2WCHA

Structure of bmori gobp2 (general odorant binding protein 2) with bombykal
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
141
structure length
141
Chain Sequence
b'TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 54
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wchA00
2WCMA 3QMEA 3CZ2A 4JD9A 2QEBA 3S0GA 3BFHA 3D74A 2ERBA 3S0DA 2WC5A 3CDNA 3DZTA 3S0AA 3RZSA 3NGVA 1TWOA 1P28A 3R72A 3Q8IA 1TUJA 1GM0A 4PT1A 3K1EA 1QWVA 3DYEA 3DXLA 3B87A 2WCLA 1XFRA 2L2CA 3D78A 2H8VA 3B7AA 3R1OA 1OOFA 3NHTA 3B86A 4INWA 3B6XA 3R1VA 3S0FA 2GTEA 3D77A 1DQEA 2WCKA 1OOIX 2P70A 3BFBA 3OGNA 2WCJA 2PQLA 3VB1A 3BJHA 3BFAA 1C3YA 2QEVA 1OW4A 3D75A 1OOGA 3L4LA 1T14A 4FQTA 3PJIA 4INXA 1ORGA 2KPHA 4OZDA 3CABA 3N7HA 2QDIA 2JPOA 2P71A 3FE8A 3S0BA 3CYZA 3V2LA 3CZ1A 3D76A 5EL2A 3L4AA 3NHIA 5DICA 3S0EA 2QEHA 4F7FA 3D73A 1LS8A 3FE6A 3L47A 2WC6A 2WCHA 3CZ0A 1C3ZA 3B88A 3FE9A 3DY9A 2FJYA 2QEOA 1OOHA 3R1PA
chains in the Genus database with same CATH superfamily
4OKHA 2JT3A 2M29A 3S0GA 1UHKA 4KYNA 1C7VA 1CFFA 2B1UA 1CM4A 4QJ5B 1YRTB 2OS8B 1PRWA 3E3RA 4I5NB 4PE0A 1QJTA 3S0DA 1LVCD 1WDCC 4NDBA 2BKIB 1ZACA 3NGVA 1TUZA 1LINA 1JFKA 1N2DA 3DVKA 1P28A 1BMOA 1F55A 3PALA 2L2EA 3OX6A 4CLNA 2EC6B 3KF9A 3EKJA 1MXLC 2QPTA 2Y5IA 3WHTB 1RROA 1TOPA 1R2UA 2F33A 4DCKA 3K1EA 4GGFC 1RK9A 1Y0VH 5I94A 1M45A 2ZNDA 2KBIA 4YGCB 1TNWA 2KFFA 5I8NA 1WY9A 1M63B 2Y4QA 1K96A 2HETA 2KYCA 1DJZA 1M31A 2JOJA 5FI2A 3B7AA 1OOFA 3KHEA 2KAYA 1B4CA 1K90D 3PATA 1D1OA 1HQVA 1SL8A 2F3YA 2L5YA 3SG4A 2BCAA 4HREE 2JTTA 3I5GB 1YVLA 5KSZA 3B86A 1YURA 2KGRA 1RTP1 2KSPA 2F2PA 2KHNA 1L2OC 1B9AA 4D1EA 1CFDA 2CTNA 1KFUS 1J1DA 1K9UA 2Q4UA 3OB1B 2JT0A 2LP3A 1QX2A 1J7PA 1UURA 1MHOA 3CWGA 1EXRA 5HLVA 3GK2A 1AUIB 3O4XA 1F8HA 1SCMC 3BJHA 1XYDA 1IGVA 1CLBA 4ORAB 4GPLB 1WRKA 2JXLA 1K94A 3D10A 1LKJA 2CBLA 4P5OE 3IF7A 3I5HB 4HSZA 3NXAA 1RECA 2TN4A 2K61A 2K2FA 3TDUA 5CSNA 4QJ4B 2LVKA 4FQTA 2BL0B 1UHNA 3PJIA 2ZRTA 3SS5A 2JQ6A 2Y1NA 1CTRA 1WLZA 1TIZA 2OS8C 1NX3A 3GOFA 1QVIY 4MLWA 1TRFA 2KAVA 3SS3A 4PDZA 4WQ3A 2JPOA 2CCMA 1JBAA 2ZN9A 2L51A 3AKBA 4MEWA 2EC6C 3I5IC 2KNEA 1IRJA 3CLNA 1IJ6A 1NCZA 2G9BA 3EK7A 5D3OA 1XFUO 4AQJA 2I94A 1SMGA 2JXCA 2M7LA 2JPTA 4XJKB 1JF2A 4GGNA 1IIOA 1G4YR 1CMFA 1XK4A 2M3WA 2K8MB 3L47A 1TCOB 1C3ZA 3B88A 3FE9A 1SBJA 3H4SE 2M49B 1NUBA 1DF0A 2BE4A 1SRAA 5HL1A 1XFWO 4N1FA 4NDCA 1ZUZA 4WQ2A 3DY9A 4BY4A 3I5GC 1K8UA 3KO0A 4ZCVA 4CFQA 2LVJA 3LLEA 3SG5A 2KFHA 5HKYA 2KI6D 2LNKA 3R1PA 2WCMA 1S6IA 3CZ2A 1B8RA 3UNWA 1J7OA 4Q04A 3F45A 3D74A 4ZCUA 3SJSA 2O60A 4IL1A 2NCPA 2WC5A 3CDNA 2SCPA 1DVIA 3EVRA 3IQOA 3OB2B 1YVHA 1SYMA 2LMUA 3I5HC 1BOCA 5IBWA 3Q8IA 4DIRA 1DT7B 3AAJA 1IKUA 4F0ZB 1PULA 1S3PA 1SCVA 4I5KA 2M97A 2BL0C 1SCMB 5FYXA 3SIBA 1Z4HA 2MRDA 1DMOA 1S26D 3BUOB 1B8CA 2ZKMX 5TNCA 1TNQA 2BCXA 3A8RA 3DYEA 4UPGA 4XYNA 2PALA 1JSAA 3DF0B 3VROA 4YGBB 5PALA 1F4QA 1CMGA 1NYAA 1K93D 3HX4A 4ORBB 3D0YB 1BLQA 1OZOA 2H2KA 3AAKA 4MSPA 2F2OA 2H8VA 1TN4A 2KLEA 3R1OA 2I2RE 5CSFA 1AJ4A 1AHRA 1GQMA 3LK1A 3PLFB 1AK8A 2OTGC 4MBEA 3SG6A 2KQ6A 1NX2A 2BNXA 2LHLA 1B7TY 2L4HA 3NSIA 1KQMB 1L7ZA 1OZSA 4INWA 1U5IB 3QRXA 2M8UA 1F71A 1PVAA 3I5IB 1MR8A 5DKQA 1K95A 4HRGA 1YRUB 1QTXA 2LLTA 4WRIA 1QX5B 1DTLA 1OOIX 1PSBA 1XFXO 2MLFC 5J3XA 1A75A 3GK4X 1C3YA 4U8DA 4GGFA 2F3ZA 3TS5B 2PMYA 1DEKA 1CLLA 1AVSA 1QLKA 4ETOA 2KYFA 2QEVA 1OW4A 1X02A 1QVIZ 1QV0A 3BOWA 1JUOA 1K2HA 4YGDB 4FTGA 1OQPA 1CFPA 3DVMA 2CT9A 4MRXA 2BBNA 2MJWB 2EGDA 2WCEA 4OCIA 1SR6B 1HT9A 3CABA 5HKZA 1YTZC 1IQ3A 5HKWA 2K7OA 1B1GA 1FI6A 1G8IA 2KFGA 3JTDC 3OP0A 1C7WA 1G33A 2KQYA 2R2IA 4GUKA 1Y1UA 3BUWB 3FE8A 5CSIA 1SL9A 3LCPC 3S0BA 1RJVA 1F70A 3V2LA 3O6BA 1JFJA 1LA0A 1EL4A 3VRRA 1DJWA 1NSHA 1RWYA 2K7DA 1QLSA 3ZNIA 5DICA 2JWWA 1GGZA 2QEHA 5I2QA 2BBMA 3RM1A 2OPOA 5AFPA 4MN0A 2I18A 1V1FA 1N65A 1PALA 3CS1A 1ZMZA 1IJ5A 1ALVA 2K60A 3CZ0A 1DC1A 4A4BA 2Y1MA 5D69A 1XFVO 4YRUA 1E8AA 1KK7Y 2VRGA 4C0LA 2H61A 2K7CA 1MWNA 1Y1AA 1OMRA 4I5JA 1BODA 2L4IA 1TNPA 3TDZA 1SY9A 2QEOA 1KQMC 4GBAA 1UP5A 2LVVA 4ICBA 1YX7A 5D7FA 1CDLA 2NLNA 1XFYO 3GK1A 4JD9A 3JVTB 1CDNA 2LE9B 2QEBA 4YI9A 2OTGB 2YGUA 1K9KA 3BFHA 4GAOA 3SG7A 2ERBA 2V53A 1WRLA 1KSOA 1CDMA 1LXFC 4PE4A 3PM8A 1UHJA 4YI8A 2MA2A 5GQQC 3S0AA 3TS5C 4ORCB 3RZSA 1MUXA 4MZKA 4GNKB 4PCWA 3VRQA 4CIDA 2G2BA 2LC5A 3EVUA 1A2XA 3R72A 4PHMA 3FWBA 1J7QA 5G08A 2K7BA 1TUJA 1IWQA 1YUSA 2LHIA 3KPXA 2PSRA 1QASA 1BT6A 2RGIA 1CDPA 3MSEB 3WXAA 1W7IB 4YGEB 2IS9A 1SR6C 3PSRA 5I2OA 1DJGA 1BR1B 2K2AA 3O2PA 2GV5A 2HQ8A 2LVIA 1TNXA 3DXLA 4FQOA 4M2OA 1UHIA 3B87A 1XA5A 2KOTA 5CSJA 2WCLA 1XFRA 1B7TZ 1DGVA 1DGUA 1DJIA 1GJYA 1KWOC 1R6PA 2KGBC 3I5FB 5KTYA 1VRKA 1YR5A 3NHTA 3VGOA 4NQGA 4AQIA 1PVBA 2HF5A 3BUNB 5ER4X 4DS7A 1C07A 1S6JA 3BQ3A 3JTDB 2M9GA 2GGZA 2FCEA 1DJHA 1DJYA 3WNXB 2MLEC 1AJ5A 3CR5X 4R1EA 2O5GA 2Q91A 1OSAA 2HQWA 3SG3A 3ZWHA 5K89A 1H4BA 2LP2A 1KSMA 2ZFDA 1LA3A 2GTEA 3SG2A 3DD4A 1CLMA 1CM1A 1UHHA 3D77A 1B8LA 2P70A 3OGNA 1MXEA 2WORA 3BFAA 4NDDA 3EG5B 1S5GY 3HCMA 1M46A 1CNPA 1SK6D 4JPZB 1A03A 5AXIA 1QX7A 2JU0A 2ZNEA 3BUMB 3EK8A 2GGMA 2M7NA 2DOQA 2L5XB 3CGAA 3LL8B 4DUQA 1JC2A 1YUUA 2COLB 4PHNA 1NPQA 1TCFA 1NX0A 1T14A 2M1UA 4DRWA 1BF5A 3JVTC 1BJFA 1SW8A 5DKNA 1M39A 3PN7B 2KPHA 4OZDA 1FF1A 1IQ5A 1NCYA 3N7HA 1PK0D 1SKTA 1JWDA 2QDIA 4XJKA 2ZN8A 1RFJA 2FJUB 3CYZA 3IQQA 2K0JA 2JULA 2KDHA 3CZ1A 3FIAA 3D76A 5EL2A 1KCYA 1S36A 3KEVA 1NIWA 2L50A 1B47A 3TZ1A 5I2LA 3TUYC 2WC8A 3OHMB 3CTNA 1BR4B 4USLA 2CXJA 4IJ7A 1KK7Z 1YX8A 4P2YB 1NP8A 1FI5A 1CFCA 5ER5A 2NCOA 1LS8A 3FE6A 1YUTA 1QIVA 2WC6A 2WCHA 4YGAA 2P6BB 3I5FC 3ICBA 2LM5A 4OVNF 1S1EA 2BAPA 1XO5A 4L9MA 2LMVA 4M2PA 4N5XA 5BPJA 1KFXL 4C0JA 2KLDA 1EG3A 3CR4X 5AANA 2I7AA 2JNXA 2KI4B 3NSKA 5HYDA 2LANA 1KFXS 2FJYA 1EJ3A 1KWOB 1NWDA 1KQVA 2LMTA 1OOHA 3C1VA 1UWOA 2BECA 2QACA 3O78A 1J7RA 1OMVA 3QMEA 1WLMA 1W7JB 3K21A 1DF0B 3VRPA 1QV1A 4PHJA 1N0YA 3IVTA 3DZTA 3OX5A 1NCXA 2LAPA 2WOSA 3DVJA 1WRZA 4M2QA 5AEQA 4MZLA 4AOMA 1TWOA 2ZRSA 3DF0A 1KFUL 2JRFA 2M1KB 3A4UB 1GM0A 3D0YA 2M0RA 3PFVA 4PT1A 5JJGA 5B8IB 2NZ0A 3DVEA 1EH2A 1KK8B 1ZFSA 3EKHA 3EVVA 1F4OA 1MQ1A 1Q80A 2AUCA 3PN7C 3UO9A 4A4CA 1Y6WA 1FW4A 1QWVA 2JC2A 3NSLA 4N1GA 2AMIA 1FPWA 1SSEB 5HLOA 1JF0A 2JT8A 1U5IA 2PYQA 4TNCA 1SNLA 2L2CA 2HPSA 3D78A 1NX1A 3VRNA 2BCBA 5JOLA 5FI7A 1QIWA 2WNDA 1QATA 1OMDA 2H61C 4BY5A 1SPYA 3M0WA 4I5LB 1OE9B 1TTXA 1BU3A 1QS7A 1V1GA 1W9ZA 2A4JA 4JWQA 2MBXA 4CFRA 3B6XA 2PRUA 2JZIA 4CPVA 2KBMA 4OR9B 1S5GZ 1UUSA 2MAZA 3CR2A 2NXQA 1OOJA 1F54A 3R1VA 1EG4A 3S0FA 2AAOA 3BXKA 4JQ0D 2LUXA 2D8NA 5F6TA 2LLSA 1DQEA 2WCKA 3TUYB 2PVBA 3BFBA 4QJ3B 2WCJA 5AERA 2PQLA 4MVFA 3VB1A 3WHUB 3SS4A 1WDCB 3FWCA 2KI6C 3PM2A 2KI4C 1S6CA 2E30A 3D75A 1H8BA 2JNFA 1DELA 1XK4C 1OOGA 4YBHB 3L4LA 4HRHA 1DJXA 1IH0A 3CZTX 4INXA 2WCBA 4MRYA 1ORGA 1A75B 2PASA 2WCFA 1GGWA 3OBVA 2CNPA 4OV2A 2JTZA 1A4PA 3LK0A 2LUCA 1XVJA 1XFZO 3BOWB 3O4YA 2MHHA 2P71A 1PSRA 2L0PA 3TDIA 3BUXB 2SASA 1CB1A 3L4AA 3SIAA 1KK8C 3NHIA 1ODBA 2FOTA 4MZJA 3S0EA 1CKKA 2EHBA 3NSOA 1SL7A 4C0KA 4F7FA 3FS7A 1IG5A 2BKHB 1L2OB 3D73A 1Z2CB 4E68A 2LCPA 1MF8B 2ISDA 5KU1A 2L98A 2FCDA 1FBVA 3AKAA 5DKRA 5CPVA 1BG1A 4JKTA 1A29A 1Y1XA 1J55A 2LLUA 2F8PA 3BYAA 2BE6A 2LV7A 1J1EA 1ZOTB 1K9PA 2E6WA 3EK4A 3RLZA 4PHKA 4GFTA 1QXPA 4PE7A 2KAXA 1ALWA 4PE1A 5FI6A 1AP4A 4PALA
chains in the Genus database with same CATH topology
2WCMA 3QMEA 3CZ2A 4JD9A 2QEBA 3S0GA 3BFHA 3D74A 2ERBA 3S0DA 2WC5A 3CDNA 3DZTA 3S0AA 3RZSA 3NGVA 1TWOA 1P28A 3R72A 3Q8IA 1TUJA 1GM0A 4PT1A 3K1EA 1QWVA 3DYEA 3DXLA 3B87A 2WCLA 1XFRA 2L2CA 3D78A 2H8VA 3B7AA 3R1OA 1OOFA 3NHTA 3B86A 4INWA 3B6XA 3R1VA 3S0FA 2GTEA 3D77A 1DQEA 2WCKA 1OOIX 2P70A 3BFBA 3OGNA 2WCJA 2PQLA 3VB1A 3BJHA 3BFAA 1C3YA 2QEVA 1OW4A 3D75A 1OOGA 3L4LA 1T14A 4FQTA 3PJIA 4INXA 1ORGA 2KPHA 4OZDA 3CABA 3N7HA 2QDIA 2JPOA 2P71A 3FE8A 3S0BA 3CYZA 3V2LA 3CZ1A 3D76A 5EL2A 3L4AA 3NHIA 5DICA 3S0EA 2QEHA 4F7FA 3D73A 1LS8A 3FE6A 3L47A 2WC6A 2WCHA 3CZ0A 1C3ZA 3B88A 3FE9A 3DY9A 2FJYA 2QEOA 1OOHA 3R1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCM A;  3QME A;  3CZ2 A;  4JD9 A;  2QEB A;  3S0G A;  3BFH A;  3D74 A;  2ERB A;  3S0D A;  2WC5 A;  3CDN A;  3DZT A;  3S0A A;  3RZS A;  3NGV A;  1TWO A;  1P28 A;  3R72 A;  3Q8I A;  1TUJ A;  1GM0 A;  4PT1 A;  3K1E A;  1QWV A;  3DYE A;  3DXL A;  3B87 A;  2WCL A;  1XFR A;  2L2C A;  3D78 A;  2H8V A;  3B7A A;  3R1O A;  1OOF A;  3NHT A;  3B86 A;  4INW A;  3B6X A;  3R1V A;  3S0F A;  2GTE A;  3D77 A;  1DQE A;  2WCK A;  1OOI X;  2P70 A;  3BFB A;  3OGN A;  2WCJ A;  2PQL A;  3VB1 A;  3BJH A;  3BFA A;  1C3Y A;  2QEV A;  1OW4 A;  3D75 A;  1OOG A;  3L4L A;  1T14 A;  4FQT A;  3PJI A;  4INX A;  1ORG A;  2KPH A;  4OZD A;  3CAB A;  3N7H A;  2QDI A;  2JPO A;  2P71 A;  3FE8 A;  3S0B A;  3CYZ A;  3V2L A;  3CZ1 A;  3D76 A;  5EL2 A;  3L4A A;  3NHI A;  5DIC A;  3S0E A;  2QEH A;  4F7F A;  3D73 A;  1LS8 A;  3FE6 A;  3L47 A;  2WC6 A;  2WCH A;  3CZ0 A;  1C3Z A;  3B88 A;  3FE9 A;  3DY9 A;  2FJY A;  2QEO A;  1OOH A;  3R1P A; 
#chains in the Genus database with same CATH topology
 4OKH A;  2JT3 A;  2M29 A;  3S0G A;  1UHK A;  4KYN A;  1C7V A;  1CFF A;  2B1U A;  1CM4 A;  4QJ5 B;  1YRT B;  2OS8 B;  1PRW A;  3E3R A;  4I5N B;  4PE0 A;  1QJT A;  3S0D A;  1LVC D;  1WDC C;  4NDB A;  2BKI B;  1ZAC A;  3NGV A;  1TUZ A;  1LIN A;  1JFK A;  1N2D A;  3DVK A;  1P28 A;  1BMO A;  1F55 A;  3PAL A;  2L2E A;  3OX6 A;  4CLN A;  2EC6 B;  3KF9 A;  3EKJ A;  1MXL C;  2QPT A;  2Y5I A;  3WHT B;  1RRO A;  1TOP A;  1R2U A;  2F33 A;  4DCK A;  3K1E A;  4GGF C;  1RK9 A;  1Y0V H;  5I94 A;  1M45 A;  2ZND A;  2KBI A;  4YGC B;  1TNW A;  2KFF A;  5I8N A;  1WY9 A;  1M63 B;  2Y4Q A;  1K96 A;  2HET A;  2KYC A;  1DJZ A;  1M31 A;  2JOJ A;  5FI2 A;  3B7A A;  1OOF A;  3KHE A;  2KAY A;  1B4C A;  1K90 D;  3PAT A;  1D1O A;  1HQV A;  1SL8 A;  2F3Y A;  2L5Y A;  3SG4 A;  2BCA A;  4HRE E;  2JTT A;  3I5G B;  1YVL A;  5KSZ A;  3B86 A;  1YUR A;  2KGR A;  1RTP 1;  2KSP A;  2F2P A;  2KHN A;  1L2O C;  1B9A A;  4D1E A;  1CFD A;  2CTN A;  1KFU S;  1J1D A;  1K9U A;  2Q4U A;  3OB1 B;  2JT0 A;  2LP3 A;  1QX2 A;  1J7P A;  1UUR A;  1MHO A;  3CWG A;  1EXR A;  5HLV A;  3GK2 A;  1AUI B;  3O4X A;  1F8H A;  1SCM C;  3BJH A;  1XYD A;  1IGV A;  1CLB A;  4ORA B;  4GPL B;  1WRK A;  2JXL A;  1K94 A;  3D10 A;  1LKJ A;  2CBL A;  4P5O E;  3IF7 A;  3I5H B;  4HSZ A;  3NXA A;  1REC A;  2TN4 A;  2K61 A;  2K2F A;  3TDU A;  5CSN A;  4QJ4 B;  2LVK A;  4FQT A;  2BL0 B;  1UHN A;  3PJI A;  2ZRT A;  3SS5 A;  2JQ6 A;  2Y1N A;  1CTR A;  1WLZ A;  1TIZ A;  2OS8 C;  1NX3 A;  3GOF A;  1QVI Y;  4MLW A;  1TRF A;  2KAV A;  3SS3 A;  4PDZ A;  4WQ3 A;  2JPO A;  2CCM A;  1JBA A;  2ZN9 A;  2L51 A;  3AKB A;  4MEW A;  2EC6 C;  3I5I C;  2KNE A;  1IRJ A;  3CLN A;  1IJ6 A;  1NCZ A;  2G9B A;  3EK7 A;  5D3O A;  1XFU O;  4AQJ A;  2I94 A;  1SMG A;  2JXC A;  2M7L A;  2JPT A;  4XJK B;  1JF2 A;  4GGN A;  1IIO A;  1G4Y R;  1CMF A;  1XK4 A;  2M3W A;  2K8M B;  3L47 A;  1TCO B;  1C3Z A;  3B88 A;  3FE9 A;  1SBJ A;  3H4S E;  2M49 B;  1NUB A;  1DF0 A;  2BE4 A;  1SRA A;  5HL1 A;  1XFW O;  4N1F A;  4NDC A;  1ZUZ A;  4WQ2 A;  3DY9 A;  4BY4 A;  3I5G C;  1K8U A;  3KO0 A;  4ZCV A;  4CFQ A;  2LVJ A;  3LLE A;  3SG5 A;  2KFH A;  5HKY A;  2KI6 D;  2LNK A;  3R1P A;  2WCM A;  1S6I A;  3CZ2 A;  1B8R A;  3UNW A;  1J7O A;  4Q04 A;  3F45 A;  3D74 A;  4ZCU A;  3SJS A;  2O60 A;  4IL1 A;  2NCP A;  2WC5 A;  3CDN A;  2SCP A;  1DVI A;  3EVR A;  3IQO A;  3OB2 B;  1YVH A;  1SYM A;  2LMU A;  3I5H C;  1BOC A;  5IBW A;  3Q8I A;  4DIR A;  1DT7 B;  3AAJ A;  1IKU A;  4F0Z B;  1PUL A;  1S3P A;  1SCV A;  4I5K A;  2M97 A;  2BL0 C;  1SCM B;  5FYX A;  3SIB A;  1Z4H A;  2MRD A;  1DMO A;  1S26 D;  3BUO B;  1B8C A;  2ZKM X;  5TNC A;  1TNQ A;  2BCX A;  3A8R A;  3DYE A;  4UPG A;  4XYN A;  2PAL A;  1JSA A;  3DF0 B;  3VRO A;  4YGB B;  5PAL A;  1F4Q A;  1CMG A;  1NYA A;  1K93 D;  3HX4 A;  4ORB B;  3D0Y B;  1BLQ A;  1OZO A;  2H2K A;  3AAK A;  4MSP A;  2F2O A;  2H8V A;  1TN4 A;  2KLE A;  3R1O A;  2I2R E;  5CSF A;  1AJ4 A;  1AHR A;  1GQM A;  3LK1 A;  3PLF B;  1AK8 A;  2OTG C;  4MBE A;  3SG6 A;  2KQ6 A;  1NX2 A;  2BNX A;  2LHL A;  1B7T Y;  2L4H A;  3NSI A;  1KQM B;  1L7Z A;  1OZS A;  4INW A;  1U5I B;  3QRX A;  2M8U A;  1F71 A;  1PVA A;  3I5I B;  1MR8 A;  5DKQ A;  1K95 A;  4HRG A;  1YRU B;  1QTX A;  2LLT A;  4WRI A;  1QX5 B;  1DTL A;  1OOI X;  1PSB A;  1XFX O;  2MLF C;  5J3X A;  1A75 A;  3GK4 X;  1C3Y A;  4U8D A;  4GGF A;  2F3Z A;  3TS5 B;  2PMY A;  1DEK A;  1CLL A;  1AVS A;  1QLK A;  4ETO A;  2KYF A;  2QEV A;  1OW4 A;  1X02 A;  1QVI Z;  1QV0 A;  3BOW A;  1JUO A;  1K2H A;  4YGD B;  4FTG A;  1OQP A;  1CFP A;  3DVM A;  2CT9 A;  4MRX A;  2BBN A;  2MJW B;  2EGD A;  2WCE A;  4OCI A;  1SR6 B;  1HT9 A;  3CAB A;  5HKZ A;  1YTZ C;  1IQ3 A;  5HKW A;  2K7O A;  1B1G A;  1FI6 A;  1G8I A;  2KFG A;  3JTD C;  3OP0 A;  1C7W A;  1G33 A;  2KQY A;  2R2I A;  4GUK A;  1Y1U A;  3BUW B;  3FE8 A;  5CSI A;  1SL9 A;  3LCP C;  3S0B A;  1RJV A;  1F70 A;  3V2L A;  3O6B A;  1JFJ A;  1LA0 A;  1EL4 A;  3VRR A;  1DJW A;  1NSH A;  1RWY A;  2K7D A;  1QLS A;  3ZNI A;  5DIC A;  2JWW A;  1GGZ A;  2QEH A;  5I2Q A;  2BBM A;  3RM1 A;  2OPO A;  5AFP A;  4MN0 A;  2I18 A;  1V1F A;  1N65 A;  1PAL A;  3CS1 A;  1ZMZ A;  1IJ5 A;  1ALV A;  2K60 A;  3CZ0 A;  1DC1 A;  4A4B A;  2Y1M A;  5D69 A;  1XFV O;  4YRU A;  1E8A A;  1KK7 Y;  2VRG A;  4C0L A;  2H61 A;  2K7C A;  1MWN A;  1Y1A A;  1OMR A;  4I5J A;  1BOD A;  2L4I A;  1TNP A;  3TDZ A;  1SY9 A;  2QEO A;  1KQM C;  4GBA A;  1UP5 A;  2LVV A;  4ICB A;  1YX7 A;  5D7F A;  1CDL A;  2NLN A;  1XFY O;  3GK1 A;  4JD9 A;  3JVT B;  1CDN A;  2LE9 B;  2QEB A;  4YI9 A;  2OTG B;  2YGU A;  1K9K A;  3BFH A;  4GAO A;  3SG7 A;  2ERB A;  2V53 A;  1WRL A;  1KSO A;  1CDM A;  1LXF C;  4PE4 A;  3PM8 A;  1UHJ A;  4YI8 A;  2MA2 A;  5GQQ C;  3S0A A;  3TS5 C;  4ORC B;  3RZS A;  1MUX A;  4MZK A;  4GNK B;  4PCW A;  3VRQ A;  4CID A;  2G2B A;  2LC5 A;  3EVU A;  1A2X A;  3R72 A;  4PHM A;  3FWB A;  1J7Q A;  5G08 A;  2K7B A;  1TUJ A;  1IWQ A;  1YUS A;  2LHI A;  3KPX A;  2PSR A;  1QAS A;  1BT6 A;  2RGI A;  1CDP A;  3MSE B;  3WXA A;  1W7I B;  4YGE B;  2IS9 A;  1SR6 C;  3PSR A;  5I2O A;  1DJG A;  1BR1 B;  2K2A A;  3O2P A;  2GV5 A;  2HQ8 A;  2LVI A;  1TNX A;  3DXL A;  4FQO A;  4M2O A;  1UHI A;  3B87 A;  1XA5 A;  2KOT A;  5CSJ A;  2WCL A;  1XFR A;  1B7T Z;  1DGV A;  1DGU A;  1DJI A;  1GJY A;  1KWO C;  1R6P A;  2KGB C;  3I5F B;  5KTY A;  1VRK A;  1YR5 A;  3NHT A;  3VGO A;  4NQG A;  4AQI A;  1PVB A;  2HF5 A;  3BUN B;  5ER4 X;  4DS7 A;  1C07 A;  1S6J A;  3BQ3 A;  3JTD B;  2M9G A;  2GGZ A;  2FCE A;  1DJH A;  1DJY A;  3WNX B;  2MLE C;  1AJ5 A;  3CR5 X;  4R1E A;  2O5G A;  2Q91 A;  1OSA A;  2HQW A;  3SG3 A;  3ZWH A;  5K89 A;  1H4B A;  2LP2 A;  1KSM A;  2ZFD A;  1LA3 A;  2GTE A;  3SG2 A;  3DD4 A;  1CLM A;  1CM1 A;  1UHH A;  3D77 A;  1B8L A;  2P70 A;  3OGN A;  1MXE A;  2WOR A;  3BFA A;  4NDD A;  3EG5 B;  1S5G Y;  3HCM A;  1M46 A;  1CNP A;  1SK6 D;  4JPZ B;  1A03 A;  5AXI A;  1QX7 A;  2JU0 A;  2ZNE A;  3BUM B;  3EK8 A;  2GGM A;  2M7N A;  2DOQ A;  2L5X B;  3CGA A;  3LL8 B;  4DUQ A;  1JC2 A;  1YUU A;  2COL B;  4PHN A;  1NPQ A;  1TCF A;  1NX0 A;  1T14 A;  2M1U A;  4DRW A;  1BF5 A;  3JVT C;  1BJF A;  1SW8 A;  5DKN A;  1M39 A;  3PN7 B;  2KPH A;  4OZD A;  1FF1 A;  1IQ5 A;  1NCY A;  3N7H A;  1PK0 D;  1SKT A;  1JWD A;  2QDI A;  4XJK A;  2ZN8 A;  1RFJ A;  2FJU B;  3CYZ A;  3IQQ A;  2K0J A;  2JUL A;  2KDH A;  3CZ1 A;  3FIA A;  3D76 A;  5EL2 A;  1KCY A;  1S36 A;  3KEV A;  1NIW A;  2L50 A;  1B47 A;  3TZ1 A;  5I2L A;  3TUY C;  2WC8 A;  3OHM B;  3CTN A;  1BR4 B;  4USL A;  2CXJ A;  4IJ7 A;  1KK7 Z;  1YX8 A;  4P2Y B;  1NP8 A;  1FI5 A;  1CFC A;  5ER5 A;  2NCO A;  1LS8 A;  3FE6 A;  1YUT A;  1QIV A;  2WC6 A;  2WCH A;  4YGA A;  2P6B B;  3I5F C;  3ICB A;  2LM5 A;  4OVN F;  1S1E A;  2BAP A;  1XO5 A;  4L9M A;  2LMV A;  4M2P A;  4N5X A;  5BPJ A;  1KFX L;  4C0J A;  2KLD A;  1EG3 A;  3CR4 X;  5AAN A;  2I7A A;  2JNX A;  2KI4 B;  3NSK A;  5HYD A;  2LAN A;  1KFX S;  2FJY A;  1EJ3 A;  1KWO B;  1NWD A;  1KQV A;  2LMT A;  1OOH A;  3C1V A;  1UWO A;  2BEC A;  2QAC A;  3O78 A;  1J7R A;  1OMV A;  3QME A;  1WLM A;  1W7J B;  3K21 A;  1DF0 B;  3VRP A;  1QV1 A;  4PHJ A;  1N0Y A;  3IVT A;  3DZT A;  3OX5 A;  1NCX A;  2LAP A;  2WOS A;  3DVJ A;  1WRZ A;  4M2Q A;  5AEQ A;  4MZL A;  4AOM A;  1TWO A;  2ZRS A;  3DF0 A;  1KFU L;  2JRF A;  2M1K B;  3A4U B;  1GM0 A;  3D0Y A;  2M0R A;  3PFV A;  4PT1 A;  5JJG A;  5B8I B;  2NZ0 A;  3DVE A;  1EH2 A;  1KK8 B;  1ZFS A;  3EKH A;  3EVV A;  1F4O A;  1MQ1 A;  1Q80 A;  2AUC A;  3PN7 C;  3UO9 A;  4A4C A;  1Y6W A;  1FW4 A;  1QWV A;  2JC2 A;  3NSL A;  4N1G A;  2AMI A;  1FPW A;  1SSE B;  5HLO A;  1JF0 A;  2JT8 A;  1U5I A;  2PYQ A;  4TNC A;  1SNL A;  2L2C A;  2HPS A;  3D78 A;  1NX1 A;  3VRN A;  2BCB A;  5JOL A;  5FI7 A;  1QIW A;  2WND A;  1QAT A;  1OMD A;  2H61 C;  4BY5 A;  1SPY A;  3M0W A;  4I5L B;  1OE9 B;  1TTX A;  1BU3 A;  1QS7 A;  1V1G A;  1W9Z A;  2A4J A;  4JWQ A;  2MBX A;  4CFR A;  3B6X A;  2PRU A;  2JZI A;  4CPV A;  2KBM A;  4OR9 B;  1S5G Z;  1UUS A;  2MAZ A;  3CR2 A;  2NXQ A;  1OOJ A;  1F54 A;  3R1V A;  1EG4 A;  3S0F A;  2AAO A;  3BXK A;  4JQ0 D;  2LUX A;  2D8N A;  5F6T A;  2LLS A;  1DQE A;  2WCK A;  3TUY B;  2PVB A;  3BFB A;  4QJ3 B;  2WCJ A;  5AER A;  2PQL A;  4MVF A;  3VB1 A;  3WHU B;  3SS4 A;  1WDC B;  3FWC A;  2KI6 C;  3PM2 A;  2KI4 C;  1S6C A;  2E30 A;  3D75 A;  1H8B A;  2JNF A;  1DEL A;  1XK4 C;  1OOG A;  4YBH B;  3L4L A;  4HRH A;  1DJX A;  1IH0 A;  3CZT X;  4INX A;  2WCB A;  4MRY A;  1ORG A;  1A75 B;  2PAS A;  2WCF A;  1GGW A;  3OBV A;  2CNP A;  4OV2 A;  2JTZ A;  1A4P A;  3LK0 A;  2LUC A;  1XVJ A;  1XFZ O;  3BOW B;  3O4Y A;  2MHH A;  2P71 A;  1PSR A;  2L0P A;  3TDI A;  3BUX B;  2SAS A;  1CB1 A;  3L4A A;  3SIA A;  1KK8 C;  3NHI A;  1ODB A;  2FOT A;  4MZJ A;  3S0E A;  1CKK A;  2EHB A;  3NSO A;  1SL7 A;  4C0K A;  4F7F A;  3FS7 A;  1IG5 A;  2BKH B;  1L2O B;  3D73 A;  1Z2C B;  4E68 A;  2LCP A;  1MF8 B;  2ISD A;  5KU1 A;  2L98 A;  2FCD A;  1FBV A;  3AKA A;  5DKR A;  5CPV A;  1BG1 A;  4JKT A;  1A29 A;  1Y1X A;  1J55 A;  2LLU A;  2F8P A;  3BYA A;  2BE6 A;  2LV7 A;  1J1E A;  1ZOT B;  1K9P A;  2E6W A;  3EK4 A;  3RLZ A;  4PHK A;  4GFT A;  1QXP A;  4PE7 A;  2KAX A;  1ALW A;  4PE1 A;  5FI6 A;  1AP4 A;  4PAL A; 
#chains in the Genus database with same CATH homology
 2WCM A;  3QME A;  3CZ2 A;  4JD9 A;  2QEB A;  3S0G A;  3BFH A;  3D74 A;  2ERB A;  3S0D A;  2WC5 A;  3CDN A;  3DZT A;  3S0A A;  3RZS A;  3NGV A;  1TWO A;  1P28 A;  3R72 A;  3Q8I A;  1TUJ A;  1GM0 A;  4PT1 A;  3K1E A;  1QWV A;  3DYE A;  3DXL A;  3B87 A;  2WCL A;  1XFR A;  2L2C A;  3D78 A;  2H8V A;  3B7A A;  3R1O A;  1OOF A;  3NHT A;  3B86 A;  4INW A;  3B6X A;  3R1V A;  3S0F A;  2GTE A;  3D77 A;  1DQE A;  2WCK A;  1OOI X;  2P70 A;  3BFB A;  3OGN A;  2WCJ A;  2PQL A;  3VB1 A;  3BJH A;  3BFA A;  1C3Y A;  2QEV A;  1OW4 A;  3D75 A;  1OOG A;  3L4L A;  1T14 A;  4FQT A;  3PJI A;  4INX A;  1ORG A;  2KPH A;  4OZD A;  3CAB A;  3N7H A;  2QDI A;  2JPO A;  2P71 A;  3FE8 A;  3S0B A;  3CYZ A;  3V2L A;  3CZ1 A;  3D76 A;  5EL2 A;  3L4A A;  3NHI A;  5DIC A;  3S0E A;  2QEH A;  4F7F A;  3D73 A;  1LS8 A;  3FE6 A;  3L47 A;  2WC6 A;  2WCH A;  3CZ0 A;  1C3Z A;  3B88 A;  3FE9 A;  3DY9 A;  2FJY A;  2QEO A;  1OOH A;  3R1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...