2WCHA

Structure of bmori gobp2 (general odorant binding protein 2) with bombykal
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
total genus 54
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wchA00
3QMEA 3D73A 4INWA 3D74A 3B87A 1OOIX 1LS8A 2QDIA 2QEVA 2P70A 1TWOA 2QEBA 3K1EA 2WCHA 2JPOA 1C3YA 1QWVA 1C3ZA 3BFAA 3NHTA 2GTEA 3DZTA 2FJYA 1ORGA 2P71A 3N7HA 1OOFA 3S0AA 3L4AA 2ERBA 3B6XA 3FE9A 4F7FA 3S0GA 2QEHA 1T14A 3CABA 3B7AA 3BJHA 3BFHA 1OOHA 3B86A 3D77A 3CZ2A 2WC5A 3D78A 3DY9A 3RZSA 3V2LA 1TUJA 3S0EA 3DXLA 4PT1A 2KPHA 3L4LA 3B88A 3CYZA 1OW4A 4OZDA 1DQEA 3NGVA 2WCMA 3R72A 2WCKA 3OGNA 3DYEA 2PQLA 2QEOA 1XFRA 3R1VA 4FQTA 3R1OA 3S0FA 1GM0A 5DICA 3R1PA 3D75A 2H8VA 3Q8IA 3BFBA 3CZ1A 3NHIA 2WCJA 4INXA 2L2CA 5EL2A 3FE6A 3S0DA 1OOGA 3VB1A 2WCLA 3S0BA 3PJIA 2WC6A 3CZ0A 3CDNA 4JD9A 3D76A 1P28A 3FE8A 3L47A
chains in the Genus database with same CATH superfamily
1PSRA 3FIAA 1YURA 2WCBA 4JKTA 1U5IB 1DJYA 1Y6WA 1OMVA 4XJKB 3D73A 1J7PA 2PASA 1LINA 3OB1B 2PMYA 4INWA 3D74A 2KI4C 2L51A 4DRWA 4DUQA 2O5GA 3LLEA 4A4BA 2LLTA 1TNQA 3I5FC 1TCOB 1J7QA 3KHEA 4GGFC 5K89A 4PHNA 1A75B 5ER4X 3D0YB 1LXFC 5J3XA 1C3YA 4GGFA 1W7JB 1QWVA 1SYMA 3BFAA 1K9UA 1WLZA 1WRZA 4MBEA 5B8IB 3HX4A 1XFZO 2K8MB 2KDHA 1PK0D 3I5IC 1IH0A 1BR4B 3KEVA 1IQ3A 1SL7A 4MZKA 3CR2A 4Q04A 1SK6D 2LM5A 1B8CA 1GQMA 5JJGA 3EVVA 2EC6B 5HL1A 1QIWA 4MZLA 2L5YA 3B6XA 1NCYA 4MN0A 4F7FA 5HLVA 3SIBA 1NX3A 5FYXA 4DS7A 1JSAA 1LVCD 1MF8B 4I5KA 3I5HB 1EG3A 1IG5A 2H61C 4QJ4B 1DF0B 1ZOTB 1IWQA 2K60A 1K9PA 3CABA 1KK8C 3IF7A 3JTDC 3B7AA 3BJHA 3H4SE 1OOHA 1SR6C 1KWOB 2BCAA 2RGIA 2Q4UA 3DF0A 4NQGA 5BPJA 1S5GZ 2BBMA 2CCMA 2JC2A 1YVHA 2JZIA 1S3PA 2CT9A 1XFYO 1CFDA 1SPYA 1JC2A 1K94A 1H8BA 2CBLA 1SSEB 1DTLA 3DVKA 4M2OA 3I5GB 3O4XA 2E30A 5D69A 1B8LA 3IQOA 4OZDA 1R2UA 4YGAA 1ZUZA 1C7VA 4TNCA 3M0WA 2FOTA 3BOWB 5G08A 3NGVA 1C07A 3R72A 2M0RA 2MLFC 3E3RA 2QEOA 1XFRA 1YR5A 2KYCA 3FWBA 2ISDA 3CR5X 1OZOA 2JPTA 1RFJA 1F55A 3PN7B 3SIAA 1DT7B 3A8RA 2I18A 1CNPA 1M63B 1F54A 1L2OC 1A03A 1TNWA 2HQWA 3BUNB 5AEQA 1TIZA 1WLMA 1SKTA 1UHHA 2MHHA 2F3ZA 2KI4B 2L2CA 1PULA 3FE6A 1MWNA 1XFUO 5D3OA 1W9ZA 2KAYA 1OOGA 3I5FB 1WY9A 2ZN8A 1JWDA 1B8RA 4I5JA 1SCMC 4F0ZB 2LUXA 1D1OA 1FI5A 4OVNF 2F33A 2K7CA 2WCFA 2FJUB 4JD9A 4YGBB 1NIWA 1P28A 3D76A 1OMDA 3AKAA 1QTXA 3PM8A 1AHRA 3SG2A 2CNPA 3SJSA 1AUIB 2L4HA 5F6TA 3BUOB 3I5IB 2K7BA 3LL8B 1EJ3A 3QMEA 4GPLB 4N1FA 5I2LA 3SG3A 1CKKA 1DJXA 4N1GA 1CLLA 5PALA 1FI6A 1DJIA 2M97A 2JNXA 2COLB 3PALA 5HLOA 1F8HA 1JFKA 2LMTA 1TOPA 1RWYA 2QEVA 4M2QA 4MRXA 3GK4X 5DKNA 2Y4QA 1QX7A 1F4QA 1GGZA 5DKRA 1UHJA 1QATA 1BU3A 4OV2A 1JBAA 1IGVA 1J7RA 2M3WA 1SY9A 2NXQA 1NX2A 1CDMA 2LMVA 3BQ3A 1KK8B 3DZTA 3JTDB 3K21A 4FTGA 3TDUA 3DF0B 1XVJA 2KBIA 1CLMA 2NZ0A 1ORGA 1FPWA 1SR6B 4GNKB 1CLBA 2KSPA 2LMUA 3BXKA 1RECA 5AANA 3TUYC 3N7HA 4YI8A 1OOFA 3S0AA 4OCIA 3WNXB 1BOCA 1A29A 4GFTA 4PALA 4PCWA 3EVRA 2KAXA 1XO5A 2KFHA 1B47A 3FE9A 3PM2A 2BCXA 3SS5A 2F8PA 3NSIA 2LVVA 2MLEC 1PALA 5AXIA 1A2XA 2K2AA 1YRTB 1ZMZA 1QV0A 1V1GA 1XFWO 2BE6A 3B86A 2MA2A 2LVIA 2LAPA 4PHJA 2SASA 2PRUA 1K9KA 1BF5A 5ER5A 3GK1A 2HF5A 1HT9A 1BJFA 4YGCB 1OE9B 1QXPA 1EH2A 2KHNA 2LNKA 2VRGA 3V2LA 2OPOA 1Y1UA 1WRLA 1AK8A 3SS3A 1PRWA 3S0EA 2PSRA 1ALWA 1TUZA 1XYDA 1TNPA 1L2OB 1CMFA 3O2PA 3L4LA 5TNCA 2Y1MA 1QVIY 1JF2A 3VRNA 1UHIA 1WDCC 2D8NA 1DQEA 2E6WA 4PE4A 1IKUA 2WCMA 3PATA 4YGDB 3VRPA 2WCKA 1QX2A 1NYAA 5FI2A 1BT6A 3DYEA 2PQLA 4CLNA 2BKIB 1IJ5A 2A4JA 1SCMB 3HCMA 1CMGA 3EG5B 1CFPA 1Y1XA 3ICBA 3S0FA 1GM0A 5DICA 1R6PA 2Y1NA 1H4BA 3VRQA 1ZFSA 1QJTA 2L2EA 3VROA 4MVFA 2LV7A 2H8VA 2KGRA 3LK1A 5DKQA 4A4CA 1PSBA 2EGDA 2JNFA 3CZ1A 2NLNA 1SBJA 1OMRA 2BKHB 5KSZA 5EL2A 1UP5A 2CXJA 1Y0VH 4D1EA 4E68A 2LANA 2JWWA 1DELA 1EXRA 1QASA 2I94A 1AJ5A 2F2OA 4HREE 2K7DA 4BY5A 3TDZA 4ETOA 2WCEA 1BMOA 2JT0A 2KYFA 1SCVA 4PE7A 1J1EA 3AKBA 2NCOA 4FQOA 3OHMB 3CDNA 2ZNDA 1KFXS 4XJKA 1JF0A 5KTYA 4BY4A 4MSPA 1G4YR 4C0KA 2LP3A 1QX5B 3VGOA 4YI9A 1RJVA 4NDBA 1MXEA 2IS9A 3B87A 5HKWA 3TUYB 1CDNA 5AERA 1TRFA 2ZRSA 2Q91A 2V53A 4WQ3A 1KQMC 2QDIA 1K90D 1KFXL 1VRKA 3NXAA 1YTZC 1OOJA 4ORBB 2MBXA 1TWOA 1W7IB 1M31A 1AP4A 1F71A 2QEBA 4IL1A 1N65A 3K1EA 3D0YA 1NP8A 2AAOA 2JPOA 2G2BA 3SG7A 1LA3A 1YX7A 1Y1AA 3CZTX 1NPQA 4MEWA 4ZCVA 2FCDA 2KNEA 1YUUA 5I94A 3OX6A 2F2PA 2LVJA 1XA5A 2FJYA 1KSOA 1S1EA 3CS1A 4NDDA 3VRRA 2ZRTA 4M2PA 2WC8A 1MR8A 2P6BB 5AFPA 3IQQA 1YRUB 1Q80A 2JXCA 3TS5C 3UNWA 1TNXA 4YRUA 3BUXB 2M1KB 1OQPA 1DJHA 1UURA 2KQ6A 1Z4HA 1DC1A 3EK8A 2K2FA 2MJWB 3S0GA 5CSNA 2QEHA 2YGUA 1T14A 1WDCB 2MAZA 1FBVA 2M7NA 2K61A 4GUKA 3F45A 2JXLA 2PVBA 4DCKA 4KYNA 2AMIA 3BFHA 4WRIA 1B4CA 1S6IA 1JFJA 1GGWA 2WC5A 3L47A 4GGNA 1DMOA 5HKYA 2L50A 2L5XB 4AQIA 2HQ8A 3DY9A 3RZSA 5CSFA 2BL0C 1KK7Y 2JTZA 1DGVA 3DXLA 2CTNA 3OBVA 5KU1A 2FCEA 2JQ6A 3JVTC 1NX1A 3KF9A 4YBHB 1FW4A 2O60A 3B88A 3TZ1A 4MZJA 1KQVA 2K0JA 1SW8A 2M9GA 2LE9B 4JQ0D 1B7TY 2JT3A 3PFVA 5HKZA 2LHLA 4OR9B 1XK4A 3CWGA 1F4OA 1BR1B 3OGNA 1S6JA 2GGZA 1SL9A 2WNDA 3EK7A 1V1FA 1CM1A 3WXAA 1NCXA 3FS7A 2M7LA 1BLQA 2BCBA 1CDLA 1AJ4A 3ZNIA 2KOTA 2I2RE 2LLSA 2BAPA 2M8UA 3EKHA 4I5NB 4CIDA 5HYDA 1E8AA 3WHUB 3D75A 3Q8IA 1UWOA 2NCPA 3BFBA 3DVJA 1MQ1A 1PVAA 1C7WA 1QVIZ 1YVLA 2L98A 3WHTB 2TN4A 2WCJA 1UHKA 4HSZA 1J7OA 4INXA 2JTTA 1A4PA 1MUXA 3EVUA 1KQMB 2JOJA 2JU0A 2QACA 3IVTA 1KSMA 3QRXA 3OX5A 1N2DA 2L4IA 3BUMB 4PE1A 4P5OE 3S0BA 4GAOA 2WOSA 2QPTA 1J1DA 2OS8C 4C0JA 5I2QA 1TTXA 4C0LA 1DJWA 1HQVA 2JULA 3AAKA 2K7OA 1K2HA 5CSJA 2EHBA 1CFCA 4PT1A 3FE8A 3OB2B 1IRJA 1F70A 4HRGA 3BUWB 3CGAA 4WQ2A 4U8DA 4P2YB 1MHOA 2BBNA 1DEKA 2GV5A 5GQQC 3GOFA 4ORAB 1FF1A 2KBMA 1CM4A 2F3YA 1OOIX 2H2KA 3TS5B 1LS8A 1S26D 3SG4A 1YUTA 1J55A 2P70A 2OTGC 4PDZA 3PSRA 1X02A 2LC5A 1M46A 1LKJA 2KAVA 4CFQA 2WCHA 4I5LB 1IJ6A 2H61A 4AQJA 1EG4A 3KPXA 1ODBA 2BECA 1C3ZA 2LUCA 3NHTA 2GTEA 3O78A 1SRAA 4NDCA 1S5GY 1ALVA 1DVIA 1QLKA 1G33A 1TN4A 2BE4A 1K96A 2ZN9A 2ZKMX 1CTRA 5I2OA 3UO9A 4JPZB 2P71A 5D7FA 1ZACA 1WRKA 1U5IA 2LVKA 2L0PA 2B1UA 4QJ5B 2M1UA 2AUCA 5IBWA 2I7AA 3NSOA 1AVSA 4JWQA 4CPVA 2BL0B 3L4AA 3CTNA 3RM1A 2KLEA 4ICBA 1QLSA 2ERBA 2ZNEA 3AAJA 3OP0A 1KFUS 3JVTB 1LA0A 4OKHA 4YGEB 2SCPA 1L7ZA 1DJGA 1G8IA 1PVBA 3DVMA 2KI6C 3SS4A 2LP2A 1A75A 1QIVA 1K8UA 1RTP1 2JT8A 1KCYA 4ZCUA 1NWDA 4R1EA 3A4UB 3D77A 1KFUL 2Y5IA 1IQ5A 1MXLC 4CFRA 4XYNA 1CFFA 3CZ2A 3CR4X 3NSLA 3PLFB 1QS7A 4PE0A 3D78A 5FI6A 2BNXA 2G9BA 1CDPA 1N0YA 1TUJA 2EC6C 4AOMA 1BODA 5I8NA 1RK9A 2KFFA 2KGBC 3NSKA 3DD4A 1SNLA 4N5XA 5CSIA 2KPHA 3D10A 1DJZA 1YUSA 2M49B 5FI7A 4QJ3B 2KFGA 1YX8A 3CYZA 3I5HC 3SG5A 1OW4A 3TDIA 1SMGA 1S36A 1EL4A 1M45A 1RROA 3LK0A 2ZFDA 3EKJA 2PYQA 1DF0A 3DVEA 1NX0A 3C1VA 3MSEB 1KWOC 1Z2CB 5JOLA 1UHNA 4MLWA 4DIRA 3KO0A 1K95A 1OSAA 3CLNA 3GK2A 2LCPA 3R1VA 1NUBA 1S6CA 1JUOA 2R2IA 2LLUA 2OS8B 1GJYA 3LCPC 4FQTA 5CPVA 1UUSA 2KLDA 3R1OA 4USLA 1SL8A 1IIOA 4MRYA 2PALA 3FWCA 3I5GC 3R1PA 4IJ7A 3ZWHA 1KK7Z 4GBAA 2HETA 2DOQA 3SG6A 2JRFA 3NHIA 2HPSA 1B1GA 4ORCB 3RLZA 1M39A 1XK4C 2WORA 3BOWA 3O6BA 3S0DA 2OTGB 1DGUA 4PHMA 1B7TZ 1NSHA 3EK4A 3VB1A 2WCLA 1XFXO 2GGMA 3PJIA 2KI6D 2KQYA 3PN7C 1OZSA 1BG1A 1TCFA 1K93D 2WC6A 1NCZA 3BYAA 3CZ0A 4UPGA 4L9MA 1CB1A 1B9AA 2LHIA 2MRDA 4PHKA 4HRHA 1XFVO 3O4YA 1QV1A 2M29A
chains in the Genus database with same CATH topology
3QMEA 3D73A 4INWA 3D74A 3B87A 1OOIX 1LS8A 2QDIA 2QEVA 2P70A 1TWOA 2QEBA 3K1EA 2WCHA 2JPOA 1C3YA 1QWVA 1C3ZA 3BFAA 3NHTA 2GTEA 3DZTA 2FJYA 1ORGA 2P71A 3N7HA 1OOFA 3S0AA 3L4AA 2ERBA 3B6XA 3FE9A 4F7FA 3S0GA 2QEHA 1T14A 3CABA 3B7AA 3BJHA 3BFHA 1OOHA 3B86A 3D77A 3CZ2A 2WC5A 3D78A 3DY9A 3RZSA 3V2LA 1TUJA 3S0EA 3DXLA 4PT1A 2KPHA 3L4LA 3B88A 3CYZA 1OW4A 4OZDA 1DQEA 3NGVA 2WCMA 3R72A 2WCKA 3OGNA 3DYEA 2PQLA 2QEOA 1XFRA 3R1VA 4FQTA 3R1OA 3S0FA 1GM0A 5DICA 3R1PA 3D75A 2H8VA 3Q8IA 3BFBA 3CZ1A 3NHIA 2WCJA 4INXA 2L2CA 5EL2A 3FE6A 3S0DA 1OOGA 3VB1A 2WCLA 3S0BA 3PJIA 2WC6A 3CZ0A 3CDNA 4JD9A 3D76A 1P28A 3FE8A 3L47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QME A;  3D73 A;  4INW A;  3D74 A;  3B87 A;  1OOI X;  1LS8 A;  2QDI A;  2QEV A;  2P70 A;  1TWO A;  2QEB A;  3K1E A;  2WCH A;  2JPO A;  1C3Y A;  1QWV A;  1C3Z A;  3BFA A;  3NHT A;  2GTE A;  3DZT A;  2FJY A;  1ORG A;  2P71 A;  3N7H A;  1OOF A;  3S0A A;  3L4A A;  2ERB A;  3B6X A;  3FE9 A;  4F7F A;  3S0G A;  2QEH A;  1T14 A;  3CAB A;  3B7A A;  3BJH A;  3BFH A;  1OOH A;  3B86 A;  3D77 A;  3CZ2 A;  2WC5 A;  3D78 A;  3DY9 A;  3RZS A;  3V2L A;  1TUJ A;  3S0E A;  3DXL A;  4PT1 A;  2KPH A;  3L4L A;  3B88 A;  3CYZ A;  1OW4 A;  4OZD A;  1DQE A;  3NGV A;  2WCM A;  3R72 A;  2WCK A;  3OGN A;  3DYE A;  2PQL A;  2QEO A;  1XFR A;  3R1V A;  4FQT A;  3R1O A;  3S0F A;  1GM0 A;  5DIC A;  3R1P A;  3D75 A;  2H8V A;  3Q8I A;  3BFB A;  3CZ1 A;  3NHI A;  2WCJ A;  4INX A;  2L2C A;  5EL2 A;  3FE6 A;  3S0D A;  1OOG A;  3VB1 A;  2WCL A;  3S0B A;  3PJI A;  2WC6 A;  3CZ0 A;  3CDN A;  4JD9 A;  3D76 A;  1P28 A;  3FE8 A;  3L47 A; 
#chains in the Genus database with same CATH topology
 1PSR A;  3FIA A;  1YUR A;  2WCB A;  4JKT A;  1U5I B;  1DJY A;  1Y6W A;  1OMV A;  4XJK B;  3D73 A;  1J7P A;  2PAS A;  1LIN A;  3OB1 B;  2PMY A;  4INW A;  3D74 A;  2KI4 C;  2L51 A;  4DRW A;  4DUQ A;  2O5G A;  3LLE A;  4A4B A;  2LLT A;  1TNQ A;  3I5F C;  1TCO B;  1J7Q A;  3KHE A;  4GGF C;  5K89 A;  4PHN A;  1A75 B;  5ER4 X;  3D0Y B;  1LXF C;  5J3X A;  1C3Y A;  4GGF A;  1W7J B;  1QWV A;  1SYM A;  3BFA A;  1K9U A;  1WLZ A;  1WRZ A;  4MBE A;  5B8I B;  3HX4 A;  1XFZ O;  2K8M B;  2KDH A;  1PK0 D;  3I5I C;  1IH0 A;  1BR4 B;  3KEV A;  1IQ3 A;  1SL7 A;  4MZK A;  3CR2 A;  4Q04 A;  1SK6 D;  2LM5 A;  1B8C A;  1GQM A;  5JJG A;  3EVV A;  2EC6 B;  5HL1 A;  1QIW A;  4MZL A;  2L5Y A;  3B6X A;  1NCY A;  4MN0 A;  4F7F A;  5HLV A;  3SIB A;  1NX3 A;  5FYX A;  4DS7 A;  1JSA A;  1LVC D;  1MF8 B;  4I5K A;  3I5H B;  1EG3 A;  1IG5 A;  2H61 C;  4QJ4 B;  1DF0 B;  1ZOT B;  1IWQ A;  2K60 A;  1K9P A;  3CAB A;  1KK8 C;  3IF7 A;  3JTD C;  3B7A A;  3BJH A;  3H4S E;  1OOH A;  1SR6 C;  1KWO B;  2BCA A;  2RGI A;  2Q4U A;  3DF0 A;  4NQG A;  5BPJ A;  1S5G Z;  2BBM A;  2CCM A;  2JC2 A;  1YVH A;  2JZI A;  1S3P A;  2CT9 A;  1XFY O;  1CFD A;  1SPY A;  1JC2 A;  1K94 A;  1H8B A;  2CBL A;  1SSE B;  1DTL A;  3DVK A;  4M2O A;  3I5G B;  3O4X A;  2E30 A;  5D69 A;  1B8L A;  3IQO A;  4OZD A;  1R2U A;  4YGA A;  1ZUZ A;  1C7V A;  4TNC A;  3M0W A;  2FOT A;  3BOW B;  5G08 A;  3NGV A;  1C07 A;  3R72 A;  2M0R A;  2MLF C;  3E3R A;  2QEO A;  1XFR A;  1YR5 A;  2KYC A;  3FWB A;  2ISD A;  3CR5 X;  1OZO A;  2JPT A;  1RFJ A;  1F55 A;  3PN7 B;  3SIA A;  1DT7 B;  3A8R A;  2I18 A;  1CNP A;  1M63 B;  1F54 A;  1L2O C;  1A03 A;  1TNW A;  2HQW A;  3BUN B;  5AEQ A;  1TIZ A;  1WLM A;  1SKT A;  1UHH A;  2MHH A;  2F3Z A;  2KI4 B;  2L2C A;  1PUL A;  3FE6 A;  1MWN A;  1XFU O;  5D3O A;  1W9Z A;  2KAY A;  1OOG A;  3I5F B;  1WY9 A;  2ZN8 A;  1JWD A;  1B8R A;  4I5J A;  1SCM C;  4F0Z B;  2LUX A;  1D1O A;  1FI5 A;  4OVN F;  2F33 A;  2K7C A;  2WCF A;  2FJU B;  4JD9 A;  4YGB B;  1NIW A;  1P28 A;  3D76 A;  1OMD A;  3AKA A;  1QTX A;  3PM8 A;  1AHR A;  3SG2 A;  2CNP A;  3SJS A;  1AUI B;  2L4H A;  5F6T A;  3BUO B;  3I5I B;  2K7B A;  3LL8 B;  1EJ3 A;  3QME A;  4GPL B;  4N1F A;  5I2L A;  3SG3 A;  1CKK A;  1DJX A;  4N1G A;  1CLL A;  5PAL A;  1FI6 A;  1DJI A;  2M97 A;  2JNX A;  2COL B;  3PAL A;  5HLO A;  1F8H A;  1JFK A;  2LMT A;  1TOP A;  1RWY A;  2QEV A;  4M2Q A;  4MRX A;  3GK4 X;  5DKN A;  2Y4Q A;  1QX7 A;  1F4Q A;  1GGZ A;  5DKR A;  1UHJ A;  1QAT A;  1BU3 A;  4OV2 A;  1JBA A;  1IGV A;  1J7R A;  2M3W A;  1SY9 A;  2NXQ A;  1NX2 A;  1CDM A;  2LMV A;  3BQ3 A;  1KK8 B;  3DZT A;  3JTD B;  3K21 A;  4FTG A;  3TDU A;  3DF0 B;  1XVJ A;  2KBI A;  1CLM A;  2NZ0 A;  1ORG A;  1FPW A;  1SR6 B;  4GNK B;  1CLB A;  2KSP A;  2LMU A;  3BXK A;  1REC A;  5AAN A;  3TUY C;  3N7H A;  4YI8 A;  1OOF A;  3S0A A;  4OCI A;  3WNX B;  1BOC A;  1A29 A;  4GFT A;  4PAL A;  4PCW A;  3EVR A;  2KAX A;  1XO5 A;  2KFH A;  1B47 A;  3FE9 A;  3PM2 A;  2BCX A;  3SS5 A;  2F8P A;  3NSI A;  2LVV A;  2MLE C;  1PAL A;  5AXI A;  1A2X A;  2K2A A;  1YRT B;  1ZMZ A;  1QV0 A;  1V1G A;  1XFW O;  2BE6 A;  3B86 A;  2MA2 A;  2LVI A;  2LAP A;  4PHJ A;  2SAS A;  2PRU A;  1K9K A;  1BF5 A;  5ER5 A;  3GK1 A;  2HF5 A;  1HT9 A;  1BJF A;  4YGC B;  1OE9 B;  1QXP A;  1EH2 A;  2KHN A;  2LNK A;  2VRG A;  3V2L A;  2OPO A;  1Y1U A;  1WRL A;  1AK8 A;  3SS3 A;  1PRW A;  3S0E A;  2PSR A;  1ALW A;  1TUZ A;  1XYD A;  1TNP A;  1L2O B;  1CMF A;  3O2P A;  3L4L A;  5TNC A;  2Y1M A;  1QVI Y;  1JF2 A;  3VRN A;  1UHI A;  1WDC C;  2D8N A;  1DQE A;  2E6W A;  4PE4 A;  1IKU A;  2WCM A;  3PAT A;  4YGD B;  3VRP A;  2WCK A;  1QX2 A;  1NYA A;  5FI2 A;  1BT6 A;  3DYE A;  2PQL A;  4CLN A;  2BKI B;  1IJ5 A;  2A4J A;  1SCM B;  3HCM A;  1CMG A;  3EG5 B;  1CFP A;  1Y1X A;  3ICB A;  3S0F A;  1GM0 A;  5DIC A;  1R6P A;  2Y1N A;  1H4B A;  3VRQ A;  1ZFS A;  1QJT A;  2L2E A;  3VRO A;  4MVF A;  2LV7 A;  2H8V A;  2KGR A;  3LK1 A;  5DKQ A;  4A4C A;  1PSB A;  2EGD A;  2JNF A;  3CZ1 A;  2NLN A;  1SBJ A;  1OMR A;  2BKH B;  5KSZ A;  5EL2 A;  1UP5 A;  2CXJ A;  1Y0V H;  4D1E A;  4E68 A;  2LAN A;  2JWW A;  1DEL A;  1EXR A;  1QAS A;  2I94 A;  1AJ5 A;  2F2O A;  4HRE E;  2K7D A;  4BY5 A;  3TDZ A;  4ETO A;  2WCE A;  1BMO A;  2JT0 A;  2KYF A;  1SCV A;  4PE7 A;  1J1E A;  3AKB A;  2NCO A;  4FQO A;  3OHM B;  3CDN A;  2ZND A;  1KFX S;  4XJK A;  1JF0 A;  5KTY A;  4BY4 A;  4MSP A;  1G4Y R;  4C0K A;  2LP3 A;  1QX5 B;  3VGO A;  4YI9 A;  1RJV A;  4NDB A;  1MXE A;  2IS9 A;  3B87 A;  5HKW A;  3TUY B;  1CDN A;  5AER A;  1TRF A;  2ZRS A;  2Q91 A;  2V53 A;  4WQ3 A;  1KQM C;  2QDI A;  1K90 D;  1KFX L;  1VRK A;  3NXA A;  1YTZ C;  1OOJ A;  4ORB B;  2MBX A;  1TWO A;  1W7I B;  1M31 A;  1AP4 A;  1F71 A;  2QEB A;  4IL1 A;  1N65 A;  3K1E A;  3D0Y A;  1NP8 A;  2AAO A;  2JPO A;  2G2B A;  3SG7 A;  1LA3 A;  1YX7 A;  1Y1A A;  3CZT X;  1NPQ A;  4MEW A;  4ZCV A;  2FCD A;  2KNE A;  1YUU A;  5I94 A;  3OX6 A;  2F2P A;  2LVJ A;  1XA5 A;  2FJY A;  1KSO A;  1S1E A;  3CS1 A;  4NDD A;  3VRR A;  2ZRT A;  4M2P A;  2WC8 A;  1MR8 A;  2P6B B;  5AFP A;  3IQQ A;  1YRU B;  1Q80 A;  2JXC A;  3TS5 C;  3UNW A;  1TNX A;  4YRU A;  3BUX B;  2M1K B;  1OQP A;  1DJH A;  1UUR A;  2KQ6 A;  1Z4H A;  1DC1 A;  3EK8 A;  2K2F A;  2MJW B;  3S0G A;  5CSN A;  2QEH A;  2YGU A;  1T14 A;  1WDC B;  2MAZ A;  1FBV A;  2M7N A;  2K61 A;  4GUK A;  3F45 A;  2JXL A;  2PVB A;  4DCK A;  4KYN A;  2AMI A;  3BFH A;  4WRI A;  1B4C A;  1S6I A;  1JFJ A;  1GGW A;  2WC5 A;  3L47 A;  4GGN A;  1DMO A;  5HKY A;  2L50 A;  2L5X B;  4AQI A;  2HQ8 A;  3DY9 A;  3RZS A;  5CSF A;  2BL0 C;  1KK7 Y;  2JTZ A;  1DGV A;  3DXL A;  2CTN A;  3OBV A;  5KU1 A;  2FCE A;  2JQ6 A;  3JVT C;  1NX1 A;  3KF9 A;  4YBH B;  1FW4 A;  2O60 A;  3B88 A;  3TZ1 A;  4MZJ A;  1KQV A;  2K0J A;  1SW8 A;  2M9G A;  2LE9 B;  4JQ0 D;  1B7T Y;  2JT3 A;  3PFV A;  5HKZ A;  2LHL A;  4OR9 B;  1XK4 A;  3CWG A;  1F4O A;  1BR1 B;  3OGN A;  1S6J A;  2GGZ A;  1SL9 A;  2WND A;  3EK7 A;  1V1F A;  1CM1 A;  3WXA A;  1NCX A;  3FS7 A;  2M7L A;  1BLQ A;  2BCB A;  1CDL A;  1AJ4 A;  3ZNI A;  2KOT A;  2I2R E;  2LLS A;  2BAP A;  2M8U A;  3EKH A;  4I5N B;  4CID A;  5HYD A;  1E8A A;  3WHU B;  3D75 A;  3Q8I A;  1UWO A;  2NCP A;  3BFB A;  3DVJ A;  1MQ1 A;  1PVA A;  1C7W A;  1QVI Z;  1YVL A;  2L98 A;  3WHT B;  2TN4 A;  2WCJ A;  1UHK A;  4HSZ A;  1J7O A;  4INX A;  2JTT A;  1A4P A;  1MUX A;  3EVU A;  1KQM B;  2JOJ A;  2JU0 A;  2QAC A;  3IVT A;  1KSM A;  3QRX A;  3OX5 A;  1N2D A;  2L4I A;  3BUM B;  4PE1 A;  4P5O E;  3S0B A;  4GAO A;  2WOS A;  2QPT A;  1J1D A;  2OS8 C;  4C0J A;  5I2Q A;  1TTX A;  4C0L A;  1DJW A;  1HQV A;  2JUL A;  3AAK A;  2K7O A;  1K2H A;  5CSJ A;  2EHB A;  1CFC A;  4PT1 A;  3FE8 A;  3OB2 B;  1IRJ A;  1F70 A;  4HRG A;  3BUW B;  3CGA A;  4WQ2 A;  4U8D A;  4P2Y B;  1MHO A;  2BBN A;  1DEK A;  2GV5 A;  5GQQ C;  3GOF A;  4ORA B;  1FF1 A;  2KBM A;  1CM4 A;  2F3Y A;  1OOI X;  2H2K A;  3TS5 B;  1LS8 A;  1S26 D;  3SG4 A;  1YUT A;  1J55 A;  2P70 A;  2OTG C;  4PDZ A;  3PSR A;  1X02 A;  2LC5 A;  1M46 A;  1LKJ A;  2KAV A;  4CFQ A;  2WCH A;  4I5L B;  1IJ6 A;  2H61 A;  4AQJ A;  1EG4 A;  3KPX A;  1ODB A;  2BEC A;  1C3Z A;  2LUC A;  3NHT A;  2GTE A;  3O78 A;  1SRA A;  4NDC A;  1S5G Y;  1ALV A;  1DVI A;  1QLK A;  1G33 A;  1TN4 A;  2BE4 A;  1K96 A;  2ZN9 A;  2ZKM X;  1CTR A;  5I2O A;  3UO9 A;  4JPZ B;  2P71 A;  5D7F A;  1ZAC A;  1WRK A;  1U5I A;  2LVK A;  2L0P A;  2B1U A;  4QJ5 B;  2M1U A;  2AUC A;  5IBW A;  2I7A A;  3NSO A;  1AVS A;  4JWQ A;  4CPV A;  2BL0 B;  3L4A A;  3CTN A;  3RM1 A;  2KLE A;  4ICB A;  1QLS A;  2ERB A;  2ZNE A;  3AAJ A;  3OP0 A;  1KFU S;  3JVT B;  1LA0 A;  4OKH A;  4YGE B;  2SCP A;  1L7Z A;  1DJG A;  1G8I A;  1PVB A;  3DVM A;  2KI6 C;  3SS4 A;  2LP2 A;  1A75 A;  1QIV A;  1K8U A;  1RTP 1;  2JT8 A;  1KCY A;  4ZCU A;  1NWD A;  4R1E A;  3A4U B;  3D77 A;  1KFU L;  2Y5I A;  1IQ5 A;  1MXL C;  4CFR A;  4XYN A;  1CFF A;  3CZ2 A;  3CR4 X;  3NSL A;  3PLF B;  1QS7 A;  4PE0 A;  3D78 A;  5FI6 A;  2BNX A;  2G9B A;  1CDP A;  1N0Y A;  1TUJ A;  2EC6 C;  4AOM A;  1BOD A;  5I8N A;  1RK9 A;  2KFF A;  2KGB C;  3NSK A;  3DD4 A;  1SNL A;  4N5X A;  5CSI A;  2KPH A;  3D10 A;  1DJZ A;  1YUS A;  2M49 B;  5FI7 A;  4QJ3 B;  2KFG A;  1YX8 A;  3CYZ A;  3I5H C;  3SG5 A;  1OW4 A;  3TDI A;  1SMG A;  1S36 A;  1EL4 A;  1M45 A;  1RRO A;  3LK0 A;  2ZFD A;  3EKJ A;  2PYQ A;  1DF0 A;  3DVE A;  1NX0 A;  3C1V A;  3MSE B;  1KWO C;  1Z2C B;  5JOL A;  1UHN A;  4MLW A;  4DIR A;  3KO0 A;  1K95 A;  1OSA A;  3CLN A;  3GK2 A;  2LCP A;  3R1V A;  1NUB A;  1S6C A;  1JUO A;  2R2I A;  2LLU A;  2OS8 B;  1GJY A;  3LCP C;  4FQT A;  5CPV A;  1UUS A;  2KLD A;  3R1O A;  4USL A;  1SL8 A;  1IIO A;  4MRY A;  2PAL A;  3FWC A;  3I5G C;  3R1P A;  4IJ7 A;  3ZWH A;  1KK7 Z;  4GBA A;  2HET A;  2DOQ A;  3SG6 A;  2JRF A;  3NHI A;  2HPS A;  1B1G A;  4ORC B;  3RLZ A;  1M39 A;  1XK4 C;  2WOR A;  3BOW A;  3O6B A;  3S0D A;  2OTG B;  1DGU A;  4PHM A;  1B7T Z;  1NSH A;  3EK4 A;  3VB1 A;  2WCL A;  1XFX O;  2GGM A;  3PJI A;  2KI6 D;  2KQY A;  3PN7 C;  1OZS A;  1BG1 A;  1TCF A;  1K93 D;  2WC6 A;  1NCZ A;  3BYA A;  3CZ0 A;  4UPG A;  4L9M A;  1CB1 A;  1B9A A;  2LHI A;  2MRD A;  4PHK A;  4HRH A;  1XFV O;  3O4Y A;  1QV1 A;  2M29 A; 
#chains in the Genus database with same CATH homology
 3QME A;  3D73 A;  4INW A;  3D74 A;  3B87 A;  1OOI X;  1LS8 A;  2QDI A;  2QEV A;  2P70 A;  1TWO A;  2QEB A;  3K1E A;  2WCH A;  2JPO A;  1C3Y A;  1QWV A;  1C3Z A;  3BFA A;  3NHT A;  2GTE A;  3DZT A;  2FJY A;  1ORG A;  2P71 A;  3N7H A;  1OOF A;  3S0A A;  3L4A A;  2ERB A;  3B6X A;  3FE9 A;  4F7F A;  3S0G A;  2QEH A;  1T14 A;  3CAB A;  3B7A A;  3BJH A;  3BFH A;  1OOH A;  3B86 A;  3D77 A;  3CZ2 A;  2WC5 A;  3D78 A;  3DY9 A;  3RZS A;  3V2L A;  1TUJ A;  3S0E A;  3DXL A;  4PT1 A;  2KPH A;  3L4L A;  3B88 A;  3CYZ A;  1OW4 A;  4OZD A;  1DQE A;  3NGV A;  2WCM A;  3R72 A;  2WCK A;  3OGN A;  3DYE A;  2PQL A;  2QEO A;  1XFR A;  3R1V A;  4FQT A;  3R1O A;  3S0F A;  1GM0 A;  5DIC A;  3R1P A;  3D75 A;  2H8V A;  3Q8I A;  3BFB A;  3CZ1 A;  3NHI A;  2WCJ A;  4INX A;  2L2C A;  5EL2 A;  3FE6 A;  3S0D A;  1OOG A;  3VB1 A;  2WCL A;  3S0B A;  3PJI A;  2WC6 A;  3CZ0 A;  3CDN A;  4JD9 A;  3D76 A;  1P28 A;  3FE8 A;  3L47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...