFA 1BOCA 2EC6C 2WCFA 4YI8A 2CNPA 4JPZB 4MSPA 5HKWA 1SYMA 3O4YA 3JVTC 2ISDA 1JF2A 1UWOA 3OHMB 3KHEA 3EKHA 5D69A 3CGAA 4MVFA 5F6TA 2MLFC 3VRNA 1QATA 1F54A 1GQMA 3CR5X 1NPQA 1IWQA 1QTXA 1IH0A 2LM5A 1BT6A 1XFUO 1NCYA 1J7RA 3CZTX 2KGRA 4MRYA 1LINA 2KDHA 2MA2A 4MZJA 1KQVA 4XYNA 1GJYA 3D0YB 3IQOA 1RFJA 1CM4A 2LAPA 4HRGA 5D7FA 3PN7B 4OVNF 1MR8A 1TRFA 1BODA 1JC2A 1SKTA 2BKHB 2F2PA 4FTGA 4PE7A 1JFJA 4HREE 3KEVA 1KK7Z 2JWWA 3CWGA 4N1FA 4YBHB 1QV1A 2LP2A 3CR2A 2LUXA 1YUUA 2F33A 1NX2A 2BL0B 2PVBA 1NX1A 1M63B 3EVUA 2Q91A 1LXFC 2KAXA 1PALA 1WRKA 2ZRSA 2JNFA 1D1OA 1QIWA 2MLEC 1KK8B 1FI5A 2KI6D 2LCPA 2M9GA 5KTYA 1WLMA 3WXAA 4YGDB 2K7OA 1SNLA 2CXJA 1AP4A 3VRRA 4JQ0D 3BUNB 1CDNA 1XO5A 2ZKMX 1YTZC 2JOJA 2CBLA 2KGBC 3OB2B 2K7BA 4GFTA 2MJWB 2JC2A 2WC8A 3ZWHA 2L0PA 1Q80A 1G4YR 4ZCVA 3EK7A 1YRUB 1U5IA 3PATA 3DD4A 1SRAA 2V53A 4M2QA 1FF1A 1YX7A 3I5GC 3JTDC 4DCKA 2KYFA 3RLZA 2KFFA 2JULA 3NSLA 2JPTA 2VRGA 5AXIA 2LC5A 3EK4A 3BQ3A 2Y5IA 3FWCA 2AUCA 1DGUA 2LLTA 3BXKA 4OV2A 5B8IB 1R2UA 2BE4A 1KSMA 2P6BB 1TNQA 1K8UA 2LLSA 1YUTA 2K7CA 5FYXA 1JUOA 2SCPA 3SG6A 3LK0A 2KOTA 1IRJA 3PFVA 1F8HA 1PULA 4PDZA 1NSHA 2KNEA 1OSAA 1SBJA 4CPVA 1KQMC 1A29A 1WDCC 1YRTB 1UP5A 3H4SE 3O6BA 1LKJA 1CFPA 3VRPA 1JSAA 2JT3A 1ODBA 2LVVA 1AUIB 1SCMB 4D1EA 3SIAA 2BECA 2LMTA 1U5IB 2M7NA 1L2OC 2M3WA 1QVIY 1OZOA 2Q4UA 3PLFB 5AFPA 1DVIA 3VGOA 2LANA 4CLNA 4AQJA 1UHNA 2L4HA 2ZNDA 2JZIA 1BMOA 1DJXA 1XVJA 5CPVA 1M31A 2E30A 4YGCB 5I2QA 2RGIA 3A8RA 4E68A 5JJGA 1ZUZA 2Y1NA 2EC6B 1RK9A 2ZRTA 1DJWA 3AAKA 5AEQA 3SIBA 1A03A 2HETA 2L2EA 3JVTB 1UUSA 1G33A 2FOTA 1UHHA 1AJ4A 2PALA 1Y1AA 3LCPC 1L7ZA 1K96A 3NXAA 2JRFA 1A75A 1F4QA 4U8DA 3ZNIA 5TNCA 1K9UA 2LV7A 4MZKA 1Y0VH 2M1KB 1ZMZA 2WNDA 4BY5A 1KFXL 1FBVA 2M0RA 1QASA 3BUXB 1QJTA 2BE6A 4PHMA 1B9AA 2FCEA 2AMIA 3GK1A 1EXRA 1K90D 2G9BA 2KFHA 2LHLA 4HSZA 1OE9B 2JXCA 1NIWA 2L5XB 3BUWB 1J55A 1KFUS 4A4CA 2GV5A 3IQQA 1DMOA 4PHJA 5CSNA 5AANA 1N0YA 2K7DA 1B8LA 3AAJA 1R6PA 2M97A 1MQ1A 1DF0B 4ORCB 4C0JA 5I2OA 3FS7A 1KWOC 1ZFSA 3I5IC 4GGFC 4N5XA 2I2RE 2R2IA 2ZFDA 2PRUA 4FQOA 3LLEA 1LVCD 1S3PA 1XFWO 4CFRA 4M2OA 4P5OE 1K9KA 1F71A 4MRXA 1B1GA 1PSRA 4NDBA 3WHUB 2I7AA 3LK1A 3PSRA 4C0KA 1HQVA 1OZSA 1RJVA 1WY9A 2QACA 2WCBA 3EVVA 2JT0A 5CSJA 2BCXA 3TUYC 1K94A 1NYAA 1OMDA 1BG1A 1EG4A 1XA5A 4WQ2A 1CNPA 1CDMA 3I5GB 3JTDB 1UHIA 2KFGA 3CLNA 3NSOA 4I5KA 5DKRA 2KYCA 2JQ6A 1JF0A 1YVLA 1TCFA 1RECA 1QXPA 1B47A 1SR6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DS7 A;  1KCY A;  3SG4 A;  1QS7 A;  2PAS A;  3M0W A;  4YGB B;  2LUC A;  1TNX A;  4ICB A;  2NXQ A;  2OS8 C;  2L51 A;  3A4U B;  4NDC A;  3BUM B;  4AQI A;  5HYD A;  1CTR A;  2MHH A;  1SY9 A;  4JWQ A;  2E6W A;  2HQW A;  1SMG A;  2K0J A;  2WOS A;  3F45 A;  1KQM B;  1WDC B;  4WQ3 A;  1J7O A;  1IJ6 A;  2M8U A;  1N65 A;  2PMY A;  1IKU A;  3ICB A;  2NCP A;  1V1F A;  5HLV A;  2AAO A;  4I5L B;  1L2O B;  1FPW A;  4M2P A;  1C7W A;  1KK7 Y;  2K2F A;  3BUO B;  3NSI A;  2BCA A;  5J3X A;  1CLL A;  1TNW A;  2QPT A;  4R1E A;  1MF8 B;  2F3Y A;  4PAL A;  4YGE B;  1AHR A;  2OTG C;  1WRL A;  3AKB A;  2LE9 B;  1SW8 A;  1S6I A;  1TIZ A;  1YUS A;  4MBE A;  3OP0 A;  2PSR A;  4PHK A;  1NP8 A;  1QLK A;  1S36 A;  2KI4 C;  3QRX A;  3IF7 A;  1X02 A;  1M39 A;  1SL9 A;  2LMV A;  1BR4 B;  1RTP 1;  1UUR A;  1B4C A;  4C0L A;  2I18 A;  2NZ0 A;  4GGF A;  1BF5 A;  2FJU B;  5PAL A;  1B7T Y;  4TNC A;  2KBI A;  3TS5 C;  3EK8 A;  1ALV A;  1PSB A;  1PRW A;  1DGV A;  1J7P A;  2MBX A;  1UHK A;  3E3R A;  1DJI A;  2JTZ A;  4PE1 A;  2EHB A;  3HX4 A;  1Y1X A;  3KPX A;  1AJ5 A;  2O5G A;  4DIR A;  2BBN A;  2FCD A;  3RM1 A;  2F8P A;  1XFV O;  3DVE A;  4ORA B;  3BYA A;  3WHT B;  2IS9 A;  3I5F C;  1PK0 D;  2M29 A;  1K9P A;  1CMF A;  1IQ5 A;  2H2K A;  2A4J A;  1CFD A;  1NCX A;  2KAV A;  2COL B;  1S5G Y;  2GGM A;  1W7J B;  2JT8 A;  2CTN A;  1XFY O;  2O60 A;  2L4I A;  1YR5 A;  1BLQ A;  3D0Y A;  3OX6 A;  4MN0 A;  1LA3 A;  1SL7 A;  1WLZ A;  4AOM A;  4GAO A;  1AK8 A;  2KSP A;  1CLB A;  1DJH A;  1RRO A;  1KWO B;  2JU0 A;  3I5I B;  2DOQ A;  3EVR A;  4MLW A;  1XFX O;  1IQ3 A;  1MHO A;  1ZOT B;  2D8N A;  3DF0 A;  2K8M B;  4XJK A;  5CSF A;  3TDZ A;  3SG3 A;  4CFQ A;  1MWN A;  4DRW A;  2JXL A;  4YI9 A;  3LL8 B;  2KI6 C;  1W7I B;  2NCO A;  2HPS A;  5GQQ C;  2M1U A;  1BR1 B;  3CTN A;  1PVB A;  1B8C A;  1EL4 A;  1C07 A;  4NDD A;  1OQP A;  1IGV A;  1A75 B;  5CSI A;  3MSE B;  4HRH A;  4QJ5 B;  1FW4 A;  1UHJ A;  2WCE A;  1BJF A;  3TUY B;  1YX8 A;  1QX7 A;  5HKZ A;  1DT7 B;  1SK6 D;  1AVS A;  1CM1 A;  3I5H C;  5HLO A;  3NSK A;  2G2B A;  1CFC A;  1QX2 A;  1ALW A;  1DJY A;  2BCB A;  1H4B A;  4OCI A;  1KSO A;  1CFF A;  3O78 A;  5DKN A;  3C1V A;  2LP3 A;  2GGZ A;  1K93 D;  1G8I A;  1SR6 B;  2F2O A;  2K2A A;  1BU3 A;  1MUX A;  2ZNE A;  1OMV A;  4UPG A;  1NWD A;  1CMG A;  1C7V A;  1SL8 A;  2OS8 B;  4ZCU A;  5AER A;  1JBA A;  2H61 A;  1IG5 A;  1OOJ A;  1F4O A;  2MAZ A;  1S6J A;  1EJ3 A;  2LMU A;  2EGD A;  3DF0 B;  4XJK B;  1TTX A;  3DVM A;  1N2D A;  2LVK A;  4A4B A;  1QLS A;  2LLU A;  1NUB A;  4GGN A;  4OKH A;  1CLM A;  3PN7 C;  1HT9 A;  2L98 A;  4GUK A;  5I8N A;  2MRD A;  5BPJ A;  1QVI Z;  1TOP A;  2JNX A;  5G08 A;  1B8R A;  2I94 A;  1ZAC A;  2KHN A;  2BL0 C;  1DTL A;  2WOR A;  4YRU A;  3SJS A;  1DJZ A;  5JOL A;  1KFX S;  2JTT A;  1MXL C;  2TN4 A;  1Y6W A;  3VRQ A;  1B7T Z;  4CID A;  5IBW A;  4QJ3 B;  3GK2 A;  2OTG B;  1KK8 C;  1F55 A;  1IJ5 A;  1CKK A;  1M46 A;  3AKA A;  1XK4 A;  3KO0 A;  3BOW A;  3O2P A;  1TN4 A;  2Y1M A;  4ETO A;  4GPL B;  2KI4 B;  1H8B A;  4BY4 A;  1GGW A;  3TDU A;  1S1E A;  4PCW A;  1SCV A;  4I5N B;  1KFU L;  2NLN A;  1QV0 A;  3FIA A;  1CDL A;  2ZN8 A;  4PHN A;  1M45 A;  4PE0 A;  3SG7 A;  2OPO A;  2LHI A;  4ORB B;  1GGZ A;  1NX3 A;  2B1U A;  1TCO B;  3TS5 B;  1S5G Z;  2F3Z A;  4MZL A;  3OX5 A;  2H61 C;  2HF5 A;  2KBM A;  3CS1 A;  4QJ4 B;  2KQ6 A;  3EKJ A;  1NX0 A;  3SG5 A;  4DUQ A;  2ZN9 A;  3DVJ A;  2CT9 A;  3KF9 A;  1LA0 A;  1CDP A;  1YVH A;  1QIV A;  5KU1 A;  1V1G A;  2BKI B;  1S26 D;  5HKY A;  4P2Y B;  1A4P A;  1TNP A;  1S6C A;  2SAS A;  3I5F B;  4WRI A;  1XYD A;  3WNX B;  3DVK A;  3BOW B;  1Y1U A;  1A2X A;  4N1G A;  5DKQ A;  4MEW A;  2CCM A;  3FWB A;  2LVJ A;  2L50 A;  3PM8 A;  1QX5 B;  2LNK A;  1J1D A;  4IL1 A;  3TZ1 A;  1E8A A;  2HQ8 A;  4NQG A;  2K61 A;  1CB1 A;  4Q04 A;  1FI6 A;  4USL A;  1JWD A;  3D10 A;  3CR4 X;  1MXE A;  3OB1 B;  4OR9 B;  5K89 A;  1SCM C;  1EH2 A;  1XK4 C;  2KAY A;  3HCM A;  5ER4 X;  3K21 A;  3PAL A;  4L9M A;  2KQY A;  1NCZ A;  1J7Q A;  4I5J A;  4GNK B;  1JFK A;  1OMR A;  2Y4Q A;  4GBA A;  5I2L A;  1K2H A;  2M7L A;  1YUR A;  1PVA A;  1DF0 A;  3GK4 X;  3TDI A;  2BBM A;  4YGA A;  1EG3 A;  1XFZ O;  1RWY A;  3SG2 A;  1J1E A;  5ER5 A;  3VRO A;  2LVI A;  4PE4 A;  1DJG A;  5KSZ A;  1WRZ A;  1F70 A;  2M49 B;  4F0Z B;  1K95 A;  3I5H B;  1SPY A;  1VRK A;  3GOF A;  1BOC A;  2EC6 C;  2WCF A;  4YI8 A;  2CNP A;  4JPZ B;  4MSP A;  5HKW A;  1SYM A;  3O4Y A;  3JVT C;  2ISD A;  1JF2 A;  1UWO A;  3OHM B;  3KHE A;  3EKH A;  5D69 A;  3CGA A;  4MVF A;  5F6T A;  2MLF C;  3VRN A;  1QAT A;  1F54 A;  1GQM A;  3CR5 X;  1NPQ A;  1IWQ A;  1QTX A;  1IH0 A;  2LM5 A;  1BT6 A;  1XFU O;  1NCY A;  1J7R A;  3CZT X;  2KGR A;  4MRY A;  1LIN A;  2KDH A;  2MA2 A;  4MZJ A;  1KQV A;  4XYN A;  1GJY A;  3D0Y B;  3IQO A;  1RFJ A;  1CM4 A;  2LAP A;  4HRG A;  5D7F A;  3PN7 B;  4OVN F;  1MR8 A;  1TRF A;  1BOD A;  1JC2 A;  1SKT A;  2BKH B;  2F2P A;  4FTG A;  4PE7 A;  1JFJ A;  4HRE E;  3KEV A;  1KK7 Z;  2JWW A;  3CWG A;  4N1F A;  4YBH B;  1QV1 A;  2LP2 A;  3CR2 A;  2LUX A;  1YUU A;  2F33 A;  1NX2 A;  2BL0 B;  2PVB A;  1NX1 A;  1M63 B;  3EVU A;  2Q91 A;  1LXF C;  2KAX A;  1PAL A;  1WRK A;  2ZRS A;  2JNF A;  1D1O A;  1QIW A;  2MLE C;  1KK8 B;  1FI5 A;  2KI6 D;  2LCP A;  2M9G A;  5KTY A;  1WLM A;  3WXA A;  4YGD B;  2K7O A;  1SNL A;  2CXJ A;  1AP4 A;  3VRR A;  4JQ0 D;  3BUN B;  1CDN A;  1XO5 A;  2ZKM X;  1YTZ C;  2JOJ A;  2CBL A;  2KGB C;  3OB2 B;  2K7B A;  4GFT A;  2MJW B;  2JC2 A;  2WC8 A;  3ZWH A;  2L0P A;  1Q80 A;  1G4Y R;  4ZCV A;  3EK7 A;  1YRU B;  1U5I A;  3PAT A;  3DD4 A;  1SRA A;  2V53 A;  4M2Q A;  1FF1 A;  1YX7 A;  3I5G C;  3JTD C;  4DCK A;  2KYF A;  3RLZ A;  2KFF A;  2JUL A;  3NSL A;  2JPT A;  2VRG A;  5AXI A;  2LC5 A;  3EK4 A;  3BQ3 A;  2Y5I A;  3FWC A;  2AUC A;  1DGU A;  2LLT A;  3BXK A;  4OV2 A;  5B8I B;  1R2U A;  2BE4 A;  1KSM A;  2P6B B;  1TNQ A;  1K8U A;  2LLS A;  1YUT A;  2K7C A;  5FYX A;  1JUO A;  2SCP A;  3SG6 A;  3LK0 A;  2KOT A;  1IRJ A;  3PFV A;  1F8H A;  1PUL A;  4PDZ A;  1NSH A;  2KNE A;  1OSA A;  1SBJ A;  4CPV A;  1KQM C;  1A29 A;  1WDC C;  1YRT B;  1UP5 A;  3H4S E;  3O6B A;  1LKJ A;  1CFP A;  3VRP A;  1JSA A;  2JT3 A;  1ODB A;  2LVV A;  1AUI B;  1SCM B;  4D1E A;  3SIA A;  2BEC A;  2LMT A;  1U5I B;  2M7N A;  1L2O C;  2M3W A;  1QVI Y;  1OZO A;  2Q4U A;  3PLF B;  5AFP A;  1DVI A;  3VGO A;  2LAN A;  4CLN A;  4AQJ A;  1UHN A;  2L4H A;  2ZND A;  2JZI A;  1BMO A;  1DJX A;  1XVJ A;  5CPV A;  1M31 A;  2E30 A;  4YGC B;  5I2Q A;  2RGI A;  3A8R A;  4E68 A;  5JJG A;  1ZUZ A;  2Y1N A;  2EC6 B;  1RK9 A;  2ZRT A;  1DJW A;  3AAK A;  5AEQ A;  3SIB A;  1A03 A;  2HET A;  2L2E A;  3JVT B;  1UUS A;  1G33 A;  2FOT A;  1UHH A;  1AJ4 A;  2PAL A;  1Y1A A;  3LCP C;  1L7Z A;  1K96 A;  3NXA A;  2JRF A;  1A75 A;  1F4Q A;  4U8D A;  3ZNI A;  5TNC A;  1K9U A;  2LV7 A;  4MZK A;  1Y0V H;  2M1K B;  1ZMZ A;  2WND A;  4BY5 A;  1KFX L;  1FBV A;  2M0R A;  1QAS A;  3BUX B;  1QJT A;  2BE6 A;  4PHM A;  1B9A A;  2FCE A;  2AMI A;  3GK1 A;  1EXR A;  1K90 D;  2G9B A;  2KFH A;  2LHL A;  4HSZ A;  1OE9 B;  2JXC A;  1NIW A;  2L5X B;  3BUW B;  1J55 A;  1KFU S;  4A4C A;  2GV5 A;  3IQQ A;  1DMO A;  4PHJ A;  5CSN A;  5AAN A;  1N0Y A;  2K7D A;  1B8L A;  3AAJ A;  1R6P A;  2M97 A;  1MQ1 A;  1DF0 B;  4ORC B;  4C0J A;  5I2O A;  3FS7 A;  1KWO C;  1ZFS A;  3I5I C;  4GGF C;  4N5X A;  2I2R E;  2R2I A;  2ZFD A;  2PRU A;  4FQO A;  3LLE A;  1LVC D;  1S3P A;  1XFW O;  4CFR A;  4M2O A;  4P5O E;  1K9K A;  1F71 A;  4MRX A;  1B1G A;  1PSR A;  4NDB A;  3WHU B;  2I7A A;  3LK1 A;  3PSR A;  4C0K A;  1HQV A;  1OZS A;  1RJV A;  1WY9 A;  2QAC A;  2WCB A;  3EVV A;  2JT0 A;  5CSJ A;  2BCX A;  3TUY C;  1K94 A;  1NYA A;  1OMD A;  1BG1 A;  1EG4 A;  1XA5 A;  4WQ2 A;  1CNP A;  1CDM A;  3I5G B;  3JTD B;  1UHI A;  2KFG A;  3CLN A;  3NSO A;  4I5K A;  5DKR A;  2KYC A;  2JQ6 A;  1JF0 A;  1YVL A;  1TCF A;  1REC A;  1QXP A;  1B47 A;  1SR6 C; 
#chains in the Genus database with same CATH topology
 4DS7 A;  1KCY A;  3SG4 A;  1QS7 A;  2PAS A;  3M0W A;  4YGB B;  2LUC A;  1TNX A;  4ICB A;  2NXQ A;  2OS8 C;  2L51 A;  3A4U B;  4NDC A;  3BUM B;  4AQI A;  5HYD A;  1CTR A;  2MHH A;  1SY9 A;  4JWQ A;  2E6W A;  2HQW A;  1SMG A;  2K0J A;  2WOS A;  3F45 A;  1KQM B;  1WDC B;  2QEO A;  3DY9 A;  4WQ3 A;  1J7O A;  1IJ6 A;  2M8U A;  1N65 A;  2PMY A;  2JPO A;  1IKU A;  3ICB A;  2NCP A;  1V1F A;  3SS4 A;  5HLV A;  2AAO A;  4I5L B;  1L2O B;  1FPW A;  3CZ2 A;  4M2P A;  3OBV A;  1C7W A;  1KK7 Y;  2K2F A;  3BUO B;  3NSI A;  2BCA A;  5J3X A;  1CLL A;  1TNW A;  2QPT A;  4R1E A;  1MF8 B;  2F3Y A;  3DYE A;  4PAL A;  4YGE B;  1AHR A;  2OTG C;  1WRL A;  3AKB A;  2LE9 B;  1SW8 A;  1S6I A;  1TIZ A;  1YUS A;  4MBE A;  3OP0 A;  2ERB A;  2PSR A;  4PHK A;  1NP8 A;  1QLK A;  1S36 A;  2KI4 C;  3QRX A;  3IF7 A;  1X02 A;  1M39 A;  1SL9 A;  2LMV A;  3CDN A;  3S0A A;  1BR4 B;  1RTP 1;  1UUR A;  1B4C A;  4C0L A;  2I18 A;  2NZ0 A;  3D74 A;  4GGF A;  1BF5 A;  2FJU B;  5PAL A;  1B7T Y;  4TNC A;  2KBI A;  3TS5 C;  3EK8 A;  1ALV A;  1PSB A;  1PRW A;  1DGV A;  2QEH A;  3B86 A;  1J7P A;  2MBX A;  1UHK A;  3E3R A;  1DC1 A;  1DJI A;  2JTZ A;  4PE1 A;  1C3Z A;  2EHB A;  3HX4 A;  1Y1X A;  3KPX A;  1AJ5 A;  2O5G A;  4DIR A;  3R1V A;  2BBN A;  2FCD A;  3B6X A;  2F8P A;  3RM1 A;  1XFV O;  3DVE A;  4ORA B;  3BYA A;  3WHT B;  2IS9 A;  2WCH A;  3I5F C;  1PK0 D;  2M29 A;  1K9P A;  1CMF A;  1IQ5 A;  2H2K A;  2A4J A;  3V2L A;  1CFD A;  1NCX A;  2KAV A;  2COL B;  1S5G Y;  2GGM A;  1W7J B;  2JT8 A;  4F7F A;  2CTN A;  1XFY O;  2O60 A;  1A03 A;  2L4I A;  1YR5 A;  1BLQ A;  3D0Y A;  3OX6 A;  4MN0 A;  1LA3 A;  1SL7 A;  1WLZ A;  4AOM A;  4GAO A;  1AK8 A;  2KSP A;  1CLB A;  1DJH A;  1RRO A;  1KWO B;  2JU0 A;  3B88 A;  1OW4 A;  3I5I B;  2DOQ A;  3EVR A;  4MLW A;  1TUZ A;  1XFX O;  1IQ3 A;  1MHO A;  1ZOT B;  2D8N A;  3DF0 A;  2K8M B;  4XJK A;  5CSF A;  3TDZ A;  3SG3 A;  4CFQ A;  1MWN A;  4DRW A;  2JXL A;  4YI9 A;  3LL8 B;  1TUJ A;  2KI6 C;  1W7I B;  2NCO A;  3N7H A;  3NHI A;  3R1O A;  2HPS A;  5GQQ C;  2M1U A;  1BR1 B;  3CTN A;  1PVB A;  1B8C A;  1EL4 A;  3QME A;  4NDD A;  1OOH A;  1OQP A;  1C07 A;  1IGV A;  1A75 B;  5CSI A;  3D78 A;  3MSE B;  4HRH A;  4QJ5 B;  1FW4 A;  1UHJ A;  2WCE A;  1BJF A;  3TUY B;  1YX8 A;  1QX7 A;  5HKZ A;  1DT7 B;  1SK6 D;  1AVS A;  1CM1 A;  3I5H C;  5HLO A;  3NSK A;  3NGV A;  1OOF A;  5FI2 A;  3SS3 A;  2G2B A;  1CFC A;  1QX2 A;  1ALW A;  1DJY A;  2BCB A;  1H4B A;  4OCI A;  1KSO A;  5FI6 A;  1CFF A;  3O78 A;  3Q8I A;  5DKN A;  2FJY A;  2LP3 A;  3C1V A;  2GGZ A;  1K93 D;  1G8I A;  1SR6 B;  1Z2C B;  2F2O A;  2K2A A;  1BU3 A;  1MUX A;  2ZNE A;  1OMV A;  4UPG A;  1NWD A;  1CMG A;  1C7V A;  1SL8 A;  2OS8 B;  3CYZ A;  4ZCU A;  5AER A;  2H61 A;  1JBA A;  1IG5 A;  1OOJ A;  1F4O A;  2MAZ A;  1S6J A;  1EJ3 A;  2LMU A;  2EGD A;  2KLE A;  3DF0 B;  3VB1 A;  4XJK B;  1TTX A;  3DVM A;  3CZ1 A;  3S0E A;  1N2D A;  2LVK A;  4A4B A;  1QLS A;  2LLU A;  1DEL A;  1NUB A;  4GGN A;  4OKH A;  1CLM A;  3PN7 C;  1HT9 A;  2L98 A;  2WCM A;  4GUK A;  5I8N A;  2MRD A;  5BPJ A;  1QVI Z;  3B87 A;  1TOP A;  2JNX A;  4OZD A;  5G08 A;  1B8R A;  2I94 A;  1ZAC A;  5HL1 A;  2KHN A;  2BL0 C;  1DTL A;  2WOR A;  4YRU A;  3SJS A;  1DJZ A;  5JOL A;  1KFX S;  2JTT A;  1MXL C;  2TN4 A;  1Y6W A;  3VRQ A;  1B7T Z;  4CID A;  5IBW A;  4QJ3 B;  5EL2 A;  3GK2 A;  2OTG B;  1KK8 C;  1F55 A;  1IJ5 A;  1CKK A;  4PT1 A;  1M46 A;  3IVT A;  1OOG A;  3AKA A;  1XK4 A;  3KO0 A;  3BOW A;  3O2P A;  1TN4 A;  2Y1M A;  4ETO A;  3B7A A;  4GPL B;  2KI4 B;  1H8B A;  4BY4 A;  1GGW A;  3RZS A;  3TDU A;  1S1E A;  4PCW A;  1SCV A;  4I5N B;  1KFU L;  2NLN A;  1QV0 A;  3FIA A;  1CDL A;  1ORG A;  2ZN8 A;  1M45 A;  4PHN A;  2WCL A;  4PE0 A;  2WCK A;  3SG7 A;  2OPO A;  2LHI A;  4ORB B;  4JD9 A;  1GGZ A;  1NX3 A;  2B1U A;  1TCO B;  3TS5 B;  1S5G Z;  4INW A;  2F3Z A;  4MZL A;  3OX5 A;  2H61 C;  2HF5 A;  2KBM A;  3CS1 A;  4QJ4 B;  2KQ6 A;  3EKJ A;  1NX0 A;  3SG5 A;  4DUQ A;  2ZN9 A;  3DVJ A;  2PYQ A;  2CT9 A;  3KF9 A;  1LA0 A;  1CDP A;  1YVH A;  1QIV A;  5KU1 A;  1V1G A;  2BKI B;  1S26 D;  5HKY A;  4P2Y B;  1A4P A;  1TNP A;  1S6C A;  2SAS A;  3I5F B;  4WRI A;  1XYD A;  3WNX B;  3DZT A;  3DXL A;  3DVK A;  3BOW B;  1Y1U A;  1A2X A;  4N1G A;  5DKQ A;  4MEW A;  2CCM A;  3FWB A;  2LVJ A;  3EG5 B;  2P71 A;  2L50 A;  3PM8 A;  1QX5 B;  2LNK A;  1J1D A;  2QEV A;  4IL1 A;  3TZ1 A;  1E8A A;  2HQ8 A;  4NQG A;  2K61 A;  1CB1 A;  4Q04 A;  1FI6 A;  4USL A;  1JWD A;  3D10 A;  3CR4 X;  1MXE A;  3OB1 B;  4OR9 B;  5K89 A;  1SCM C;  1EH2 A;  1XK4 C;  2KAY A;  3HCM A;  5ER4 X;  3K21 A;  3PAL A;  4L9M A;  2KQY A;  1NCZ A;  1J7Q A;  4I5J A;  4GNK B;  1JFK A;  1OMR A;  2Y4Q A;  4GBA A;  5I2L A;  1K2H A;  2QDI A;  2M7L A;  1YUR A;  1PVA A;  1DF0 A;  3GK4 X;  3TDI A;  2BBM A;  4YGA A;  1EG3 A;  2WCJ A;  1XFZ O;  1RWY A;  4JKT A;  3SG2 A;  1J1E A;  5ER5 A;  3VRO A;  2LVI A;  4PE4 A;  1DJG A;  5KSZ A;  1WRZ A;  1F70 A;  2M49 B;  4F0Z B;  1K95 A;  1TWO A;  3I5H B;  1SPY A;  1VRK A;  3GOF A;  1BOC A;  1Z4H A;  3BFH A;  3OGN A;  2EC6 C;  2WCF A;  3BFB A;  4YI8 A;  2CNP A;  2L2C A;  4JPZ B;  4MSP A;  5HKW A;  1SYM A;  3O4Y A;  3JVT C;  2ISD A;  3S0F A;  1JF2 A;  1UWO A;  3OHM B;  3KHE A;  3EKH A;  5D69 A;  1XFR A;  3CGA A;  4INX A;  2BNX A;  2BAP A;  4MVF A;  5F6T A;  2MLF C;  3VRN A;  1QAT A;  3BJH A;  1F54 A;  1GQM A;  3CR5 X;  4KYN A;  1NPQ A;  1IWQ A;  2KLD A;  1QTX A;  1IH0 A;  2LM5 A;  1BT6 A;  2KPH A;  1XFU O;  1NCY A;  1J7R A;  3CZT X;  2KGR A;  4MRY A;  1LIN A;  1P28 A;  2KDH A;  2MA2 A;  3D75 A;  4MZJ A;  4XYN A;  1KQV A;  3S0D A;  1GJY A;  3D0Y B;  3IQO A;  1RFJ A;  3FE6 A;  1CM4 A;  2LAP A;  4HRG A;  5D7F A;  3PN7 B;  4OVN F;  1MR8 A;  1TRF A;  1BOD A;  1JC2 A;  1SKT A;  2BKH B;  2F2P A;  4FTG A;  4PE7 A;  1JFJ A;  3D73 A;  4HRE E;  3KEV A;  1KK7 Z;  2JWW A;  3CWG A;  4N1F A;  4YBH B;  1QV1 A;  2LP2 A;  3CR2 A;  2LUX A;  3FE8 A;  1YUU A;  2F33 A;  1NX2 A;  2BL0 B;  2PVB A;  1NX1 A;  1M63 B;  3EVU A;  2Q91 A;  1LXF C;  2KAX A;  1PAL A;  1WRK A;  2K60 A;  2JNF A;  2ZRS A;  3S0G A;  1QIW A;  2MLE C;  1D1O A;  1KK8 B;  1FI5 A;  4FQT A;  2KI6 D;  1DQE A;  2LCP A;  2M9G A;  5KTY A;  1WLM A;  3WXA A;  4YGD B;  2K7O A;  1SNL A;  2CXJ A;  1AP4 A;  3VRR A;  4JQ0 D;  3BUN B;  1CDN A;  1XO5 A;  2ZKM X;  1YTZ C;  2JOJ A;  2CBL A;  2KGB C;  3OB2 B;  2K7B A;  4GFT A;  2MJW B;  2JC2 A;  2WC8 A;  3ZWH A;  2L0P A;  1Q80 A;  1G4Y R;  4ZCV A;  1T14 A;  3EK7 A;  1YRU B;  1U5I A;  3PAT A;  3DD4 A;  1SRA A;  2V53 A;  4M2Q A;  1FF1 A;  1YX7 A;  3I5G C;  3JTD C;  1SSE B;  4DCK A;  1IIO A;  3CAB A;  2KYF A;  3RLZ A;  2KFF A;  2JUL A;  2WC6 A;  2JPT A;  2VRG A;  3NSL A;  5AXI A;  2LC5 A;  3EK4 A;  3BQ3 A;  2Y5I A;  3FWC A;  2AUC A;  1DGU A;  2LLT A;  3BXK A;  4OV2 A;  5B8I B;  1R2U A;  2BE4 A;  2QEB A;  1KSM A;  2P6B B;  1DEK A;  1TNQ A;  1K8U A;  2LLS A;  1YUT A;  2K7C A;  5FYX A;  3CZ0 A;  1JUO A;  2SCP A;  3SG6 A;  3LK0 A;  2KOT A;  1IRJ A;  3PFV A;  1F8H A;  1PUL A;  4PDZ A;  1NSH A;  2KNE A;  1OSA A;  1SBJ A;  4CPV A;  1KQM C;  1A29 A;  1WDC C;  1YRT B;  1UP5 A;  3H4S E;  3O6B A;  4IJ7 A;  1LKJ A;  1CFP A;  3VRP A;  1JSA A;  2JT3 A;  1ODB A;  2LVV A;  1AUI B;  1SCM B;  4D1E A;  3SIA A;  2BEC A;  2LMT A;  1U5I B;  2M7N A;  1L2O C;  2M3W A;  1QVI Y;  3R1P A;  1OZO A;  2Q4U A;  3PLF B;  5AFP A;  1DVI A;  3VGO A;  3L4L A;  2LAN A;  4CLN A;  4AQJ A;  1UHN A;  2L4H A;  2ZND A;  3D77 A;  3S0B A;  2JZI A;  1BMO A;  1DJX A;  1XVJ A;  5CPV A;  1M31 A;  2E30 A;  2GTE A;  4YGC B;  5I2Q A;  2RGI A;  3A8R A;  4E68 A;  5JJG A;  1ZUZ A;  2Y1N A;  2EC6 B;  1RK9 A;  2ZRT A;  1DJW A;  3AAK A;  3R72 A;  5AEQ A;  1LS8 A;  2HET A;  3SIB A;  2L2E A;  3JVT B;  5I94 A;  1UUS A;  1G33 A;  2FOT A;  1UHH A;  1AJ4 A;  2PAL A;  1W9Z A;  1Y1A A;  2PQL A;  1L7Z A;  3LCP C;  1K96 A;  3NXA A;  2JRF A;  1A75 A;  1F4Q A;  3BFA A;  4U8D A;  3ZNI A;  5TNC A;  1K9U A;  2LV7 A;  1C3Y A;  4MZK A;  1Y0V H;  2M1K B;  1ZMZ A;  2WND A;  4BY5 A;  1KFX L;  1FBV A;  2M0R A;  1QAS A;  3BUX B;  1QJT A;  5DIC A;  3UNW A;  2BE6 A;  4PHM A;  1B9A A;  2FCE A;  2AMI A;  3GK1 A;  2WC5 A;  1QWV A;  1EXR A;  1K90 D;  5FI7 A;  2G9B A;  2L5Y A;  2KFH A;  2LHL A;  4HSZ A;  1OE9 B;  2JXC A;  1NIW A;  3K1E A;  2H8V A;  2L5X B;  3BUW B;  1J55 A;  1KFU S;  4A4C A;  2GV5 A;  3IQQ A;  1DMO A;  4PHJ A;  5CSN A;  2P70 A;  1N0Y A;  2K7D A;  5AAN A;  1B8L A;  2YGU A;  3AAJ A;  1R6P A;  3L4A A;  2M97 A;  1MQ1 A;  4C0K A;  1DF0 B;  4ORC B;  4C0J A;  5I2O A;  3FS7 A;  5CSJ A;  1KWO C;  1ZFS A;  3I5I C;  4GGF C;  4N5X A;  2I2R E;  2R2I A;  2ZFD A;  2PRU A;  4FQO A;  3LLE A;  3L47 A;  3NHT A;  1LVC D;  5D3O A;  1S3P A;  3UO9 A;  1XFW O;  4CFR A;  4M2O A;  4P5O E;  3PJI A;  1K9K A;  1F71 A;  1OOI X;  4MRX A;  3SS5 A;  1B1G A;  1PSR A;  4NDB A;  3WHU B;  2I7A A;  3LK1 A;  3PM2 A;  3PSR A;  1HQV A;  1OZS A;  1RJV A;  1WY9 A;  2QAC A;  2WCB A;  3D76 A;  2JT0 A;  3EVV A;  2BCX A;  3TUY C;  1K94 A;  1NYA A;  1OMD A;  1BG1 A;  1EG4 A;  1XA5 A;  1GM0 A;  3FE9 A;  4WQ2 A;  1CNP A;  1CDM A;  3I5G B;  3JTD B;  1UHI A;  2KFG A;  3CLN A;  3NSO A;  4I5K A;  5DKR A;  2KYC A;  2JQ6 A;  1JF0 A;  1YVL A;  1TCF A;  1REC A;  3O4X A;  1QXP A;  1B47 A;  1SR6 C; 
#chains in the Genus database with same CATH homology
 4DS7 A;  1KCY A;  3SG4 A;  1QS7 A;  2PAS A;  3M0W A;  4YGB B;  2LUC A;  1TNX A;  4ICB A;  2NXQ A;  2OS8 C;  2L51 A;  3A4U B;  4NDC A;  3BUM B;  4AQI A;  5HYD A;  1CTR A;  2MHH A;  1SY9 A;  4JWQ A;  2E6W A;  2HQW A;  1SMG A;  2K0J A;  2WOS A;  3F45 A;  1KQM B;  1WDC B;  4WQ3 A;  1J7O A;  1IJ6 A;  2M8U A;  1N65 A;  2PMY A;  1IKU A;  3ICB A;  2NCP A;  1V1F A;  5HLV A;  2AAO A;  4I5L B;  1L2O B;  1FPW A;  4M2P A;  1C7W A;  1KK7 Y;  2K2F A;  3BUO B;  3NSI A;  2BCA A;  5J3X A;  1CLL A;  1TNW A;  2QPT A;  4R1E A;  1MF8 B;  2F3Y A;  4PAL A;  4YGE B;  1AHR A;  2OTG C;  1WRL A;  3AKB A;  2LE9 B;  1SW8 A;  1S6I A;  1TIZ A;  1YUS A;  4MBE A;  3OP0 A;  2PSR A;  4PHK A;  1NP8 A;  1QLK A;  1S36 A;  2KI4 C;  3QRX A;  3IF7 A;  1X02 A;  1M39 A;  1SL9 A;  2LMV A;  1BR4 B;  1RTP 1;  1UUR A;  1B4C A;  4C0L A;  2I18 A;  2NZ0 A;  4GGF A;  1BF5 A;  2FJU B;  5PAL A;  1B7T Y;  4TNC A;  2KBI A;  3TS5 C;  3EK8 A;  1ALV A;  1PSB A;  1PRW A;  1DGV A;  1J7P A;  2MBX A;  1UHK A;  3E3R A;  1DJI A;  2JTZ A;  4PE1 A;  2EHB A;  3HX4 A;  1Y1X A;  3KPX A;  1AJ5 A;  2O5G A;  4DIR A;  2BBN A;  2FCD A;  3RM1 A;  2F8P A;  1XFV O;  3DVE A;  4ORA B;  3BYA A;  3WHT B;  2IS9 A;  3I5F C;  1PK0 D;  2M29 A;  1K9P A;  1CMF A;  1IQ5 A;  2H2K A;  2A4J A;  1CFD A;  1NCX A;  2KAV A;  2COL B;  1S5G Y;  2GGM A;  1W7J B;  2JT8 A;  2CTN A;  1XFY O;  2O60 A;  2L4I A;  1YR5 A;  1BLQ A;  3D0Y A;  3OX6 A;  4MN0 A;  1LA3 A;  1SL7 A;  1WLZ A;  4AOM A;  4GAO A;  1AK8 A;  2KSP A;  1CLB A;  1DJH A;  1RRO A;  1KWO B;  2JU0 A;  3I5I B;  2DOQ A;  3EVR A;  4MLW A;  1XFX O;  1IQ3 A;  1MHO A;  1ZOT B;  2D8N A;  3DF0 A;  2K8M B;  4XJK A;  5CSF A;  3TDZ A;  3SG3 A;  4CFQ A;  1MWN A;  4DRW A;  2JXL A;  4YI9 A;  3LL8 B;  2KI6 C;  1W7I B;  2NCO A;  2HPS A;  5GQQ C;  2M1U A;  1BR1 B;  3CTN A;  1PVB A;  1B8C A;  1EL4 A;  1C07 A;  4NDD A;  1OQP A;  1IGV A;  1A75 B;  5CSI A;  3MSE B;  4HRH A;  4QJ5 B;  1FW4 A;  1UHJ A;  2WCE A;  1BJF A;  3TUY B;  1YX8 A;  1QX7 A;  5HKZ A;  1DT7 B;  1SK6 D;  1AVS A;  1CM1 A;  3I5H C;  5HLO A;  3NSK A;  2G2B A;  1CFC A;  1QX2 A;  1ALW A;  1DJY A;  2BCB A;  1H4B A;  4OCI A;  1KSO A;  1CFF A;  3O78 A;  5DKN A;  3C1V A;  2LP3 A;  2GGZ A;  1K93 D;  1G8I A;  1SR6 B;  2F2O A;  2K2A A;  1BU3 A;  1MUX A;  2ZNE A;  1OMV A;  4UPG A;  1NWD A;  1CMG A;  1C7V A;  1SL8 A;  2OS8 B;  4ZCU A;  5AER A;  1JBA A;  2H61 A;  1IG5 A;  1OOJ A;  1F4O A;  2MAZ A;  1S6J A;  1EJ3 A;  2LMU A;  2EGD A;  3DF0 B;  4XJK B;  1TTX A;  3DVM A;  1N2D A;  2LVK A;  4A4B A;  1QLS A;  2LLU A;  1NUB A;  4GGN A;  4OKH A;  1CLM A;  3PN7 C;  1HT9 A;  2L98 A;  4GUK A;  5I8N A;  2MRD A;  5BPJ A;  1QVI Z;  1TOP A;  2JNX A;  5G08 A;  1B8R A;  2I94 A;  1ZAC A;  2KHN A;  2BL0 C;  1DTL A;  2WOR A;  4YRU A;  3SJS A;  1DJZ A;  5JOL A;  1KFX S;  2JTT A;  1MXL C;  2TN4 A;  1Y6W A;  3VRQ A;  1B7T Z;  4CID A;  5IBW A;  4QJ3 B;  3GK2 A;  2OTG B;  1KK8 C;  1F55 A;  1IJ5 A;  1CKK A;  1M46 A;  3AKA A;  1XK4 A;  3KO0 A;  3BOW A;  3O2P A;  1TN4 A;  2Y1M A;  4ETO A;  4GPL B;  2KI4 B;  1H8B A;  4BY4 A;  1GGW A;  3TDU A;  1S1E A;  4PCW A;  1SCV A;  4I5N B;  1KFU L;  2NLN A;  1QV0 A;  3FIA A;  1CDL A;  2ZN8 A;  4PHN A;  1M45 A;  4PE0 A;  3SG7 A;  2OPO A;  2LHI A;  4ORB B;  1GGZ A;  1NX3 A;  2B1U A;  1TCO B;  3TS5 B;  1S5G Z;  2F3Z A;  4MZL A;  3OX5 A;  2H61 C;  2HF5 A;  2KBM A;  3CS1 A;  4QJ4 B;  2KQ6 A;  3EKJ A;  1NX0 A;  3SG5 A;  4DUQ A;  2ZN9 A;  3DVJ A;  2CT9 A;  3KF9 A;  1LA0 A;  1CDP A;  1YVH A;  1QIV A;  5KU1 A;  1V1G A;  2BKI B;  1S26 D;  5HKY A;  4P2Y B;  1A4P A;  1TNP A;  1S6C A;  2SAS A;  3I5F B;  4WRI A;  1XYD A;  3WNX B;  3DVK A;  3BOW B;  1Y1U A;  1A2X A;  4N1G A;  5DKQ A;  4MEW A;  2CCM A;  3FWB A;  2LVJ A;  2L50 A;  3PM8 A;  1QX5 B;  2LNK A;  1J1D A;  4IL1 A;  3TZ1 A;  1E8A A;  2HQ8 A;  4NQG A;  2K61 A;  1CB1 A;  4Q04 A;  1FI6 A;  4USL A;  1JWD A;  3D10 A;  3CR4 X;  1MXE A;  3OB1 B;  4OR9 B;  5K89 A;  1SCM C;  1EH2 A;  1XK4 C;  2KAY A;  3HCM A;  5ER4 X;  3K21 A;  3PAL A;  4L9M A;  2KQY A;  1NCZ A;  1J7Q A;  4I5J A;  4GNK B;  1JFK A;  1OMR A;  2Y4Q A;  4GBA A;  5I2L A;  1K2H A;  2M7L A;  1YUR A;  1PVA A;  1DF0 A;  3GK4 X;  3TDI A;  2BBM A;  4YGA A;  1EG3 A;  1XFZ O;  1RWY A;  3SG2 A;  1J1E A;  5ER5 A;  3VRO A;  2LVI A;  4PE4 A;  1DJG A;  5KSZ A;  1WRZ A;  1F70 A;  2M49 B;  4F0Z B;  1K95 A;  3I5H B;  1SPY A;  1VRK A;  3GOF A;  1BOC A;  2EC6 C;  2WCF A;  4YI8 A;  2CNP A;  4JPZ B;  4MSP A;  5HKW A;  1SYM A;  3O4Y A;  3JVT C;  2ISD A;  1JF2 A;  1UWO A;  3OHM B;  3KHE A;  3EKH A;  5D69 A;  3CGA A;  4MVF A;  5F6T A;  2MLF C;  3VRN A;  1QAT A;  1F54 A;  1GQM A;  3CR5 X;  1NPQ A;  1IWQ A;  1QTX A;  1IH0 A;  2LM5 A;  1BT6 A;  1XFU O;  1NCY A;  1J7R A;  3CZT X;  2KGR A;  4MRY A;  1LIN A;  2KDH A;  2MA2 A;  4MZJ A;  1KQV A;  4XYN A;  1GJY A;  3D0Y B;  3IQO A;  1RFJ A;  1CM4 A;  2LAP A;  4HRG A;  5D7F A;  3PN7 B;  4OVN F;  1MR8 A;  1TRF A;  1BOD A;  1JC2 A;  1SKT A;  2BKH B;  2F2P A;  4FTG A;  4PE7 A;  1JFJ A;  4HRE E;  3KEV A;  1KK7 Z;  2JWW A;  3CWG A;  4N1F A;  4YBH B;  1QV1 A;  2LP2 A;  3CR2 A;  2LUX A;  1YUU A;  2F33 A;  1NX2 A;  2BL0 B;  2PVB A;  1NX1 A;  1M63 B;  3EVU A;  2Q91 A;  1LXF C;  2KAX A;  1PAL A;  1WRK A;  2ZRS A;  2JNF A;  1D1O A;  1QIW A;  2MLE C;  1KK8 B;  1FI5 A;  2KI6 D;  2LCP A;  2M9G A;  5KTY A;  1WLM A;  3WXA A;  4YGD B;  2K7O A;  1SNL A;  2CXJ A;  1AP4 A;  3VRR A;  4JQ0 D;  3BUN B;  1CDN A;  1XO5 A;  2ZKM X;  1YTZ C;  2JOJ A;  2CBL A;  2KGB C;  3OB2 B;  2K7B A;  4GFT A;  2MJW B;  2JC2 A;  2WC8 A;  3ZWH A;  2L0P A;  1Q80 A;  1G4Y R;  4ZCV A;  3EK7 A;  1YRU B;  1U5I A;  3PAT A;  3DD4 A;  1SRA A;  2V53 A;  4M2Q A;  1FF1 A;  1YX7 A;  3I5G C;  3JTD C;  4DCK A;  2KYF A;  3RLZ A;  2KFF A;  2JUL A;  3NSL A;  2JPT A;  2VRG A;  5AXI A;  2LC5 A;  3EK4 A;  3BQ3 A;  2Y5I A;  3FWC A;  2AUC A;  1DGU A;  2LLT A;  3BXK A;  4OV2 A;  5B8I B;  1R2U A;  2BE4 A;  1KSM A;  2P6B B;  1TNQ A;  1K8U A;  2LLS A;  1YUT A;  2K7C A;  5FYX A;  1JUO A;  2SCP A;  3SG6 A;  3LK0 A;  2KOT A;  1IRJ A;  3PFV A;  1F8H A;  1PUL A;  4PDZ A;  1NSH A;  2KNE A;  1OSA A;  1SBJ A;  4CPV A;  1KQM C;  1A29 A;  1WDC C;  1YRT B;  1UP5 A;  3H4S E;  3O6B A;  1LKJ A;  1CFP A;  3VRP A;  1JSA A;  2JT3 A;  1ODB A;  2LVV A;  1AUI B;  1SCM B;  4D1E A;  3SIA A;  2BEC A;  2LMT A;  1U5I B;  2M7N A;  1L2O C;  2M3W A;  1QVI Y;  1OZO A;  2Q4U A;  3PLF B;  5AFP A;  1DVI A;  3VGO A;  2LAN A;  4CLN A;  4AQJ A;  1UHN A;  2L4H A;  2ZND A;  2JZI A;  1BMO A;  1DJX A;  1XVJ A;  5CPV A;  1M31 A;  2E30 A;  4YGC B;  5I2Q A;  2RGI A;  3A8R A;  4E68 A;  5JJG A;  1ZUZ A;  2Y1N A;  2EC6 B;  1RK9 A;  2ZRT A;  1DJW A;  3AAK A;  5AEQ A;  3SIB A;  1A03 A;  2HET A;  2L2E A;  3JVT B;  1UUS A;  1G33 A;  2FOT A;  1UHH A;  1AJ4 A;  2PAL A;  1Y1A A;  3LCP C;  1L7Z A;  1K96 A;  3NXA A;  2JRF A;  1A75 A;  1F4Q A;  4U8D A;  3ZNI A;  5TNC A;  1K9U A;  2LV7 A;  4MZK A;  1Y0V H;  2M1K B;  1ZMZ A;  2WND A;  4BY5 A;  1KFX L;  1FBV A;  2M0R A;  1QAS A;  3BUX B;  1QJT A;  2BE6 A;  4PHM A;  1B9A A;  2FCE A;  2AMI A;  3GK1 A;  1EXR A;  1K90 D;  2G9B A;  2KFH A;  2LHL A;  4HSZ A;  1OE9 B;  2JXC A;  1NIW A;  2L5X B;  3BUW B;  1J55 A;  1KFU S;  4A4C A;  2GV5 A;  3IQQ A;  1DMO A;  4PHJ A;  5CSN A;  5AAN A;  1N0Y A;  2K7D A;  1B8L A;  3AAJ A;  1R6P A;  2M97 A;  1MQ1 A;  1DF0 B;  4ORC B;  4C0J A;  5I2O A;  3FS7 A;  1KWO C;  1ZFS A;  3I5I C;  4GGF C;  4N5X A;  2I2R E;  2R2I A;  2ZFD A;  2PRU A;  4FQO A;  3LLE A;  1LVC D;  1S3P A;  1XFW O;  4CFR A;  4M2O A;  4P5O E;  1K9K A;  1F71 A;  4MRX A;  1B1G A;  1PSR A;  4NDB A;  3WHU B;  2I7A A;  3LK1 A;  3PSR A;  4C0K A;  1HQV A;  1OZS A;  1RJV A;  1WY9 A;  2QAC A;  2WCB A;  3EVV A;  2JT0 A;  5CSJ A;  2BCX A;  3TUY C;  1K94 A;  1NYA A;  1OMD A;  1BG1 A;  1EG4 A;  1XA5 A;  4WQ2 A;  1CNP A;  1CDM A;  3I5G B;  3JTD B;  1UHI A;  2KFG A;  3CLN A;  3NSO A;  4I5K A;  5DKR A;  2KYC A;  2JQ6 A;  1JF0 A;  1YVL A;  1TCF A;  1REC A;  1QXP A;  1B47 A;  1SR6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...