5D7FA

X-ray structure of ca(2+)-s100b with human rage-derived w72 peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d7fA00
1EG3A 3JVTC 1DJYA 3LK1A 2LHLA 1BODA 1K9PA 3DVEA 1IWQA 3RLZA 4MZKA 1LA0A 5KU1A 1G33A 2MLFC 4MZJA 1F71A 1VRKA 3EK4A 4WQ3A 5CSIA 1PK0D 2KI4C 3OB1B 5B8IB 1IQ3A 2AUCA 4CFQA 2BECA 3KO0A 4PHKA 3TUYB 1PSRA 2BCAA 2I18A 3MSEB 1KWOB 3PSRA 1UHIA 3FWBA 2KGRA 4MLWA 1FI5A 3O6BA 1CDNA 1N2DA 1OZOA 1OMRA 4JPZB 1DF0A 1OOJA 1ZFSA 2HQ8A 2K2AA 2LVIA 2K8MB 3SG3A 1M63B 1WLZA 4YI9A 1A75A 5GQQC 4YGEB 4A4CA 2KFFA 2LVJA 2CBLA 1JSAA 1CLBA 1XFXO 2KQ6A 4FQOA 1KQMB 4WRIA 1XA5A 3E3RA 1BMOA 1QASA 2NCPA 2LUCA 4UPGA 1QXPA 4Q04A 2L50A 1DJXA 1TNPA 4MBEA 1QV1A 2M8UA 2HPSA 1SRAA 3BUNB 2MRDA 2OS8C 1YVHA 1QJTA 2L4IA 2WCBA 3LLEA 1TNWA 1UHNA 4MEWA 1J7PA 4CFRA 1DJHA 3FWCA 2F2OA 1L2OB 2Q4UA 3CGAA 4JWQA 1B7TZ 2GGMA 1GGZA 1SYMA 2LLTA 3EK7A 5CSNA 3SJSA 1WRLA 1CLLA 1TNQA 2BE6A 4MSPA 1A29A 4XJKA 1QX7A 1K95A 2M1KB 5D69A 5HLOA 1SK6D 2KAXA 1QTXA 1J55A 1KFUL 2JC2A 4TNCA 1GJYA 5ER5A 2EC6B 2O60A 2ZNDA 3KPXA 4FTGA 4N1FA 2KI4B 1IRJA 3BUOB 1F4OA 1YUTA 2PASA 3I5FC 1BT6A 1B7TY 1TNXA 2LE9B 1NUBA 2PSRA 1NX2A 1DVIA 2L0PA 4GFTA 2BCBA 2ISDA 1EXRA 1RJVA 2K61A 2KBIA 1WLMA 3I5HC 3JTDB 2KNEA 1D1OA 2MBXA 1BR1B 1L7ZA 3TUYC 1RK9A 2M3WA 2I2RE 2Y4QA 4L9MA 5FYXA 1E8AA 1UHJA 5I2OA 5I2LA 3CS1A 5BPJA 2CNPA 4YI8A 3DF0B 1QX2A 4DCKA 1SKTA 3SG6A 1WRZA 2OS8B 3PLFB 1QVIZ 1ALVA 1Y1AA 5HKZA 3WHTB 1JF0A 2V53A 4XYNA 3WNXB 1CFPA 1KCYA 3LK0A 3BUWB 3FS7A 1KK7Z 1F4QA 1M45A 2AAOA 1XFVO 5CSJA 5AFPA 1B47A 1ZMZA 1JC2A 2NXQA 3OB2B 1NYAA 2K0JA 1NX0A 1QIVA 1DJWA 2M7NA 2M97A 1CMGA 2L2EA 2OTGC 1YTZC 3NSLA 1CB1A 1OQPA 3ICBA 3H4SE 1HQVA 1BG1A 3NSIA 1NP8A 1L2OC 2CCMA 2BKHB 2F3YA 2H61C 2MAZA 1QVIY 2BKIB 1BOCA 3BYAA 1F55A 1SL8A 1S6IA 4C0LA 1FBVA 4P2YB 1KK7Y 1QS7A 1KQVA 1YRUB 1B8LA 4ETOA 2MLEC 3FIAA 4HRHA 1NIWA 2L5XB 4HRGA 4OCIA 1JFJA 4NQGA 4YGBB 3RM1A 1S1EA 1F70A 3K21A 2TN4A 1JBAA 2BL0B 2K7BA 1B1GA 3NSOA 5D7FA 1XFYO 1U5IB 2EC6C 1Y1XA 1PSBA 1NSHA 2WORA 2DOQA 1ALWA 2WCEA 5JJGA 2JT8A 2MA2A 3I5HB 1SW8A 5HLVA 1KFUS 1XFWO 3SIBA 2R2IA 1DGUA 1M39A 1PRWA 1S3PA 3BUXB 2LHIA 1OE9B 2M49B 1YURA 1KK8B 2LLUA 4WQ2A 3SG2A 3TDZA 2JOJA 1K2HA 3DVJA 2Q91A 1BU3A 1DTLA 4ICBA 4OR9B 1PVBA 4PALA 3JTDC 3TS5C 2JZIA 4F0ZB 1EL4A 4NDBA 1QLKA 4C0KA 1H4BA 5AXIA 2K7OA 1V1GA 3F45A 1JUOA 4QJ4B 3DF0A 1TOPA 3AKAA 3OP0A 1QLSA 4QJ5B 3AAKA 3VRPA 1XVJA 1QV0A 2OTGB 1NCYA 3BOWB 4DIRA 2KOTA 1RECA 4YBHB 1LVCD 1SY9A 4N1GA 3LCPC 1UHHA 2NCOA 3EKHA 1ZUZA 5TNCA 2MHHA 1H8BA 2K7CA 1WDCB 3EVRA 1F8HA 1NWDA 4GGFC 1B9AA 1QIWA 3OX5A 2ZN8A 2MJWB 3WXAA 3PFVA 2P6BB 5HKYA 4PE1A 1CNPA 2KDHA 3D10A 3AKBA 1ZOTB 2K7DA 2KGBC 1EH2A 3O2PA 4PE7A 3BXKA 5DKNA 2L4HA 1FI6A 1CM1A 2WNDA 1DJZA 1GQMA 2JXLA 1WRKA 5J3XA 1CDLA 2EHBA 1KSMA 1M31A 2KHNA 3CR2A 1BR4B 5AANA 1XK4C 2M29A 2PMYA 1CFDA 2LMTA 1TCFA 3GK1A 4MZLA 4D1EA 4YGCB 2BL0C 5K89A 1SR6C 2HF5A 1AJ5A 1AJ4A 4ORCB 2JPTA 5AERA 2D8NA 4OV2A 1U5IA 2JT0A 3TDUA 1IJ6A 3OHMB 4M2QA 4YRUA 1XYDA 1J7OA 3TS5B 1YX7A 3EVVA 3DVKA 2HQWA 3A8RA 2AMIA 2SCPA 2KYCA 2G9BA 1AUIB 1K9UA 1UP5A 3SIAA 1TCOB 1MF8B 2CXJA 1IGVA 1IJ5A 1K8UA 2FOTA 2ZKMX 1J1EA 1Y1UA 1CKKA 5KSZA 2F33A 1KK8C 2I7AA 2JTTA 3GK2A 3CTNA 4YGAA 1OMDA 2PVBA 2G2BA 4GGNA 3AAJA 3LL8B 2NLNA 3CR4X 5HKWA 1R6PA 3VRQA 4USLA 2JXCA 1M46A 2LAPA 1MWNA 1S6JA 2GGZA 5DKRA 3SG7A 2RGIA 1SBJA 1YRTB 2NZ0A 2ZRSA 1S5GZ 4GBAA 4HSZA 4BY4A 3VRNA 1MUXA 3I5IC 3OX6A 3TZ1A 1N0YA 4PE0A 1YUSA 2KQYA 2IS9A 3A4UB 2KFGA 1YR5A 2WC8A 3BOWA 1F54A 2Y5IA 3CR5X 1K9KA 1LINA 2CTNA 2A4JA 2LVVA 2E6WA 2KAYA 1C07A 1SCMC 4DRWA 1WDCC 2H61A 3NXAA 1JF2A 4GNKB 4DUQA 4MRXA 4CIDA 1AK8A 3VROA 2LP3A 2LMVA 1ZACA 2LMUA 1YUUA 1S5GY 1SL9A 2KI6C 1QX5B 5ER4X 3NSKA 4GPLB 4N5XA 1SR6B 5JOLA 2B1UA 1PVAA 2LUXA 1B8RA 1SCVA 1CM4A 3PATA 3KEVA 4NDDA 2LANA 2KSPA 3ZNIA 2SASA 2M7LA 3CZTX 1Y6WA 4I5LB 3KHEA 1MQ1A 2JT3A 2LC5A 3PALA 2F2PA 1MXLC 1KSOA 4I5JA 3GK4X 2I94A 3HX4A 2EGDA 1PULA 1AVSA 1CFCA 1SL7A 4PHNA 5DKQA 1WY9A 1EJ3A 1CLMA 1NX1A 1FW4A 2JQ6A 2LM5A 1G4YR 4DS7A 3GOFA 1DGVA 4PHMA 1EG4A 4ZCUA 1K96A 1RWYA 3PN7C 1OMVA 2KI6D 1ODBA 1NPQA 3D0YB 1CMFA 3ZWHA 1CDPA 3KF9A 2JWWA 1LA3A 1V1FA 3I5IB 2L98A 1IG5A 1SPYA 2WCFA 3CWGA 2QACA 1N65A 4ORAB 4QJ3B 4AOMA 4E68A 1LKJA 3IQOA 4R1EA 2OPOA 1CDMA 3BUMB 4I5KA 1RFJA 4P5OE 1AP4A 4NDCA 1SCMB 2COLB 3I5GC 1A2XA 3HCMA 4GGFA 3VGOA 4CLNA 3M0WA 3TDIA 3WHUB 1KFXL 1Q80A 1QATA 1RTP1 2BBMA 2QPTA 1S36A 4GUKA 4ORBB 4A4BA 5G08A 1BJFA 2CT9A 1NCZA 1YVLA 2VRGA 1DJIA 4IL1A 4BY5A 2JULA 1DT7B 2JRFA 1XFUO 1BLQA 1UUSA 2WOSA 2F3ZA 1XK4A 3VRRA 2M9GA 1OZSA 4CPVA 2LV7A 1G8IA 3QRXA 4PDZA 5CPVA 4U8DA 4MRYA 5F6TA 3DD4A 1TRFA 2PALA 2ZN9A 2JTZA 4OKHA 3JVTB 5KTYA 3EKJA 2M0RA 1B4CA 4AQIA 3PN7B 1UWOA 1A4PA 2JNXA 4MVFA 4YGDB 1NCXA 1TN4A 5CSFA 2JU0A 2H2KA 1YX8A 3CLNA 1NX3A 3EVUA 2KBMA 1K93D 1HT9A 1DMOA 1J1DA 1DF0B 1IKUA 1SMGA 1W7JB 3EK8A 1A75B 1JFKA 1JWDA 2LCPA 1RROA 1FPWA 1MXEA 2K2FA 1GGWA 1LXFC 3D0YA 1FF1A 1KWOC 1A03A 5I8NA 4PE4A 5I2QA 3I5GB 1CFFA 1R2UA 4GAOA 2GV5A 2LVKA 1B8CA 3O78A 2FCDA 1W7IB 3IQQA 3O4YA 1K94A 4JQ0D 1C7WA 2KAVA 3IF7A 1C7VA 4M2OA 1XFZO 2E30A 4MN0A 4ZCVA 4C0JA 2FCEA 1KQMC 3BQ3A 2BBNA 1UURA 4HREE 2Y1NA 1S26D 2LP2A 4PCWA 5IBWA 1AHRA 1TTXA 1IH0A 5PALA 1S6CA 2ZRTA 2JNFA 2M1UA 5AEQA 1CTRA 1X02A 1Y0VH 3SG4A 4XJKB 4AQJA 1J7RA 1K90D 1KFXS 1DJGA 1TIZA 3SG5A 2Y1MA 2BCXA 1OSAA 2PRUA 2LLSA 1MR8A 4M2PA 4PHJA 2L51A 2BE4A 2ZNEA 3DVMA 2F8PA 4OVNF 2KYFA 1MHOA 2FJUB 1PALA 1J7QA 1UHKA 1IQ5A 2HETA 2KFHA 5HYDA 1SNLA 2ZFDA 3I5FB 4I5NB 2LNKA 2O5GA 1XO5A 3PM8A 1BF5A 3C1VA
chains in the Genus database with same CATH superfamily
1EG3A 3JVTC 1DJYA 3LK1A 2LHLA 1BODA 1K9PA 3DVEA 1IWQA 3RLZA 4MZKA 1LA0A 5KU1A 1G33A 2MLFC 4FQTA 4MZJA 1VRKA 3EK4A 4WQ3A 1TUJA 5CSIA 1F71A 1PK0D 2KI4C 3OB1B 5B8IB 1IQ3A 2AUCA 4CFQA 2BECA 3KO0A 4PHKA 3TUYB 1PSRA 1W9ZA 3FE9A 2BCAA 2I18A 3MSEB 1KWOB 3PSRA 1UHIA 3FE8A 3FWBA 2KGRA 4MLWA 1FI5A 3O6BA 1CDNA 3D78A 1N2DA 1OZOA 1OMRA 1OOHA 4JPZB 1DF0A 1OOJA 1ZFSA 2HQ8A 2K2AA 2LVIA 2K8MB 3SG3A 3DVKA 1M63B 1WLZA 4YI9A 1A75A 5GQQC 4YGEB 1C3ZA 4A4CA 2KFFA 2LVJA 2CBLA 1JSAA 1CLBA 1XFXO 2KQ6A 4FQOA 1KQMB 4WRIA 1XA5A 3E3RA 1BMOA 1QASA 2NCPA 2LUCA 4UPGA 1QXPA 4Q04A 2L50A 1DJXA 1TNPA 4MBEA 1QV1A 2M8UA 2HPSA 4PT1A 1SRAA 3BUNB 1DEKA 2MRDA 2OS8C 1YVHA 1QJTA 2L4IA 2WCBA 3LLEA 3B7AA 1TNWA 1UHNA 4MEWA 1J7PA 4CFRA 1DJHA 2WCJA 3FWCA 2F2OA 1L2OB 2Q4UA 3CGAA 4JWQA 2QEHA 1B7TZ 2GGMA 1GGZA 1SYMA 2LLTA 3D73A 3CZ2A 3EK7A 3L4AA 5CSNA 3SJSA 1WRLA 1CLLA 1TNQA 2BE6A 4MSPA 3SS4A 2L2CA 1A29A 4XJKA 1QX7A 1K95A 3CZ1A 2M1KB 5D69A 5HLOA 1SK6D 2KAXA 1QTXA 1J55A 1KFUL 2JC2A 4TNCA 1GJYA 5ER5A 2EC6B 2O60A 2ZNDA 3KPXA 4FTGA 4N1FA 2KI4B 1IRJA 1OOIX 3BUOB 1F4OA 1YUTA 2PASA 2YGUA 3I5FC 1BT6A 1B7TY 1LS8A 1TNXA 2LE9B 1NUBA 2PSRA 1NX2A 1DVIA 2L0PA 4GFTA 2BCBA 2ISDA 1EXRA 1RJVA 2K61A 1DELA 2KBIA 1WLMA 3I5HC 3JTDB 2KNEA 1DC1A 1D1OA 2MBXA 1BR1B 1L7ZA 3TUYC 1RK9A 2M3WA 2I2RE 2Y4QA 4L9MA 5FYXA 3S0GA 1E8AA 1UHJA 5I2OA 5I2LA 3CS1A 5BPJA 2CNPA 4YI8A 3DF0B 1QX2A 4DCKA 1SKTA 3SG6A 1WRZA 2OS8B 2QEVA 3PLFB 1QVIZ 1ALVA 1Y1AA 5HKZA 3WHTB 2QEBA 1JF0A 2V53A 4XYNA 3WNXB 1CFPA 3K1EA 1KCYA 3LK0A 3BUWB 3NHIA 5FI7A 3FS7A 1KK7Z 1F4QA 1M45A 2AAOA 1XFVO 5CSJA 5D3OA 5AFPA 1B47A 3EG5B 1ZMZA 1JC2A 2NXQA 3OB2B 1NYAA 2K0JA 1NX0A 1QIVA 1DJWA 2M7NA 2M97A 2WCKA 1CMGA 3CZ0A 2L2EA 2OTGC 1YTZC 3NSLA 1CB1A 1OQPA 3ICBA 3H4SE 1HQVA 3OBVA 1BG1A 3NSIA 1NP8A 1L2OC 3QMEA 2CCMA 2BKHB 3R72A 2F3YA 2H61C 2MAZA 1QVIY 3S0DA 2BKIB 1BOCA 3BYAA 1F55A 1SL8A 1S6IA 4C0LA 1FBVA 4P2YB 1KK7Y 1QS7A 1KQVA 1YRUB 1B8LA 4ETOA 2MLEC 3FIAA 4HRHA 1NIWA 2L5XB 4HRGA 4OCIA 1JFJA 4NQGA 4YGBB 3RM1A 1S1EA 1F70A 3K21A 1IIOA 2TN4A 1JBAA 2BL0B 2K7BA 1B1GA 3NSOA 2WC5A 5D7FA 1XFYO 1U5IB 2EC6C 1Y1XA 1PSBA 1NSHA 2BNXA 2WORA 2DOQA 1ALWA 2WCEA 5JJGA 2JT8A 2MA2A 3I5HB 1SW8A 3SS3A 5HLVA 1KFUS 1XFWO 3SIBA 2R2IA 1DGUA 1M39A 1PRWA 1S3PA 3BUXB 2LHIA 1OE9B 2K60A 2M49B 1YURA 1KK8B 2LLUA 4WQ2A 3S0BA 3SG2A 2JOJA 3TDZA 3DVJA 1K2HA 2Q91A 1BU3A 1DTLA 1Z2CB 4ICBA 4OR9B 1PVBA 4PALA 3JTDC 3TS5C 1SSEB 4IJ7A 2ERBA 1OW4A 2JZIA 4F0ZB 1EL4A 4NDBA 1QLKA 4C0KA 1H4BA 5AXIA 2K7OA 1V1GA 3F45A 1JUOA 2PQLA 4QJ4B 3DF0A 1TOPA 3AKAA 3OP0A 1QLSA 4QJ5B 3AAKA 2H8VA 3VRPA 1XVJA 1QV0A 2OTGB 5FI6A 1NCYA 3BOWB 4DIRA 2KOTA 1RECA 2PYQA 1LVCD 4YBHB 1SY9A 4N1GA 3LCPC 1UHHA 2NCOA 3EKHA 1ZUZA 3D76A 5TNCA 2MHHA 1H8BA 2K7CA 1WDCB 3EVRA 1F8HA 1NWDA 4GGFC 1B9AA 1QIWA 3OX5A 2WCMA 2ZN8A 2MJWB 3WXAA 3B87A 3PFVA 2P6BB 3RZSA 5HKYA 4PE1A 1CNPA 2KDHA 3D10A 3AKBA 1ZOTB 2K7DA 2KGBC 1EH2A 3O2PA 4PE7A 3BXKA 5DKNA 2L4HA 4INWA 1FI6A 4JKTA 1CM1A 1ORGA 2WNDA 1DJZA 1GQMA 2JXLA 1WRKA 5J3XA 1CDLA 2EHBA 3DY9A 1KSMA 1M31A 2KHNA 3CR2A 1BR4B 5AANA 1XK4C 2M29A 2PMYA 1CFDA 2LMTA 2P71A 1TCFA 3GK1A 4MZLA 4D1EA 4YGCB 2BL0C 3BJHA 5K89A 2WCHA 1SR6C 4JD9A 2HF5A 1AJ5A 1AJ4A 3D75A 2JPTA 4ORCB 5AERA 2D8NA 4OV2A 1U5IA 2JT0A 5FI2A 3TDUA 1IJ6A 3OHMB 4M2QA 4YRUA 1XYDA 1J7OA 3L47A 3R1VA 3TS5B 1YX7A 3EVVA 2QEOA 2HQWA 3A8RA 2AMIA 2SCPA 3B88A 2KYCA 2G9BA 1AUIB 1K9UA 1UP5A 4INXA 1TCOB 3SIAA 1T14A 1MF8B 2CXJA 1IGVA 2KLEA 1IJ5A 1QWVA 1K8UA 2FOTA 2ZKMX 1J1EA 1Y1UA 1CKKA 5KSZA 2F33A 1KK8C 2I7AA 2JTTA 3GK2A 3CTNA 4YGAA 1OMDA 2PVBA 2G2BA 3S0EA 3IVTA 4GGNA 3AAJA 3LL8B 3UO9A 2NLNA 3CR4X 5HKWA 1P28A 1R6PA 4USLA 2JXCA 3VRQA 1M46A 2LAPA 3UNWA 1MWNA 1S6JA 2GGZA 5DKRA 1Z4HA 3SG7A 5DICA 3DYEA 2RGIA 2P70A 1SBJA 1YRTB 2NZ0A 2ZRSA 1S5GZ 4GBAA 4HSZA 4BY4A 3S0AA 3VRNA 1MUXA 3I5IC 3OX6A 3TZ1A 1N0YA 4PE0A 1YUSA 2KQYA 2IS9A 3A4UB 3NHTA 1OOFA 2KFGA 2L5YA 1YR5A 2WC8A 3BOWA 1F54A 2Y5IA 3CR5X 1K9KA 1LINA 2CTNA 2A4JA 2LVVA 2E6WA 2KAYA 3O4XA 1C07A 1SCMC 4DRWA 1WDCC 2H61A 3NXAA 1JF2A 4GNKB 4DUQA 4MRXA 4CIDA 1AK8A 3V2LA 3VROA 2LP3A 2LMVA 1ZACA 2LMUA 2WC6A 1YUUA 1S5GY 1SL9A 2KI6C 1QX5B 5ER4X 3NSKA 4GPLB 4N5XA 1SR6B 5JOLA 1OOGA 2B1UA 1PVAA 2LUXA 1B8RA 1SCVA 1CM4A 3PATA 3KEVA 4NDDA 2LANA 2KSPA 3ZNIA 2SASA 2M7LA 3CZTX 3R1PA 2KPHA 3PJIA 1Y6WA 4I5LB 3KHEA 1MQ1A 2JT3A 2LC5A 3PALA 2F2PA 3PM2A 1MXLC 1KSOA 4I5JA 3GK4X 2I94A 3HX4A 2EGDA 1PULA 1AVSA 1CFCA 1SL7A 4PHNA 5DKQA 1WY9A 1EJ3A 1CLMA 1NX1A 1FW4A 2JQ6A 1C3YA 2LM5A 1G4YR 4DS7A 1XFRA 3GOFA 1DGVA 2FJYA 4PHMA 1EG4A 2QDIA 4ZCUA 1K96A 1RWYA 3PN7C 1OMVA 2KI6D 1ODBA 1NPQA 3D0YB 1CMFA 5I94A 3ZWHA 1GM0A 1CDPA 3BFBA 3KF9A 2JWWA 1LA3A 1V1FA 3I5IB 2L98A 1IG5A 1SPYA 2WCFA 3CWGA 2QACA 1N65A 4ORAB 4QJ3B 4AOMA 4E68A 1LKJA 3L4LA 3IQOA 4R1EA 2BAPA 1TUZA 2OPOA 1CDMA 3BUMB 4I5KA 1RFJA 5HL1A 4F7FA 4P5OE 1AP4A 4NDCA 1SCMB 2COLB 3I5GC 1A2XA 3HCMA 3BFHA 4GGFA 3VGOA 4CLNA 3FE6A 3M0WA 3TDIA 3WHUB 1KFXL 1Q80A 1QATA 1RTP1 2BBMA 2QPTA 1S36A 3CYZA 4GUKA 4KYNA 4ORBB 5G08A 4A4BA 1BJFA 2CT9A 3OGNA 3S0FA 1NCZA 1YVLA 2VRGA 1DJIA 4IL1A 4BY5A 1TWOA 1DQEA 2JULA 1DT7B 2JRFA 1XFUO 3NGVA 4OZDA 1BLQA 1UUSA 2GTEA 2WOSA 2F3ZA 1XK4A 3VRRA 3DZTA 2M9GA 1OZSA 4CPVA 2LV7A 1G8IA 3BFAA 3QRXA 4PDZA 5CPVA 4U8DA 4MRYA 5F6TA 3DD4A 1TRFA 2PALA 2ZN9A 2JTZA 4OKHA 3JVTB 5KTYA 3SS5A 2KLDA 3EKJA 2M0RA 1B4CA 4AQIA 3PN7B 1UWOA 1A4PA 2JNXA 4MVFA 4YGDB 1NCXA 1TN4A 5CSFA 2JU0A 2H2KA 1YX8A 3CLNA 2WCLA 1NX3A 3EVUA 2KBMA 1K93D 1HT9A 1DMOA 1J1DA 1DF0B 1IKUA 5EL2A 3DXLA 1SMGA 1W7JB 3CDNA 3EK8A 3D77A 1A75B 1JFKA 1JWDA 2LCPA 1RROA 3B86A 1FPWA 1MXEA 2K2FA 1GGWA 1LXFC 3D0YA 1FF1A 3B6XA 3Q8IA 1KWOC 1A03A 5I8NA 4PE4A 5I2QA 3I5GB 1CFFA 1R2UA 4GAOA 2GV5A 2LVKA 1B8CA 3O78A 2FCDA 1W7IB 3IQQA 3O4YA 1K94A 4JQ0D 1C7WA 2KAVA 3CABA 3IF7A 1C7VA 4M2OA 1XFZO 2E30A 4MN0A 4ZCVA 4C0JA 2FCEA 1KQMC 3BQ3A 2BBNA 1UURA 4HREE 2Y1NA 1S26D 2LP2A 4PCWA 5IBWA 1AHRA 1TTXA 1IH0A 5PALA 1S6CA 2ZRTA 2JPOA 2JNFA 2M1UA 3N7HA 3R1OA 5AEQA 1CTRA 1X02A 1Y0VH 3SG4A 4XJKB 3D74A 4AQJA 1J7RA 1K90D 1KFXS 1DJGA 1TIZA 3SG5A 2Y1MA 2BCXA 1OSAA 2PRUA 2LLSA 1MR8A 4M2PA 4PHJA 2L51A 2BE4A 2ZNEA 3DVMA 2F8PA 4OVNF 2KYFA 1MHOA 2FJUB 1PALA 1J7QA 1UHKA 1IQ5A 2HETA 2KFHA 5HYDA 1SNLA 2ZFDA 3I5FB 4I5NB 2LNKA 2O5GA 1XO5A 3PM8A 3VB1A 1BF5A 3C1VA
chains in the Genus database with same CATH topology
1EG3A 3JVTC 1DJYA 3LK1A 2LHLA 1BODA 1K9PA 3DVEA 1IWQA 3RLZA 4MZKA 1LA0A 5KU1A 1G33A 2MLFC 4MZJA 1F71A 1VRKA 3EK4A 4WQ3A 5CSIA 1PK0D 2KI4C 3OB1B 5B8IB 1IQ3A 2AUCA 4CFQA 2BECA 3KO0A 4PHKA 3TUYB 1PSRA 2BCAA 2I18A 3MSEB 1KWOB 3PSRA 1UHIA 3FWBA 2KGRA 4MLWA 1FI5A 3O6BA 1CDNA 1N2DA 1OZOA 1OMRA 4JPZB 1DF0A 1OOJA 1ZFSA 2HQ8A 2K2AA 2LVIA 2K8MB 3SG3A 1M63B 1WLZA 4YI9A 1A75A 5GQQC 4YGEB 4A4CA 2KFFA 2LVJA 2CBLA 1JSAA 1CLBA 1XFXO 2KQ6A 4FQOA 1KQMB 4WRIA 1XA5A 3E3RA 1BMOA 1QASA 2NCPA 2LUCA 4UPGA 1QXPA 4Q04A 2L50A 1DJXA 1TNPA 4MBEA 1QV1A 2M8UA 2HPSA 1SRAA 3BUNB 2MRDA 2OS8C 1YVHA 1QJTA 2L4IA 2WCBA 3LLEA 1TNWA 1UHNA 4MEWA 1J7PA 4CFRA 1DJHA 3FWCA 2F2OA 1L2OB 2Q4UA 3CGAA 4JWQA 1B7TZ 2GGMA 1GGZA 1SYMA 2LLTA 3EK7A 5CSNA 3SJSA 1WRLA 1CLLA 1TNQA 2BE6A 4MSPA 1A29A 4XJKA 1QX7A 1K95A 2M1KB 5D69A 5HLOA 1SK6D 2KAXA 1QTXA 1J55A 1KFUL 2JC2A 4TNCA 1GJYA 5ER5A 2EC6B 2O60A 2ZNDA 3KPXA 4FTGA 4N1FA 2KI4B 1IRJA 3BUOB 1F4OA 1YUTA 2PASA 3I5FC 1BT6A 1B7TY 1TNXA 2LE9B 1NUBA 2PSRA 1NX2A 1DVIA 2L0PA 4GFTA 2BCBA 2ISDA 1EXRA 1RJVA 2K61A 2KBIA 1WLMA 3I5HC 3JTDB 2KNEA 1D1OA 2MBXA 1BR1B 1L7ZA 3TUYC 1RK9A 2M3WA 2I2RE 2Y4QA 4L9MA 5FYXA 1E8AA 1UHJA 5I2OA 5I2LA 3CS1A 5BPJA 2CNPA 4YI8A 3DF0B 1QX2A 4DCKA 1SKTA 3SG6A 1WRZA 2OS8B 3PLFB 1QVIZ 1ALVA 1Y1AA 5HKZA 3WHTB 1JF0A 2V53A 4XYNA 3WNXB 1CFPA 1KCYA 3LK0A 3BUWB 3FS7A 1KK7Z 1F4QA 1M45A 2AAOA 1XFVO 5CSJA 5AFPA 1B47A 1ZMZA 1JC2A 2NXQA 3OB2B 1NYAA 2K0JA 1NX0A 1QIVA 1DJWA 2M7NA 2M97A 1CMGA 2L2EA 2OTGC 1YTZC 3NSLA 1CB1A 1OQPA 3ICBA 3H4SE 1HQVA 1BG1A 3NSIA 1NP8A 1L2OC 2CCMA 2BKHB 2F3YA 2H61C 2MAZA 1QVIY 2BKIB 1BOCA 3BYAA 1F55A 1SL8A 1S6IA 4C0LA 1FBVA 4P2YB 1KK7Y 1QS7A 1KQVA 1YRUB 1B8LA 4ETOA 2MLEC 3FIAA 4HRHA 1NIWA 2L5XB 4HRGA 4OCIA 1JFJA 4NQGA 4YGBB 3RM1A 1S1EA 1F70A 3K21A 2TN4A 1JBAA 2BL0B 2K7BA 1B1GA 3NSOA 5D7FA 1XFYO 1U5IB 2EC6C 1Y1XA 1PSBA 1NSHA 2WORA 2DOQA 1ALWA 2WCEA 5JJGA 2JT8A 2MA2A 3I5HB 1SW8A 5HLVA 1KFUS 1XFWO 3SIBA 2R2IA 1DGUA 1M39A 1PRWA 1S3PA 3BUXB 2LHIA 1OE9B 2M49B 1YURA 1KK8B 2LLUA 4WQ2A 3SG2A 3TDZA 2JOJA 1K2HA 3DVJA 2Q91A 1BU3A 1DTLA 4ICBA 4OR9B 1PVBA 4PALA 3JTDC 3TS5C 2JZIA 4F0ZB 1EL4A 4NDBA 1QLKA 4C0KA 1H4BA 5AXIA 2K7OA 1V1GA 3F45A 1JUOA 4QJ4B 3DF0A 1TOPA 3AKAA 3OP0A 1QLSA 4QJ5B 3AAKA 3VRPA 1XVJA 1QV0A 2OTGB 1NCYA 3BOWB 4DIRA 2KOTA 1RECA 4YBHB 1LVCD 1SY9A 4N1GA 3LCPC 1UHHA 2NCOA 3EKHA 1ZUZA 5TNCA 2MHHA 1H8BA 2K7CA 1WDCB 3EVRA 1F8HA 1NWDA 4GGFC 1B9AA 1QIWA 3OX5A 2ZN8A 2MJWB 3WXAA 3PFVA 2P6BB 5HKYA 4PE1A 1CNPA 2KDHA 3D10A 3AKBA 1ZOTB 2K7DA 2KGBC 1EH2A 3O2PA 4PE7A 3BXKA 5DKNA 2L4HA 1FI6A 1CM1A 2WNDA 1DJZA 1GQMA 2JXLA 1WRKA 5J3XA 1CDLA 2EHBA 1KSMA 1M31A 2KHNA 3CR2A 1BR4B 5AANA 1XK4C 2M29A 2PMYA 1CFDA 2LMTA 1TCFA 3GK1A 4MZLA 4D1EA 4YGCB 2BL0C 5K89A 1SR6C 2HF5A 1AJ5A 1AJ4A 4ORCB 2JPTA 5AERA 2D8NA 4OV2A 1U5IA 2JT0A 3TDUA 1IJ6A 3OHMB 4M2QA 4YRUA 1XYDA 1J7OA 3TS5B 1YX7A 3EVVA 3DVKA 2HQWA 3A8RA 2AMIA 2SCPA 2KYCA 2G9BA 1AUIB 1K9UA 1UP5A 3SIAA 1TCOB 1MF8B 2CXJA 1IGVA 1IJ5A 1K8UA 2FOTA 2ZKMX 1J1EA 1Y1UA 1CKKA 5KSZA 2F33A 1KK8C 2I7AA 2JTTA 3GK2A 3CTNA 4YGAA 1OMDA 2PVBA 2G2BA 4GGNA 3AAJA 3LL8B 2NLNA 3CR4X 5HKWA 1R6PA 3VRQA 4USLA 2JXCA 1M46A 2LAPA 1MWNA 1S6JA 2GGZA 5DKRA 3SG7A 2RGIA 1SBJA 1YRTB 2NZ0A 2ZRSA 1S5GZ 4GBAA 4HSZA 4BY4A 3VRNA 1MUXA 3I5IC 3OX6A 3TZ1A 1N0YA 4PE0A 1YUSA 2KQYA 2IS9A 3A4UB 2KFGA 1YR5A 2WC8A 3BOWA 1F54A 2Y5IA 3CR5X 1K9KA 1LINA 2CTNA 2A4JA 2LVVA 2E6WA 2KAYA 1C07A 1SCMC 4DRWA 1WDCC 2H61A 3NXAA 1JF2A 4GNKB 4DUQA 4MRXA 4CIDA 1AK8A 3VROA 2LP3A 2LMVA 1ZACA 2LMUA 1YUUA 1S5GY 1SL9A 2KI6C 1QX5B 5ER4X 3NSKA 4GPLB 4N5XA 1SR6B 5JOLA 2B1UA 1PVAA 2LUXA 1B8RA 1SCVA 1CM4A 3PATA 3KEVA 4NDDA 2LANA 2KSPA 3ZNIA 2SASA 2M7LA 3CZTX 1Y6WA 4I5LB 3KHEA 1MQ1A 2JT3A 2LC5A 3PALA 2F2PA 1MXLC 1KSOA 4I5JA 3GK4X 2I94A 3HX4A 2EGDA 1PULA 1AVSA 1CFCA 1SL7A 4PHNA 5DKQA 1WY9A 1EJ3A 1CLMA 1NX1A 1FW4A 2JQ6A 2LM5A 1G4YR 4DS7A 3GOFA 1DGVA 4PHMA 1EG4A 4ZCUA 1K96A 1RWYA 3PN7C 1OMVA 2KI6D 1ODBA 1NPQA 3D0YB 1CMFA 3ZWHA 1CDPA 3KF9A 2JWWA 1LA3A 1V1FA 3I5IB 2L98A 1IG5A 1SPYA 2WCFA 3CWGA 2QACA 1N65A 4ORAB 4QJ3B 4AOMA 4E68A 1LKJA 3IQOA 4R1EA 2OPOA 1CDMA 3BUMB 4I5KA 1RFJA 4P5OE 1AP4A 4NDCA 1SCMB 2COLB 3I5GC 1A2XA 3HCMA 4GGFA 3VGOA 4CLNA 3M0WA 3TDIA 3WHUB 1KFXL 1Q80A 1QATA 1RTP1 2BBMA 2QPTA 1S36A 4GUKA 4ORBB 4A4BA 5G08A 1BJFA 2CT9A 1NCZA 1YVLA 2VRGA 1DJIA 4IL1A 4BY5A 2JULA 1DT7B 2JRFA 1XFUO 1BLQA 1UUSA 2WOSA 2F3ZA 1XK4A 3VRRA 2M9GA 1OZSA 4CPVA 2LV7A 1G8IA 3QRXA 4PDZA 5CPVA 4U8DA 4MRYA 5F6TA 3DD4A 1TRFA 2PALA 2ZN9A 2JTZA 4OKHA 3JVTB 5KTYA 3EKJA 2M0RA 1B4CA 4AQIA 3PN7B 1UWOA 1A4PA 2JNXA 4MVFA 4YGDB 1NCXA 1TN4A 5CSFA 2JU0A 2H2KA 1YX8A 3CLNA 1NX3A 3EVUA 2KBMA 1K93D 1HT9A 1DMOA 1J1DA 1DF0B 1IKUA 1SMGA 1W7JB 3EK8A 1A75B 1JFKA 1JWDA 2LCPA 1RROA 1FPWA 1MXEA 2K2FA 1GGWA 1LXFC 3D0YA 1FF1A 1KWOC 1A03A 5I8NA 4PE4A 5I2QA 3I5GB 1CFFA 1R2UA 4GAOA 2GV5A 2LVKA 1B8CA 3O78A 2FCDA 1W7IB 3IQQA 3O4YA 1K94A 4JQ0D 1C7WA 2KAVA 3IF7A 1C7VA 4M2OA 1XFZO 2E30A 4MN0A 4ZCVA 4C0JA 2FCEA 1KQMC 3BQ3A 2BBNA 1UURA 4HREE 2Y1NA 1S26D 2LP2A 4PCWA 5IBWA 1AHRA 1TTXA 1IH0A 5PALA 1S6CA 2ZRTA 2JNFA 2M1UA 5AEQA 1CTRA 1X02A 1Y0VH 3SG4A 4XJKB 4AQJA 1J7RA 1K90D 1KFXS 1DJGA 1TIZA 3SG5A 2Y1MA 2BCXA 1OSAA 2PRUA 2LLSA 1MR8A 4M2PA 4PHJA 2L51A 2BE4A 2ZNEA 3DVMA 2F8PA 4OVNF 2KYFA 1MHOA 2FJUB 1PALA 1J7QA 1UHKA 1IQ5A 2HETA 2KFHA 5HYDA 1SNLA 2ZFDA 3I5FB 4I5NB 2LNKA 2O5GA 1XO5A 3PM8A 1BF5A 3C1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  3JVT C;  1DJY A;  3LK1 A;  2LHL A;  1BOD A;  1K9P A;  3DVE A;  1IWQ A;  3RLZ A;  4MZK A;  1LA0 A;  5KU1 A;  1G33 A;  2MLF C;  4MZJ A;  1F71 A;  1VRK A;  3EK4 A;  4WQ3 A;  5CSI A;  1PK0 D;  2KI4 C;  3OB1 B;  5B8I B;  1IQ3 A;  2AUC A;  4CFQ A;  2BEC A;  3KO0 A;  4PHK A;  3TUY B;  1PSR A;  2BCA A;  2I18 A;  3MSE B;  1KWO B;  3PSR A;  1UHI A;  3FWB A;  2KGR A;  4MLW A;  1FI5 A;  3O6B A;  1CDN A;  1N2D A;  1OZO A;  1OMR A;  4JPZ B;  1DF0 A;  1OOJ A;  1ZFS A;  2HQ8 A;  2K2A A;  2LVI A;  2K8M B;  3SG3 A;  1M63 B;  1WLZ A;  4YI9 A;  1A75 A;  5GQQ C;  4YGE B;  4A4C A;  2KFF A;  2LVJ A;  2CBL A;  1JSA A;  1CLB A;  1XFX O;  2KQ6 A;  4FQO A;  1KQM B;  4WRI A;  1XA5 A;  3E3R A;  1BMO A;  1QAS A;  2NCP A;  2LUC A;  4UPG A;  1QXP A;  4Q04 A;  2L50 A;  1DJX A;  1TNP A;  4MBE A;  1QV1 A;  2M8U A;  2HPS A;  1SRA A;  3BUN B;  2MRD A;  2OS8 C;  1YVH A;  1QJT A;  2L4I A;  2WCB A;  3LLE A;  1TNW A;  1UHN A;  4MEW A;  1J7P A;  4CFR A;  1DJH A;  3FWC A;  2F2O A;  1L2O B;  2Q4U A;  3CGA A;  4JWQ A;  1B7T Z;  2GGM A;  1GGZ A;  1SYM A;  2LLT A;  3EK7 A;  5CSN A;  3SJS A;  1WRL A;  1CLL A;  1TNQ A;  2BE6 A;  4MSP A;  1A29 A;  4XJK A;  1QX7 A;  1K95 A;  2M1K B;  5D69 A;  5HLO A;  1SK6 D;  2KAX A;  1QTX A;  1J55 A;  1KFU L;  2JC2 A;  4TNC A;  1GJY A;  5ER5 A;  2EC6 B;  2O60 A;  2ZND A;  3KPX A;  4FTG A;  4N1F A;  2KI4 B;  1IRJ A;  3BUO B;  1F4O A;  1YUT A;  2PAS A;  3I5F C;  1BT6 A;  1B7T Y;  1TNX A;  2LE9 B;  1NUB A;  2PSR A;  1NX2 A;  1DVI A;  2L0P A;  4GFT A;  2BCB A;  2ISD A;  1EXR A;  1RJV A;  2K61 A;  2KBI A;  1WLM A;  3I5H C;  3JTD B;  2KNE A;  1D1O A;  2MBX A;  1BR1 B;  1L7Z A;  3TUY C;  1RK9 A;  2M3W A;  2I2R E;  2Y4Q A;  4L9M A;  5FYX A;  1E8A A;  1UHJ A;  5I2O A;  5I2L A;  3CS1 A;  5BPJ A;  2CNP A;  4YI8 A;  3DF0 B;  1QX2 A;  4DCK A;  1SKT A;  3SG6 A;  1WRZ A;  2OS8 B;  3PLF B;  1QVI Z;  1ALV A;  1Y1A A;  5HKZ A;  3WHT B;  1JF0 A;  2V53 A;  4XYN A;  3WNX B;  1CFP A;  1KCY A;  3LK0 A;  3BUW B;  3FS7 A;  1KK7 Z;  1F4Q A;  1M45 A;  2AAO A;  1XFV O;  5CSJ A;  5AFP A;  1B47 A;  1ZMZ A;  1JC2 A;  2NXQ A;  3OB2 B;  1NYA A;  2K0J A;  1NX0 A;  1QIV A;  1DJW A;  2M7N A;  2M97 A;  1CMG A;  2L2E A;  2OTG C;  1YTZ C;  3NSL A;  1CB1 A;  1OQP A;  3ICB A;  3H4S E;  1HQV A;  1BG1 A;  3NSI A;  1NP8 A;  1L2O C;  2CCM A;  2BKH B;  2F3Y A;  2H61 C;  2MAZ A;  1QVI Y;  2BKI B;  1BOC A;  3BYA A;  1F55 A;  1SL8 A;  1S6I A;  4C0L A;  1FBV A;  4P2Y B;  1KK7 Y;  1QS7 A;  1KQV A;  1YRU B;  1B8L A;  4ETO A;  2MLE C;  3FIA A;  4HRH A;  1NIW A;  2L5X B;  4HRG A;  4OCI A;  1JFJ A;  4NQG A;  4YGB B;  3RM1 A;  1S1E A;  1F70 A;  3K21 A;  2TN4 A;  1JBA A;  2BL0 B;  2K7B A;  1B1G A;  3NSO A;  5D7F A;  1XFY O;  1U5I B;  2EC6 C;  1Y1X A;  1PSB A;  1NSH A;  2WOR A;  2DOQ A;  1ALW A;  2WCE A;  5JJG A;  2JT8 A;  2MA2 A;  3I5H B;  1SW8 A;  5HLV A;  1KFU S;  1XFW O;  3SIB A;  2R2I A;  1DGU A;  1M39 A;  1PRW A;  1S3P A;  3BUX B;  2LHI A;  1OE9 B;  2M49 B;  1YUR A;  1KK8 B;  2LLU A;  4WQ2 A;  3SG2 A;  3TDZ A;  2JOJ A;  1K2H A;  3DVJ A;  2Q91 A;  1BU3 A;  1DTL A;  4ICB A;  4OR9 B;  1PVB A;  4PAL A;  3JTD C;  3TS5 C;  2JZI A;  4F0Z B;  1EL4 A;  4NDB A;  1QLK A;  4C0K A;  1H4B A;  5AXI A;  2K7O A;  1V1G A;  3F45 A;  1JUO A;  4QJ4 B;  3DF0 A;  1TOP A;  3AKA A;  3OP0 A;  1QLS A;  4QJ5 B;  3AAK A;  3VRP A;  1XVJ A;  1QV0 A;  2OTG B;  1NCY A;  3BOW B;  4DIR A;  2KOT A;  1REC A;  4YBH B;  1LVC D;  1SY9 A;  4N1G A;  3LCP C;  1UHH A;  2NCO A;  3EKH A;  1ZUZ A;  5TNC A;  2MHH A;  1H8B A;  2K7C A;  1WDC B;  3EVR A;  1F8H A;  1NWD A;  4GGF C;  1B9A A;  1QIW A;  3OX5 A;  2ZN8 A;  2MJW B;  3WXA A;  3PFV A;  2P6B B;  5HKY A;  4PE1 A;  1CNP A;  2KDH A;  3D10 A;  3AKB A;  1ZOT B;  2K7D A;  2KGB C;  1EH2 A;  3O2P A;  4PE7 A;  3BXK A;  5DKN A;  2L4H A;  1FI6 A;  1CM1 A;  2WND A;  1DJZ A;  1GQM A;  2JXL A;  1WRK A;  5J3X A;  1CDL A;  2EHB A;  1KSM A;  1M31 A;  2KHN A;  3CR2 A;  1BR4 B;  5AAN A;  1XK4 C;  2M29 A;  2PMY A;  1CFD A;  2LMT A;  1TCF A;  3GK1 A;  4MZL A;  4D1E A;  4YGC B;  2BL0 C;  5K89 A;  1SR6 C;  2HF5 A;  1AJ5 A;  1AJ4 A;  4ORC B;  2JPT A;  5AER A;  2D8N A;  4OV2 A;  1U5I A;  2JT0 A;  3TDU A;  1IJ6 A;  3OHM B;  4M2Q A;  4YRU A;  1XYD A;  1J7O A;  3TS5 B;  1YX7 A;  3EVV A;  3DVK A;  2HQW A;  3A8R A;  2AMI A;  2SCP A;  2KYC A;  2G9B A;  1AUI B;  1K9U A;  1UP5 A;  3SIA A;  1TCO B;  1MF8 B;  2CXJ A;  1IGV A;  1IJ5 A;  1K8U A;  2FOT A;  2ZKM X;  1J1E A;  1Y1U A;  1CKK A;  5KSZ A;  2F33 A;  1KK8 C;  2I7A A;  2JTT A;  3GK2 A;  3CTN A;  4YGA A;  1OMD A;  2PVB A;  2G2B A;  4GGN A;  3AAJ A;  3LL8 B;  2NLN A;  3CR4 X;  5HKW A;  1R6P A;  3VRQ A;  4USL A;  2JXC A;  1M46 A;  2LAP A;  1MWN A;  1S6J A;  2GGZ A;  5DKR A;  3SG7 A;  2RGI A;  1SBJ A;  1YRT B;  2NZ0 A;  2ZRS A;  1S5G Z;  4GBA A;  4HSZ A;  4BY4 A;  3VRN A;  1MUX A;  3I5I C;  3OX6 A;  3TZ1 A;  1N0Y A;  4PE0 A;  1YUS A;  2KQY A;  2IS9 A;  3A4U B;  2KFG A;  1YR5 A;  2WC8 A;  3BOW A;  1F54 A;  2Y5I A;  3CR5 X;  1K9K A;  1LIN A;  2CTN A;  2A4J A;  2LVV A;  2E6W A;  2KAY A;  1C07 A;  1SCM C;  4DRW A;  1WDC C;  2H61 A;  3NXA A;  1JF2 A;  4GNK B;  4DUQ A;  4MRX A;  4CID A;  1AK8 A;  3VRO A;  2LP3 A;  2LMV A;  1ZAC A;  2LMU A;  1YUU A;  1S5G Y;  1SL9 A;  2KI6 C;  1QX5 B;  5ER4 X;  3NSK A;  4GPL B;  4N5X A;  1SR6 B;  5JOL A;  2B1U A;  1PVA A;  2LUX A;  1B8R A;  1SCV A;  1CM4 A;  3PAT A;  3KEV A;  4NDD A;  2LAN A;  2KSP A;  3ZNI A;  2SAS A;  2M7L A;  3CZT X;  1Y6W A;  4I5L B;  3KHE A;  1MQ1 A;  2JT3 A;  2LC5 A;  3PAL A;  2F2P A;  1MXL C;  1KSO A;  4I5J A;  3GK4 X;  2I94 A;  3HX4 A;  2EGD A;  1PUL A;  1AVS A;  1CFC A;  1SL7 A;  4PHN A;  5DKQ A;  1WY9 A;  1EJ3 A;  1CLM A;  1NX1 A;  1FW4 A;  2JQ6 A;  2LM5 A;  1G4Y R;  4DS7 A;  3GOF A;  1DGV A;  4PHM A;  1EG4 A;  4ZCU A;  1K96 A;  1RWY A;  3PN7 C;  1OMV A;  2KI6 D;  1ODB A;  1NPQ A;  3D0Y B;  1CMF A;  3ZWH A;  1CDP A;  3KF9 A;  2JWW A;  1LA3 A;  1V1F A;  3I5I B;  2L98 A;  1IG5 A;  1SPY A;  2WCF A;  3CWG A;  2QAC A;  1N65 A;  4ORA B;  4QJ3 B;  4AOM A;  4E68 A;  1LKJ A;  3IQO A;  4R1E A;  2OPO A;  1CDM A;  3BUM B;  4I5K A;  1RFJ A;  4P5O E;  1AP4 A;  4NDC A;  1SCM B;  2COL B;  3I5G C;  1A2X A;  3HCM A;  4GGF A;  3VGO A;  4CLN A;  3M0W A;  3TDI A;  3WHU B;  1KFX L;  1Q80 A;  1QAT A;  1RTP 1;  2BBM A;  2QPT A;  1S36 A;  4GUK A;  4ORB B;  4A4B A;  5G08 A;  1BJF A;  2CT9 A;  1NCZ A;  1YVL A;  2VRG A;  1DJI A;  4IL1 A;  4BY5 A;  2JUL A;  1DT7 B;  2JRF A;  1XFU O;  1BLQ A;  1UUS A;  2WOS A;  2F3Z A;  1XK4 A;  3VRR A;  2M9G A;  1OZS A;  4CPV A;  2LV7 A;  1G8I A;  3QRX A;  4PDZ A;  5CPV A;  4U8D A;  4MRY A;  5F6T A;  3DD4 A;  1TRF A;  2PAL A;  2ZN9 A;  2JTZ A;  4OKH A;  3JVT B;  5KTY A;  3EKJ A;  2M0R A;  1B4C A;  4AQI A;  3PN7 B;  1UWO A;  1A4P A;  2JNX A;  4MVF A;  4YGD B;  1NCX A;  1TN4 A;  5CSF A;  2JU0 A;  2H2K A;  1YX8 A;  3CLN A;  1NX3 A;  3EVU A;  2KBM A;  1K93 D;  1HT9 A;  1DMO A;  1J1D A;  1DF0 B;  1IKU A;  1SMG A;  1W7J B;  3EK8 A;  1A75 B;  1JFK A;  1JWD A;  2LCP A;  1RRO A;  1FPW A;  1MXE A;  2K2F A;  1GGW A;  1LXF C;  3D0Y A;  1FF1 A;  1KWO C;  1A03 A;  5I8N A;  4PE4 A;  5I2Q A;  3I5G B;  1CFF A;  1R2U A;  4GAO A;  2GV5 A;  2LVK A;  1B8C A;  3O78 A;  2FCD A;  1W7I B;  3IQQ A;  3O4Y A;  1K94 A;  4JQ0 D;  1C7W A;  2KAV A;  3IF7 A;  1C7V A;  4M2O A;  1XFZ O;  2E30 A;  4MN0 A;  4ZCV A;  4C0J A;  2FCE A;  1KQM C;  3BQ3 A;  2BBN A;  1UUR A;  4HRE E;  2Y1N A;  1S26 D;  2LP2 A;  4PCW A;  5IBW A;  1AHR A;  1TTX A;  1IH0 A;  5PAL A;  1S6C A;  2ZRT A;  2JNF A;  2M1U A;  5AEQ A;  1CTR A;  1X02 A;  1Y0V H;  3SG4 A;  4XJK B;  4AQJ A;  1J7R A;  1K90 D;  1KFX S;  1DJG A;  1TIZ A;  3SG5 A;  2Y1M A;  2BCX A;  1OSA A;  2PRU A;  2LLS A;  1MR8 A;  4M2P A;  4PHJ A;  2L51 A;  2BE4 A;  2ZNE A;  3DVM A;  2F8P A;  4OVN F;  2KYF A;  1MHO A;  2FJU B;  1PAL A;  1J7Q A;  1UHK A;  1IQ5 A;  2HET A;  2KFH A;  5HYD A;  1SNL A;  2ZFD A;  3I5F B;  4I5N B;  2LNK A;  2O5G A;  1XO5 A;  3PM8 A;  1BF5 A;  3C1V A; 
#chains in the Genus database with same CATH topology
 1EG3 A;  3JVT C;  1DJY A;  3LK1 A;  2LHL A;  1BOD A;  1K9P A;  3DVE A;  1IWQ A;  3RLZ A;  4MZK A;  1LA0 A;  5KU1 A;  1G33 A;  2MLF C;  4FQT A;  4MZJ A;  1VRK A;  3EK4 A;  4WQ3 A;  1TUJ A;  5CSI A;  1F71 A;  1PK0 D;  2KI4 C;  3OB1 B;  5B8I B;  1IQ3 A;  2AUC A;  4CFQ A;  2BEC A;  3KO0 A;  4PHK A;  3TUY B;  1PSR A;  1W9Z A;  3FE9 A;  2BCA A;  2I18 A;  3MSE B;  1KWO B;  3PSR A;  1UHI A;  3FE8 A;  3FWB A;  2KGR A;  4MLW A;  1FI5 A;  3O6B A;  1CDN A;  3D78 A;  1N2D A;  1OZO A;  1OMR A;  1OOH A;  4JPZ B;  1DF0 A;  1OOJ A;  1ZFS A;  2HQ8 A;  2K2A A;  2LVI A;  2K8M B;  3SG3 A;  3DVK A;  1M63 B;  1WLZ A;  4YI9 A;  1A75 A;  5GQQ C;  4YGE B;  1C3Z A;  4A4C A;  2KFF A;  2LVJ A;  2CBL A;  1JSA A;  1CLB A;  1XFX O;  2KQ6 A;  4FQO A;  1KQM B;  4WRI A;  1XA5 A;  3E3R A;  1BMO A;  1QAS A;  2NCP A;  2LUC A;  4UPG A;  1QXP A;  4Q04 A;  2L50 A;  1DJX A;  1TNP A;  4MBE A;  1QV1 A;  2M8U A;  2HPS A;  4PT1 A;  1SRA A;  3BUN B;  1DEK A;  2MRD A;  2OS8 C;  1YVH A;  1QJT A;  2L4I A;  2WCB A;  3LLE A;  3B7A A;  1TNW A;  1UHN A;  4MEW A;  1J7P A;  4CFR A;  1DJH A;  2WCJ A;  3FWC A;  2F2O A;  1L2O B;  2Q4U A;  3CGA A;  4JWQ A;  2QEH A;  1B7T Z;  2GGM A;  1GGZ A;  1SYM A;  2LLT A;  3D73 A;  3CZ2 A;  3EK7 A;  3L4A A;  5CSN A;  3SJS A;  1WRL A;  1CLL A;  1TNQ A;  2BE6 A;  4MSP A;  3SS4 A;  2L2C A;  1A29 A;  4XJK A;  1QX7 A;  1K95 A;  3CZ1 A;  2M1K B;  5D69 A;  5HLO A;  1SK6 D;  2KAX A;  1QTX A;  1J55 A;  1KFU L;  2JC2 A;  4TNC A;  1GJY A;  5ER5 A;  2EC6 B;  2O60 A;  2ZND A;  3KPX A;  4FTG A;  4N1F A;  2KI4 B;  1IRJ A;  1OOI X;  3BUO B;  1F4O A;  1YUT A;  2PAS A;  2YGU A;  3I5F C;  1BT6 A;  1B7T Y;  1LS8 A;  1TNX A;  2LE9 B;  1NUB A;  2PSR A;  1NX2 A;  1DVI A;  2L0P A;  4GFT A;  2BCB A;  2ISD A;  1EXR A;  1RJV A;  2K61 A;  1DEL A;  2KBI A;  1WLM A;  3I5H C;  3JTD B;  2KNE A;  1DC1 A;  1D1O A;  2MBX A;  1BR1 B;  1L7Z A;  3TUY C;  1RK9 A;  2M3W A;  2I2R E;  2Y4Q A;  4L9M A;  5FYX A;  3S0G A;  1E8A A;  1UHJ A;  5I2O A;  5I2L A;  3CS1 A;  5BPJ A;  2CNP A;  4YI8 A;  3DF0 B;  1QX2 A;  4DCK A;  1SKT A;  3SG6 A;  1WRZ A;  2OS8 B;  2QEV A;  3PLF B;  1QVI Z;  1ALV A;  1Y1A A;  5HKZ A;  3WHT B;  2QEB A;  1JF0 A;  2V53 A;  4XYN A;  3WNX B;  1CFP A;  3K1E A;  1KCY A;  3LK0 A;  3BUW B;  3NHI A;  5FI7 A;  3FS7 A;  1KK7 Z;  1F4Q A;  1M45 A;  2AAO A;  1XFV O;  5CSJ A;  5D3O A;  5AFP A;  1B47 A;  3EG5 B;  1ZMZ A;  1JC2 A;  2NXQ A;  3OB2 B;  1NYA A;  2K0J A;  1NX0 A;  1QIV A;  1DJW A;  2M7N A;  2M97 A;  2WCK A;  1CMG A;  3CZ0 A;  2L2E A;  2OTG C;  1YTZ C;  3NSL A;  1CB1 A;  1OQP A;  3ICB A;  3H4S E;  1HQV A;  3OBV A;  1BG1 A;  3NSI A;  1NP8 A;  1L2O C;  3QME A;  2CCM A;  2BKH B;  3R72 A;  2F3Y A;  2H61 C;  2MAZ A;  1QVI Y;  3S0D A;  2BKI B;  1BOC A;  3BYA A;  1F55 A;  1SL8 A;  1S6I A;  4C0L A;  1FBV A;  4P2Y B;  1KK7 Y;  1QS7 A;  1KQV A;  1YRU B;  1B8L A;  4ETO A;  2MLE C;  3FIA A;  4HRH A;  1NIW A;  2L5X B;  4HRG A;  4OCI A;  1JFJ A;  4NQG A;  4YGB B;  3RM1 A;  1S1E A;  1F70 A;  3K21 A;  1IIO A;  2TN4 A;  1JBA A;  2BL0 B;  2K7B A;  1B1G A;  3NSO A;  2WC5 A;  5D7F A;  1XFY O;  1U5I B;  2EC6 C;  1Y1X A;  1PSB A;  1NSH A;  2BNX A;  2WOR A;  2DOQ A;  1ALW A;  2WCE A;  5JJG A;  2JT8 A;  2MA2 A;  3I5H B;  1SW8 A;  3SS3 A;  5HLV A;  1KFU S;  1XFW O;  3SIB A;  2R2I A;  1DGU A;  1M39 A;  1PRW A;  1S3P A;  3BUX B;  2LHI A;  1OE9 B;  2K60 A;  2M49 B;  1YUR A;  1KK8 B;  2LLU A;  4WQ2 A;  3S0B A;  3SG2 A;  2JOJ A;  3TDZ A;  3DVJ A;  1K2H A;  2Q91 A;  1BU3 A;  1DTL A;  1Z2C B;  4ICB A;  4OR9 B;  1PVB A;  4PAL A;  3JTD C;  3TS5 C;  1SSE B;  4IJ7 A;  2ERB A;  1OW4 A;  2JZI A;  4F0Z B;  1EL4 A;  4NDB A;  1QLK A;  4C0K A;  1H4B A;  5AXI A;  2K7O A;  1V1G A;  3F45 A;  1JUO A;  2PQL A;  4QJ4 B;  3DF0 A;  1TOP A;  3AKA A;  3OP0 A;  1QLS A;  4QJ5 B;  3AAK A;  2H8V A;  3VRP A;  1XVJ A;  1QV0 A;  2OTG B;  5FI6 A;  1NCY A;  3BOW B;  4DIR A;  2KOT A;  1REC A;  2PYQ A;  1LVC D;  4YBH B;  1SY9 A;  4N1G A;  3LCP C;  1UHH A;  2NCO A;  3EKH A;  1ZUZ A;  3D76 A;  5TNC A;  2MHH A;  1H8B A;  2K7C A;  1WDC B;  3EVR A;  1F8H A;  1NWD A;  4GGF C;  1B9A A;  1QIW A;  3OX5 A;  2WCM A;  2ZN8 A;  2MJW B;  3WXA A;  3B87 A;  3PFV A;  2P6B B;  3RZS A;  5HKY A;  4PE1 A;  1CNP A;  2KDH A;  3D10 A;  3AKB A;  1ZOT B;  2K7D A;  2KGB C;  1EH2 A;  3O2P A;  4PE7 A;  3BXK A;  5DKN A;  2L4H A;  4INW A;  1FI6 A;  4JKT A;  1CM1 A;  1ORG A;  2WND A;  1DJZ A;  1GQM A;  2JXL A;  1WRK A;  5J3X A;  1CDL A;  2EHB A;  3DY9 A;  1KSM A;  1M31 A;  2KHN A;  3CR2 A;  1BR4 B;  5AAN A;  1XK4 C;  2M29 A;  2PMY A;  1CFD A;  2LMT A;  2P71 A;  1TCF A;  3GK1 A;  4MZL A;  4D1E A;  4YGC B;  2BL0 C;  3BJH A;  5K89 A;  2WCH A;  1SR6 C;  4JD9 A;  2HF5 A;  1AJ5 A;  1AJ4 A;  3D75 A;  2JPT A;  4ORC B;  5AER A;  2D8N A;  4OV2 A;  1U5I A;  2JT0 A;  5FI2 A;  3TDU A;  1IJ6 A;  3OHM B;  4M2Q A;  4YRU A;  1XYD A;  1J7O A;  3L47 A;  3R1V A;  3TS5 B;  1YX7 A;  3EVV A;  2QEO A;  2HQW A;  3A8R A;  2AMI A;  2SCP A;  3B88 A;  2KYC A;  2G9B A;  1AUI B;  1K9U A;  1UP5 A;  4INX A;  1TCO B;  3SIA A;  1T14 A;  1MF8 B;  2CXJ A;  1IGV A;  2KLE A;  1IJ5 A;  1QWV A;  1K8U A;  2FOT A;  2ZKM X;  1J1E A;  1Y1U A;  1CKK A;  5KSZ A;  2F33 A;  1KK8 C;  2I7A A;  2JTT A;  3GK2 A;  3CTN A;  4YGA A;  1OMD A;  2PVB A;  2G2B A;  3S0E A;  3IVT A;  4GGN A;  3AAJ A;  3LL8 B;  3UO9 A;  2NLN A;  3CR4 X;  5HKW A;  1P28 A;  1R6P A;  4USL A;  2JXC A;  3VRQ A;  1M46 A;  2LAP A;  3UNW A;  1MWN A;  1S6J A;  2GGZ A;  5DKR A;  1Z4H A;  3SG7 A;  5DIC A;  3DYE A;  2RGI A;  2P70 A;  1SBJ A;  1YRT B;  2NZ0 A;  2ZRS A;  1S5G Z;  4GBA A;  4HSZ A;  4BY4 A;  3S0A A;  3VRN A;  1MUX A;  3I5I C;  3OX6 A;  3TZ1 A;  1N0Y A;  4PE0 A;  1YUS A;  2KQY A;  2IS9 A;  3A4U B;  3NHT A;  1OOF A;  2KFG A;  2L5Y A;  1YR5 A;  2WC8 A;  3BOW A;  1F54 A;  2Y5I A;  3CR5 X;  1K9K A;  1LIN A;  2CTN A;  2A4J A;  2LVV A;  2E6W A;  2KAY A;  3O4X A;  1C07 A;  1SCM C;  4DRW A;  1WDC C;  2H61 A;  3NXA A;  1JF2 A;  4GNK B;  4DUQ A;  4MRX A;  4CID A;  1AK8 A;  3V2L A;  3VRO A;  2LP3 A;  2LMV A;  1ZAC A;  2LMU A;  2WC6 A;  1YUU A;  1S5G Y;  1SL9 A;  2KI6 C;  1QX5 B;  5ER4 X;  3NSK A;  4GPL B;  4N5X A;  1SR6 B;  5JOL A;  1OOG A;  2B1U A;  1PVA A;  2LUX A;  1B8R A;  1SCV A;  1CM4 A;  3PAT A;  3KEV A;  4NDD A;  2LAN A;  2KSP A;  3ZNI A;  2SAS A;  2M7L A;  3CZT X;  3R1P A;  2KPH A;  3PJI A;  1Y6W A;  4I5L B;  3KHE A;  1MQ1 A;  2JT3 A;  2LC5 A;  3PAL A;  2F2P A;  3PM2 A;  1MXL C;  1KSO A;  4I5J A;  3GK4 X;  2I94 A;  3HX4 A;  2EGD A;  1PUL A;  1AVS A;  1CFC A;  1SL7 A;  4PHN A;  5DKQ A;  1WY9 A;  1EJ3 A;  1CLM A;  1NX1 A;  1FW4 A;  2JQ6 A;  1C3Y A;  2LM5 A;  1G4Y R;  4DS7 A;  1XFR A;  3GOF A;  1DGV A;  2FJY A;  4PHM A;  1EG4 A;  2QDI A;  4ZCU A;  1K96 A;  1RWY A;  3PN7 C;  1OMV A;  2KI6 D;  1ODB A;  1NPQ A;  3D0Y B;  1CMF A;  5I94 A;  3ZWH A;  1GM0 A;  1CDP A;  3BFB A;  3KF9 A;  2JWW A;  1LA3 A;  1V1F A;  3I5I B;  2L98 A;  1IG5 A;  1SPY A;  2WCF A;  3CWG A;  2QAC A;  1N65 A;  4ORA B;  4QJ3 B;  4AOM A;  4E68 A;  1LKJ A;  3L4L A;  3IQO A;  4R1E A;  2BAP A;  1TUZ A;  2OPO A;  1CDM A;  3BUM B;  4I5K A;  1RFJ A;  5HL1 A;  4F7F A;  4P5O E;  1AP4 A;  4NDC A;  1SCM B;  2COL B;  3I5G C;  1A2X A;  3HCM A;  3BFH A;  4GGF A;  3VGO A;  4CLN A;  3FE6 A;  3M0W A;  3TDI A;  3WHU B;  1KFX L;  1Q80 A;  1QAT A;  1RTP 1;  2BBM A;  2QPT A;  1S36 A;  3CYZ A;  4GUK A;  4KYN A;  4ORB B;  5G08 A;  4A4B A;  1BJF A;  2CT9 A;  3OGN A;  3S0F A;  1NCZ A;  1YVL A;  2VRG A;  1DJI A;  4IL1 A;  4BY5 A;  1TWO A;  1DQE A;  2JUL A;  1DT7 B;  2JRF A;  1XFU O;  3NGV A;  4OZD A;  1BLQ A;  1UUS A;  2GTE A;  2WOS A;  2F3Z A;  1XK4 A;  3VRR A;  3DZT A;  2M9G A;  1OZS A;  4CPV A;  2LV7 A;  1G8I A;  3BFA A;  3QRX A;  4PDZ A;  5CPV A;  4U8D A;  4MRY A;  5F6T A;  3DD4 A;  1TRF A;  2PAL A;  2ZN9 A;  2JTZ A;  4OKH A;  3JVT B;  5KTY A;  3SS5 A;  2KLD A;  3EKJ A;  2M0R A;  1B4C A;  4AQI A;  3PN7 B;  1UWO A;  1A4P A;  2JNX A;  4MVF A;  4YGD B;  1NCX A;  1TN4 A;  5CSF A;  2JU0 A;  2H2K A;  1YX8 A;  3CLN A;  2WCL A;  1NX3 A;  3EVU A;  2KBM A;  1K93 D;  1HT9 A;  1DMO A;  1J1D A;  1DF0 B;  1IKU A;  5EL2 A;  3DXL A;  1SMG A;  1W7J B;  3CDN A;  3EK8 A;  3D77 A;  1A75 B;  1JFK A;  1JWD A;  2LCP A;  1RRO A;  3B86 A;  1FPW A;  1MXE A;  2K2F A;  1GGW A;  1LXF C;  3D0Y A;  1FF1 A;  3B6X A;  3Q8I A;  1KWO C;  1A03 A;  5I8N A;  4PE4 A;  5I2Q A;  3I5G B;  1CFF A;  1R2U A;  4GAO A;  2GV5 A;  2LVK A;  1B8C A;  3O78 A;  2FCD A;  1W7I B;  3IQQ A;  3O4Y A;  1K94 A;  4JQ0 D;  1C7W A;  2KAV A;  3CAB A;  3IF7 A;  1C7V A;  4M2O A;  1XFZ O;  2E30 A;  4MN0 A;  4ZCV A;  4C0J A;  2FCE A;  1KQM C;  3BQ3 A;  2BBN A;  1UUR A;  4HRE E;  2Y1N A;  1S26 D;  2LP2 A;  4PCW A;  5IBW A;  1AHR A;  1TTX A;  1IH0 A;  5PAL A;  1S6C A;  2ZRT A;  2JPO A;  2JNF A;  2M1U A;  3N7H A;  3R1O A;  5AEQ A;  1CTR A;  1X02 A;  1Y0V H;  3SG4 A;  4XJK B;  3D74 A;  4AQJ A;  1J7R A;  1K90 D;  1KFX S;  1DJG A;  1TIZ A;  3SG5 A;  2Y1M A;  2BCX A;  1OSA A;  2PRU A;  2LLS A;  1MR8 A;  4M2P A;  4PHJ A;  2L51 A;  2BE4 A;  2ZNE A;  3DVM A;  2F8P A;  4OVN F;  2KYF A;  1MHO A;  2FJU B;  1PAL A;  1J7Q A;  1UHK A;  1IQ5 A;  2HET A;  2KFH A;  5HYD A;  1SNL A;  2ZFD A;  3I5F B;  4I5N B;  2LNK A;  2O5G A;  1XO5 A;  3PM8 A;  3VB1 A;  1BF5 A;  3C1V A; 
#chains in the Genus database with same CATH homology
 1EG3 A;  3JVT C;  1DJY A;  3LK1 A;  2LHL A;  1BOD A;  1K9P A;  3DVE A;  1IWQ A;  3RLZ A;  4MZK A;  1LA0 A;  5KU1 A;  1G33 A;  2MLF C;  4MZJ A;  1F71 A;  1VRK A;  3EK4 A;  4WQ3 A;  5CSI A;  1PK0 D;  2KI4 C;  3OB1 B;  5B8I B;  1IQ3 A;  2AUC A;  4CFQ A;  2BEC A;  3KO0 A;  4PHK A;  3TUY B;  1PSR A;  2BCA A;  2I18 A;  3MSE B;  1KWO B;  3PSR A;  1UHI A;  3FWB A;  2KGR A;  4MLW A;  1FI5 A;  3O6B A;  1CDN A;  1N2D A;  1OZO A;  1OMR A;  4JPZ B;  1DF0 A;  1OOJ A;  1ZFS A;  2HQ8 A;  2K2A A;  2LVI A;  2K8M B;  3SG3 A;  1M63 B;  1WLZ A;  4YI9 A;  1A75 A;  5GQQ C;  4YGE B;  4A4C A;  2KFF A;  2LVJ A;  2CBL A;  1JSA A;  1CLB A;  1XFX O;  2KQ6 A;  4FQO A;  1KQM B;  4WRI A;  1XA5 A;  3E3R A;  1BMO A;  1QAS A;  2NCP A;  2LUC A;  4UPG A;  1QXP A;  4Q04 A;  2L50 A;  1DJX A;  1TNP A;  4MBE A;  1QV1 A;  2M8U A;  2HPS A;  1SRA A;  3BUN B;  2MRD A;  2OS8 C;  1YVH A;  1QJT A;  2L4I A;  2WCB A;  3LLE A;  1TNW A;  1UHN A;  4MEW A;  1J7P A;  4CFR A;  1DJH A;  3FWC A;  2F2O A;  1L2O B;  2Q4U A;  3CGA A;  4JWQ A;  1B7T Z;  2GGM A;  1GGZ A;  1SYM A;  2LLT A;  3EK7 A;  5CSN A;  3SJS A;  1WRL A;  1CLL A;  1TNQ A;  2BE6 A;  4MSP A;  1A29 A;  4XJK A;  1QX7 A;  1K95 A;  2M1K B;  5D69 A;  5HLO A;  1SK6 D;  2KAX A;  1QTX A;  1J55 A;  1KFU L;  2JC2 A;  4TNC A;  1GJY A;  5ER5 A;  2EC6 B;  2O60 A;  2ZND A;  3KPX A;  4FTG A;  4N1F A;  2KI4 B;  1IRJ A;  3BUO B;  1F4O A;  1YUT A;  2PAS A;  3I5F C;  1BT6 A;  1B7T Y;  1TNX A;  2LE9 B;  1NUB A;  2PSR A;  1NX2 A;  1DVI A;  2L0P A;  4GFT A;  2BCB A;  2ISD A;  1EXR A;  1RJV A;  2K61 A;  2KBI A;  1WLM A;  3I5H C;  3JTD B;  2KNE A;  1D1O A;  2MBX A;  1BR1 B;  1L7Z A;  3TUY C;  1RK9 A;  2M3W A;  2I2R E;  2Y4Q A;  4L9M A;  5FYX A;  1E8A A;  1UHJ A;  5I2O A;  5I2L A;  3CS1 A;  5BPJ A;  2CNP A;  4YI8 A;  3DF0 B;  1QX2 A;  4DCK A;  1SKT A;  3SG6 A;  1WRZ A;  2OS8 B;  3PLF B;  1QVI Z;  1ALV A;  1Y1A A;  5HKZ A;  3WHT B;  1JF0 A;  2V53 A;  4XYN A;  3WNX B;  1CFP A;  1KCY A;  3LK0 A;  3BUW B;  3FS7 A;  1KK7 Z;  1F4Q A;  1M45 A;  2AAO A;  1XFV O;  5CSJ A;  5AFP A;  1B47 A;  1ZMZ A;  1JC2 A;  2NXQ A;  3OB2 B;  1NYA A;  2K0J A;  1NX0 A;  1QIV A;  1DJW A;  2M7N A;  2M97 A;  1CMG A;  2L2E A;  2OTG C;  1YTZ C;  3NSL A;  1CB1 A;  1OQP A;  3ICB A;  3H4S E;  1HQV A;  1BG1 A;  3NSI A;  1NP8 A;  1L2O C;  2CCM A;  2BKH B;  2F3Y A;  2H61 C;  2MAZ A;  1QVI Y;  2BKI B;  1BOC A;  3BYA A;  1F55 A;  1SL8 A;  1S6I A;  4C0L A;  1FBV A;  4P2Y B;  1KK7 Y;  1QS7 A;  1KQV A;  1YRU B;  1B8L A;  4ETO A;  2MLE C;  3FIA A;  4HRH A;  1NIW A;  2L5X B;  4HRG A;  4OCI A;  1JFJ A;  4NQG A;  4YGB B;  3RM1 A;  1S1E A;  1F70 A;  3K21 A;  2TN4 A;  1JBA A;  2BL0 B;  2K7B A;  1B1G A;  3NSO A;  5D7F A;  1XFY O;  1U5I B;  2EC6 C;  1Y1X A;  1PSB A;  1NSH A;  2WOR A;  2DOQ A;  1ALW A;  2WCE A;  5JJG A;  2JT8 A;  2MA2 A;  3I5H B;  1SW8 A;  5HLV A;  1KFU S;  1XFW O;  3SIB A;  2R2I A;  1DGU A;  1M39 A;  1PRW A;  1S3P A;  3BUX B;  2LHI A;  1OE9 B;  2M49 B;  1YUR A;  1KK8 B;  2LLU A;  4WQ2 A;  3SG2 A;  3TDZ A;  2JOJ A;  1K2H A;  3DVJ A;  2Q91 A;  1BU3 A;  1DTL A;  4ICB A;  4OR9 B;  1PVB A;  4PAL A;  3JTD C;  3TS5 C;  2JZI A;  4F0Z B;  1EL4 A;  4NDB A;  1QLK A;  4C0K A;  1H4B A;  5AXI A;  2K7O A;  1V1G A;  3F45 A;  1JUO A;  4QJ4 B;  3DF0 A;  1TOP A;  3AKA A;  3OP0 A;  1QLS A;  4QJ5 B;  3AAK A;  3VRP A;  1XVJ A;  1QV0 A;  2OTG B;  1NCY A;  3BOW B;  4DIR A;  2KOT A;  1REC A;  4YBH B;  1LVC D;  1SY9 A;  4N1G A;  3LCP C;  1UHH A;  2NCO A;  3EKH A;  1ZUZ A;  5TNC A;  2MHH A;  1H8B A;  2K7C A;  1WDC B;  3EVR A;  1F8H A;  1NWD A;  4GGF C;  1B9A A;  1QIW A;  3OX5 A;  2ZN8 A;  2MJW B;  3WXA A;  3PFV A;  2P6B B;  5HKY A;  4PE1 A;  1CNP A;  2KDH A;  3D10 A;  3AKB A;  1ZOT B;  2K7D A;  2KGB C;  1EH2 A;  3O2P A;  4PE7 A;  3BXK A;  5DKN A;  2L4H A;  1FI6 A;  1CM1 A;  2WND A;  1DJZ A;  1GQM A;  2JXL A;  1WRK A;  5J3X A;  1CDL A;  2EHB A;  1KSM A;  1M31 A;  2KHN A;  3CR2 A;  1BR4 B;  5AAN A;  1XK4 C;  2M29 A;  2PMY A;  1CFD A;  2LMT A;  1TCF A;  3GK1 A;  4MZL A;  4D1E A;  4YGC B;  2BL0 C;  5K89 A;  1SR6 C;  2HF5 A;  1AJ5 A;  1AJ4 A;  4ORC B;  2JPT A;  5AER A;  2D8N A;  4OV2 A;  1U5I A;  2JT0 A;  3TDU A;  1IJ6 A;  3OHM B;  4M2Q A;  4YRU A;  1XYD A;  1J7O A;  3TS5 B;  1YX7 A;  3EVV A;  3DVK A;  2HQW A;  3A8R A;  2AMI A;  2SCP A;  2KYC A;  2G9B A;  1AUI B;  1K9U A;  1UP5 A;  3SIA A;  1TCO B;  1MF8 B;  2CXJ A;  1IGV A;  1IJ5 A;  1K8U A;  2FOT A;  2ZKM X;  1J1E A;  1Y1U A;  1CKK A;  5KSZ A;  2F33 A;  1KK8 C;  2I7A A;  2JTT A;  3GK2 A;  3CTN A;  4YGA A;  1OMD A;  2PVB A;  2G2B A;  4GGN A;  3AAJ A;  3LL8 B;  2NLN A;  3CR4 X;  5HKW A;  1R6P A;  3VRQ A;  4USL A;  2JXC A;  1M46 A;  2LAP A;  1MWN A;  1S6J A;  2GGZ A;  5DKR A;  3SG7 A;  2RGI A;  1SBJ A;  1YRT B;  2NZ0 A;  2ZRS A;  1S5G Z;  4GBA A;  4HSZ A;  4BY4 A;  3VRN A;  1MUX A;  3I5I C;  3OX6 A;  3TZ1 A;  1N0Y A;  4PE0 A;  1YUS A;  2KQY A;  2IS9 A;  3A4U B;  2KFG A;  1YR5 A;  2WC8 A;  3BOW A;  1F54 A;  2Y5I A;  3CR5 X;  1K9K A;  1LIN A;  2CTN A;  2A4J A;  2LVV A;  2E6W A;  2KAY A;  1C07 A;  1SCM C;  4DRW A;  1WDC C;  2H61 A;  3NXA A;  1JF2 A;  4GNK B;  4DUQ A;  4MRX A;  4CID A;  1AK8 A;  3VRO A;  2LP3 A;  2LMV A;  1ZAC A;  2LMU A;  1YUU A;  1S5G Y;  1SL9 A;  2KI6 C;  1QX5 B;  5ER4 X;  3NSK A;  4GPL B;  4N5X A;  1SR6 B;  5JOL A;  2B1U A;  1PVA A;  2LUX A;  1B8R A;  1SCV A;  1CM4 A;  3PAT A;  3KEV A;  4NDD A;  2LAN A;  2KSP A;  3ZNI A;  2SAS A;  2M7L A;  3CZT X;  1Y6W A;  4I5L B;  3KHE A;  1MQ1 A;  2JT3 A;  2LC5 A;  3PAL A;  2F2P A;  1MXL C;  1KSO A;  4I5J A;  3GK4 X;  2I94 A;  3HX4 A;  2EGD A;  1PUL A;  1AVS A;  1CFC A;  1SL7 A;  4PHN A;  5DKQ A;  1WY9 A;  1EJ3 A;  1CLM A;  1NX1 A;  1FW4 A;  2JQ6 A;  2LM5 A;  1G4Y R;  4DS7 A;  3GOF A;  1DGV A;  4PHM A;  1EG4 A;  4ZCU A;  1K96 A;  1RWY A;  3PN7 C;  1OMV A;  2KI6 D;  1ODB A;  1NPQ A;  3D0Y B;  1CMF A;  3ZWH A;  1CDP A;  3KF9 A;  2JWW A;  1LA3 A;  1V1F A;  3I5I B;  2L98 A;  1IG5 A;  1SPY A;  2WCF A;  3CWG A;  2QAC A;  1N65 A;  4ORA B;  4QJ3 B;  4AOM A;  4E68 A;  1LKJ A;  3IQO A;  4R1E A;  2OPO A;  1CDM A;  3BUM B;  4I5K A;  1RFJ A;  4P5O E;  1AP4 A;  4NDC A;  1SCM B;  2COL B;  3I5G C;  1A2X A;  3HCM A;  4GGF A;  3VGO A;  4CLN A;  3M0W A;  3TDI A;  3WHU B;  1KFX L;  1Q80 A;  1QAT A;  1RTP 1;  2BBM A;  2QPT A;  1S36 A;  4GUK A;  4ORB B;  4A4B A;  5G08 A;  1BJF A;  2CT9 A;  1NCZ A;  1YVL A;  2VRG A;  1DJI A;  4IL1 A;  4BY5 A;  2JUL A;  1DT7 B;  2JRF A;  1XFU O;  1BLQ A;  1UUS A;  2WOS A;  2F3Z A;  1XK4 A;  3VRR A;  2M9G A;  1OZS A;  4CPV A;  2LV7 A;  1G8I A;  3QRX A;  4PDZ A;  5CPV A;  4U8D A;  4MRY A;  5F6T A;  3DD4 A;  1TRF A;  2PAL A;  2ZN9 A;  2JTZ A;  4OKH A;  3JVT B;  5KTY A;  3EKJ A;  2M0R A;  1B4C A;  4AQI A;  3PN7 B;  1UWO A;  1A4P A;  2JNX A;  4MVF A;  4YGD B;  1NCX A;  1TN4 A;  5CSF A;  2JU0 A;  2H2K A;  1YX8 A;  3CLN A;  1NX3 A;  3EVU A;  2KBM A;  1K93 D;  1HT9 A;  1DMO A;  1J1D A;  1DF0 B;  1IKU A;  1SMG A;  1W7J B;  3EK8 A;  1A75 B;  1JFK A;  1JWD A;  2LCP A;  1RRO A;  1FPW A;  1MXE A;  2K2F A;  1GGW A;  1LXF C;  3D0Y A;  1FF1 A;  1KWO C;  1A03 A;  5I8N A;  4PE4 A;  5I2Q A;  3I5G B;  1CFF A;  1R2U A;  4GAO A;  2GV5 A;  2LVK A;  1B8C A;  3O78 A;  2FCD A;  1W7I B;  3IQQ A;  3O4Y A;  1K94 A;  4JQ0 D;  1C7W A;  2KAV A;  3IF7 A;  1C7V A;  4M2O A;  1XFZ O;  2E30 A;  4MN0 A;  4ZCV A;  4C0J A;  2FCE A;  1KQM C;  3BQ3 A;  2BBN A;  1UUR A;  4HRE E;  2Y1N A;  1S26 D;  2LP2 A;  4PCW A;  5IBW A;  1AHR A;  1TTX A;  1IH0 A;  5PAL A;  1S6C A;  2ZRT A;  2JNF A;  2M1U A;  5AEQ A;  1CTR A;  1X02 A;  1Y0V H;  3SG4 A;  4XJK B;  4AQJ A;  1J7R A;  1K90 D;  1KFX S;  1DJG A;  1TIZ A;  3SG5 A;  2Y1M A;  2BCX A;  1OSA A;  2PRU A;  2LLS A;  1MR8 A;  4M2P A;  4PHJ A;  2L51 A;  2BE4 A;  2ZNE A;  3DVM A;  2F8P A;  4OVN F;  2KYF A;  1MHO A;  2FJU B;  1PAL A;  1J7Q A;  1UHK A;  1IQ5 A;  2HET A;  2KFH A;  5HYD A;  1SNL A;  2ZFD A;  3I5F B;  4I5N B;  2LNK A;  2O5G A;  1XO5 A;  3PM8 A;  1BF5 A;  3C1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...