5F6TA

Structure of calexcitin-gd3+ complex.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
185
structure length
185
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calexcitin
publication title Binding of Gd(3+) to the neuronal signalling protein calexcitin identifies an exchangeable Ca(2+)-binding site.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Calcium-binding protein
total genus 70
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2015-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5f6tA00
4MZJA 3SJSA 2K2AA 1OMDA 4MRYA 1NIWA 2G2BA 4XJKA 4OVNF 1KSOA 3BXKA 3SG7A 1EG4A 1NCYA 3D0YB 2AMIA 1MR8A 3PFVA 1DT7B 1NP8A 3DF0A 4P5OE 3BQ3A 4NQGA 3C1VA 1OOJA 1ZMZA 3VRNA 1XFVO 1M63B 4FQOA 2ZNEA 4PE4A 2HPSA 2P6BB 3LK0A 4DIRA 4GGNA 3WHTB 4ZCUA 1CDLA 4OV2A 3D10A 1QLSA 2BE6A 1GGWA 1TIZA 1IQ5A 2F2OA 1NX3A 2KYFA 1B8RA 2L4HA 1MF8B 1QV1A 2BCAA 1N0YA 1XVJA 3TDUA 3CWGA 4M2QA 3BUNB 1KQVA 4GGFC 5I2LA 1ZOTB 4YGCB 1ALWA 2WOSA 2FOTA 2PMYA 1A2XA 2IS9A 2M9GA 1F54A 1PK0D 3WHUB 3CLNA 5KSZA 2LLTA 1DJHA 2CT9A 1CTRA 1BG1A 1UURA 1TTXA 1FPWA 1G4YR 2A4JA 2JT3A 1YRTB 1PSRA 2HETA 2K7OA 1KFUS 5TNCA 3FIAA 3EVVA 2JXCA 2M29A 1JFKA 3NSKA 2E6WA 4YBHB 5BPJA 2Q91A 1SPYA 1BR4B 1QX2A 1JWDA 4OR9B 3TS5C 5PALA 3VRQA 1YR5A 1SY9A 2JRFA 1SL8A 3SIBA 3TS5B 1B8LA 2CNPA 3SG3A 3TDIA 1WRZA 2EC6C 4A4CA 2M1KB 5AFPA 2JT0A 5IBWA 1EG3A 1PULA 1AJ5A 1NPQA 3F45A 1WRKA 1BT6A 2KYCA 2K7BA 2F33A 1NYAA 2KHNA 3E3RA 1YUTA 2CXJA 4TNCA 3WNXB 1PRWA 2NXQA 3VROA 3BOWB 1JSAA 3BUXB 1FI5A 3I5HC 1JF0A 1NSHA 3I5HB 2FJUB 2JXLA 4N5XA 1HT9A 1S6JA 2BE4A 1B1GA 1RECA 3CGAA 4I5JA 3OB1B 5K89A 1KK7Z 1KCYA 4WQ3A 1B8CA 2SCPA 4MEWA 5DKNA 2LANA 1NX1A 2JOJA 4OCIA 4M2PA 2RGIA 4N1FA 4Q04A 3JVTB 3KHEA 1VRKA 1DF0A 1DJYA 3KEVA 1WDCC 4BY4A 2JNXA 3DVEA 1WDCB 1K90D 1KFXS 4PALA 1BMOA 1LA3A 2JZIA 1RWYA 2F2PA 1CLMA 1V1FA 2WCBA 1J1EA 2PASA 2Q4UA 1SR6C 2K0JA 3VRRA 1L7ZA 1SR6B 3O6BA 1L2OC 2WCEA 5HYDA 1OZSA 2KBIA 1KSMA 1L2OB 1B9AA 5CSJA 2LVVA 2JT8A 4PHKA 4C0JA 1CM1A 2K7CA 1PSBA 4DS7A 1FF1A 1SRAA 4I5NB 2M3WA 1MXLC 4ORBB 4HSZA 1CDNA 1QVIY 1F70A 2NZ0A 1KQMC 1OZOA 2KSPA 1DGUA 2MBXA 1CM4A 1PVBA 1YUUA 1KQMB 1QVIZ 1U5IB 1UHHA 3GK4X 3KPXA 1ZFSA 5HKWA 1SBJA 1XO5A 1QX7A 5HKYA 3BUOB 2O60A 2V53A 2ZN8A 2K61A 1E8AA 3FS7A 4MVFA 4DCKA 3IF7A 2H61A 2KAVA 5CSIA 2CCMA 1X02A 1XA5A 5D69A 1LXFC 1YTZC 1Q80A 2EGDA 2HQWA 5CSNA 4ZCVA 3I5GC 3NSIA 2BKHB 4DUQA 1CLBA 2PRUA 2LM5A 4CLNA 1QX5B 2LLUA 1QXPA 3I5GB 2M7LA 2WCFA 1SNLA 5HKZA 5AERA 1YX8A 2KDHA 1XFYO 4MN0A 3IQQA 4PE0A 2KAXA 2ZNDA 2OPOA 4PHJA 3OP0A 1YX7A 1GGZA 3NSOA 1AHRA 2LUCA 2F8PA 1JF2A 2JNFA 1MHOA 1WY9A 1JFJA 3ZNIA 1YRUB 3D0YA 3BUMB 4MZLA 5KU1A 2LMVA 2KGBC 2LNKA 2MA2A 4AQJA 1CFDA 3GK1A 1SL7A 3EK4A 2MRDA 1LVCD 1J7PA 1DJGA 1K2HA 1ALVA 1IWQA 1AP4A 2BCXA 1OQPA 1OSAA 4U8DA 1QJTA 3PLFB 2NCOA 3LK1A 2JTTA 2ZRSA 3OB2B 1MXEA 1DJZA 2BCBA 2M7NA 3I5IC 1QS7A 4PHNA 4PE1A 1SYMA 2KI6D 1TNWA 3I5IB 1YVHA 2ZN9A 2LVKA 2M0RA 5I8NA 5DKQA 3GOFA 3PN7C 2AAOA 1OE9B 2BECA 3PN7B 3OHMB 1IG5A 4GGFA 3SG6A 3TUYC 3TUYB 4C0KA 1F55A 2JULA 1IJ5A 1K93D 3AAJA 4PCWA 1NWDA 1CDPA 1CFFA 1IRJA 2DOQA 1BODA 1Y1XA 2EC6B 3KO0A 2KFHA 3MSEB 5HLVA 3EVUA 1V1GA 2ZFDA 1XFWO 1TNQA 4CPVA 1JC2A 3GK2A 2B1UA 4P2YB 2MJWB 1Y0VH 2LP3A 1A4PA 3TDZA 1J55A 2I18A 4D1EA 1QASA 2I7AA 2NLNA 1TNPA 2MLEC 1AUIB 2KFGA 2LE9B 3FWCA 1Y6WA 4ICBA 4GUKA 2JTZA 4XYNA 4AOMA 1A75B 3EKJA 4ORCB 1M46A 1EL4A 1OMRA 1QLKA 2LC5A 1AJ4A 1XK4C 1BR1B 1TRFA 1LA0A 3AKBA 1IKUA 3QRXA 3DVJA 2L4IA 4MZKA 1CMFA 1M39A 1C7VA 2LHIA 4I5LB 3CR2A 3AKAA 2ISDA 5F6TA 1F4OA 3A8RA 3TZ1A 3BOWA 5ER5A 4QJ4B 5ER4X 2AUCA 1NCZA 1N65A 4OKHA 2JU0A 4JQ0D 1CDMA 1SMGA 1KFUL 1ZACA 2M49B 2PALA 5J3XA 4C0LA 3LLEA 1CFCA 1NX2A 1YUSA 2TN4A 3CS1A 4GBAA 2EHBA 1R6PA 1UHJA 1UUSA 3DD4A 3RM1A 1CLLA 2K8MB 3SG5A 1FBVA 2HQ8A 3ICBA 3M0WA 5GQQC 4FTGA 1QV0A 1N2DA 2CTNA 4R1EA 1CMGA 2KAYA 2K2FA 1BF5A 2Y5IA 4ETOA 2LVIA 1DMOA 4WRIA 1DJIA 3BYAA 2FCDA 1EXRA 2MAZA 1YVLA 3PATA 4MBEA 2F3YA 4XJKB 2LLSA 2LCPA 1PALA 1BOCA 1CFPA 1TCOB 1QATA 2KQYA 4I5KA 4PHMA 1QIWA 2M8UA 4MRXA 1OMVA 2WC8A 1XFUO 3DF0B 1BLQA 1AVSA 1EJ3A 3EVRA 4NDBA 1B4CA 1QIVA 1WRLA 2JC2A 2QPTA 2LMTA 1DJXA 4PE7A 2LUXA 1M45A 3SG4A 1U5IA 2LAPA 4HRHA 2BL0C 3CTNA 1C07A 4PDZA 4NDDA 1KFXL 1XFZO 4A4BA 1F8HA 2BL0B 2Y1NA 1Y1AA 2M97A 1B7TY 3LCPC 1XYDA 2SASA 1F4QA 2KI4C 4YGBB 1B7TZ 4DRWA 4F0ZB 2LP2A 1DTLA 3FWBA 2KI4B 5G08A 1QTXA 3CZTX 5I2OA 1S36A 2Y4QA 1AK8A 2L50A 1K95A 1H8BA 5AANA 1S3PA 2PSRA 1H4BA 3O4YA 1MWNA 1K9KA 1S6CA 2FCEA 2KQ6A 1ODBA 4NDCA 3EKHA 2PVBA 3NSLA 1G33A 4L9MA 3PM8A 2KGRA 1ZUZA 1CNPA 1CB1A 2JPTA 5DKRA 3ZWHA 1SKTA 4GFTA 1Y1UA 1S1EA 2GV5A 3EK8A 1B47A 4AQIA 2QACA 2HF5A 2KI6C 2LHLA 3CR4X 4MLWA 4BY5A 1FW4A 2K7DA 2OTGC 3OX5A 2D8NA 2O5GA 1UHKA 5CSFA 3WXAA 2OTGB 2F3ZA 1R2UA 2R2IA 1DVIA 1JUOA 3HCMA 3JTDC 3PSRA 4E68A 1LINA 3RLZA 3JTDB 5FYXA 3A4UB 4YGAA 3SIAA 2BBMA 4HRGA 2KNEA 1M31A 2L51A 1DGVA 3VRPA 2WORA 2COLB 1J1DA 1W7JB 2NCPA 5D7FA 1TOPA 1SW8A 1TNXA 2L98A 2L5XB 4YGEB 5AEQA 1SK6D 2KOTA 3LL8B 4USLA 1BJFA 2I2RE 4GAOA 5I2QA 1K96A 1WLZA 2KFFA 4MSPA 1KWOC 1MQ1A 4YI9A 5KTYA 4QJ5B 1KWOB 4HREE 3BUWB 1GQMA 1TN4A 1IGVA 1RJVA 4QJ3B 1K94A 1RROA 4YRUA 1DJWA 3AAKA 2MLFC 1DF0B 1HQVA 2M1UA 4GNKB 1EH2A 1JBAA 1UP5A 4GPLB 1BU3A 2L2EA 2Y1MA 5B8IB 2L0PA 1C7WA 3PALA 1LKJA 1TCFA 2WNDA 2ZRTA 2ZKMX 1FI6A 3IQOA 2H2KA 2I94A 4YGDB 3EK7A 1UHIA 1WLMA 1W7IB 1IQ3A 2KBMA 4WQ2A 5JOLA 2GGZA 3I5FC 1A75A 4M2OA 1IJ6A 3I5FB 3HX4A 2LVJA 3JVTC 3O78A 1G8IA 4CFRA 1IH0A 1S6IA 5CPVA 1CKKA 1XK4A 2BKIB 1NX0A 3KF9A 2G9BA 2JQ6A 2JWWA 5HLOA 4JPZB 1K8UA 1UHNA 1S5GY 1SCVA 3OX6A 1SL9A 1RTP1 5AXIA 1NUBA 4CIDA 1XFXO 1J7OA 4JWQA 1S5GZ 3NXAA 2CBLA 4ORAB 1K9PA 3SG2A 1RK9A 1F71A 1J7QA 1MUXA 1SCMC 1K9UA 1GJYA 2E30A 3H4SE 1SCMB 2H61C 3O2PA 2BBNA 4YI8A 5JJGA 2MHHA 2VRGA 3CR5X 4N1GA 1NCXA 2OS8C 1KK8C 3DVKA 2GGMA 2LMUA 2OS8B 1J7RA 3DVMA 1KK8B 1A29A 4UPGA 1PVAA 1A03A 1D1OA 1KK7Y 4IL1A 2LV7A 4CFQA 1YURA 3K21A 3VGOA 1RFJA 1UWOA 1S26D
chains in the Genus database with same CATH superfamily
3D78A 4MZJA 3SJSA 2K2AA 1OMDA 4MRYA 1NIWA 2G2BA 4XJKA 4OVNF 1KSOA 1DEKA 3BXKA 1EG4A 3SG7A 3S0FA 2ERBA 1NCYA 3D0YB 2AMIA 3EG5B 1MR8A 3PFVA 1DT7B 1NP8A 2KPHA 3DF0A 4P5OE 2KLEA 3CDNA 3BQ3A 4NQGA 4F7FA 3C1VA 1OOJA 1ZMZA 1DQEA 1XFVO 3VRNA 1M63B 3R72A 4FQOA 2ZNEA 4PE4A 2HPSA 2P6BB 3LK0A 4DIRA 4GGNA 3WHTB 4ZCUA 1CDLA 2BAPA 4OV2A 3D10A 3S0EA 1QLSA 2BE6A 1GGWA 1TIZA 1IQ5A 2F2OA 1NX3A 2KYFA 1B8RA 2JPOA 2L4HA 4KYNA 1MF8B 1QV1A 2BCAA 1N0YA 1XVJA 3TDUA 3CWGA 4M2QA 3BUNB 1KQVA 4GGFC 5I2LA 1ZOTB 4YGCB 2QEHA 1ALWA 2WOSA 3S0BA 3CZ0A 2FOTA 2PMYA 1A2XA 2IS9A 2M9GA 1F54A 1PK0D 3OBVA 3WHUB 3CLNA 5KSZA 2LLTA 1DJHA 2CT9A 1CTRA 1BG1A 1UURA 1TTXA 1FPWA 1G4YR 2A4JA 2JT3A 1YRTB 1PSRA 2HETA 2K7OA 1KFUS 5TNCA 1Z4HA 3FIAA 3EVVA 2WC5A 3B87A 2JXCA 2M29A 1JFKA 3NSKA 2E6WA 4YBHB 5BPJA 2Q91A 1SPYA 1BR4B 1QX2A 1JWDA 4OR9B 3TS5C 5PALA 3VRQA 1YR5A 1SY9A 2JRFA 1SL8A 3SIBA 3TS5B 1B8LA 2CNPA 3SG3A 3TDIA 1WRZA 2EC6C 3B6XA 4A4CA 2M1KB 5AFPA 2JT0A 5IBWA 1EG3A 1PULA 3D73A 1AJ5A 1NPQA 2WCJA 1WRKA 3F45A 2QEVA 1BT6A 2KYCA 2K7BA 2F33A 1NYAA 2KHNA 3E3RA 1YUTA 2CXJA 3N7HA 4TNCA 3WNXB 1PRWA 2NXQA 3VROA 3BOWB 1JSAA 3BUXB 1FI5A 3I5HC 1JF0A 1NSHA 3I5HB 2FJUB 2JXLA 3L47A 4N5XA 1HT9A 1S6JA 2BE4A 1B1GA 1RECA 3CGAA 4I5JA 3OB1B 5K89A 1KK7Z 1KCYA 4WQ3A 1B8CA 2SCPA 4MEWA 5DKNA 2LANA 1NX1A 2QEBA 2JOJA 4OCIA 4M2PA 2RGIA 4N1FA 4Q04A 3JVTB 3UO9A 3KHEA 1VRKA 1DF0A 1DJYA 3KEVA 1WDCC 4BY4A 3BJHA 2JNXA 3DVEA 1WDCB 1K90D 1KFXS 3L4LA 4PALA 1BMOA 3DZTA 1LA3A 1OOGA 2JZIA 1RWYA 2F2PA 1CLMA 1V1FA 2WCBA 3NHTA 1J1EA 2PASA 2Q4UA 1SR6C 2K0JA 3D75A 3VRRA 1L7ZA 1SR6B 4INXA 3O6BA 1L2OC 2WCEA 2KLDA 5HYDA 1OZSA 2KBIA 1KSMA 1L2OB 1B9AA 5CSJA 2LVVA 2JT8A 4PHKA 4C0JA 1CM1A 1DC1A 2K7CA 1PSBA 4DS7A 1FF1A 1SRAA 4I5NB 2M3WA 1MXLC 4ORBB 4HSZA 1CDNA 1QVIY 3D76A 2NZ0A 1F70A 1KQMC 1OZOA 2KSPA 1DGUA 2MBXA 1CM4A 1PVBA 1YUUA 1KQMB 1QVIZ 1U5IB 1UHHA 3GK4X 3KPXA 3S0AA 1ORGA 1ZFSA 5HKWA 1SBJA 1XO5A 1QX7A 5HKYA 3BUOB 2O60A 2V53A 2ZN8A 2K61A 1E8AA 3FS7A 4MVFA 5FI6A 3IF7A 4DCKA 2H61A 5HL1A 3FE8A 2KAVA 5CSIA 2CCMA 1X02A 1XA5A 5D69A 1LXFC 1YTZC 1Q80A 2EGDA 2HQWA 2QDIA 5CSNA 4ZCVA 3I5GC 3NSIA 2BKHB 4DUQA 1CLBA 2PRUA 2GTEA 2LM5A 4CLNA 1QX5B 2LLUA 1QXPA 3I5GB 2M7LA 2WCFA 1SNLA 5HKZA 5AERA 1YX8A 2KDHA 1XFYO 4MN0A 3IQQA 4PE0A 2KAXA 2K60A 2PQLA 2ZNDA 2OPOA 2L2CA 4PHJA 3OP0A 1YX7A 1GGZA 3NSOA 1AHRA 2LUCA 2F8PA 1JF2A 2JNFA 1MHOA 1WY9A 1JFJA 3ZNIA 1YRUB 3D0YA 3BUMB 4MZLA 5KU1A 2LMVA 2KGBC 2LNKA 2MA2A 3DXLA 4AQJA 1CFDA 3GK1A 1SL7A 3EK4A 2MRDA 1LVCD 1J7PA 1DJGA 1K2HA 1ALVA 1IWQA 1AP4A 2BCXA 1OQPA 1OSAA 4U8DA 1QJTA 3PLFB 2NCOA 3LK1A 2JTTA 2ZRSA 3OB2B 1MXEA 2BNXA 1DJZA 2BCBA 2M7NA 3I5IC 1QS7A 1SSEB 4PHNA 4PE1A 1SYMA 3VB1A 2KI6D 1TNWA 3I5IB 1YVHA 2ZN9A 1C3YA 2LVKA 2M0RA 5I8NA 5DKQA 3GOFA 3PN7C 2AAOA 3R1PA 1OE9B 2BECA 3PN7B 1Z2CB 3OHMB 1IG5A 4GGFA 3SG6A 3TUYC 3SS3A 3TUYB 4C0KA 1F55A 2JULA 1IJ5A 1K93D 3AAJA 4PCWA 1NWDA 1CDPA 3L4AA 1CFFA 3IVTA 3D77A 1IRJA 5D3OA 5FI7A 3BFHA 2DOQA 4PT1A 1Y1XA 2EC6B 3KO0A 3OGNA 1BODA 2KFHA 3MSEB 5HLVA 3EVUA 1V1GA 2ZFDA 1XFWO 1TNQA 4CPVA 1JC2A 3GK2A 2B1UA 3QMEA 4P2YB 2MJWB 1Y0VH 2LP3A 4OZDA 1A4PA 3TDZA 1J55A 2I18A 4D1EA 1TUZA 1QASA 2I7AA 2NLNA 1TNPA 2MLEC 1AUIB 2KFGA 2LE9B 3FWCA 1Y6WA 4ICBA 4GUKA 2JTZA 4XYNA 4AOMA 2FJYA 1A75B 3EKJA 4ORCB 1M46A 1EL4A 1OMRA 1QLKA 2LC5A 1AJ4A 1XK4C 1BR1B 1TRFA 1LA0A 3AKBA 1IKUA 3QRXA 3DVJA 1DELA 2L4IA 4MZKA 1CMFA 1M39A 1C7VA 2LHIA 4I5LB 3CR2A 3AKAA 2ISDA 5F6TA 1F4OA 3A8RA 3TZ1A 3BOWA 5ER5A 4QJ4B 5ER4X 2AUCA 3SS5A 1NCZA 1N65A 4OKHA 2JU0A 4JQ0D 1ZACA 1CDMA 1KFUL 1SMGA 2M49B 2PALA 5J3XA 4C0LA 1TUJA 3LLEA 1CFCA 1NX2A 1YUSA 4INWA 2TN4A 3CS1A 4GBAA 2EHBA 3B86A 1R6PA 1UHJA 1UUSA 3DD4A 3RM1A 1CLLA 2K8MB 3SG5A 1FBVA 3B88A 2HQ8A 3ICBA 3M0WA 5GQQC 4FTGA 1QV0A 1N2DA 2CTNA 4R1EA 1CMGA 3NGVA 2KAYA 2K2FA 3DY9A 2Y5IA 4ETOA 1BF5A 2LVIA 1DMOA 4WRIA 1DJIA 3BYAA 2FCDA 1EXRA 2MAZA 1YVLA 3PATA 4MBEA 2F3YA 4XJKB 3FE6A 2LLSA 3RZSA 2LCPA 1PALA 1BOCA 1CFPA 1TCOB 1QATA 2KQYA 3O4XA 4I5KA 4PHMA 1QIWA 4JD9A 2M8UA 3S0GA 4MRXA 1OMVA 3FE9A 2WC8A 1XFUO 3DF0B 1BLQA 5FI2A 1AVSA 1EJ3A 3EVRA 3CYZA 4NDBA 1B4CA 1QIVA 1WRLA 2JC2A 2QPTA 2LMTA 1DJXA 3BFAA 4PE7A 2LUXA 1M45A 3SG4A 1U5IA 2LAPA 4HRHA 5I94A 2BL0C 3CTNA 1C07A 4PDZA 4NDDA 1KFXL 1XFZO 4A4BA 1F8HA 2BL0B 2Y1NA 1Y1AA 2M97A 1B7TY 2YGUA 3LCPC 1XYDA 2SASA 1F4QA 2KI4C 4YGBB 1B7TZ 4DRWA 4F0ZB 2LP2A 3D74A 1DTLA 3FWBA 2KI4B 5G08A 1QTXA 3CZTX 5I2OA 1S36A 2WC6A 2Y4QA 1AK8A 2L50A 2L5YA 1K95A 2WCLA 5AANA 1H8BA 1S3PA 2PSRA 3R1VA 3O4YA 1MWNA 1K9KA 1H4BA 1S6CA 2FCEA 2KQ6A 1ODBA 4NDCA 3PM2A 2QEOA 3EKHA 2PVBA 3NSLA 1G33A 4L9MA 3PM8A 2KGRA 1ZUZA 1CNPA 2PYQA 1CB1A 2JPTA 5DKRA 3ZWHA 1SKTA 4GFTA 1Y1UA 1S1EA 2GV5A 3EK8A 1B47A 4AQIA 2QACA 2HF5A 4IJ7A 2KI6C 2LHLA 2WCMA 3CR4X 1XFRA 4MLWA 4BY5A 1FW4A 2K7DA 2OTGC 3OX5A 2D8NA 2O5GA 1UHKA 3NHIA 5CSFA 3WXAA 2OTGB 2F3ZA 1R2UA 2R2IA 1DVIA 1JUOA 3HCMA 3JTDC 3PSRA 4E68A 1LINA 3RLZA 2P71A 3JTDB 3A4UB 5FYXA 4YGAA 3SIAA 2BBMA 4HRGA 2KNEA 1M31A 2L51A 1DGVA 3VRPA 2WORA 2COLB 1J1DA 1W7JB 2NCPA 5D7FA 1TOPA 1SW8A 1TNXA 2L98A 2L5XB 4YGEB 5AEQA 1SK6D 2KOTA 3LL8B 4USLA 3B7AA 1BJFA 2I2RE 4GAOA 5I2QA 1K96A 1WLZA 2KFFA 3Q8IA 4MSPA 1KWOC 1MQ1A 4YI9A 5KTYA 3BFBA 4QJ5B 1KWOB 4HREE 3BUWB 1GQMA 2P70A 1TN4A 1IGVA 1RJVA 1OW4A 1K94A 1RROA 4QJ3B 4YRUA 1DJWA 1OOHA 3AAKA 2WCKA 2MLFC 1DF0B 1HQVA 2M1UA 4GNKB 3V2LA 1EH2A 1JBAA 1UP5A 3R1OA 4GPLB 1BU3A 2L2EA 1IIOA 2Y1MA 5B8IB 2L0PA 1C7WA 3PALA 1LKJA 1TCFA 2WNDA 2ZRTA 2ZKMX 1FI6A 3IQOA 2H2KA 2I94A 4YGDB 3EK7A 1UHIA 1WLMA 1W7IB 1IQ3A 2KBMA 4WQ2A 5JOLA 2GGZA 3I5FC 1A75A 3PJIA 4M2OA 1IJ6A 1T14A 3I5FB 2WCHA 3HX4A 2LVJA 3JVTC 3O78A 1G8IA 3S0DA 4CFRA 1IH0A 1S6IA 5CPVA 1CKKA 2H8VA 1XK4A 2BKIB 1NX0A 3KF9A 2G9BA 2JQ6A 1OOIX 2JWWA 5HLOA 4JPZB 1K8UA 1UHNA 1W9ZA 1S5GY 1SCVA 3OX6A 1SL9A 1RTP1 5AXIA 1NUBA 4CIDA 1XFXO 5DICA 1J7OA 4JWQA 1S5GZ 3NXAA 2CBLA 4ORAB 1QWVA 1K9PA 4FQTA 3CZ1A 1RK9A 3SG2A 3UNWA 1OOFA 4JKTA 1J7QA 1MUXA 1SCMC 1F71A 1K9UA 1GJYA 2E30A 3H4SE 1SCMB 2H61C 3O2PA 2BBNA 1GM0A 3DYEA 4YI8A 5JJGA 2MHHA 2VRGA 1C3ZA 3CR5X 4N1GA 1NCXA 2OS8C 1TWOA 1KK8C 3DVKA 2GGMA 2LMUA 1LS8A 2OS8B 1J7RA 3DVMA 1KK8B 1A29A 3CABA 1PVAA 4UPGA 3SS4A 3K1EA 1A03A 1P28A 1D1OA 1KK7Y 4IL1A 2LV7A 5EL2A 1YURA 3CZ2A 4CFQA 3K21A 3VGOA 1RFJA 1UWOA 1S26D
chains in the Genus database with same CATH topology
4MZJA 3SJSA 2K2AA 1OMDA 4MRYA 1NIWA 2G2BA 4XJKA 4OVNF 1KSOA 3BXKA 3SG7A 1EG4A 1NCYA 3D0YB 2AMIA 1MR8A 3PFVA 1DT7B 1NP8A 3DF0A 4P5OE 3BQ3A 4NQGA 3C1VA 1OOJA 1ZMZA 3VRNA 1XFVO 1M63B 4FQOA 2ZNEA 4PE4A 2HPSA 2P6BB 3LK0A 4DIRA 4GGNA 3WHTB 4ZCUA 1CDLA 4OV2A 3D10A 1QLSA 2BE6A 1GGWA 1TIZA 1IQ5A 2F2OA 1NX3A 2KYFA 1B8RA 2L4HA 1MF8B 1QV1A 2BCAA 1N0YA 1XVJA 3TDUA 3CWGA 4M2QA 3BUNB 1KQVA 4GGFC 5I2LA 1ZOTB 4YGCB 1ALWA 2WOSA 2FOTA 2PMYA 1A2XA 2IS9A 2M9GA 1F54A 1PK0D 3WHUB 3CLNA 5KSZA 2LLTA 1DJHA 2CT9A 1CTRA 1BG1A 1UURA 1TTXA 1FPWA 1G4YR 2A4JA 2JT3A 1YRTB 1PSRA 2HETA 2K7OA 1KFUS 5TNCA 3FIAA 3EVVA 2JXCA 2M29A 1JFKA 3NSKA 2E6WA 4YBHB 5BPJA 2Q91A 1SPYA 1BR4B 1QX2A 1JWDA 4OR9B 3TS5C 5PALA 3VRQA 1YR5A 1SY9A 2JRFA 1SL8A 3SIBA 3TS5B 1B8LA 2CNPA 3SG3A 3TDIA 1WRZA 2EC6C 4A4CA 2M1KB 5AFPA 2JT0A 5IBWA 1EG3A 1PULA 1AJ5A 1NPQA 3F45A 1WRKA 1BT6A 2KYCA 2K7BA 2F33A 1NYAA 2KHNA 3E3RA 1YUTA 2CXJA 4TNCA 3WNXB 1PRWA 2NXQA 3VROA 3BOWB 1JSAA 3BUXB 1FI5A 3I5HC 1JF0A 1NSHA 3I5HB 2FJUB 2JXLA 4N5XA 1HT9A 1S6JA 2BE4A 1B1GA 1RECA 3CGAA 4I5JA 3OB1B 5K89A 1KK7Z 1KCYA 4WQ3A 1B8CA 2SCPA 4MEWA 5DKNA 2LANA 1NX1A 2JOJA 4OCIA 4M2PA 2RGIA 4N1FA 4Q04A 3JVTB 3KHEA 1VRKA 1DF0A 1DJYA 3KEVA 1WDCC 4BY4A 2JNXA 3DVEA 1WDCB 1K90D 1KFXS 4PALA 1BMOA 1LA3A 2JZIA 1RWYA 2F2PA 1CLMA 1V1FA 2WCBA 1J1EA 2PASA 2Q4UA 1SR6C 2K0JA 3VRRA 1L7ZA 1SR6B 3O6BA 1L2OC 2WCEA 5HYDA 1OZSA 2KBIA 1KSMA 1L2OB 1B9AA 5CSJA 2LVVA 2JT8A 4PHKA 4C0JA 1CM1A 2K7CA 1PSBA 4DS7A 1FF1A 1SRAA 4I5NB 2M3WA 1MXLC 4ORBB 4HSZA 1CDNA 1QVIY 1F70A 2NZ0A 1KQMC 1OZOA 2KSPA 1DGUA 2MBXA 1CM4A 1PVBA 1YUUA 1KQMB 1QVIZ 1U5IB 1UHHA 3GK4X 3KPXA 1ZFSA 5HKWA 1SBJA 1XO5A 1QX7A 5HKYA 3BUOB 2O60A 2V53A 2ZN8A 2K61A 1E8AA 3FS7A 4MVFA 4DCKA 3IF7A 2H61A 2KAVA 5CSIA 2CCMA 1X02A 1XA5A 5D69A 1LXFC 1YTZC 1Q80A 2EGDA 2HQWA 5CSNA 4ZCVA 3I5GC 3NSIA 2BKHB 4DUQA 1CLBA 2PRUA 2LM5A 4CLNA 1QX5B 2LLUA 1QXPA 3I5GB 2M7LA 2WCFA 1SNLA 5HKZA 5AERA 1YX8A 2KDHA 1XFYO 4MN0A 3IQQA 4PE0A 2KAXA 2ZNDA 2OPOA 4PHJA 3OP0A 1YX7A 1GGZA 3NSOA 1AHRA 2LUCA 2F8PA 1JF2A 2JNFA 1MHOA 1WY9A 1JFJA 3ZNIA 1YRUB 3D0YA 3BUMB 4MZLA 5KU1A 2LMVA 2KGBC 2LNKA 2MA2A 4AQJA 1CFDA 3GK1A 1SL7A 3EK4A 2MRDA 1LVCD 1J7PA 1DJGA 1K2HA 1ALVA 1IWQA 1AP4A 2BCXA 1OQPA 1OSAA 4U8DA 1QJTA 3PLFB 2NCOA 3LK1A 2JTTA 2ZRSA 3OB2B 1MXEA 1DJZA 2BCBA 2M7NA 3I5IC 1QS7A 4PHNA 4PE1A 1SYMA 2KI6D 1TNWA 3I5IB 1YVHA 2ZN9A 2LVKA 2M0RA 5I8NA 5DKQA 3GOFA 3PN7C 2AAOA 1OE9B 2BECA 3PN7B 3OHMB 1IG5A 4GGFA 3SG6A 3TUYC 3TUYB 4C0KA 1F55A 2JULA 1IJ5A 1K93D 3AAJA 4PCWA 1NWDA 1CDPA 1CFFA 1IRJA 2DOQA 1BODA 1Y1XA 2EC6B 3KO0A 2KFHA 3MSEB 5HLVA 3EVUA 1V1GA 2ZFDA 1XFWO 1TNQA 4CPVA 1JC2A 3GK2A 2B1UA 4P2YB 2MJWB 1Y0VH 2LP3A 1A4PA 3TDZA 1J55A 2I18A 4D1EA 1QASA 2I7AA 2NLNA 1TNPA 2MLEC 1AUIB 2KFGA 2LE9B 3FWCA 1Y6WA 4ICBA 4GUKA 2JTZA 4XYNA 4AOMA 1A75B 3EKJA 4ORCB 1M46A 1EL4A 1OMRA 1QLKA 2LC5A 1AJ4A 1XK4C 1BR1B 1TRFA 1LA0A 3AKBA 1IKUA 3QRXA 3DVJA 2L4IA 4MZKA 1CMFA 1M39A 1C7VA 2LHIA 4I5LB 3CR2A 3AKAA 2ISDA 5F6TA 1F4OA 3A8RA 3TZ1A 3BOWA 5ER5A 4QJ4B 5ER4X 2AUCA 1NCZA 1N65A 4OKHA 2JU0A 4JQ0D 1CDMA 1SMGA 1KFUL 1ZACA 2M49B 2PALA 5J3XA 4C0LA 3LLEA 1CFCA 1NX2A 1YUSA 2TN4A 3CS1A 4GBAA 2EHBA 1R6PA 1UHJA 1UUSA 3DD4A 3RM1A 1CLLA 2K8MB 3SG5A 1FBVA 2HQ8A 3ICBA 3M0WA 5GQQC 4FTGA 1QV0A 1N2DA 2CTNA 4R1EA 1CMGA 2KAYA 2K2FA 1BF5A 2Y5IA 4ETOA 2LVIA 1DMOA 4WRIA 1DJIA 3BYAA 2FCDA 1EXRA 2MAZA 1YVLA 3PATA 4MBEA 2F3YA 4XJKB 2LLSA 2LCPA 1PALA 1BOCA 1CFPA 1TCOB 1QATA 2KQYA 4I5KA 4PHMA 1QIWA 2M8UA 4MRXA 1OMVA 2WC8A 1XFUO 3DF0B 1BLQA 1AVSA 1EJ3A 3EVRA 4NDBA 1B4CA 1QIVA 1WRLA 2JC2A 2QPTA 2LMTA 1DJXA 4PE7A 2LUXA 1M45A 3SG4A 1U5IA 2LAPA 4HRHA 2BL0C 3CTNA 1C07A 4PDZA 4NDDA 1KFXL 1XFZO 4A4BA 1F8HA 2BL0B 2Y1NA 1Y1AA 2M97A 1B7TY 3LCPC 1XYDA 2SASA 1F4QA 2KI4C 4YGBB 1B7TZ 4DRWA 4F0ZB 2LP2A 1DTLA 3FWBA 2KI4B 5G08A 1QTXA 3CZTX 5I2OA 1S36A 2Y4QA 1AK8A 2L50A 1K95A 1H8BA 5AANA 1S3PA 2PSRA 1H4BA 3O4YA 1MWNA 1K9KA 1S6CA 2FCEA 2KQ6A 1ODBA 4NDCA 3EKHA 2PVBA 3NSLA 1G33A 4L9MA 3PM8A 2KGRA 1ZUZA 1CNPA 1CB1A 2JPTA 5DKRA 3ZWHA 1SKTA 4GFTA 1Y1UA 1S1EA 2GV5A 3EK8A 1B47A 4AQIA 2QACA 2HF5A 2KI6C 2LHLA 3CR4X 4MLWA 4BY5A 1FW4A 2K7DA 2OTGC 3OX5A 2D8NA 2O5GA 1UHKA 5CSFA 3WXAA 2OTGB 2F3ZA 1R2UA 2R2IA 1DVIA 1JUOA 3HCMA 3JTDC 3PSRA 4E68A 1LINA 3RLZA 3JTDB 5FYXA 3A4UB 4YGAA 3SIAA 2BBMA 4HRGA 2KNEA 1M31A 2L51A 1DGVA 3VRPA 2WORA 2COLB 1J1DA 1W7JB 2NCPA 5D7FA 1TOPA 1SW8A 1TNXA 2L98A 2L5XB 4YGEB 5AEQA 1SK6D 2KOTA 3LL8B 4USLA 1BJFA 2I2RE 4GAOA 5I2QA 1K96A 1WLZA 2KFFA 4MSPA 1KWOC 1MQ1A 4YI9A 5KTYA 4QJ5B 1KWOB 4HREE 3BUWB 1GQMA 1TN4A 1IGVA 1RJVA 4QJ3B 1K94A 1RROA 4YRUA 1DJWA 3AAKA 2MLFC 1DF0B 1HQVA 2M1UA 4GNKB 1EH2A 1JBAA 1UP5A 4GPLB 1BU3A 2L2EA 2Y1MA 5B8IB 2L0PA 1C7WA 3PALA 1LKJA 1TCFA 2WNDA 2ZRTA 2ZKMX 1FI6A 3IQOA 2H2KA 2I94A 4YGDB 3EK7A 1UHIA 1WLMA 1W7IB 1IQ3A 2KBMA 4WQ2A 5JOLA 2GGZA 3I5FC 1A75A 4M2OA 1IJ6A 3I5FB 3HX4A 2LVJA 3JVTC 3O78A 1G8IA 4CFRA 1IH0A 1S6IA 5CPVA 1CKKA 1XK4A 2BKIB 1NX0A 3KF9A 2G9BA 2JQ6A 2JWWA 5HLOA 4JPZB 1K8UA 1UHNA 1S5GY 1SCVA 3OX6A 1SL9A 1RTP1 5AXIA 1NUBA 4CIDA 1XFXO 1J7OA 4JWQA 1S5GZ 3NXAA 2CBLA 4ORAB 1K9PA 3SG2A 1RK9A 1F71A 1J7QA 1MUXA 1SCMC 1K9UA 1GJYA 2E30A 3H4SE 1SCMB 2H61C 3O2PA 2BBNA 4YI8A 5JJGA 2MHHA 2VRGA 3CR5X 4N1GA 1NCXA 2OS8C 1KK8C 3DVKA 2GGMA 2LMUA 2OS8B 1J7RA 3DVMA 1KK8B 1A29A 4UPGA 1PVAA 1A03A 1D1OA 1KK7Y 4IL1A 2LV7A 4CFQA 1YURA 3K21A 3VGOA 1RFJA 1UWOA 1S26D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZJ A;  3SJS A;  2K2A A;  1OMD A;  4MRY A;  1NIW A;  2G2B A;  4XJK A;  4OVN F;  1KSO A;  3BXK A;  3SG7 A;  1EG4 A;  1NCY A;  3D0Y B;  2AMI A;  1MR8 A;  3PFV A;  1DT7 B;  1NP8 A;  3DF0 A;  4P5O E;  3BQ3 A;  4NQG A;  3C1V A;  1OOJ A;  1ZMZ A;  3VRN A;  1XFV O;  1M63 B;  4FQO A;  2ZNE A;  4PE4 A;  2HPS A;  2P6B B;  3LK0 A;  4DIR A;  4GGN A;  3WHT B;  4ZCU A;  1CDL A;  4OV2 A;  3D10 A;  1QLS A;  2BE6 A;  1GGW A;  1TIZ A;  1IQ5 A;  2F2O A;  1NX3 A;  2KYF A;  1B8R A;  2L4H A;  1MF8 B;  1QV1 A;  2BCA A;  1N0Y A;  1XVJ A;  3TDU A;  3CWG A;  4M2Q A;  3BUN B;  1KQV A;  4GGF C;  5I2L A;  1ZOT B;  4YGC B;  1ALW A;  2WOS A;  2FOT A;  2PMY A;  1A2X A;  2IS9 A;  2M9G A;  1F54 A;  1PK0 D;  3WHU B;  3CLN A;  5KSZ A;  2LLT A;  1DJH A;  2CT9 A;  1CTR A;  1BG1 A;  1UUR A;  1TTX A;  1FPW A;  1G4Y R;  2A4J A;  2JT3 A;  1YRT B;  1PSR A;  2HET A;  2K7O A;  1KFU S;  5TNC A;  3FIA A;  3EVV A;  2JXC A;  2M29 A;  1JFK A;  3NSK A;  2E6W A;  4YBH B;  5BPJ A;  2Q91 A;  1SPY A;  1BR4 B;  1QX2 A;  1JWD A;  4OR9 B;  3TS5 C;  5PAL A;  3VRQ A;  1YR5 A;  1SY9 A;  2JRF A;  1SL8 A;  3SIB A;  3TS5 B;  1B8L A;  2CNP A;  3SG3 A;  3TDI A;  1WRZ A;  2EC6 C;  4A4C A;  2M1K B;  5AFP A;  2JT0 A;  5IBW A;  1EG3 A;  1PUL A;  1AJ5 A;  1NPQ A;  3F45 A;  1WRK A;  1BT6 A;  2KYC A;  2K7B A;  2F33 A;  1NYA A;  2KHN A;  3E3R A;  1YUT A;  2CXJ A;  4TNC A;  3WNX B;  1PRW A;  2NXQ A;  3VRO A;  3BOW B;  1JSA A;  3BUX B;  1FI5 A;  3I5H C;  1JF0 A;  1NSH A;  3I5H B;  2FJU B;  2JXL A;  4N5X A;  1HT9 A;  1S6J A;  2BE4 A;  1B1G A;  1REC A;  3CGA A;  4I5J A;  3OB1 B;  5K89 A;  1KK7 Z;  1KCY A;  4WQ3 A;  1B8C A;  2SCP A;  4MEW A;  5DKN A;  2LAN A;  1NX1 A;  2JOJ A;  4OCI A;  4M2P A;  2RGI A;  4N1F A;  4Q04 A;  3JVT B;  3KHE A;  1VRK A;  1DF0 A;  1DJY A;  3KEV A;  1WDC C;  4BY4 A;  2JNX A;  3DVE A;  1WDC B;  1K90 D;  1KFX S;  4PAL A;  1BMO A;  1LA3 A;  2JZI A;  1RWY A;  2F2P A;  1CLM A;  1V1F A;  2WCB A;  1J1E A;  2PAS A;  2Q4U A;  1SR6 C;  2K0J A;  3VRR A;  1L7Z A;  1SR6 B;  3O6B A;  1L2O C;  2WCE A;  5HYD A;  1OZS A;  2KBI A;  1KSM A;  1L2O B;  1B9A A;  5CSJ A;  2LVV A;  2JT8 A;  4PHK A;  4C0J A;  1CM1 A;  2K7C A;  1PSB A;  4DS7 A;  1FF1 A;  1SRA A;  4I5N B;  2M3W A;  1MXL C;  4ORB B;  4HSZ A;  1CDN A;  1QVI Y;  1F70 A;  2NZ0 A;  1KQM C;  1OZO A;  2KSP A;  1DGU A;  2MBX A;  1CM4 A;  1PVB A;  1YUU A;  1KQM B;  1QVI Z;  1U5I B;  1UHH A;  3GK4 X;  3KPX A;  1ZFS A;  5HKW A;  1SBJ A;  1XO5 A;  1QX7 A;  5HKY A;  3BUO B;  2O60 A;  2V53 A;  2ZN8 A;  2K61 A;  1E8A A;  3FS7 A;  4MVF A;  4DCK A;  3IF7 A;  2H61 A;  2KAV A;  5CSI A;  2CCM A;  1X02 A;  1XA5 A;  5D69 A;  1LXF C;  1YTZ C;  1Q80 A;  2EGD A;  2HQW A;  5CSN A;  4ZCV A;  3I5G C;  3NSI A;  2BKH B;  4DUQ A;  1CLB A;  2PRU A;  2LM5 A;  4CLN A;  1QX5 B;  2LLU A;  1QXP A;  3I5G B;  2M7L A;  2WCF A;  1SNL A;  5HKZ A;  5AER A;  1YX8 A;  2KDH A;  1XFY O;  4MN0 A;  3IQQ A;  4PE0 A;  2KAX A;  2ZND A;  2OPO A;  4PHJ A;  3OP0 A;  1YX7 A;  1GGZ A;  3NSO A;  1AHR A;  2LUC A;  2F8P A;  1JF2 A;  2JNF A;  1MHO A;  1WY9 A;  1JFJ A;  3ZNI A;  1YRU B;  3D0Y A;  3BUM B;  4MZL A;  5KU1 A;  2LMV A;  2KGB C;  2LNK A;  2MA2 A;  4AQJ A;  1CFD A;  3GK1 A;  1SL7 A;  3EK4 A;  2MRD A;  1LVC D;  1J7P A;  1DJG A;  1K2H A;  1ALV A;  1IWQ A;  1AP4 A;  2BCX A;  1OQP A;  1OSA A;  4U8D A;  1QJT A;  3PLF B;  2NCO A;  3LK1 A;  2JTT A;  2ZRS A;  3OB2 B;  1MXE A;  1DJZ A;  2BCB A;  2M7N A;  3I5I C;  1QS7 A;  4PHN A;  4PE1 A;  1SYM A;  2KI6 D;  1TNW A;  3I5I B;  1YVH A;  2ZN9 A;  2LVK A;  2M0R A;  5I8N A;  5DKQ A;  3GOF A;  3PN7 C;  2AAO A;  1OE9 B;  2BEC A;  3PN7 B;  3OHM B;  1IG5 A;  4GGF A;  3SG6 A;  3TUY C;  3TUY B;  4C0K A;  1F55 A;  2JUL A;  1IJ5 A;  1K93 D;  3AAJ A;  4PCW A;  1NWD A;  1CDP A;  1CFF A;  1IRJ A;  2DOQ A;  1BOD A;  1Y1X A;  2EC6 B;  3KO0 A;  2KFH A;  3MSE B;  5HLV A;  3EVU A;  1V1G A;  2ZFD A;  1XFW O;  1TNQ A;  4CPV A;  1JC2 A;  3GK2 A;  2B1U A;  4P2Y B;  2MJW B;  1Y0V H;  2LP3 A;  1A4P A;  3TDZ A;  1J55 A;  2I18 A;  4D1E A;  1QAS A;  2I7A A;  2NLN A;  1TNP A;  2MLE C;  1AUI B;  2KFG A;  2LE9 B;  3FWC A;  1Y6W A;  4ICB A;  4GUK A;  2JTZ A;  4XYN A;  4AOM A;  1A75 B;  3EKJ A;  4ORC B;  1M46 A;  1EL4 A;  1OMR A;  1QLK A;  2LC5 A;  1AJ4 A;  1XK4 C;  1BR1 B;  1TRF A;  1LA0 A;  3AKB A;  1IKU A;  3QRX A;  3DVJ A;  2L4I A;  4MZK A;  1CMF A;  1M39 A;  1C7V A;  2LHI A;  4I5L B;  3CR2 A;  3AKA A;  2ISD A;  5F6T A;  1F4O A;  3A8R A;  3TZ1 A;  3BOW A;  5ER5 A;  4QJ4 B;  5ER4 X;  2AUC A;  1NCZ A;  1N65 A;  4OKH A;  2JU0 A;  4JQ0 D;  1CDM A;  1SMG A;  1KFU L;  1ZAC A;  2M49 B;  2PAL A;  5J3X A;  4C0L A;  3LLE A;  1CFC A;  1NX2 A;  1YUS A;  2TN4 A;  3CS1 A;  4GBA A;  2EHB A;  1R6P A;  1UHJ A;  1UUS A;  3DD4 A;  3RM1 A;  1CLL A;  2K8M B;  3SG5 A;  1FBV A;  2HQ8 A;  3ICB A;  3M0W A;  5GQQ C;  4FTG A;  1QV0 A;  1N2D A;  2CTN A;  4R1E A;  1CMG A;  2KAY A;  2K2F A;  1BF5 A;  2Y5I A;  4ETO A;  2LVI A;  1DMO A;  4WRI A;  1DJI A;  3BYA A;  2FCD A;  1EXR A;  2MAZ A;  1YVL A;  3PAT A;  4MBE A;  2F3Y A;  4XJK B;  2LLS A;  2LCP A;  1PAL A;  1BOC A;  1CFP A;  1TCO B;  1QAT A;  2KQY A;  4I5K A;  4PHM A;  1QIW A;  2M8U A;  4MRX A;  1OMV A;  2WC8 A;  1XFU O;  3DF0 B;  1BLQ A;  1AVS A;  1EJ3 A;  3EVR A;  4NDB A;  1B4C A;  1QIV A;  1WRL A;  2JC2 A;  2QPT A;  2LMT A;  1DJX A;  4PE7 A;  2LUX A;  1M45 A;  3SG4 A;  1U5I A;  2LAP A;  4HRH A;  2BL0 C;  3CTN A;  1C07 A;  4PDZ A;  4NDD A;  1KFX L;  1XFZ O;  4A4B A;  1F8H A;  2BL0 B;  2Y1N A;  1Y1A A;  2M97 A;  1B7T Y;  3LCP C;  1XYD A;  2SAS A;  1F4Q A;  2KI4 C;  4YGB B;  1B7T Z;  4DRW A;  4F0Z B;  2LP2 A;  1DTL A;  3FWB A;  2KI4 B;  5G08 A;  1QTX A;  3CZT X;  5I2O A;  1S36 A;  2Y4Q A;  1AK8 A;  2L50 A;  1K95 A;  1H8B A;  5AAN A;  1S3P A;  2PSR A;  1H4B A;  3O4Y A;  1MWN A;  1K9K A;  1S6C A;  2FCE A;  2KQ6 A;  1ODB A;  4NDC A;  3EKH A;  2PVB A;  3NSL A;  1G33 A;  4L9M A;  3PM8 A;  2KGR A;  1ZUZ A;  1CNP A;  1CB1 A;  2JPT A;  5DKR A;  3ZWH A;  1SKT A;  4GFT A;  1Y1U A;  1S1E A;  2GV5 A;  3EK8 A;  1B47 A;  4AQI A;  2QAC A;  2HF5 A;  2KI6 C;  2LHL A;  3CR4 X;  4MLW A;  4BY5 A;  1FW4 A;  2K7D A;  2OTG C;  3OX5 A;  2D8N A;  2O5G A;  1UHK A;  5CSF A;  3WXA A;  2OTG B;  2F3Z A;  1R2U A;  2R2I A;  1DVI A;  1JUO A;  3HCM A;  3JTD C;  3PSR A;  4E68 A;  1LIN A;  3RLZ A;  3JTD B;  5FYX A;  3A4U B;  4YGA A;  3SIA A;  2BBM A;  4HRG A;  2KNE A;  1M31 A;  2L51 A;  1DGV A;  3VRP A;  2WOR A;  2COL B;  1J1D A;  1W7J B;  2NCP A;  5D7F A;  1TOP A;  1SW8 A;  1TNX A;  2L98 A;  2L5X B;  4YGE B;  5AEQ A;  1SK6 D;  2KOT A;  3LL8 B;  4USL A;  1BJF A;  2I2R E;  4GAO A;  5I2Q A;  1K96 A;  1WLZ A;  2KFF A;  4MSP A;  1KWO C;  1MQ1 A;  4YI9 A;  5KTY A;  4QJ5 B;  1KWO B;  4HRE E;  3BUW B;  1GQM A;  1TN4 A;  1IGV A;  1RJV A;  4QJ3 B;  1K94 A;  1RRO A;  4YRU A;  1DJW A;  3AAK A;  2MLF C;  1DF0 B;  1HQV A;  2M1U A;  4GNK B;  1EH2 A;  1JBA A;  1UP5 A;  4GPL B;  1BU3 A;  2L2E A;  2Y1M A;  5B8I B;  2L0P A;  1C7W A;  3PAL A;  1LKJ A;  1TCF A;  2WND A;  2ZRT A;  2ZKM X;  1FI6 A;  3IQO A;  2H2K A;  2I94 A;  4YGD B;  3EK7 A;  1UHI A;  1WLM A;  1W7I B;  1IQ3 A;  2KBM A;  4WQ2 A;  5JOL A;  2GGZ A;  3I5F C;  1A75 A;  4M2O A;  1IJ6 A;  3I5F B;  3HX4 A;  2LVJ A;  3JVT C;  3O78 A;  1G8I A;  4CFR A;  1IH0 A;  1S6I A;  5CPV A;  1CKK A;  1XK4 A;  2BKI B;  1NX0 A;  3KF9 A;  2G9B A;  2JQ6 A;  2JWW A;  5HLO A;  4JPZ B;  1K8U A;  1UHN A;  1S5G Y;  1SCV A;  3OX6 A;  1SL9 A;  1RTP 1;  5AXI A;  1NUB A;  4CID A;  1XFX O;  1J7O A;  4JWQ A;  1S5G Z;  3NXA A;  2CBL A;  4ORA B;  1K9P A;  3SG2 A;  1RK9 A;  1F71 A;  1J7Q A;  1MUX A;  1SCM C;  1K9U A;  1GJY A;  2E30 A;  3H4S E;  1SCM B;  2H61 C;  3O2P A;  2BBN A;  4YI8 A;  5JJG A;  2MHH A;  2VRG A;  3CR5 X;  4N1G A;  1NCX A;  2OS8 C;  1KK8 C;  3DVK A;  2GGM A;  2LMU A;  2OS8 B;  1J7R A;  3DVM A;  1KK8 B;  1A29 A;  4UPG A;  1PVA A;  1A03 A;  1D1O A;  1KK7 Y;  4IL1 A;  2LV7 A;  4CFQ A;  1YUR A;  3K21 A;  3VGO A;  1RFJ A;  1UWO A;  1S26 D; 
#chains in the Genus database with same CATH topology
 3D78 A;  4MZJ A;  3SJS A;  2K2A A;  1OMD A;  4MRY A;  1NIW A;  2G2B A;  4XJK A;  4OVN F;  1KSO A;  1DEK A;  3BXK A;  1EG4 A;  3SG7 A;  3S0F A;  2ERB A;  1NCY A;  3D0Y B;  2AMI A;  3EG5 B;  1MR8 A;  3PFV A;  1DT7 B;  1NP8 A;  2KPH A;  3DF0 A;  4P5O E;  2KLE A;  3CDN A;  3BQ3 A;  4NQG A;  4F7F A;  3C1V A;  1OOJ A;  1ZMZ A;  1DQE A;  1XFV O;  3VRN A;  1M63 B;  3R72 A;  4FQO A;  2ZNE A;  4PE4 A;  2HPS A;  2P6B B;  3LK0 A;  4DIR A;  4GGN A;  3WHT B;  4ZCU A;  1CDL A;  2BAP A;  4OV2 A;  3D10 A;  3S0E A;  1QLS A;  2BE6 A;  1GGW A;  1TIZ A;  1IQ5 A;  2F2O A;  1NX3 A;  2KYF A;  1B8R A;  2JPO A;  2L4H A;  4KYN A;  1MF8 B;  1QV1 A;  2BCA A;  1N0Y A;  1XVJ A;  3TDU A;  3CWG A;  4M2Q A;  3BUN B;  1KQV A;  4GGF C;  5I2L A;  1ZOT B;  4YGC B;  2QEH A;  1ALW A;  2WOS A;  3S0B A;  3CZ0 A;  2FOT A;  2PMY A;  1A2X A;  2IS9 A;  2M9G A;  1F54 A;  1PK0 D;  3OBV A;  3WHU B;  3CLN A;  5KSZ A;  2LLT A;  1DJH A;  2CT9 A;  1CTR A;  1BG1 A;  1UUR A;  1TTX A;  1FPW A;  1G4Y R;  2A4J A;  2JT3 A;  1YRT B;  1PSR A;  2HET A;  2K7O A;  1KFU S;  5TNC A;  1Z4H A;  3FIA A;  3EVV A;  2WC5 A;  3B87 A;  2JXC A;  2M29 A;  1JFK A;  3NSK A;  2E6W A;  4YBH B;  5BPJ A;  2Q91 A;  1SPY A;  1BR4 B;  1QX2 A;  1JWD A;  4OR9 B;  3TS5 C;  5PAL A;  3VRQ A;  1YR5 A;  1SY9 A;  2JRF A;  1SL8 A;  3SIB A;  3TS5 B;  1B8L A;  2CNP A;  3SG3 A;  3TDI A;  1WRZ A;  2EC6 C;  3B6X A;  4A4C A;  2M1K B;  5AFP A;  2JT0 A;  5IBW A;  1EG3 A;  1PUL A;  3D73 A;  1AJ5 A;  1NPQ A;  2WCJ A;  1WRK A;  3F45 A;  2QEV A;  1BT6 A;  2KYC A;  2K7B A;  2F33 A;  1NYA A;  2KHN A;  3E3R A;  1YUT A;  2CXJ A;  3N7H A;  4TNC A;  3WNX B;  1PRW A;  2NXQ A;  3VRO A;  3BOW B;  1JSA A;  3BUX B;  1FI5 A;  3I5H C;  1JF0 A;  1NSH A;  3I5H B;  2FJU B;  2JXL A;  3L47 A;  4N5X A;  1HT9 A;  1S6J A;  2BE4 A;  1B1G A;  1REC A;  3CGA A;  4I5J A;  3OB1 B;  5K89 A;  1KK7 Z;  1KCY A;  4WQ3 A;  1B8C A;  2SCP A;  4MEW A;  5DKN A;  2LAN A;  1NX1 A;  2QEB A;  2JOJ A;  4OCI A;  4M2P A;  2RGI A;  4N1F A;  4Q04 A;  3JVT B;  3UO9 A;  3KHE A;  1VRK A;  1DF0 A;  1DJY A;  3KEV A;  1WDC C;  4BY4 A;  3BJH A;  2JNX A;  3DVE A;  1WDC B;  1K90 D;  1KFX S;  3L4L A;  4PAL A;  1BMO A;  3DZT A;  1LA3 A;  1OOG A;  2JZI A;  1RWY A;  2F2P A;  1CLM A;  1V1F A;  2WCB A;  3NHT A;  1J1E A;  2PAS A;  2Q4U A;  1SR6 C;  2K0J A;  3D75 A;  3VRR A;  1L7Z A;  1SR6 B;  4INX A;  3O6B A;  1L2O C;  2WCE A;  2KLD A;  5HYD A;  1OZS A;  2KBI A;  1KSM A;  1L2O B;  1B9A A;  5CSJ A;  2LVV A;  2JT8 A;  4PHK A;  4C0J A;  1CM1 A;  1DC1 A;  2K7C A;  1PSB A;  4DS7 A;  1FF1 A;  1SRA A;  4I5N B;  2M3W A;  1MXL C;  4ORB B;  4HSZ A;  1CDN A;  1QVI Y;  3D76 A;  2NZ0 A;  1F70 A;  1KQM C;  1OZO A;  2KSP A;  1DGU A;  2MBX A;  1CM4 A;  1PVB A;  1YUU A;  1KQM B;  1QVI Z;  1U5I B;  1UHH A;  3GK4 X;  3KPX A;  3S0A A;  1ORG A;  1ZFS A;  5HKW A;  1SBJ A;  1XO5 A;  1QX7 A;  5HKY A;  3BUO B;  2O60 A;  2V53 A;  2ZN8 A;  2K61 A;  1E8A A;  3FS7 A;  4MVF A;  5FI6 A;  3IF7 A;  4DCK A;  2H61 A;  5HL1 A;  3FE8 A;  2KAV A;  5CSI A;  2CCM A;  1X02 A;  1XA5 A;  5D69 A;  1LXF C;  1YTZ C;  1Q80 A;  2EGD A;  2HQW A;  2QDI A;  5CSN A;  4ZCV A;  3I5G C;  3NSI A;  2BKH B;  4DUQ A;  1CLB A;  2PRU A;  2GTE A;  2LM5 A;  4CLN A;  1QX5 B;  2LLU A;  1QXP A;  3I5G B;  2M7L A;  2WCF A;  1SNL A;  5HKZ A;  5AER A;  1YX8 A;  2KDH A;  1XFY O;  4MN0 A;  3IQQ A;  4PE0 A;  2KAX A;  2K60 A;  2PQL A;  2ZND A;  2OPO A;  2L2C A;  4PHJ A;  3OP0 A;  1YX7 A;  1GGZ A;  3NSO A;  1AHR A;  2LUC A;  2F8P A;  1JF2 A;  2JNF A;  1MHO A;  1WY9 A;  1JFJ A;  3ZNI A;  1YRU B;  3D0Y A;  3BUM B;  4MZL A;  5KU1 A;  2LMV A;  2KGB C;  2LNK A;  2MA2 A;  3DXL A;  4AQJ A;  1CFD A;  3GK1 A;  1SL7 A;  3EK4 A;  2MRD A;  1LVC D;  1J7P A;  1DJG A;  1K2H A;  1ALV A;  1IWQ A;  1AP4 A;  2BCX A;  1OQP A;  1OSA A;  4U8D A;  1QJT A;  3PLF B;  2NCO A;  3LK1 A;  2JTT A;  2ZRS A;  3OB2 B;  1MXE A;  2BNX A;  1DJZ A;  2BCB A;  2M7N A;  3I5I C;  1QS7 A;  1SSE B;  4PHN A;  4PE1 A;  1SYM A;  3VB1 A;  2KI6 D;  1TNW A;  3I5I B;  1YVH A;  2ZN9 A;  1C3Y A;  2LVK A;  2M0R A;  5I8N A;  5DKQ A;  3GOF A;  3PN7 C;  2AAO A;  3R1P A;  1OE9 B;  2BEC A;  3PN7 B;  1Z2C B;  3OHM B;  1IG5 A;  4GGF A;  3SG6 A;  3TUY C;  3SS3 A;  3TUY B;  4C0K A;  1F55 A;  2JUL A;  1IJ5 A;  1K93 D;  3AAJ A;  4PCW A;  1NWD A;  1CDP A;  3L4A A;  1CFF A;  3IVT A;  3D77 A;  1IRJ A;  5D3O A;  5FI7 A;  3BFH A;  2DOQ A;  4PT1 A;  1Y1X A;  2EC6 B;  3KO0 A;  3OGN A;  1BOD A;  2KFH A;  3MSE B;  5HLV A;  3EVU A;  1V1G A;  2ZFD A;  1XFW O;  1TNQ A;  4CPV A;  1JC2 A;  3GK2 A;  2B1U A;  3QME A;  4P2Y B;  2MJW B;  1Y0V H;  2LP3 A;  4OZD A;  1A4P A;  3TDZ A;  1J55 A;  2I18 A;  4D1E A;  1TUZ A;  1QAS A;  2I7A A;  2NLN A;  1TNP A;  2MLE C;  1AUI B;  2KFG A;  2LE9 B;  3FWC A;  1Y6W A;  4ICB A;  4GUK A;  2JTZ A;  4XYN A;  4AOM A;  2FJY A;  1A75 B;  3EKJ A;  4ORC B;  1M46 A;  1EL4 A;  1OMR A;  1QLK A;  2LC5 A;  1AJ4 A;  1XK4 C;  1BR1 B;  1TRF A;  1LA0 A;  3AKB A;  1IKU A;  3QRX A;  3DVJ A;  1DEL A;  2L4I A;  4MZK A;  1CMF A;  1M39 A;  1C7V A;  2LHI A;  4I5L B;  3CR2 A;  3AKA A;  2ISD A;  5F6T A;  1F4O A;  3A8R A;  3TZ1 A;  3BOW A;  5ER5 A;  4QJ4 B;  5ER4 X;  2AUC A;  3SS5 A;  1NCZ A;  1N65 A;  4OKH A;  2JU0 A;  4JQ0 D;  1ZAC A;  1CDM A;  1KFU L;  1SMG A;  2M49 B;  2PAL A;  5J3X A;  4C0L A;  1TUJ A;  3LLE A;  1CFC A;  1NX2 A;  1YUS A;  4INW A;  2TN4 A;  3CS1 A;  4GBA A;  2EHB A;  3B86 A;  1R6P A;  1UHJ A;  1UUS A;  3DD4 A;  3RM1 A;  1CLL A;  2K8M B;  3SG5 A;  1FBV A;  3B88 A;  2HQ8 A;  3ICB A;  3M0W A;  5GQQ C;  4FTG A;  1QV0 A;  1N2D A;  2CTN A;  4R1E A;  1CMG A;  3NGV A;  2KAY A;  2K2F A;  3DY9 A;  2Y5I A;  4ETO A;  1BF5 A;  2LVI A;  1DMO A;  4WRI A;  1DJI A;  3BYA A;  2FCD A;  1EXR A;  2MAZ A;  1YVL A;  3PAT A;  4MBE A;  2F3Y A;  4XJK B;  3FE6 A;  2LLS A;  3RZS A;  2LCP A;  1PAL A;  1BOC A;  1CFP A;  1TCO B;  1QAT A;  2KQY A;  3O4X A;  4I5K A;  4PHM A;  1QIW A;  4JD9 A;  2M8U A;  3S0G A;  4MRX A;  1OMV A;  3FE9 A;  2WC8 A;  1XFU O;  3DF0 B;  1BLQ A;  5FI2 A;  1AVS A;  1EJ3 A;  3EVR A;  3CYZ A;  4NDB A;  1B4C A;  1QIV A;  1WRL A;  2JC2 A;  2QPT A;  2LMT A;  1DJX A;  3BFA A;  4PE7 A;  2LUX A;  1M45 A;  3SG4 A;  1U5I A;  2LAP A;  4HRH A;  5I94 A;  2BL0 C;  3CTN A;  1C07 A;  4PDZ A;  4NDD A;  1KFX L;  1XFZ O;  4A4B A;  1F8H A;  2BL0 B;  2Y1N A;  1Y1A A;  2M97 A;  1B7T Y;  2YGU A;  3LCP C;  1XYD A;  2SAS A;  1F4Q A;  2KI4 C;  4YGB B;  1B7T Z;  4DRW A;  4F0Z B;  2LP2 A;  3D74 A;  1DTL A;  3FWB A;  2KI4 B;  5G08 A;  1QTX A;  3CZT X;  5I2O A;  1S36 A;  2WC6 A;  2Y4Q A;  1AK8 A;  2L50 A;  2L5Y A;  1K95 A;  2WCL A;  5AAN A;  1H8B A;  1S3P A;  2PSR A;  3R1V A;  3O4Y A;  1MWN A;  1K9K A;  1H4B A;  1S6C A;  2FCE A;  2KQ6 A;  1ODB A;  4NDC A;  3PM2 A;  2QEO A;  3EKH A;  2PVB A;  3NSL A;  1G33 A;  4L9M A;  3PM8 A;  2KGR A;  1ZUZ A;  1CNP A;  2PYQ A;  1CB1 A;  2JPT A;  5DKR A;  3ZWH A;  1SKT A;  4GFT A;  1Y1U A;  1S1E A;  2GV5 A;  3EK8 A;  1B47 A;  4AQI A;  2QAC A;  2HF5 A;  4IJ7 A;  2KI6 C;  2LHL A;  2WCM A;  3CR4 X;  1XFR A;  4MLW A;  4BY5 A;  1FW4 A;  2K7D A;  2OTG C;  3OX5 A;  2D8N A;  2O5G A;  1UHK A;  3NHI A;  5CSF A;  3WXA A;  2OTG B;  2F3Z A;  1R2U A;  2R2I A;  1DVI A;  1JUO A;  3HCM A;  3JTD C;  3PSR A;  4E68 A;  1LIN A;  3RLZ A;  2P71 A;  3JTD B;  3A4U B;  5FYX A;  4YGA A;  3SIA A;  2BBM A;  4HRG A;  2KNE A;  1M31 A;  2L51 A;  1DGV A;  3VRP A;  2WOR A;  2COL B;  1J1D A;  1W7J B;  2NCP A;  5D7F A;  1TOP A;  1SW8 A;  1TNX A;  2L98 A;  2L5X B;  4YGE B;  5AEQ A;  1SK6 D;  2KOT A;  3LL8 B;  4USL A;  3B7A A;  1BJF A;  2I2R E;  4GAO A;  5I2Q A;  1K96 A;  1WLZ A;  2KFF A;  3Q8I A;  4MSP A;  1KWO C;  1MQ1 A;  4YI9 A;  5KTY A;  3BFB A;  4QJ5 B;  1KWO B;  4HRE E;  3BUW B;  1GQM A;  2P70 A;  1TN4 A;  1IGV A;  1RJV A;  1OW4 A;  1K94 A;  1RRO A;  4QJ3 B;  4YRU A;  1DJW A;  1OOH A;  3AAK A;  2WCK A;  2MLF C;  1DF0 B;  1HQV A;  2M1U A;  4GNK B;  3V2L A;  1EH2 A;  1JBA A;  1UP5 A;  3R1O A;  4GPL B;  1BU3 A;  2L2E A;  1IIO A;  2Y1M A;  5B8I B;  2L0P A;  1C7W A;  3PAL A;  1LKJ A;  1TCF A;  2WND A;  2ZRT A;  2ZKM X;  1FI6 A;  3IQO A;  2H2K A;  2I94 A;  4YGD B;  3EK7 A;  1UHI A;  1WLM A;  1W7I B;  1IQ3 A;  2KBM A;  4WQ2 A;  5JOL A;  2GGZ A;  3I5F C;  1A75 A;  3PJI A;  4M2O A;  1IJ6 A;  1T14 A;  3I5F B;  2WCH A;  3HX4 A;  2LVJ A;  3JVT C;  3O78 A;  1G8I A;  3S0D A;  4CFR A;  1IH0 A;  1S6I A;  5CPV A;  1CKK A;  2H8V A;  1XK4 A;  2BKI B;  1NX0 A;  3KF9 A;  2G9B A;  2JQ6 A;  1OOI X;  2JWW A;  5HLO A;  4JPZ B;  1K8U A;  1UHN A;  1W9Z A;  1S5G Y;  1SCV A;  3OX6 A;  1SL9 A;  1RTP 1;  5AXI A;  1NUB A;  4CID A;  1XFX O;  5DIC A;  1J7O A;  4JWQ A;  1S5G Z;  3NXA A;  2CBL A;  4ORA B;  1QWV A;  1K9P A;  4FQT A;  3CZ1 A;  1RK9 A;  3SG2 A;  3UNW A;  1OOF A;  4JKT A;  1J7Q A;  1MUX A;  1SCM C;  1F71 A;  1K9U A;  1GJY A;  2E30 A;  3H4S E;  1SCM B;  2H61 C;  3O2P A;  2BBN A;  1GM0 A;  3DYE A;  4YI8 A;  5JJG A;  2MHH A;  2VRG A;  1C3Z A;  3CR5 X;  4N1G A;  1NCX A;  2OS8 C;  1TWO A;  1KK8 C;  3DVK A;  2GGM A;  2LMU A;  1LS8 A;  2OS8 B;  1J7R A;  3DVM A;  1KK8 B;  1A29 A;  3CAB A;  1PVA A;  4UPG A;  3SS4 A;  3K1E A;  1A03 A;  1P28 A;  1D1O A;  1KK7 Y;  4IL1 A;  2LV7 A;  5EL2 A;  1YUR A;  3CZ2 A;  4CFQ A;  3K21 A;  3VGO A;  1RFJ A;  1UWO A;  1S26 D; 
#chains in the Genus database with same CATH homology
 4MZJ A;  3SJS A;  2K2A A;  1OMD A;  4MRY A;  1NIW A;  2G2B A;  4XJK A;  4OVN F;  1KSO A;  3BXK A;  3SG7 A;  1EG4 A;  1NCY A;  3D0Y B;  2AMI A;  1MR8 A;  3PFV A;  1DT7 B;  1NP8 A;  3DF0 A;  4P5O E;  3BQ3 A;  4NQG A;  3C1V A;  1OOJ A;  1ZMZ A;  3VRN A;  1XFV O;  1M63 B;  4FQO A;  2ZNE A;  4PE4 A;  2HPS A;  2P6B B;  3LK0 A;  4DIR A;  4GGN A;  3WHT B;  4ZCU A;  1CDL A;  4OV2 A;  3D10 A;  1QLS A;  2BE6 A;  1GGW A;  1TIZ A;  1IQ5 A;  2F2O A;  1NX3 A;  2KYF A;  1B8R A;  2L4H A;  1MF8 B;  1QV1 A;  2BCA A;  1N0Y A;  1XVJ A;  3TDU A;  3CWG A;  4M2Q A;  3BUN B;  1KQV A;  4GGF C;  5I2L A;  1ZOT B;  4YGC B;  1ALW A;  2WOS A;  2FOT A;  2PMY A;  1A2X A;  2IS9 A;  2M9G A;  1F54 A;  1PK0 D;  3WHU B;  3CLN A;  5KSZ A;  2LLT A;  1DJH A;  2CT9 A;  1CTR A;  1BG1 A;  1UUR A;  1TTX A;  1FPW A;  1G4Y R;  2A4J A;  2JT3 A;  1YRT B;  1PSR A;  2HET A;  2K7O A;  1KFU S;  5TNC A;  3FIA A;  3EVV A;  2JXC A;  2M29 A;  1JFK A;  3NSK A;  2E6W A;  4YBH B;  5BPJ A;  2Q91 A;  1SPY A;  1BR4 B;  1QX2 A;  1JWD A;  4OR9 B;  3TS5 C;  5PAL A;  3VRQ A;  1YR5 A;  1SY9 A;  2JRF A;  1SL8 A;  3SIB A;  3TS5 B;  1B8L A;  2CNP A;  3SG3 A;  3TDI A;  1WRZ A;  2EC6 C;  4A4C A;  2M1K B;  5AFP A;  2JT0 A;  5IBW A;  1EG3 A;  1PUL A;  1AJ5 A;  1NPQ A;  3F45 A;  1WRK A;  1BT6 A;  2KYC A;  2K7B A;  2F33 A;  1NYA A;  2KHN A;  3E3R A;  1YUT A;  2CXJ A;  4TNC A;  3WNX B;  1PRW A;  2NXQ A;  3VRO A;  3BOW B;  1JSA A;  3BUX B;  1FI5 A;  3I5H C;  1JF0 A;  1NSH A;  3I5H B;  2FJU B;  2JXL A;  4N5X A;  1HT9 A;  1S6J A;  2BE4 A;  1B1G A;  1REC A;  3CGA A;  4I5J A;  3OB1 B;  5K89 A;  1KK7 Z;  1KCY A;  4WQ3 A;  1B8C A;  2SCP A;  4MEW A;  5DKN A;  2LAN A;  1NX1 A;  2JOJ A;  4OCI A;  4M2P A;  2RGI A;  4N1F A;  4Q04 A;  3JVT B;  3KHE A;  1VRK A;  1DF0 A;  1DJY A;  3KEV A;  1WDC C;  4BY4 A;  2JNX A;  3DVE A;  1WDC B;  1K90 D;  1KFX S;  4PAL A;  1BMO A;  1LA3 A;  2JZI A;  1RWY A;  2F2P A;  1CLM A;  1V1F A;  2WCB A;  1J1E A;  2PAS A;  2Q4U A;  1SR6 C;  2K0J A;  3VRR A;  1L7Z A;  1SR6 B;  3O6B A;  1L2O C;  2WCE A;  5HYD A;  1OZS A;  2KBI A;  1KSM A;  1L2O B;  1B9A A;  5CSJ A;  2LVV A;  2JT8 A;  4PHK A;  4C0J A;  1CM1 A;  2K7C A;  1PSB A;  4DS7 A;  1FF1 A;  1SRA A;  4I5N B;  2M3W A;  1MXL C;  4ORB B;  4HSZ A;  1CDN A;  1QVI Y;  1F70 A;  2NZ0 A;  1KQM C;  1OZO A;  2KSP A;  1DGU A;  2MBX A;  1CM4 A;  1PVB A;  1YUU A;  1KQM B;  1QVI Z;  1U5I B;  1UHH A;  3GK4 X;  3KPX A;  1ZFS A;  5HKW A;  1SBJ A;  1XO5 A;  1QX7 A;  5HKY A;  3BUO B;  2O60 A;  2V53 A;  2ZN8 A;  2K61 A;  1E8A A;  3FS7 A;  4MVF A;  4DCK A;  3IF7 A;  2H61 A;  2KAV A;  5CSI A;  2CCM A;  1X02 A;  1XA5 A;  5D69 A;  1LXF C;  1YTZ C;  1Q80 A;  2EGD A;  2HQW A;  5CSN A;  4ZCV A;  3I5G C;  3NSI A;  2BKH B;  4DUQ A;  1CLB A;  2PRU A;  2LM5 A;  4CLN A;  1QX5 B;  2LLU A;  1QXP A;  3I5G B;  2M7L A;  2WCF A;  1SNL A;  5HKZ A;  5AER A;  1YX8 A;  2KDH A;  1XFY O;  4MN0 A;  3IQQ A;  4PE0 A;  2KAX A;  2ZND A;  2OPO A;  4PHJ A;  3OP0 A;  1YX7 A;  1GGZ A;  3NSO A;  1AHR A;  2LUC A;  2F8P A;  1JF2 A;  2JNF A;  1MHO A;  1WY9 A;  1JFJ A;  3ZNI A;  1YRU B;  3D0Y A;  3BUM B;  4MZL A;  5KU1 A;  2LMV A;  2KGB C;  2LNK A;  2MA2 A;  4AQJ A;  1CFD A;  3GK1 A;  1SL7 A;  3EK4 A;  2MRD A;  1LVC D;  1J7P A;  1DJG A;  1K2H A;  1ALV A;  1IWQ A;  1AP4 A;  2BCX A;  1OQP A;  1OSA A;  4U8D A;  1QJT A;  3PLF B;  2NCO A;  3LK1 A;  2JTT A;  2ZRS A;  3OB2 B;  1MXE A;  1DJZ A;  2BCB A;  2M7N A;  3I5I C;  1QS7 A;  4PHN A;  4PE1 A;  1SYM A;  2KI6 D;  1TNW A;  3I5I B;  1YVH A;  2ZN9 A;  2LVK A;  2M0R A;  5I8N A;  5DKQ A;  3GOF A;  3PN7 C;  2AAO A;  1OE9 B;  2BEC A;  3PN7 B;  3OHM B;  1IG5 A;  4GGF A;  3SG6 A;  3TUY C;  3TUY B;  4C0K A;  1F55 A;  2JUL A;  1IJ5 A;  1K93 D;  3AAJ A;  4PCW A;  1NWD A;  1CDP A;  1CFF A;  1IRJ A;  2DOQ A;  1BOD A;  1Y1X A;  2EC6 B;  3KO0 A;  2KFH A;  3MSE B;  5HLV A;  3EVU A;  1V1G A;  2ZFD A;  1XFW O;  1TNQ A;  4CPV A;  1JC2 A;  3GK2 A;  2B1U A;  4P2Y B;  2MJW B;  1Y0V H;  2LP3 A;  1A4P A;  3TDZ A;  1J55 A;  2I18 A;  4D1E A;  1QAS A;  2I7A A;  2NLN A;  1TNP A;  2MLE C;  1AUI B;  2KFG A;  2LE9 B;  3FWC A;  1Y6W A;  4ICB A;  4GUK A;  2JTZ A;  4XYN A;  4AOM A;  1A75 B;  3EKJ A;  4ORC B;  1M46 A;  1EL4 A;  1OMR A;  1QLK A;  2LC5 A;  1AJ4 A;  1XK4 C;  1BR1 B;  1TRF A;  1LA0 A;  3AKB A;  1IKU A;  3QRX A;  3DVJ A;  2L4I A;  4MZK A;  1CMF A;  1M39 A;  1C7V A;  2LHI A;  4I5L B;  3CR2 A;  3AKA A;  2ISD A;  5F6T A;  1F4O A;  3A8R A;  3TZ1 A;  3BOW A;  5ER5 A;  4QJ4 B;  5ER4 X;  2AUC A;  1NCZ A;  1N65 A;  4OKH A;  2JU0 A;  4JQ0 D;  1CDM A;  1SMG A;  1KFU L;  1ZAC A;  2M49 B;  2PAL A;  5J3X A;  4C0L A;  3LLE A;  1CFC A;  1NX2 A;  1YUS A;  2TN4 A;  3CS1 A;  4GBA A;  2EHB A;  1R6P A;  1UHJ A;  1UUS A;  3DD4 A;  3RM1 A;  1CLL A;  2K8M B;  3SG5 A;  1FBV A;  2HQ8 A;  3ICB A;  3M0W A;  5GQQ C;  4FTG A;  1QV0 A;  1N2D A;  2CTN A;  4R1E A;  1CMG A;  2KAY A;  2K2F A;  1BF5 A;  2Y5I A;  4ETO A;  2LVI A;  1DMO A;  4WRI A;  1DJI A;  3BYA A;  2FCD A;  1EXR A;  2MAZ A;  1YVL A;  3PAT A;  4MBE A;  2F3Y A;  4XJK B;  2LLS A;  2LCP A;  1PAL A;  1BOC A;  1CFP A;  1TCO B;  1QAT A;  2KQY A;  4I5K A;  4PHM A;  1QIW A;  2M8U A;  4MRX A;  1OMV A;  2WC8 A;  1XFU O;  3DF0 B;  1BLQ A;  1AVS A;  1EJ3 A;  3EVR A;  4NDB A;  1B4C A;  1QIV A;  1WRL A;  2JC2 A;  2QPT A;  2LMT A;  1DJX A;  4PE7 A;  2LUX A;  1M45 A;  3SG4 A;  1U5I A;  2LAP A;  4HRH A;  2BL0 C;  3CTN A;  1C07 A;  4PDZ A;  4NDD A;  1KFX L;  1XFZ O;  4A4B A;  1F8H A;  2BL0 B;  2Y1N A;  1Y1A A;  2M97 A;  1B7T Y;  3LCP C;  1XYD A;  2SAS A;  1F4Q A;  2KI4 C;  4YGB B;  1B7T Z;  4DRW A;  4F0Z B;  2LP2 A;  1DTL A;  3FWB A;  2KI4 B;  5G08 A;  1QTX A;  3CZT X;  5I2O A;  1S36 A;  2Y4Q A;  1AK8 A;  2L50 A;  1K95 A;  1H8B A;  5AAN A;  1S3P A;  2PSR A;  1H4B A;  3O4Y A;  1MWN A;  1K9K A;  1S6C A;  2FCE A;  2KQ6 A;  1ODB A;  4NDC A;  3EKH A;  2PVB A;  3NSL A;  1G33 A;  4L9M A;  3PM8 A;  2KGR A;  1ZUZ A;  1CNP A;  1CB1 A;  2JPT A;  5DKR A;  3ZWH A;  1SKT A;  4GFT A;  1Y1U A;  1S1E A;  2GV5 A;  3EK8 A;  1B47 A;  4AQI A;  2QAC A;  2HF5 A;  2KI6 C;  2LHL A;  3CR4 X;  4MLW A;  4BY5 A;  1FW4 A;  2K7D A;  2OTG C;  3OX5 A;  2D8N A;  2O5G A;  1UHK A;  5CSF A;  3WXA A;  2OTG B;  2F3Z A;  1R2U A;  2R2I A;  1DVI A;  1JUO A;  3HCM A;  3JTD C;  3PSR A;  4E68 A;  1LIN A;  3RLZ A;  3JTD B;  5FYX A;  3A4U B;  4YGA A;  3SIA A;  2BBM A;  4HRG A;  2KNE A;  1M31 A;  2L51 A;  1DGV A;  3VRP A;  2WOR A;  2COL B;  1J1D A;  1W7J B;  2NCP A;  5D7F A;  1TOP A;  1SW8 A;  1TNX A;  2L98 A;  2L5X B;  4YGE B;  5AEQ A;  1SK6 D;  2KOT A;  3LL8 B;  4USL A;  1BJF A;  2I2R E;  4GAO A;  5I2Q A;  1K96 A;  1WLZ A;  2KFF A;  4MSP A;  1KWO C;  1MQ1 A;  4YI9 A;  5KTY A;  4QJ5 B;  1KWO B;  4HRE E;  3BUW B;  1GQM A;  1TN4 A;  1IGV A;  1RJV A;  4QJ3 B;  1K94 A;  1RRO A;  4YRU A;  1DJW A;  3AAK A;  2MLF C;  1DF0 B;  1HQV A;  2M1U A;  4GNK B;  1EH2 A;  1JBA A;  1UP5 A;  4GPL B;  1BU3 A;  2L2E A;  2Y1M A;  5B8I B;  2L0P A;  1C7W A;  3PAL A;  1LKJ A;  1TCF A;  2WND A;  2ZRT A;  2ZKM X;  1FI6 A;  3IQO A;  2H2K A;  2I94 A;  4YGD B;  3EK7 A;  1UHI A;  1WLM A;  1W7I B;  1IQ3 A;  2KBM A;  4WQ2 A;  5JOL A;  2GGZ A;  3I5F C;  1A75 A;  4M2O A;  1IJ6 A;  3I5F B;  3HX4 A;  2LVJ A;  3JVT C;  3O78 A;  1G8I A;  4CFR A;  1IH0 A;  1S6I A;  5CPV A;  1CKK A;  1XK4 A;  2BKI B;  1NX0 A;  3KF9 A;  2G9B A;  2JQ6 A;  2JWW A;  5HLO A;  4JPZ B;  1K8U A;  1UHN A;  1S5G Y;  1SCV A;  3OX6 A;  1SL9 A;  1RTP 1;  5AXI A;  1NUB A;  4CID A;  1XFX O;  1J7O A;  4JWQ A;  1S5G Z;  3NXA A;  2CBL A;  4ORA B;  1K9P A;  3SG2 A;  1RK9 A;  1F71 A;  1J7Q A;  1MUX A;  1SCM C;  1K9U A;  1GJY A;  2E30 A;  3H4S E;  1SCM B;  2H61 C;  3O2P A;  2BBN A;  4YI8 A;  5JJG A;  2MHH A;  2VRG A;  3CR5 X;  4N1G A;  1NCX A;  2OS8 C;  1KK8 C;  3DVK A;  2GGM A;  2LMU A;  2OS8 B;  1J7R A;  3DVM A;  1KK8 B;  1A29 A;  4UPG A;  1PVA A;  1A03 A;  1D1O A;  1KK7 Y;  4IL1 A;  2LV7 A;  4CFQ A;  1YUR A;  3K21 A;  3VGO A;  1RFJ A;  1UWO A;  1S26 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...