2WCHA

Structure of bmori gobp2 (general odorant binding protein 2) with bombykal
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
total genus 54
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wchA00
3R72A 3OGNA 2ERBA 3DYEA 3L4LA 1XFRA 3K1EA 3S0DA 3FE6A 3V2LA 1DQEA 3D76A 3CZ0A 4JD9A 4OZDA 2WCKA 3BFAA 2P71A 3D75A 3BJHA 1OOGA 2QEOA 3DY9A 3R1OA 1OW4A 1TUJA 3L4AA 3DXLA 2QEBA 3NHTA 2WC6A 2L2CA 3Q8IA 4INWA 3S0EA 3D73A 3DZTA 3PJIA 1QWVA 1TWOA 1OOIX 3N7HA 3B6XA 3L47A 4PT1A 3BFBA 3S0GA 3FE9A 3CDNA 3D74A 2GTEA 2WCJA 1GM0A 3QMEA 3CYZA 3D78A 3NHIA 3B87A 2WCMA 1C3YA 2PQLA 2QEHA 2QDIA 2FJYA 5DICA 1OOFA 2WCLA 3CZ1A 3RZSA 3CZ2A 2WCHA 3R1PA 1C3ZA 2P70A 3R1VA 2JPOA 1P28A 3S0BA 3B88A 3FE8A 3S0AA 3B86A 3BFHA 2H8VA 4FQTA 1LS8A 4F7FA 1ORGA 4INXA 3D77A 1OOHA 2WC5A 3NGVA 2QEVA 3CABA 3VB1A 5EL2A 1T14A 3S0FA 2KPHA 3B7AA
chains in the Genus database with same CATH superfamily
2K60A 4HREE 1MWNA 2JNXA 1CLLA 1XFRA 2KBMA 1BT6A 1DF0A 2KI4B 2MLEC 2PASA 1ZUZA 1SBJA 4MN0A 1ZOTB 1WRZA 1SL7A 2HPSA 2KGBC 1XFVO 1YUTA 2P71A 1B9AA 5BPJA 1IJ6A 1R2UA 2KI4C 3MSEB 3I5IC 5I8NA 2F8PA 3CWGA 3D75A 2KQYA 2JC2A 1W7JB 1K9UA 1JUOA 2KFFA 3UO9A 4BY4A 2K0JA 1NYAA 2L50A 2PMYA 1SK6D 1NWDA 1SNLA 3D0YB 4YBHB 2M97A 2JXLA 1Y1UA 5HKYA 3SS5A 3O4YA 3DVJA 3DXLA 4ICBA 1PALA 5HLVA 1LINA 4AQJA 2JOJA 4I5JA 2KQ6A 1OE9B 3VROA 2GV5A 4AQIA 3FS7A 1NSHA 2KNEA 4INWA 3S0EA 1JSAA 4I5NB 4D1EA 3BUOB 4OV2A 1JC2A 1OQPA 1RK9A 1IRJA 1J7PA 1XO5A 3EK8A 1TN4A 1YUUA 1TWOA 2ZRSA 4P2YB 4XJKB 1CFDA 1EL4A 1VRKA 2G9BA 3CZTX 4CFQA 2OPOA 5KU1A 1DT7B 1QXPA 1DJYA 4PT1A 1KFXL 1S5GY 2KYFA 1W9ZA 1YVLA 5TNCA 4C0LA 1F4OA 5HYDA 1NUBA 1YUSA 2LUCA 1ZFSA 1B8LA 2MRDA 2Y1NA 1GM0A 5KTYA 1WLZA 1WDCB 2NLNA 2Y4QA 3D78A 1SCMC 3NHIA 4GUKA 4YGCB 2JTTA 1K93D 5AXIA 1HQVA 1QATA 3PN7C 3FWCA 1C3YA 3EK4A 2MBXA 2LAPA 2F3ZA 3CTNA 2QEHA 3KHEA 1QVIY 1AK8A 2VRGA 1C07A 1AUIB 2BECA 2ZNEA 1C7VA 3PM2A 3EVUA 2H61A 2MA2A 2NZ0A 4HRHA 1QASA 1AP4A 4WQ3A 3C1VA 2I7AA 3FWBA 3EKHA 1M39A 1XFUO 2JTZA 4OVNF 3OB2B 1CMGA 1DVIA 4I5LB 2ZN8A 3OX5A 3GK4X 1A75A 1Z4HA 4A4CA 1G33A 3AAKA 2P70A 4ORAB 2MHHA 3D10A 1P28A 1NX1A 1UURA 3B88A 2CBLA 3DD4A 1N65A 4CFRA 3B86A 3H4SE 2PALA 4FQTA 1NCZA 1YTZC 3A8RA 4MVFA 1J7QA 1L2OB 3LCPC 1S1EA 2L5XB 1CDPA 2CNPA 1BF5A 1H8BA 2P6BB 4PCWA 1TUZA 1UHIA 4PE4A 3PATA 4IL1A 4ORBB 2SCPA 3CR2A 1YX7A 1GQMA 3JTDC 2L98A 2CCMA 1JWDA 2LUXA 1JF0A 3CABA 5K89A 5ER4X 1T14A 2E6WA 1Y0VH 2A4JA 4KYNA 3SG5A 5HLOA 1H4BA 3O2PA 2JT0A 1AHRA 3ZWHA 3R72A 3AAJA 2ERBA 3IVTA 1B7TY 4YRUA 3GK1A 4MLWA 4PHMA 1EJ3A 1LVCD 2EGDA 1D1OA 1XVJA 1MXLC 4DRWA 1UHJA 3S0DA 5HL1A 5JOLA 3D76A 3CZ0A 3I5HB 1DJIA 4DS7A 1IG5A 5G08A 4JD9A 1UHNA 4OZDA 2WCKA 1K8UA 1BLQA 3JTDB 1J1EA 3I5IB 1CM4A 1B7TZ 1EG4A 4QJ3B 1OOGA 1KFUS 1K9PA 1F54A 1K9KA 3WNXB 1GGZA 1Z2CB 1ZMZA 2MLFC 2QEOA 1DJZA 3CS1A 1B47A 3M0WA 1EH2A 4QJ5B 4ZCUA 1MQ1A 2ZKMX 5I2OA 3OP0A 1J7OA 3OBVA 3BOWB 1IKUA 3KPXA 3NHTA 2BE4A 2AMIA 4PHKA 1U5IA 4C0KA 1CFPA 5B8IB 3PSRA 4PE7A 1DGVA 4CLNA 5KSZA 1K96A 2CTNA 2JQ6A 3CR4X 4PE1A 1U5IB 2F3YA 1WLMA 1DJHA 4M2OA 1K2HA 1B8CA 1EXRA 4M2QA 1YRTB 1S6IA 1X02A 1Q80A 2CXJA 3GK2A 3LK0A 3I5FB 1S26D 3TDZA 1FW4A 1TIZA 1B8RA 1PULA 3O78A 1RWYA 5I94A 2JULA 2ZNDA 4NDDA 2KI6D 2COLB 2LVVA 1DELA 4F0ZB 1FPWA 2K2AA 1JFJA 4A4BA 4HSZA 3DVMA 3D74A 4GGFC 2D8NA 1DJGA 2WCJA 2OS8B 5AANA 1XYDA 3UNWA 2KYCA 3QMEA 1KQMC 5CSNA 1MF8B 2LM5A 1QVIZ 5DKNA 1MHOA 2K7OA 2BCXA 1V1GA 1K95A 2GGMA 2O5GA 2OS8C 2BL0C 2WCMA 1F71A 2OTGC 1JBAA 1CDNA 1LKJA 4U8DA 2F33A 1ODBA 3QRXA 1M46A 2QDIA 1SR6B 1ZACA 2FJUB 3AKAA 5DICA 3NSIA 1TNWA 1F8HA 1CFFA 3CZ1A 2AAOA 3OX6A 3ICBA 3RZSA 1SPYA 1CFCA 1KK8C 1OOJA 2KI6C 2WCHA 3NSKA 4YI9A 3VRRA 1B4CA 3R1PA 1UWOA 3R1VA 2TN4A 3I5GB 3S0BA 3OHMB 4FQOA 2JPTA 3IF7A 1SY9A 3FIAA 3PALA 3BFHA 4XJKA 2H8VA 2OTGB 4YI8A 1CDLA 1FI6A 1SCVA 2F2PA 4OR9B 3I5GC 1WRKA 3VRPA 1TNPA 2MJWB 2M0RA 4GBAA 1S36A 1XK4C 1BU3A 1XK4A 5AFPA 2DOQA 3PLFB 1RJVA 3D77A 3EVRA 4DUQA 3WXAA 1OMRA 1J1DA 3K21A 2AUCA 2K61A 3A4UB 1A4PA 2QEVA 2KAVA 2BAPA 3CR5X 5EL2A 1XA5A 4MEWA 1IH0A 2KAXA 1DEKA 2RGIA 4WRIA 1QX2A 2JU0A 3DF0A 1KFUL 1TNXA 2L4HA 3SG2A 3HX4A 2BKHB 1Y1AA 1OMDA 1L7ZA 1QIVA 2LMTA 3DYEA 3SJSA 2LANA 3NSLA 3BOWA 1CNPA 2KLEA 2GGZA 4OKHA 3TDIA 3WHTB 1CKKA 3FE6A 3V2LA 1DQEA 1QX5B 4MZJA 1S6JA 5D69A 2F2OA 1FF1A 3BFAA 1PVBA 4GPLB 1NX2A 1KFXS 4JWQA 4USLA 1KWOB 5FI7A 1V1FA 1OZSA 5CSIA 1S3PA 2M3WA 2M8UA 2LNKA 2K7CA 3BJHA 3JVTB 4JQ0D 1AJ4A 1SL8A 2HQ8A 2WC8A 2WNDA 4M2PA 2ZN9A 3SS3A 1EG3A 5AERA 1G8IA 2I18A 3DY9A 4OCIA 1A03A 1PRWA 2WCBA 3BQ3A 1TUJA 1YRUB 4ETOA 2EC6C 2H2KA 3L4AA 2NCOA 3O6BA 3CGAA 1RECA 1PVAA 2HF5A 2KOTA 1QTXA 1DMOA 1FBVA 2L2CA 1KSOA 1CM1A 1RROA 1KSMA 2LHLA 3KF9A 1E8AA 5FI6A 2EHBA 2PRUA 4ORCB 1W7IB 5CSJA 2I2RE 4GNKB 2KLDA 1IIOA 2WOSA 4IJ7A 2FCDA 1NP8A 1OOIX 1QS7A 1K90D 2Y1MA 3GOFA 1YX8A 3DF0B 3LK1A 3N7HA 2L5YA 3DVEA 1IJ5A 3B6XA 3L47A 3VGOA 1BJFA 1PSBA 3FE9A 1IQ3A 3LLEA 1YURA 1PK0D 1HT9A 3TUYC 2GTEA 2K2FA 2BBMA 2L2EA 3E3RA 2B1UA 1NCXA 1SL9A 1F4QA 1KK8B 3HCMA 4P5OE 1KK7Y 2LE9B 3NSOA 4GFTA 5IBWA 2M29A 4YGBB 2LP3A 2LLUA 1MR8A 4MZLA 1K94A 2PQLA 1KK7Z 1B1GA 1CMFA 3BUNB 2SASA 1TTXA 1RFJA 2HQWA 4DIRA 2BNXA 5HKWA 2FJYA 2IS9A 2KFHA 1F70A 4N1GA 2KGRA 1NPQA 3TZ1A 3BUXB 1QJTA 3I5HC 2LVIA 3SIAA 3PM8A 1A75B 1SYMA 1YR5A 5HKZA 1OMVA 2Q4UA 1DC1A 1C3ZA 3AKBA 4YGEB 2KBIA 2FOTA 1XFZO 1BOCA 1DJXA 1PSRA 1UHHA 4NDCA 3S0AA 2BE6A 2LV7A 1QX7A 2EC6B 1R6PA 4YGAA 1DTLA 2M7LA 2ZRTA 2M1UA 3SS4A 3VRQA 1XFXO 1CB1A 1LS8A 3EVVA 1M45A 4FTGA 1WRLA 1QV0A 2QPTA 1ORGA 2NXQA 4INXA 1BR4B 4PHJA 1DF0B 5I2QA 1BODA 2LP2A 2R2IA 5DKRA 2LLTA 1SCMB 1QLSA 1XFWO 5D7FA 1N2DA 1WY9A 3IQOA 3NGVA 1KWOC 4C0JA 1ALWA 3PN7B 4ZCVA 1KCYA 1Y6WA 2Q91A 3S0FA 2Y5IA 3B7AA 1SKTA 1TCFA 2LMVA 3SG7A 4E68A 2KHNA 1S6CA 1CLBA 2LVKA 3OGNA 1OZOA 2O60A 1M63B 1OSAA 1UUSA 2KDHA 2LVJA 1XFYO 2H61C 3I5FC 3L4LA 1DJWA 2BCBA 3O4XA 4PE0A 1BR1B 2V53A 3K1EA 3SG4A 4NQGA 3TDUA 2M1KB 1GGWA 1S5GZ 4GGFA 3ZNIA 1KQMB 2WCFA 5J3XA 2HETA 1LA0A 1IGVA 5D3OA 4JKTA 2PVBA 4N5XA 1CLMA 1NX0A 1JFKA 2L51A 3BXKA 1GJYA 2BL0B 3R1OA 3EG5B 1OW4A 1NX3A 1FI5A 2ISDA 2MAZA 5JJGA 4BY5A 2LLSA 3DVKA 2QEBA 4UPGA 3WHUB 4CIDA 2L0PA 1SR6C 2LHIA 2WC6A 4GGNA 3TUYB 1SRAA 1NIWA 5CSFA 4NDBA 2M9GA 3Q8IA 1SMGA 3CLNA 3D73A 1UHKA 1QLKA 3BYAA 1CTRA 2K7DA 3RM1A 3DZTA 1M31A 1Y1XA 3PJIA 1QWVA 1TCOB 1ALVA 3IQQA 1J7RA 1AJ5A 4I5KA 3EK7A 1A2XA 3BFBA 3S0GA 2KSPA 3CDNA 3PFVA 3NXAA 5F6TA 5FI2A 3SG6A 1LA3A 2I94A 1YVHA 4MRXA 4WQ2A 4N1FA 3SIBA 3CYZA 2JZIA 4Q04A 4DCKA 1WDCC 5I2LA 1MUXA 1DGUA 2BBNA 3B87A 1A29A 2QACA 3OB1B 2KFGA 1TNQA 1NCYA 4AOMA 4PHNA 1SW8A 4XYNA 1AVSA 4R1EA 2M7NA 2K8MB 2LCPA 4MSPA 2JNFA 3BUMB 5CPVA 1MXEA 2JT3A 5PALA 4CPVA 5AEQA 4PALA 2NCPA 4JPZB 3VRNA 2WORA 3KEVA 4TNCA 1OOFA 2WCLA 5FYXA 4QJ4B 2BKIB 1QIWA 1IWQA 1TRFA 3CZ2A 1N0YA 2LMUA 2JPOA 2ZFDA 2L4IA 3FE8A 4MZKA 2G2BA 2PYQA 3LL8B 2M49B 4MBEA 1JF2A 2JRFA 3JVTC 1J55A 4GAOA 3TS5C 1LXFC 1CDMA 2JXCA 3D0YA 1BG1A 2PSRA 4HRGA 1G4YR 1UP5A 2FCEA 5GQQC 1BMOA 1L2OC 4MRYA 2JWWA 1SSEB 3TS5B 4F7FA 2LC5A 5ER5A 2E30A 3EKJA 4YGDB 5DKQA 2JT8A 4PDZA 2KAYA 3KO0A 2K7BA 1IQ5A 3BUWB 1OOHA 2WC5A 2YGUA 3RLZA 1KQVA 1F55A 2WCEA 2BCAA 3SG3A 3F45A 4L9MA 2CT9A 1QV1A 3VB1A 1TOPA 1C7WA 1RTP1 2KPHA
chains in the Genus database with same CATH topology
3R72A 3OGNA 2ERBA 3DYEA 3L4LA 1XFRA 3K1EA 3S0DA 3FE6A 3V2LA 1DQEA 3D76A 3CZ0A 4JD9A 4OZDA 2WCKA 3BFAA 2P71A 3D75A 3BJHA 1OOGA 2QEOA 3DY9A 3R1OA 1OW4A 1TUJA 3L4AA 3DXLA 2QEBA 3NHTA 2WC6A 2L2CA 3Q8IA 4INWA 3S0EA 3D73A 3DZTA 3PJIA 1QWVA 1TWOA 1OOIX 3N7HA 3B6XA 3L47A 4PT1A 3BFBA 3S0GA 3FE9A 3CDNA 3D74A 2GTEA 2WCJA 1GM0A 3QMEA 3CYZA 3D78A 3NHIA 3B87A 2WCMA 1C3YA 2PQLA 2QEHA 2QDIA 2FJYA 5DICA 1OOFA 2WCLA 3CZ1A 3RZSA 3CZ2A 2WCHA 3R1PA 1C3ZA 2P70A 3R1VA 2JPOA 1P28A 3S0BA 3B88A 3FE8A 3S0AA 3B86A 3BFHA 2H8VA 4FQTA 1LS8A 4F7FA 1ORGA 4INXA 3D77A 1OOHA 2WC5A 3NGVA 2QEVA 3CABA 3VB1A 5EL2A 1T14A 3S0FA 2KPHA 3B7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R72 A;  3OGN A;  2ERB A;  3DYE A;  3L4L A;  1XFR A;  3K1E A;  3S0D A;  3FE6 A;  3V2L A;  1DQE A;  3D76 A;  3CZ0 A;  4JD9 A;  4OZD A;  2WCK A;  3BFA A;  2P71 A;  3D75 A;  3BJH A;  1OOG A;  2QEO A;  3DY9 A;  3R1O A;  1OW4 A;  1TUJ A;  3L4A A;  3DXL A;  2QEB A;  3NHT A;  2WC6 A;  2L2C A;  3Q8I A;  4INW A;  3S0E A;  3D73 A;  3DZT A;  3PJI A;  1QWV A;  1TWO A;  1OOI X;  3N7H A;  3B6X A;  3L47 A;  4PT1 A;  3BFB A;  3S0G A;  3FE9 A;  3CDN A;  3D74 A;  2GTE A;  2WCJ A;  1GM0 A;  3QME A;  3CYZ A;  3D78 A;  3NHI A;  3B87 A;  2WCM A;  1C3Y A;  2PQL A;  2QEH A;  2QDI A;  2FJY A;  5DIC A;  1OOF A;  2WCL A;  3CZ1 A;  3RZS A;  3CZ2 A;  2WCH A;  3R1P A;  1C3Z A;  2P70 A;  3R1V A;  2JPO A;  1P28 A;  3S0B A;  3B88 A;  3FE8 A;  3S0A A;  3B86 A;  3BFH A;  2H8V A;  4FQT A;  1LS8 A;  4F7F A;  1ORG A;  4INX A;  3D77 A;  1OOH A;  2WC5 A;  3NGV A;  2QEV A;  3CAB A;  3VB1 A;  5EL2 A;  1T14 A;  3S0F A;  2KPH A;  3B7A A; 
#chains in the Genus database with same CATH topology
 2K60 A;  4HRE E;  1MWN A;  2JNX A;  1CLL A;  1XFR A;  2KBM A;  1BT6 A;  1DF0 A;  2KI4 B;  2MLE C;  2PAS A;  1ZUZ A;  1SBJ A;  4MN0 A;  1ZOT B;  1WRZ A;  1SL7 A;  2HPS A;  2KGB C;  1XFV O;  1YUT A;  2P71 A;  1B9A A;  5BPJ A;  1IJ6 A;  1R2U A;  2KI4 C;  3MSE B;  3I5I C;  5I8N A;  2F8P A;  3CWG A;  3D75 A;  2KQY A;  2JC2 A;  1W7J B;  1K9U A;  1JUO A;  2KFF A;  3UO9 A;  4BY4 A;  2K0J A;  1NYA A;  2L50 A;  2PMY A;  1SK6 D;  1NWD A;  1SNL A;  3D0Y B;  4YBH B;  2M97 A;  2JXL A;  1Y1U A;  5HKY A;  3SS5 A;  3O4Y A;  3DVJ A;  3DXL A;  4ICB A;  1PAL A;  5HLV A;  1LIN A;  4AQJ A;  2JOJ A;  4I5J A;  2KQ6 A;  1OE9 B;  3VRO A;  2GV5 A;  4AQI A;  3FS7 A;  1NSH A;  2KNE A;  4INW A;  3S0E A;  1JSA A;  4I5N B;  4D1E A;  3BUO B;  4OV2 A;  1JC2 A;  1OQP A;  1RK9 A;  1IRJ A;  1J7P A;  1XO5 A;  3EK8 A;  1TN4 A;  1YUU A;  1TWO A;  2ZRS A;  4P2Y B;  4XJK B;  1CFD A;  1EL4 A;  1VRK A;  2G9B A;  3CZT X;  4CFQ A;  2OPO A;  5KU1 A;  1DT7 B;  1QXP A;  1DJY A;  4PT1 A;  1KFX L;  1S5G Y;  2KYF A;  1W9Z A;  1YVL A;  5TNC A;  4C0L A;  1F4O A;  5HYD A;  1NUB A;  1YUS A;  2LUC A;  1ZFS A;  1B8L A;  2MRD A;  2Y1N A;  1GM0 A;  5KTY A;  1WLZ A;  1WDC B;  2NLN A;  2Y4Q A;  3D78 A;  1SCM C;  3NHI A;  4GUK A;  4YGC B;  2JTT A;  1K93 D;  5AXI A;  1HQV A;  1QAT A;  3PN7 C;  3FWC A;  1C3Y A;  3EK4 A;  2MBX A;  2LAP A;  2F3Z A;  3CTN A;  2QEH A;  3KHE A;  1QVI Y;  1AK8 A;  2VRG A;  1C07 A;  1AUI B;  2BEC A;  2ZNE A;  1C7V A;  3PM2 A;  3EVU A;  2H61 A;  2MA2 A;  2NZ0 A;  4HRH A;  1QAS A;  1AP4 A;  4WQ3 A;  3C1V A;  2I7A A;  3FWB A;  3EKH A;  1M39 A;  1XFU O;  2JTZ A;  4OVN F;  3OB2 B;  1CMG A;  1DVI A;  4I5L B;  2ZN8 A;  3OX5 A;  3GK4 X;  1A75 A;  1Z4H A;  4A4C A;  1G33 A;  3AAK A;  2P70 A;  4ORA B;  2MHH A;  3D10 A;  1P28 A;  1NX1 A;  1UUR A;  3B88 A;  2CBL A;  3DD4 A;  1N65 A;  4CFR A;  3B86 A;  3H4S E;  2PAL A;  4FQT A;  1NCZ A;  1YTZ C;  3A8R A;  4MVF A;  1J7Q A;  1L2O B;  3LCP C;  1S1E A;  2L5X B;  1CDP A;  2CNP A;  1BF5 A;  1H8B A;  2P6B B;  4PCW A;  1TUZ A;  1UHI A;  4PE4 A;  3PAT A;  4IL1 A;  4ORB B;  2SCP A;  3CR2 A;  1YX7 A;  1GQM A;  3JTD C;  2L98 A;  2CCM A;  1JWD A;  2LUX A;  1JF0 A;  3CAB A;  5K89 A;  5ER4 X;  1T14 A;  2E6W A;  1Y0V H;  2A4J A;  4KYN A;  3SG5 A;  5HLO A;  1H4B A;  3O2P A;  2JT0 A;  1AHR A;  3ZWH A;  3R72 A;  3AAJ A;  2ERB A;  3IVT A;  1B7T Y;  4YRU A;  3GK1 A;  4MLW A;  4PHM A;  1EJ3 A;  1LVC D;  2EGD A;  1D1O A;  1XVJ A;  1MXL C;  4DRW A;  1UHJ A;  3S0D A;  5HL1 A;  5JOL A;  3D76 A;  3CZ0 A;  3I5H B;  1DJI A;  4DS7 A;  1IG5 A;  5G08 A;  4JD9 A;  1UHN A;  4OZD A;  2WCK A;  1K8U A;  1BLQ A;  3JTD B;  1J1E A;  3I5I B;  1CM4 A;  1B7T Z;  1EG4 A;  4QJ3 B;  1OOG A;  1KFU S;  1K9P A;  1F54 A;  1K9K A;  3WNX B;  1GGZ A;  1Z2C B;  1ZMZ A;  2MLF C;  2QEO A;  1DJZ A;  3CS1 A;  1B47 A;  3M0W A;  1EH2 A;  4QJ5 B;  4ZCU A;  1MQ1 A;  2ZKM X;  5I2O A;  3OP0 A;  1J7O A;  3OBV A;  3BOW B;  1IKU A;  3KPX A;  3NHT A;  2BE4 A;  2AMI A;  4PHK A;  1U5I A;  4C0K A;  1CFP A;  5B8I B;  3PSR A;  4PE7 A;  1DGV A;  4CLN A;  5KSZ A;  1K96 A;  2CTN A;  2JQ6 A;  3CR4 X;  4PE1 A;  1U5I B;  2F3Y A;  1WLM A;  1DJH A;  4M2O A;  1K2H A;  1B8C A;  1EXR A;  4M2Q A;  1YRT B;  1S6I A;  1X02 A;  1Q80 A;  2CXJ A;  3GK2 A;  3LK0 A;  3I5F B;  1S26 D;  3TDZ A;  1FW4 A;  1TIZ A;  1B8R A;  1PUL A;  3O78 A;  1RWY A;  5I94 A;  2JUL A;  2ZND A;  4NDD A;  2KI6 D;  2COL B;  2LVV A;  1DEL A;  4F0Z B;  1FPW A;  2K2A A;  1JFJ A;  4A4B A;  4HSZ A;  3DVM A;  3D74 A;  4GGF C;  2D8N A;  1DJG A;  2WCJ A;  2OS8 B;  5AAN A;  1XYD A;  3UNW A;  2KYC A;  3QME A;  1KQM C;  5CSN A;  1MF8 B;  2LM5 A;  1QVI Z;  5DKN A;  1MHO A;  2K7O A;  2BCX A;  1V1G A;  1K95 A;  2GGM A;  2O5G A;  2OS8 C;  2BL0 C;  2WCM A;  1F71 A;  2OTG C;  1JBA A;  1CDN A;  1LKJ A;  4U8D A;  2F33 A;  1ODB A;  3QRX A;  1M46 A;  2QDI A;  1SR6 B;  1ZAC A;  2FJU B;  3AKA A;  5DIC A;  3NSI A;  1TNW A;  1F8H A;  1CFF A;  3CZ1 A;  2AAO A;  3OX6 A;  3ICB A;  3RZS A;  1SPY A;  1CFC A;  1KK8 C;  1OOJ A;  2KI6 C;  2WCH A;  3NSK A;  4YI9 A;  3VRR A;  1B4C A;  3R1P A;  1UWO A;  3R1V A;  2TN4 A;  3I5G B;  3S0B A;  3OHM B;  4FQO A;  2JPT A;  3IF7 A;  1SY9 A;  3FIA A;  3PAL A;  3BFH A;  4XJK A;  2H8V A;  2OTG B;  4YI8 A;  1CDL A;  1FI6 A;  1SCV A;  2F2P A;  4OR9 B;  3I5G C;  1WRK A;  3VRP A;  1TNP A;  2MJW B;  2M0R A;  4GBA A;  1S36 A;  1XK4 C;  1BU3 A;  1XK4 A;  5AFP A;  2DOQ A;  3PLF B;  1RJV A;  3D77 A;  3EVR A;  4DUQ A;  3WXA A;  1OMR A;  1J1D A;  3K21 A;  2AUC A;  2K61 A;  3A4U B;  1A4P A;  2QEV A;  2KAV A;  2BAP A;  3CR5 X;  5EL2 A;  1XA5 A;  4MEW A;  1IH0 A;  2KAX A;  1DEK A;  2RGI A;  4WRI A;  1QX2 A;  2JU0 A;  3DF0 A;  1KFU L;  1TNX A;  2L4H A;  3SG2 A;  3HX4 A;  2BKH B;  1Y1A A;  1OMD A;  1L7Z A;  1QIV A;  2LMT A;  3DYE A;  3SJS A;  2LAN A;  3NSL A;  3BOW A;  1CNP A;  2KLE A;  2GGZ A;  4OKH A;  3TDI A;  3WHT B;  1CKK A;  3FE6 A;  3V2L A;  1DQE A;  1QX5 B;  4MZJ A;  1S6J A;  5D69 A;  2F2O A;  1FF1 A;  3BFA A;  1PVB A;  4GPL B;  1NX2 A;  1KFX S;  4JWQ A;  4USL A;  1KWO B;  5FI7 A;  1V1F A;  1OZS A;  5CSI A;  1S3P A;  2M3W A;  2M8U A;  2LNK A;  2K7C A;  3BJH A;  3JVT B;  4JQ0 D;  1AJ4 A;  1SL8 A;  2HQ8 A;  2WC8 A;  2WND A;  4M2P A;  2ZN9 A;  3SS3 A;  1EG3 A;  5AER A;  1G8I A;  2I18 A;  3DY9 A;  4OCI A;  1A03 A;  1PRW A;  2WCB A;  3BQ3 A;  1TUJ A;  1YRU B;  4ETO A;  2EC6 C;  2H2K A;  3L4A A;  2NCO A;  3O6B A;  3CGA A;  1REC A;  1PVA A;  2HF5 A;  2KOT A;  1QTX A;  1DMO A;  1FBV A;  2L2C A;  1KSO A;  1CM1 A;  1RRO A;  1KSM A;  2LHL A;  3KF9 A;  1E8A A;  5FI6 A;  2EHB A;  2PRU A;  4ORC B;  1W7I B;  5CSJ A;  2I2R E;  4GNK B;  2KLD A;  1IIO A;  2WOS A;  4IJ7 A;  2FCD A;  1NP8 A;  1OOI X;  1QS7 A;  1K90 D;  2Y1M A;  3GOF A;  1YX8 A;  3DF0 B;  3LK1 A;  3N7H A;  2L5Y A;  3DVE A;  1IJ5 A;  3B6X A;  3L47 A;  3VGO A;  1BJF A;  1PSB A;  3FE9 A;  1IQ3 A;  3LLE A;  1YUR A;  1PK0 D;  1HT9 A;  3TUY C;  2GTE A;  2K2F A;  2BBM A;  2L2E A;  3E3R A;  2B1U A;  1NCX A;  1SL9 A;  1F4Q A;  1KK8 B;  3HCM A;  4P5O E;  1KK7 Y;  2LE9 B;  3NSO A;  4GFT A;  5IBW A;  2M29 A;  4YGB B;  2LP3 A;  2LLU A;  1MR8 A;  4MZL A;  1K94 A;  2PQL A;  1KK7 Z;  1B1G A;  1CMF A;  3BUN B;  2SAS A;  1TTX A;  1RFJ A;  2HQW A;  4DIR A;  2BNX A;  5HKW A;  2FJY A;  2IS9 A;  2KFH A;  1F70 A;  4N1G A;  2KGR A;  1NPQ A;  3TZ1 A;  3BUX B;  1QJT A;  3I5H C;  2LVI A;  3SIA A;  3PM8 A;  1A75 B;  1SYM A;  1YR5 A;  5HKZ A;  1OMV A;  2Q4U A;  1DC1 A;  1C3Z A;  3AKB A;  4YGE B;  2KBI A;  2FOT A;  1XFZ O;  1BOC A;  1DJX A;  1PSR A;  1UHH A;  4NDC A;  3S0A A;  2BE6 A;  2LV7 A;  1QX7 A;  2EC6 B;  1R6P A;  4YGA A;  1DTL A;  2M7L A;  2ZRT A;  2M1U A;  3SS4 A;  3VRQ A;  1XFX O;  1CB1 A;  1LS8 A;  3EVV A;  1M45 A;  4FTG A;  1WRL A;  1QV0 A;  2QPT A;  1ORG A;  2NXQ A;  4INX A;  1BR4 B;  4PHJ A;  1DF0 B;  5I2Q A;  1BOD A;  2LP2 A;  2R2I A;  5DKR A;  2LLT A;  1SCM B;  1QLS A;  1XFW O;  5D7F A;  1N2D A;  1WY9 A;  3IQO A;  3NGV A;  1KWO C;  4C0J A;  1ALW A;  3PN7 B;  4ZCV A;  1KCY A;  1Y6W A;  2Q91 A;  3S0F A;  2Y5I A;  3B7A A;  1SKT A;  1TCF A;  2LMV A;  3SG7 A;  4E68 A;  2KHN A;  1S6C A;  1CLB A;  2LVK A;  3OGN A;  1OZO A;  2O60 A;  1M63 B;  1OSA A;  1UUS A;  2KDH A;  2LVJ A;  1XFY O;  2H61 C;  3I5F C;  3L4L A;  1DJW A;  2BCB A;  3O4X A;  4PE0 A;  1BR1 B;  2V53 A;  3K1E A;  3SG4 A;  4NQG A;  3TDU A;  2M1K B;  1GGW A;  1S5G Z;  4GGF A;  3ZNI A;  1KQM B;  2WCF A;  5J3X A;  2HET A;  1LA0 A;  1IGV A;  5D3O A;  4JKT A;  2PVB A;  4N5X A;  1CLM A;  1NX0 A;  1JFK A;  2L51 A;  3BXK A;  1GJY A;  2BL0 B;  3R1O A;  3EG5 B;  1OW4 A;  1NX3 A;  1FI5 A;  2ISD A;  2MAZ A;  5JJG A;  4BY5 A;  2LLS A;  3DVK A;  2QEB A;  4UPG A;  3WHU B;  4CID A;  2L0P A;  1SR6 C;  2LHI A;  2WC6 A;  4GGN A;  3TUY B;  1SRA A;  1NIW A;  5CSF A;  4NDB A;  2M9G A;  3Q8I A;  1SMG A;  3CLN A;  3D73 A;  1UHK A;  1QLK A;  3BYA A;  1CTR A;  2K7D A;  3RM1 A;  3DZT A;  1M31 A;  1Y1X A;  3PJI A;  1QWV A;  1TCO B;  1ALV A;  3IQQ A;  1J7R A;  1AJ5 A;  4I5K A;  3EK7 A;  1A2X A;  3BFB A;  3S0G A;  2KSP A;  3CDN A;  3PFV A;  3NXA A;  5F6T A;  5FI2 A;  3SG6 A;  1LA3 A;  2I94 A;  1YVH A;  4MRX A;  4WQ2 A;  4N1F A;  3SIB A;  3CYZ A;  2JZI A;  4Q04 A;  4DCK A;  1WDC C;  5I2L A;  1MUX A;  1DGU A;  2BBN A;  3B87 A;  1A29 A;  2QAC A;  3OB1 B;  2KFG A;  1TNQ A;  1NCY A;  4AOM A;  4PHN A;  1SW8 A;  4XYN A;  1AVS A;  4R1E A;  2M7N A;  2K8M B;  2LCP A;  4MSP A;  2JNF A;  3BUM B;  5CPV A;  1MXE A;  2JT3 A;  5PAL A;  4CPV A;  5AEQ A;  4PAL A;  2NCP A;  4JPZ B;  3VRN A;  2WOR A;  3KEV A;  4TNC A;  1OOF A;  2WCL A;  5FYX A;  4QJ4 B;  2BKI B;  1QIW A;  1IWQ A;  1TRF A;  3CZ2 A;  1N0Y A;  2LMU A;  2JPO A;  2ZFD A;  2L4I A;  3FE8 A;  4MZK A;  2G2B A;  2PYQ A;  3LL8 B;  2M49 B;  4MBE A;  1JF2 A;  2JRF A;  3JVT C;  1J55 A;  4GAO A;  3TS5 C;  1LXF C;  1CDM A;  2JXC A;  3D0Y A;  1BG1 A;  2PSR A;  4HRG A;  1G4Y R;  1UP5 A;  2FCE A;  5GQQ C;  1BMO A;  1L2O C;  4MRY A;  2JWW A;  1SSE B;  3TS5 B;  4F7F A;  2LC5 A;  5ER5 A;  2E30 A;  3EKJ A;  4YGD B;  5DKQ A;  2JT8 A;  4PDZ A;  2KAY A;  3KO0 A;  2K7B A;  1IQ5 A;  3BUW B;  1OOH A;  2WC5 A;  2YGU A;  3RLZ A;  1KQV A;  1F55 A;  2WCE A;  2BCA A;  3SG3 A;  3F45 A;  4L9M A;  2CT9 A;  1QV1 A;  3VB1 A;  1TOP A;  1C7W A;  1RTP 1;  2KPH A; 
#chains in the Genus database with same CATH homology
 3R72 A;  3OGN A;  2ERB A;  3DYE A;  3L4L A;  1XFR A;  3K1E A;  3S0D A;  3FE6 A;  3V2L A;  1DQE A;  3D76 A;  3CZ0 A;  4JD9 A;  4OZD A;  2WCK A;  3BFA A;  2P71 A;  3D75 A;  3BJH A;  1OOG A;  2QEO A;  3DY9 A;  3R1O A;  1OW4 A;  1TUJ A;  3L4A A;  3DXL A;  2QEB A;  3NHT A;  2WC6 A;  2L2C A;  3Q8I A;  4INW A;  3S0E A;  3D73 A;  3DZT A;  3PJI A;  1QWV A;  1TWO A;  1OOI X;  3N7H A;  3B6X A;  3L47 A;  4PT1 A;  3BFB A;  3S0G A;  3FE9 A;  3CDN A;  3D74 A;  2GTE A;  2WCJ A;  1GM0 A;  3QME A;  3CYZ A;  3D78 A;  3NHI A;  3B87 A;  2WCM A;  1C3Y A;  2PQL A;  2QEH A;  2QDI A;  2FJY A;  5DIC A;  1OOF A;  2WCL A;  3CZ1 A;  3RZS A;  3CZ2 A;  2WCH A;  3R1P A;  1C3Z A;  2P70 A;  3R1V A;  2JPO A;  1P28 A;  3S0B A;  3B88 A;  3FE8 A;  3S0A A;  3B86 A;  3BFH A;  2H8V A;  4FQT A;  1LS8 A;  4F7F A;  1ORG A;  4INX A;  3D77 A;  1OOH A;  2WC5 A;  3NGV A;  2QEV A;  3CAB A;  3VB1 A;  5EL2 A;  1T14 A;  3S0F A;  2KPH A;  3B7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...