2WCHA

Structure of bmori gobp2 (general odorant binding protein 2) with bombykal
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 54
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wchA00
2QEOA 3CZ0A 3N7HA 3CZ2A 3K1EA 3OGNA 2WCJA 3S0EA 1OOHA 3D78A 4PT1A 1DQEA 3Q8IA 3QMEA 1ORGA 3B88A 2GTEA 3DXLA 3NGVA 3D73A 3D77A 3VB1A 3NHTA 2FJYA 3PJIA 5DICA 3D76A 3S0DA 3S0FA 3BFAA 3CABA 1OOFA 4F7FA 4OZDA 3CZ1A 3L47A 3R72A 3B7AA 2QEHA 2P71A 3B87A 3FE6A 2WCKA 3B6XA 1C3YA 2WC5A 1OOIX 2ERBA 1XFRA 3R1VA 2PQLA 1LS8A 2JPOA 1GM0A 1TWOA 2QEVA 2H8VA 1T14A 4JD9A 3DZTA 2P70A 3FE9A 3L4LA 2QDIA 3BFHA 1OW4A 2KPHA 2WCLA 3R1PA 3L4AA 3RZSA 2L2CA 3D75A 1P28A 3DY9A 3S0AA 3S0BA 3FE8A 4INXA 3CYZA 1TUJA 3CDNA 3BFBA 3NHIA 1OOGA 2WC6A 3S0GA 4FQTA 3B86A 2WCHA 1C3ZA 2QEBA 5EL2A 3V2LA 4INWA 3BJHA 1QWVA 2WCMA 3D74A 3R1OA 3DYEA
chains in the Genus database with same CATH superfamily
1PVAA 2M9GA 1KWOC 1MXEA 4PHMA 1B7TZ 5I8NA 1DELA 1UHJA 4QJ3B 1L7ZA 1NCZA 1PALA 2MJWB 4CFQA 1W7IB 2F8PA 3OGNA 2LAPA 2WCFA 1Q80A 1ZOTB 2KGRA 2ZNEA 1MR8A 4YGAA 4IJ7A 5JJGA 4PHKA 4D1EA 4I5KA 2ZNDA 2COLB 1ORGA 4P5OE 2I2RE 1L2OB 2M8UA 4F0ZB 1BOCA 1KK7Z 2JT3A 2KOTA 3DXLA 2L5YA 2PMYA 3D73A 4GGNA 1SKTA 5KU1A 1AHRA 1A75A 2IS9A 1CFDA 3TS5B 2LP3A 3PM2A 3NSOA 3O78A 5HKWA 1DJXA 3LCPC 2FCEA 1RFJA 4P2YB 3D76A 3S0DA 1F8HA 1DJHA 1M46A 5I94A 1WLMA 3GOFA 1FF1A 3CZTX 2KBMA 1Y1XA 1YRTB 2BAPA 2M7NA 4E68A 1NYAA 3TDUA 4F7FA 2K7OA 3CZ1A 5CSIA 5DKQA 1J7RA 3L47A 3R72A 2LP2A 1E8AA 2AUCA 4PHNA 4YI9A 1SL9A 1DEKA 2KSPA 4HRGA 1QJTA 1J7PA 3I5FC 1ZFSA 2LLTA 2KI4B 3ZWHA 5AXIA 3UO9A 3PATA 2I94A 1VRKA 3OBVA 1NX0A 2EC6C 3SIBA 3LK1A 1FI5A 2F2OA 3R1VA 1CFPA 1K9PA 1DTLA 2DOQA 1TWOA 1Y1UA 2HQ8A 1F70A 2JNXA 1M39A 2H8VA 1AUIB 1T14A 3DF0B 3O2PA 4JD9A 2LLUA 1K93D 2PYQA 3DZTA 2H2KA 2M0RA 3WHUB 2KBIA 2PALA 1FPWA 4MZJA 1SK6D 1TCOB 2CBLA 5AANA 5CSFA 1JFKA 1J7OA 1XK4A 3M0WA 1JF2A 1F54A 1MXLC 2P6BB 3HCMA 2JU0A 4ZCUA 3BOWB 2B1UA 3RZSA 5HLOA 3A8RA 4HREE 5K89A 1IH0A 1NUBA 1OQPA 3A4UB 3D75A 1UHKA 2MAZA 3S0BA 1U5IB 1RWYA 4DUQA 1WY9A 3RM1A 1K96A 2M1UA 4NDBA 2I18A 1YR5A 2BECA 2E6WA 1G8IA 3KEVA 4FTGA 4QJ4B 3EK8A 2LMUA 3KPXA 1H4BA 2KDHA 3TDIA 2LVIA 2TN4A 4N1GA 1MQ1A 1B7TY 1WRKA 2PVBA 2K7CA 4MRXA 5FI2A 1CLLA 2ZN8A 2OS8C 1CM4A 1GJYA 1KSOA 1SCVA 3IQOA 1QX2A 5BPJA 1LXFC 3PN7C 2L98A 3TZ1A 2BL0B 2QEBA 3O4YA 3KF9A 4M2OA 2QACA 3BJHA 4MRYA 5JOLA 1J55A 1PK0D 2LANA 1KK7Y 4AOMA 2M3WA 1BU3A 3VRNA 2FJYA 3DYEA 1AJ4A 2E30A 1CDNA 1DMOA 1S36A 2QEOA 3I5GB 3OP0A 4OCIA 1CMGA 5HKZA 1K8UA 1JFJA 5IBWA 3CZ0A 4USLA 2BCAA 1SMGA 2K2AA 2HQWA 2L50A 2LVVA 3CGAA 1NSHA 2WCJA 3I5HB 4MEWA 5CPVA 2ISDA 3S0EA 3SG7A 1FI6A 1QLKA 2JTZA 2SASA 1X02A 2KAXA 5ER4X 1TOPA 5HYDA 1XA5A 3EVUA 1IQ3A 2BCBA 3OX5A 3GK4X 4PALA 2KQYA 1C07A 2JTTA 1H8BA 2LVKA 3D77A 3QRXA 1TCFA 1MWNA 2BBNA 3ICBA 2FOTA 2OTGC 3SG6A 4XYNA 3BQ3A 5HLVA 4I5NB 1S6CA 2PSRA 3F45A 5TNCA 3S0FA 3CR4X 3JVTC 2KYFA 1RTP1 4OKHA 3BFAA 3GK1A 4ETOA 2CT9A 3CABA 1OOFA 3DD4A 3BUOB 4KYNA 2LMTA 4C0LA 1XFWO 4NDDA 5I2LA 3SS3A 2Y1NA 3FIAA 3IF7A 3UNWA 1S5GY 2MA2A 1XK4C 1NIWA 1KQMC 3B7AA 1SR6C 1V1GA 4YGEB 1PULA 4PE4A 2NLNA 1JF0A 1TUZA 3B87A 2LC5A 1CDLA 2KYCA 4JPZB 1KK8C 3HX4A 4NQGA 1NCXA 2BKIB 4C0KA 2HETA 3FWCA 3PN7B 1XFRA 3SS4A 2OPOA 1BLQA 1DVIA 1R2UA 2WORA 1QATA 2QPTA 4ZCVA 2M7LA 2LV7A 2PQLA 3PLFB 1TRFA 3D0YA 4ORAB 4PE7A 5B8IB 3MSEB 5HKYA 5FI7A 4TNCA 1PVBA 3SS5A 1B4CA 1S3PA 2HPSA 3CWGA 1A2XA 2Y4QA 1DJYA 5D7FA 4DIRA 1RK9A 1SL7A 2P70A 3NSIA 1OMRA 1NWDA 1CNPA 1TNQA 2GGZA 1CFCA 1QVIZ 1BR1B 1UHHA 4NDCA 2SCPA 4M2QA 4ORBB 3PSRA 2ZKMX 1QLSA 1ALVA 1CDPA 3I5IB 2L2CA 1SCMC 1SL8A 1JUOA 5GQQC 1DJIA 4MN0A 1G4YR 4XJKA 5F6TA 1LA0A 1B1GA 2JWWA 3DVMA 4A4BA 1CTRA 1EJ3A 1ODBA 3CYZA 2BBMA 5PALA 3CDNA 2KFFA 2VRGA 4YGCB 1ZMZA 4CPVA 1BR4B 1C7VA 1N0YA 3BFBA 3BUNB 4BY5A 3SJSA 1KWOB 1XO5A 1AJ5A 3KO0A 1B9AA 3VRQA 2LE9B 2BKHB 1ALWA 3H4SE 3WHTB 2LUCA 2WC6A 1A29A 1OZSA 1YTZC 1WDCC 2WCHA 3B86A 3NXAA 4FQTA 1RECA 4HRHA 3WXAA 1IWQA 1EG3A 1CFFA 4U8DA 1WRLA 1JSAA 5EL2A 3V2LA 1RROA 2L0PA 4I5JA 4WRIA 1B8CA 1KQMB 2LHIA 4OVNF 5I2OA 1JBAA 3GK2A 1D1OA 1DT7B 1MF8B 1DJGA 3N7HA 1Z2CB 2G9BA 3CZ2A 3K1EA 4ORCB 3OB1B 3BOWA 1F4QA 2Y5IA 4CIDA 5HL1A 3SG5A 1DQEA 3Q8IA 4CLNA 3SG4A 1V1FA 1BT6A 1YVLA 2ZRSA 3B88A 1OSAA 2GTEA 1QX7A 1CM1A 1DC1A 1DF0B 2CTNA 3PFVA 3VROA 1U5IA 3EKHA 5D69A 4BY4A 2GGMA 3OX6A 4DS7A 1GGZA 1XFVO 2WCEA 5FI6A 1KFUL 1N65A 1YX7A 1GGWA 1MUXA 4OV2A 2K2FA 2Q4UA 1QIWA 1UWOA 5ER5A 4AQIA 2MLEC 2F33A 1L2OC 1SCMB 3PM8A 3I5FB 4QJ5B 2JPTA 2M97A 1IJ5A 2NZ0A 3OHMB 1Y0VH 1QXPA 4GGFA 2EC6B 2L51A 4OZDA 4DRWA 3TS5C 4PHJA 2F3YA 1HT9A 2QEHA 2CNPA 1KFXL 2P71A 1CB1A 4WQ3A 1LVCD 4YBHB 1B47A 1PSBA 3FE6A 4PDZA 2WCKA 3BUWB 1F71A 5CSNA 1IRJA 1J1EA 1C3YA 2WC5A 4IL1A 1UHIA 2LNKA 1OOIX 1SPYA 1TIZA 2CCMA 3LLEA 1EG4A 1N2DA 1TTXA 3AAJA 2L2EA 5DKRA 3TUYC 1YURA 3PALA 4ICBA 1QX5B 1LS8A 1GM0A 2EHBA 1YUSA 5I2QA 2PRUA 3D0YB 4YGBB 1ZUZA 1M45A 3NSLA 2H61A 2A4JA 4GNKB 3BXKA 4GAOA 2FCDA 2KQ6A 1MHOA 4MSPA 3L4LA 3O6BA 2KI4C 1Y6WA 3BFHA 1JWDA 1B8LA 3LL8B 2L5XB 2KPHA 2WCLA 1K2HA 5AEQA 3R1PA 2MLFC 4M2PA 2HF5A 3EG5B 3CR2A 3TDZA 3BUXB 3BYAA 1QTXA 1YUUA 4R1EA 4OR9B 5AERA 1KQVA 3DY9A 2D8NA 2OS8B 1GQMA 1M63B 1QASA 2MBXA 4N1FA 2KLEA 3S0AA 2JQ6A 1QIVA 3CS1A 3FE8A 1EL4A 2KI6D 4INXA 1A75B 3IQQA 1CDMA 1TUJA 1NP8A 3EK4A 3DVEA 1IJ6A 2BNXA 2JRFA 1B8RA 1YRUB 1R6PA 1XYDA 2JXLA 1XVJA 5KSZA 2KFGA 1Y1AA 4FQOA 1W9ZA 1TNWA 1JC2A 1OOGA 2Y1MA 4PCWA 1OMVA 1QV0A 1C3ZA 5J3XA 1KCYA 3O4XA 1NX1A 4INWA 1TN4A 1CMFA 2M29A 1NX3A 1YUTA 2JC2A 2WCMA 3D74A 3R1OA 2BE4A 2I7AA 3CR5X 4MBEA 4PE1A 1DJZA 1SRAA 5DKNA 1OOJA 2JULA 2KAYA 1QS7A 2O60A 1K94A 2K60A 3AKAA 2MHHA 4N5XA 4XJKB 3EK7A 1ZACA 1SW8A 2L4IA 2LLSA 1DJWA 2BL0C 2OTGB 4GGFC 2KHNA 2L4HA 4I5LB 5KTYA 1OOHA 3TUYB 3D78A 2FJUB 1F4OA 1QV1A 2CXJA 4MLWA 4PT1A 2K0JA 3QMEA 3LK0A 2LUXA 2R2IA 3JVTB 2BCXA 2ZRTA 1A03A 3NGVA 1J7QA 1IQ5A 3I5GC 1SNLA 1KFUS 5CSJA 1F55A 1S6JA 3VB1A 2LHLA 3NHTA 2WC8A 1SBJA 4A4CA 2LCPA 1S1EA 1SR6B 3I5HC 1AK8A 3VRRA 2JT8A 3PJIA 5DICA 3ZNIA 1SYMA 1FW4A 3DF0A 4AQJA 1LINA 2JZIA 2NXQA 2V53A 2K7BA 1S5GZ 1K95A 2KAVA 1KK8B 2H61C 2JOJA 4GPLB 4JQ0D 2RGIA 1BG1A 1K9UA 1EH2A 4UPGA 2K61A 1KFXS 1W7JB 2O5GA 4GFTA 1UURA 2LVJA 2MRDA 3AAKA 4WQ2A 4YI8A 4GUKA 4L9MA 1IKUA 1IGVA 1LA3A 3JTDC 3FWBA 2F2PA 4GBAA 2KFHA 3BUMB 2LM5A 2AMIA 3RLZA 5FYXA 1OZOA 1CLMA 1BODA 5D3OA 3B6XA 2YGUA 1SY9A 3SG2A 5AFPA 2NCOA 4C0JA 2ERBA 1TNXA 3KHEA 3NSKA 3OB2B 1WLZA 1DGVA 1NPQA 2JPOA 1YX8A 3EVRA 1AP4A 2QEVA 4YRUA 1IIOA 1C7WA 1XFYO 1NX2A 3FS7A 4JWQA 3VRPA 1FBVA 2WCBA 1DF0A 1DGUA 3FE9A 2QDIA 2JNFA 2ZFDA 4CFRA 1CLBA 1OW4A 2ZN9A 1G33A 3WNXB 1XFUO 1XFZO 2WNDA 4Q04A 3L4AA 3EKJA 4MVFA 1SSEB 1IG5A 1BMOA 1LKJA 1XFXO 1J1DA 2KI6C 3VGOA 1P28A 1BJFA 1QVIY 1S6IA 2NCPA 3EVVA 4MZKA 2M49B 1RJVA 3DVKA 1WDCB 2GV5A 3CLNA 2K7DA 2LMVA 4HSZA 4YGDB 1YVHA 2G2BA 1K9KA 1UUSA 1WRZA 2EGDA 2PASA 1M31A 1NCYA 1UHNA 3C1VA 3SIAA 3NHIA 3I5IC 1A4PA 5G08A 3CTNA 2K8MB 2KNEA 3IVTA 1TNPA 1UP5A 1K90D 2JT0A 2KGBC 2JXCA 1OMDA 3K21A 2Q91A 3S0GA 1AVSA 1Z4HA 1PSRA 3AKBA 3SG3A 4MZLA 1KSMA 4DCKA 2WOSA 4PE0A 3E3RA 2BE6A 3DVJA 3D10A 1QWVA 2M1KB 1PRWA 1CKKA 2AAOA 1BF5A 2KLDA 3JTDB 1HQVA 1S26D 1EXRA 2F3ZA 1OE9B 4JKTA
chains in the Genus database with same CATH topology
2QEOA 3CZ0A 3N7HA 3CZ2A 3K1EA 3OGNA 2WCJA 3S0EA 1OOHA 3D78A 4PT1A 1DQEA 3Q8IA 3QMEA 1ORGA 3B88A 2GTEA 3DXLA 3NGVA 3D73A 3D77A 3VB1A 3NHTA 2FJYA 3PJIA 5DICA 3D76A 3S0DA 3S0FA 3BFAA 3CABA 1OOFA 4F7FA 4OZDA 3CZ1A 3L47A 3R72A 3B7AA 2QEHA 2P71A 3B87A 3FE6A 2WCKA 3B6XA 1C3YA 2WC5A 1OOIX 2ERBA 1XFRA 3R1VA 2PQLA 1LS8A 2JPOA 1GM0A 1TWOA 2QEVA 2H8VA 1T14A 4JD9A 3DZTA 2P70A 3FE9A 3L4LA 2QDIA 3BFHA 1OW4A 2KPHA 2WCLA 3R1PA 3L4AA 3RZSA 2L2CA 3D75A 1P28A 3DY9A 3S0AA 3S0BA 3FE8A 4INXA 3CYZA 1TUJA 3CDNA 3BFBA 3NHIA 1OOGA 2WC6A 3S0GA 4FQTA 3B86A 2WCHA 1C3ZA 2QEBA 5EL2A 3V2LA 4INWA 3BJHA 1QWVA 2WCMA 3D74A 3R1OA 3DYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEO A;  3CZ0 A;  3N7H A;  3CZ2 A;  3K1E A;  3OGN A;  2WCJ A;  3S0E A;  1OOH A;  3D78 A;  4PT1 A;  1DQE A;  3Q8I A;  3QME A;  1ORG A;  3B88 A;  2GTE A;  3DXL A;  3NGV A;  3D73 A;  3D77 A;  3VB1 A;  3NHT A;  2FJY A;  3PJI A;  5DIC A;  3D76 A;  3S0D A;  3S0F A;  3BFA A;  3CAB A;  1OOF A;  4F7F A;  4OZD A;  3CZ1 A;  3L47 A;  3R72 A;  3B7A A;  2QEH A;  2P71 A;  3B87 A;  3FE6 A;  2WCK A;  3B6X A;  1C3Y A;  2WC5 A;  1OOI X;  2ERB A;  1XFR A;  3R1V A;  2PQL A;  1LS8 A;  2JPO A;  1GM0 A;  1TWO A;  2QEV A;  2H8V A;  1T14 A;  4JD9 A;  3DZT A;  2P70 A;  3FE9 A;  3L4L A;  2QDI A;  3BFH A;  1OW4 A;  2KPH A;  2WCL A;  3R1P A;  3L4A A;  3RZS A;  2L2C A;  3D75 A;  1P28 A;  3DY9 A;  3S0A A;  3S0B A;  3FE8 A;  4INX A;  3CYZ A;  1TUJ A;  3CDN A;  3BFB A;  3NHI A;  1OOG A;  2WC6 A;  3S0G A;  4FQT A;  3B86 A;  2WCH A;  1C3Z A;  2QEB A;  5EL2 A;  3V2L A;  4INW A;  3BJH A;  1QWV A;  2WCM A;  3D74 A;  3R1O A;  3DYE A; 
#chains in the Genus database with same CATH topology
 1PVA A;  2M9G A;  1KWO C;  1MXE A;  4PHM A;  1B7T Z;  5I8N A;  1DEL A;  1UHJ A;  4QJ3 B;  1L7Z A;  1NCZ A;  1PAL A;  2MJW B;  4CFQ A;  1W7I B;  2F8P A;  3OGN A;  2LAP A;  2WCF A;  1Q80 A;  1ZOT B;  2KGR A;  2ZNE A;  1MR8 A;  4YGA A;  4IJ7 A;  5JJG A;  4PHK A;  4D1E A;  4I5K A;  2ZND A;  2COL B;  1ORG A;  4P5O E;  2I2R E;  1L2O B;  2M8U A;  4F0Z B;  1BOC A;  1KK7 Z;  2JT3 A;  2KOT A;  3DXL A;  2L5Y A;  2PMY A;  3D73 A;  4GGN A;  1SKT A;  5KU1 A;  1AHR A;  1A75 A;  2IS9 A;  1CFD A;  3TS5 B;  2LP3 A;  3PM2 A;  3NSO A;  3O78 A;  5HKW A;  1DJX A;  3LCP C;  2FCE A;  1RFJ A;  4P2Y B;  3D76 A;  3S0D A;  1F8H A;  1DJH A;  1M46 A;  5I94 A;  1WLM A;  3GOF A;  1FF1 A;  3CZT X;  2KBM A;  1Y1X A;  1YRT B;  2BAP A;  2M7N A;  4E68 A;  1NYA A;  3TDU A;  4F7F A;  2K7O A;  3CZ1 A;  5CSI A;  5DKQ A;  1J7R A;  3L47 A;  3R72 A;  2LP2 A;  1E8A A;  2AUC A;  4PHN A;  4YI9 A;  1SL9 A;  1DEK A;  2KSP A;  4HRG A;  1QJT A;  1J7P A;  3I5F C;  1ZFS A;  2LLT A;  2KI4 B;  3ZWH A;  5AXI A;  3UO9 A;  3PAT A;  2I94 A;  1VRK A;  3OBV A;  1NX0 A;  2EC6 C;  3SIB A;  3LK1 A;  1FI5 A;  2F2O A;  3R1V A;  1CFP A;  1K9P A;  1DTL A;  2DOQ A;  1TWO A;  1Y1U A;  2HQ8 A;  1F70 A;  2JNX A;  1M39 A;  2H8V A;  1AUI B;  1T14 A;  3DF0 B;  3O2P A;  4JD9 A;  2LLU A;  1K93 D;  2PYQ A;  3DZT A;  2H2K A;  2M0R A;  3WHU B;  2KBI A;  2PAL A;  1FPW A;  4MZJ A;  1SK6 D;  1TCO B;  2CBL A;  5AAN A;  5CSF A;  1JFK A;  1J7O A;  1XK4 A;  3M0W A;  1JF2 A;  1F54 A;  1MXL C;  2P6B B;  3HCM A;  2JU0 A;  4ZCU A;  3BOW B;  2B1U A;  3RZS A;  5HLO A;  3A8R A;  4HRE E;  5K89 A;  1IH0 A;  1NUB A;  1OQP A;  3A4U B;  3D75 A;  1UHK A;  2MAZ A;  3S0B A;  1U5I B;  1RWY A;  4DUQ A;  1WY9 A;  3RM1 A;  1K96 A;  2M1U A;  4NDB A;  2I18 A;  1YR5 A;  2BEC A;  2E6W A;  1G8I A;  3KEV A;  4FTG A;  4QJ4 B;  3EK8 A;  2LMU A;  3KPX A;  1H4B A;  2KDH A;  3TDI A;  2LVI A;  2TN4 A;  4N1G A;  1MQ1 A;  1B7T Y;  1WRK A;  2PVB A;  2K7C A;  4MRX A;  5FI2 A;  1CLL A;  2ZN8 A;  2OS8 C;  1CM4 A;  1GJY A;  1KSO A;  1SCV A;  3IQO A;  1QX2 A;  5BPJ A;  1LXF C;  3PN7 C;  2L98 A;  3TZ1 A;  2BL0 B;  2QEB A;  3O4Y A;  3KF9 A;  4M2O A;  2QAC A;  3BJH A;  4MRY A;  5JOL A;  1J55 A;  1PK0 D;  2LAN A;  1KK7 Y;  4AOM A;  2M3W A;  1BU3 A;  3VRN A;  2FJY A;  3DYE A;  1AJ4 A;  2E30 A;  1CDN A;  1DMO A;  1S36 A;  2QEO A;  3I5G B;  3OP0 A;  4OCI A;  1CMG A;  5HKZ A;  1K8U A;  1JFJ A;  5IBW A;  3CZ0 A;  4USL A;  2BCA A;  1SMG A;  2K2A A;  2HQW A;  2L50 A;  2LVV A;  3CGA A;  1NSH A;  2WCJ A;  3I5H B;  4MEW A;  5CPV A;  2ISD A;  3S0E A;  3SG7 A;  1FI6 A;  1QLK A;  2JTZ A;  2SAS A;  1X02 A;  2KAX A;  5ER4 X;  1TOP A;  5HYD A;  1XA5 A;  3EVU A;  1IQ3 A;  2BCB A;  3OX5 A;  3GK4 X;  4PAL A;  2KQY A;  1C07 A;  2JTT A;  1H8B A;  2LVK A;  3D77 A;  3QRX A;  1TCF A;  1MWN A;  2BBN A;  3ICB A;  2FOT A;  2OTG C;  3SG6 A;  4XYN A;  3BQ3 A;  5HLV A;  4I5N B;  1S6C A;  2PSR A;  3F45 A;  5TNC A;  3S0F A;  3CR4 X;  3JVT C;  2KYF A;  1RTP 1;  4OKH A;  3BFA A;  3GK1 A;  4ETO A;  2CT9 A;  3CAB A;  1OOF A;  3DD4 A;  3BUO B;  4KYN A;  2LMT A;  4C0L A;  1XFW O;  4NDD A;  5I2L A;  3SS3 A;  2Y1N A;  3FIA A;  3IF7 A;  3UNW A;  1S5G Y;  2MA2 A;  1XK4 C;  1NIW A;  1KQM C;  3B7A A;  1SR6 C;  1V1G A;  4YGE B;  1PUL A;  4PE4 A;  2NLN A;  1JF0 A;  1TUZ A;  3B87 A;  2LC5 A;  1CDL A;  2KYC A;  4JPZ B;  1KK8 C;  3HX4 A;  4NQG A;  1NCX A;  2BKI B;  4C0K A;  2HET A;  3FWC A;  3PN7 B;  1XFR A;  3SS4 A;  2OPO A;  1BLQ A;  1DVI A;  1R2U A;  2WOR A;  1QAT A;  2QPT A;  4ZCV A;  2M7L A;  2LV7 A;  2PQL A;  3PLF B;  1TRF A;  3D0Y A;  4ORA B;  4PE7 A;  5B8I B;  3MSE B;  5HKY A;  5FI7 A;  4TNC A;  1PVB A;  3SS5 A;  1B4C A;  1S3P A;  2HPS A;  3CWG A;  1A2X A;  2Y4Q A;  1DJY A;  5D7F A;  4DIR A;  1RK9 A;  1SL7 A;  2P70 A;  3NSI A;  1OMR A;  1NWD A;  1CNP A;  1TNQ A;  2GGZ A;  1CFC A;  1QVI Z;  1BR1 B;  1UHH A;  4NDC A;  2SCP A;  4M2Q A;  4ORB B;  3PSR A;  2ZKM X;  1QLS A;  1ALV A;  1CDP A;  3I5I B;  2L2C A;  1SCM C;  1SL8 A;  1JUO A;  5GQQ C;  1DJI A;  4MN0 A;  1G4Y R;  4XJK A;  5F6T A;  1LA0 A;  1B1G A;  2JWW A;  3DVM A;  4A4B A;  1CTR A;  1EJ3 A;  1ODB A;  3CYZ A;  2BBM A;  5PAL A;  3CDN A;  2KFF A;  2VRG A;  4YGC B;  1ZMZ A;  4CPV A;  1BR4 B;  1C7V A;  1N0Y A;  3BFB A;  3BUN B;  4BY5 A;  3SJS A;  1KWO B;  1XO5 A;  1AJ5 A;  3KO0 A;  1B9A A;  3VRQ A;  2LE9 B;  2BKH B;  1ALW A;  3H4S E;  3WHT B;  2LUC A;  2WC6 A;  1A29 A;  1OZS A;  1YTZ C;  1WDC C;  2WCH A;  3B86 A;  3NXA A;  4FQT A;  1REC A;  4HRH A;  3WXA A;  1IWQ A;  1EG3 A;  1CFF A;  4U8D A;  1WRL A;  1JSA A;  5EL2 A;  3V2L A;  1RRO A;  2L0P A;  4I5J A;  4WRI A;  1B8C A;  1KQM B;  2LHI A;  4OVN F;  5I2O A;  1JBA A;  3GK2 A;  1D1O A;  1DT7 B;  1MF8 B;  1DJG A;  3N7H A;  1Z2C B;  2G9B A;  3CZ2 A;  3K1E A;  4ORC B;  3OB1 B;  3BOW A;  1F4Q A;  2Y5I A;  4CID A;  5HL1 A;  3SG5 A;  1DQE A;  3Q8I A;  4CLN A;  3SG4 A;  1V1F A;  1BT6 A;  1YVL A;  2ZRS A;  3B88 A;  1OSA A;  2GTE A;  1QX7 A;  1CM1 A;  1DC1 A;  1DF0 B;  2CTN A;  3PFV A;  3VRO A;  1U5I A;  3EKH A;  5D69 A;  4BY4 A;  2GGM A;  3OX6 A;  4DS7 A;  1GGZ A;  1XFV O;  2WCE A;  5FI6 A;  1KFU L;  1N65 A;  1YX7 A;  1GGW A;  1MUX A;  4OV2 A;  2K2F A;  2Q4U A;  1QIW A;  1UWO A;  5ER5 A;  4AQI A;  2MLE C;  2F33 A;  1L2O C;  1SCM B;  3PM8 A;  3I5F B;  4QJ5 B;  2JPT A;  2M97 A;  1IJ5 A;  2NZ0 A;  3OHM B;  1Y0V H;  1QXP A;  4GGF A;  2EC6 B;  2L51 A;  4OZD A;  4DRW A;  3TS5 C;  4PHJ A;  2F3Y A;  1HT9 A;  2QEH A;  2CNP A;  1KFX L;  2P71 A;  1CB1 A;  4WQ3 A;  1LVC D;  4YBH B;  1B47 A;  1PSB A;  3FE6 A;  4PDZ A;  2WCK A;  3BUW B;  1F71 A;  5CSN A;  1IRJ A;  1J1E A;  1C3Y A;  2WC5 A;  4IL1 A;  1UHI A;  2LNK A;  1OOI X;  1SPY A;  1TIZ A;  2CCM A;  3LLE A;  1EG4 A;  1N2D A;  1TTX A;  3AAJ A;  2L2E A;  5DKR A;  3TUY C;  1YUR A;  3PAL A;  4ICB A;  1QX5 B;  1LS8 A;  1GM0 A;  2EHB A;  1YUS A;  5I2Q A;  2PRU A;  3D0Y B;  4YGB B;  1ZUZ A;  1M45 A;  3NSL A;  2H61 A;  2A4J A;  4GNK B;  3BXK A;  4GAO A;  2FCD A;  2KQ6 A;  1MHO A;  4MSP A;  3L4L A;  3O6B A;  2KI4 C;  1Y6W A;  3BFH A;  1JWD A;  1B8L A;  3LL8 B;  2L5X B;  2KPH A;  2WCL A;  1K2H A;  5AEQ A;  3R1P A;  2MLF C;  4M2P A;  2HF5 A;  3EG5 B;  3CR2 A;  3TDZ A;  3BUX B;  3BYA A;  1QTX A;  1YUU A;  4R1E A;  4OR9 B;  5AER A;  1KQV A;  3DY9 A;  2D8N A;  2OS8 B;  1GQM A;  1M63 B;  1QAS A;  2MBX A;  4N1F A;  2KLE A;  3S0A A;  2JQ6 A;  1QIV A;  3CS1 A;  3FE8 A;  1EL4 A;  2KI6 D;  4INX A;  1A75 B;  3IQQ A;  1CDM A;  1TUJ A;  1NP8 A;  3EK4 A;  3DVE A;  1IJ6 A;  2BNX A;  2JRF A;  1B8R A;  1YRU B;  1R6P A;  1XYD A;  2JXL A;  1XVJ A;  5KSZ A;  2KFG A;  1Y1A A;  4FQO A;  1W9Z A;  1TNW A;  1JC2 A;  1OOG A;  2Y1M A;  4PCW A;  1OMV A;  1QV0 A;  1C3Z A;  5J3X A;  1KCY A;  3O4X A;  1NX1 A;  4INW A;  1TN4 A;  1CMF A;  2M29 A;  1NX3 A;  1YUT A;  2JC2 A;  2WCM A;  3D74 A;  3R1O A;  2BE4 A;  2I7A A;  3CR5 X;  4MBE A;  4PE1 A;  1DJZ A;  1SRA A;  5DKN A;  1OOJ A;  2JUL A;  2KAY A;  1QS7 A;  2O60 A;  1K94 A;  2K60 A;  3AKA A;  2MHH A;  4N5X A;  4XJK B;  3EK7 A;  1ZAC A;  1SW8 A;  2L4I A;  2LLS A;  1DJW A;  2BL0 C;  2OTG B;  4GGF C;  2KHN A;  2L4H A;  4I5L B;  5KTY A;  1OOH A;  3TUY B;  3D78 A;  2FJU B;  1F4O A;  1QV1 A;  2CXJ A;  4MLW A;  4PT1 A;  2K0J A;  3QME A;  3LK0 A;  2LUX A;  2R2I A;  3JVT B;  2BCX A;  2ZRT A;  1A03 A;  3NGV A;  1J7Q A;  1IQ5 A;  3I5G C;  1SNL A;  1KFU S;  5CSJ A;  1F55 A;  1S6J A;  3VB1 A;  2LHL A;  3NHT A;  2WC8 A;  1SBJ A;  4A4C A;  2LCP A;  1S1E A;  1SR6 B;  3I5H C;  1AK8 A;  3VRR A;  2JT8 A;  3PJI A;  5DIC A;  3ZNI A;  1SYM A;  1FW4 A;  3DF0 A;  4AQJ A;  1LIN A;  2JZI A;  2NXQ A;  2V53 A;  2K7B A;  1S5G Z;  1K95 A;  2KAV A;  1KK8 B;  2H61 C;  2JOJ A;  4GPL B;  4JQ0 D;  2RGI A;  1BG1 A;  1K9U A;  1EH2 A;  4UPG A;  2K61 A;  1KFX S;  1W7J B;  2O5G A;  4GFT A;  1UUR A;  2LVJ A;  2MRD A;  3AAK A;  4WQ2 A;  4YI8 A;  4GUK A;  4L9M A;  1IKU A;  1IGV A;  1LA3 A;  3JTD C;  3FWB A;  2F2P A;  4GBA A;  2KFH A;  3BUM B;  2LM5 A;  2AMI A;  3RLZ A;  5FYX A;  1OZO A;  1CLM A;  1BOD A;  5D3O A;  3B6X A;  2YGU A;  1SY9 A;  3SG2 A;  5AFP A;  2NCO A;  4C0J A;  2ERB A;  1TNX A;  3KHE A;  3NSK A;  3OB2 B;  1WLZ A;  1DGV A;  1NPQ A;  2JPO A;  1YX8 A;  3EVR A;  1AP4 A;  2QEV A;  4YRU A;  1IIO A;  1C7W A;  1XFY O;  1NX2 A;  3FS7 A;  4JWQ A;  3VRP A;  1FBV A;  2WCB A;  1DF0 A;  1DGU A;  3FE9 A;  2QDI A;  2JNF A;  2ZFD A;  4CFR A;  1CLB A;  1OW4 A;  2ZN9 A;  1G33 A;  3WNX B;  1XFU O;  1XFZ O;  2WND A;  4Q04 A;  3L4A A;  3EKJ A;  4MVF A;  1SSE B;  1IG5 A;  1BMO A;  1LKJ A;  1XFX O;  1J1D A;  2KI6 C;  3VGO A;  1P28 A;  1BJF A;  1QVI Y;  1S6I A;  2NCP A;  3EVV A;  4MZK A;  2M49 B;  1RJV A;  3DVK A;  1WDC B;  2GV5 A;  3CLN A;  2K7D A;  2LMV A;  4HSZ A;  4YGD B;  1YVH A;  2G2B A;  1K9K A;  1UUS A;  1WRZ A;  2EGD A;  2PAS A;  1M31 A;  1NCY A;  1UHN A;  3C1V A;  3SIA A;  3NHI A;  3I5I C;  1A4P A;  5G08 A;  3CTN A;  2K8M B;  2KNE A;  3IVT A;  1TNP A;  1UP5 A;  1K90 D;  2JT0 A;  2KGB C;  2JXC A;  1OMD A;  3K21 A;  2Q91 A;  3S0G A;  1AVS A;  1Z4H A;  1PSR A;  3AKB A;  3SG3 A;  4MZL A;  1KSM A;  4DCK A;  2WOS A;  4PE0 A;  3E3R A;  2BE6 A;  3DVJ A;  3D10 A;  1QWV A;  2M1K B;  1PRW A;  1CKK A;  2AAO A;  1BF5 A;  2KLD A;  3JTD B;  1HQV A;  1S26 D;  1EXR A;  2F3Z A;  1OE9 B;  4JKT A; 
#chains in the Genus database with same CATH homology
 2QEO A;  3CZ0 A;  3N7H A;  3CZ2 A;  3K1E A;  3OGN A;  2WCJ A;  3S0E A;  1OOH A;  3D78 A;  4PT1 A;  1DQE A;  3Q8I A;  3QME A;  1ORG A;  3B88 A;  2GTE A;  3DXL A;  3NGV A;  3D73 A;  3D77 A;  3VB1 A;  3NHT A;  2FJY A;  3PJI A;  5DIC A;  3D76 A;  3S0D A;  3S0F A;  3BFA A;  3CAB A;  1OOF A;  4F7F A;  4OZD A;  3CZ1 A;  3L47 A;  3R72 A;  3B7A A;  2QEH A;  2P71 A;  3B87 A;  3FE6 A;  2WCK A;  3B6X A;  1C3Y A;  2WC5 A;  1OOI X;  2ERB A;  1XFR A;  3R1V A;  2PQL A;  1LS8 A;  2JPO A;  1GM0 A;  1TWO A;  2QEV A;  2H8V A;  1T14 A;  4JD9 A;  3DZT A;  2P70 A;  3FE9 A;  3L4L A;  2QDI A;  3BFH A;  1OW4 A;  2KPH A;  2WCL A;  3R1P A;  3L4A A;  3RZS A;  2L2C A;  3D75 A;  1P28 A;  3DY9 A;  3S0A A;  3S0B A;  3FE8 A;  4INX A;  3CYZ A;  1TUJ A;  3CDN A;  3BFB A;  3NHI A;  1OOG A;  2WC6 A;  3S0G A;  4FQT A;  3B86 A;  2WCH A;  1C3Z A;  2QEB A;  5EL2 A;  3V2L A;  4INW A;  3BJH A;  1QWV A;  2WCM A;  3D74 A;  3R1O A;  3DYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...