1MHOA

The 2.0 a structure of holo s100b from bovine brain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding
molecule keywords S-100 PROTEIN
publication title A novel mode of target recognition suggested by the 2.0 A structure of holo S100B from bovine brain.
pubmed doi rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mhoA00
3EKJA 1QV1A 3EK7A 3NSIA 3TDIA 1S1EA 4PE7A 1YVHA 2EC6C 1DF0B 1WY9A 2KGRA 2MHHA 1A03A 1KWOB 2O60A 1SY9A 1MWNA 3OHMB 1B7TY 1TNWA 5D69A 2JT0A 4BY5A 3D0YA 2LANA 1QJTA 2SASA 2KYFA 2L2EA 1TOPA 2CTNA 1XFUO 3EVVA 1F55A 1GGZA 1TCFA 1XO5A 1C07A 4ZCUA 1U5IB 5KSZA 4MZJA 1IQ3A 5JJGA 1YUTA 1TIZA 5PALA 4OR9B 4PALA 1WLZA 1UWOA 3PN7B 1PALA 2FCEA 1KFUS 3BOWB 3BUMB 3SG4A 2ZRSA 1F71A 1Y6WA 1CNPA 2WCBA 3RLZA 4WQ2A 4YGEB 3JTDC 2LM5A 4PHMA 4DS7A 2L5XB 4I5KA 5HKZA 1YUUA 1XK4C 1ZFSA 1UHNA 1QVIZ 3A8RA 4E68A 1DMOA 4FTGA 2ZN8A 2ZKMX 4ORCB 1UUSA 3SG2A 1V1GA 5G08A 3SIAA 1SW8A 2M7LA 1A75A 2JNXA 4JPZB 4MN0A 2LAPA 1G4YR 3OB1B 2MJWB 1S6IA 1OMVA 1RK9A 4XJKA 4NQGA 3WNXB 3CR4X 2JQ6A 3FWBA 2BCBA 1SR6C 2H61C 1YRTB 1RECA 2KQ6A 1PK0D 2KDHA 3TDUA 3DF0A 2OTGB 1N0YA 1Y1UA 2ISDA 1QX5B 1JFKA 1QLSA 1YURA 1IWQA 2PSRA 1LINA 4DIRA 2KI6D 1SL8A 4FQOA 3CZTX 1WRLA 1PSRA 2L4IA 1XA5A 3DD4A 1EXRA 4YGBB 3BUOB 4GUKA 1PULA 2L51A 1IJ5A 4PDZA 5I2LA 3DVMA 3EK4A 4CLNA 2Y4QA 3OP0A 4M2OA 3O4YA 2NCPA 4PHNA 4MBEA 3WHUB 2HQ8A 2KI4B 3EVUA 2BL0B 2JZIA 2M1UA 1CMFA 3F45A 1EJ3A 2KSPA 2KAVA 1GJYA 3WHTB 2LE9B 2TN4A 1PRWA 2JU0A 1KK8B 1K94A 4PHKA 3VROA 1V1FA 1AHRA 4CFRA 1CM1A 2L0PA 1NX2A 2BECA 2LUXA 1CLLA 1LA0A 1CFCA 1BU3A 1Y1AA 1DJHA 1NX3A 3QRXA 3AAJA 3GK2A 2PASA 1L2OB 5CSFA 1BG1A 2OPOA 2LP3A 1LXFC 1CLMA 3CGAA 2K7CA 2HQWA 5DKQA 2M8UA 4YI8A 5HKWA 1SMGA 1JC2A 3CR2A 4ORBB 4MZLA 4CFQA 2BE6A 1BOCA 3ZNIA 3FWCA 4JQ0D 1XFXO 5GQQC 1M45A 1OQPA 2LVJA 1L7ZA 3IQOA 1QLKA 2BKHB 1YVLA 1SL7A 2LP2A 5I2OA 2PMYA 1U5IA 3LK1A 2LLSA 3GK1A 1JF0A 1KQMC 2SCPA 1CM4A 4XYNA 1NCXA 2KAYA 1XFYO 2LMVA 1SBJA 1DJIA 1S5GZ 3BOWA 1MXLC 1K9KA 2K2AA 4PCWA 4TNCA 5CSNA 4A4BA 3KPXA 4IL1A 2LLTA 2ZFDA 4N5XA 1N65A 4GNKB 4HREE 2K2FA 1ALVA 1DTLA 1SPYA 1HQVA 1GQMA 2LMTA 1FF1A 1WDCC 5TNCA 1OZSA 4BY4A 1J7RA 3I5GC 1PSBA 1WRZA 1GGWA 2RGIA 3JTDB 5AERA 1MF8B 1YUSA 2L98A 1NX0A 2JWWA 4HSZA 2LVVA 4L9MA 4C0LA 4QJ3B 1A29A 1A4PA 2H2KA 1CFPA 5D7FA 4ORAB 4PE4A 5AANA 2V53A 2Y1NA 1LKJA 2M9GA 1M31A 1SNLA 2F3YA 2PVBA 1M39A 1QS7A 2NZ0A 2MBXA 4C0JA 4PE0A 1JBAA 1DGVA 2FCDA 1PVBA 1SR6B 1JSAA 1QX2A 3TUYB 1D1OA 2PALA 1CDPA 5IBWA 2WNDA 3HCMA 1OSAA 3SG7A 3PFVA 1CLBA 4MZKA 5AXIA 1HT9A 1R2UA 4A4CA 1ODBA 2EGDA 5CSJA 2MRDA 3FS7A 2M7NA 1FW4A 3NSOA 4WRIA 3SG3A 3OX6A 2K7BA 2WC8A 3LL8B 5KU1A 3NSLA 1XYDA 5DKNA 2KOTA 3K21A 2B1UA 1CFFA 2BBMA 2O5GA 3SJSA 4GAOA 1ZOTB 1TRFA 2L50A 3OX5A 1DJWA 1QXPA 1OOJA 2L4HA 3CTNA 1DJXA 2I2RE 1CTRA 1EG4A 1KSMA 1MUXA 1KK7Y 2ZNDA 3EVRA 1PVAA 1UHIA 1EL4A 2HPSA 2LNKA 3OB2B 4ICBA 1B1GA 1IQ5A 1K95A 1YX8A 2CCMA 4DUQA 1SCMC 1DJYA 4AOMA 2KYCA 2BCAA 1QTXA 3JVTC 1KSOA 4NDDA 2KAXA 3E3RA 4OCIA 3FIAA 1VRKA 1MR8A 4ZCVA 2JXCA 1N2DA 2E30A 3LLEA 4AQJA 5I2QA 4MRYA 4YBHB 4QJ5B 2A4JA 2WCFA 4I5LB 1A2XA 2PRUA 2LMUA 1FPWA 1AJ4A 1C7VA 1ZUZA 4Q04A 1UHKA 1BR4B 2AAOA 1B7TZ 2K8MB 2KBIA 3LCPC 2LHLA 3WXAA 2MLEC 1F54A 1F8HA 1B8CA 2OS8B 2I18A 1OMRA 3PSRA 1XVJA 2F8PA 3KHEA 1QV0A 2WCEA 1BJFA 1WRKA 2BBNA 1RTP1 1K9PA 1EG3A 3BXKA 2M49B 2WOSA 4NDBA 2Y5IA 4F0ZB 1AVSA 1NYAA 2K61A 1DF0A 2AUCA 4XJKB 1SCVA 1TN4A 5K89A 1IJ6A 2I7AA 1JWDA 1QIVA 2OTGC 3H4SE 1X02A 3ZWHA 5HLVA 1JFJA 1WDCB 1ZMZA 2BCXA 2KQYA 2EC6B 2JNFA 1IGVA 2JXLA 3I5GB 1XK4A 1ALWA 1NCYA 1AP4A 2K0JA 2IS9A 2G2BA 1YX7A 1QVIY 1SYMA 2LC5A 2M3WA 1NCZA 3BUWB 1BMOA 1TNPA 2ZRTA 3KEVA 2AMIA 2JTTA 1M63B 2QPTA 2R2IA 1QATA 5KTYA 1JUOA 1MQ1A 2CNPA 2KHNA 2JPTA 4M2QA 5FYXA 1NUBA 1XFWO 1K96A 3AAKA 1J7PA 1BODA 1NSHA 4UPGA 2KI4C 3TDZA 2BL0C 2JULA 2NLNA 4WQ3A 2Y1MA 3VRNA 1LA3A 1J1EA 2LV7A 4N1GA 3LK0A 3I5IC 5HLOA 2F33A 3PATA 2ZN9A 5ER5A 1S3PA 3KF9A 1RJVA 2VRGA 3TZ1A 2KNEA 1L2OC 2JOJA 2K7DA 3PALA 1J7QA 2FJUB 1F4QA 1XFVO 4R1EA 1F70A 3TS5C 1KCYA 2LVKA 2MLFC 1E8AA 1EH2A 3I5HC 3BUNB 4P2YB 1SKTA 1J1DA 1S6JA 1FBVA 3IQQA 1W7JB 2EHBA 4N1FA 3CR5X 5F6TA 3AKAA 1LVCD 1F4OA 4M2PA 4YGDB 2ZNEA 1AUIB 3I5FC 4MLWA 2CT9A 4DCKA 5AFPA 5JOLA 1J55A 3AKBA 4AQIA 1OE9B 1FI5A 1JF2A 1SCMB 2LHIA 2LLUA 1YRUB 1KFXL 1YTZC 3CLNA 3HX4A 4MEWA 2MAZA 4C0KA 1SL9A 4QJ4B 3PLFB 4OVNF 3JVTB 4PHJA 4U8DA 1TCOB 3RM1A 2JT8A 5I8NA 3SG6A 1YR5A 2KFHA 1IH0A 1S36A 1OZOA 3A4UB 1RWYA 3BYAA 1KWOC 1S26D 4CIDA 2M0RA 2E6WA 1BF5A 1H8BA 2F2PA 1C7WA 3D10A 1BT6A 4I5NB 1ZACA 2BKIB 5J3XA 2Q91A 4MRXA 1G33A 1CDMA 4GGFA 3D0YB 2D8NA 3M0WA 3PM8A 2DOQA 5AEQA 3VRQA 2JRFA 4YRUA 1G8IA 1TNQA 2BE4A 3BQ3A 4PE1A 1CKKA 1SRAA 2WORA 2LUCA 2COLB 3PN7C 2HF5A 1B8RA 4GPLB 1S5GY 1OMDA 3EKHA 4GBAA 1CFDA 4NDCA 2HETA 1S6CA 1B8LA 5CSIA 4P5OE 1BR1B 3TUYC 2KGBC 5DKRA 1DGUA 3VRRA 2GGZA 5ER4X 1M46A 5CPVA 5BPJA 1CB1A 3BUXB 2JC2A 1SK6D 2JT3A 1CDNA 2FOTA 1NX1A 4YI9A 4CPVA 1NWDA 3O6BA 1IRJA 1K8UA 1K9UA 4D1EA 1QASA 1TTXA 3KO0A 1MXEA 3DVKA 4DRWA 4OKHA 1KQMB 2F3ZA 1DJZA 2LCPA 3VRPA 1AJ5A 1IKUA 4GFTA 1DT7B 1B4CA 5B8IB 1K2HA 1A75B 2F2OA 1UHHA 1CDLA 2M29A 2MA2A 1AK8A 3MSEB 1KFUL 1KQVA 1MHOA 2KI6C 3SIBA 4YGCB 2LVIA 4OV2A 2P6BB 1XFZO 4GGNA 4I5JA 1DJGA 3O78A 1RROA 4JWQA 4USLA 3O2PA 4ETOA 2K7OA 2M1KB 1UURA 3I5IB 3SG5A 3DF0B 2QACA 1DVIA 1KFXS 2M97A 4HRGA 2KFFA 3ICBA 1Q80A 1QIWA 2CXJA 2GGMA 3NXAA 4YGAA 2NCOA 1B47A 3TS5B 1FI6A 1R6PA 3I5HB 2H61A 1NP8A 2GV5A 3GK4X 3GOFA 3CWGA 1QX7A 2I94A 1B9AA 1KK7Z 1UHJA 1RFJA 4MSPA 1WLMA 2OS8C 1KK8C 2G9BA 2KFGA 5HYDA 4MVFA 1Y0VH 3I5FB 1BLQA 4GGFC 1K90D 2Q4UA 3EK8A 1J7OA 3NSKA 1Y1XA 3VGOA 3IF7A 2JTZA 2KBMA 3DVJA 1H4BA 2NXQA 3C1VA 1CMGA 1UP5A 2CBLA 1IG5A 1K93D 1TNXA 1NPQA 1NIWA 3CS1A 1W7IB 4HRHA 3DVEA 5HKYA
chains in the Genus database with same CATH superfamily
3EKJA 1QV1A 3EK7A 3NSIA 3TDIA 1S1EA 4PE7A 1YVHA 2EC6C 1DF0B 1WY9A 2KGRA 1XFRA 2MHHA 1A03A 1KWOB 2O60A 1SY9A 1MWNA 3OHMB 1B7TY 1ORGA 1TNWA 5D69A 2JT0A 4BY5A 3D0YA 2LANA 4KYNA 1QJTA 2SASA 2KYFA 2L2EA 1TOPA 2CTNA 1XFUO 3EVVA 3S0GA 1F55A 1GGZA 1OW4A 1TCFA 1XO5A 2BAPA 4ZCUA 1U5IB 3S0EA 3D78A 4IJ7A 4MZJA 3SS3A 5KSZA 1IQ3A 5JJGA 1YUTA 1TIZA 5PALA 4OR9B 4PALA 1WLZA 1UWOA 3PN7B 1PALA 2FCEA 1KFUS 3BOWB 3DY9A 3BUMB 3SG4A 1TUJA 3RZSA 2ZRSA 1F71A 1Y6WA 1CNPA 2WCBA 3RLZA 4WQ2A 3BFAA 3JTDC 4YGEB 2LM5A 4PHMA 3S0BA 4DS7A 4F7FA 2L5XB 4I5KA 5HKZA 1YUUA 1XK4C 1ZFSA 1UHNA 1QVIZ 3A8RA 4E68A 1DMOA 4FTGA 2ZN8A 2ZKMX 4ORCB 1UUSA 3SG2A 1V1GA 3QMEA 5G08A 3SIAA 2BNXA 1SW8A 4JKTA 2M7LA 1A75A 2JNXA 4JPZB 4MN0A 2LAPA 1G4YR 3OB1B 2MJWB 3R1PA 1S6IA 1OMVA 1RK9A 4XJKA 4NQGA 3WNXB 3CR4X 2JQ6A 3FWBA 2BCBA 1SR6C 2H61C 1OOFA 1YRTB 1RECA 2KQ6A 1PK0D 2L5YA 2KDHA 3TDUA 3DF0A 2OTGB 1N0YA 1Y1UA 2ISDA 1QX5B 1JFKA 1QLSA 1YURA 1IWQA 2PSRA 1LINA 4DIRA 2KI6D 1SL8A 3D76A 4FQOA 3CZTX 1WRLA 1PSRA 2L4IA 1XA5A 3DD4A 5D3OA 1EXRA 3FE6A 4YGBB 3L47A 3BUOB 4GUKA 1PULA 2L51A 1IJ5A 4PDZA 5I2LA 5HL1A 3DVMA 2KPHA 3EK4A 4CLNA 2Y4QA 3OP0A 4M2OA 3O4YA 2NCPA 4OZDA 1DQEA 4PHNA 4MBEA 3WHUB 2HQ8A 2KI4B 3EVUA 5FI6A 2BL0B 3B87A 2JZIA 2M1UA 1SSEB 2WCMA 3F45A 1EJ3A 2KSPA 2KAVA 1CMFA 1GJYA 3WHTB 2LE9B 2TN4A 1PRWA 2JU0A 1KK8B 1K94A 4PHKA 3VROA 1V1FA 1AHRA 4CFRA 1CM1A 3SS4A 2L0PA 1NX2A 2BECA 2LUXA 1CLLA 1LA0A 1CFCA 1BU3A 1Y1AA 1DJHA 1NX3A 3QRXA 3AAJA 3GK2A 2PASA 1L2OB 5CSFA 1BG1A 2PYQA 2OPOA 2LP3A 1LXFC 1CLMA 3CGAA 2K7CA 2HQWA 5DKQA 2M8UA 2JPOA 4YI8A 5HKWA 1SMGA 1JC2A 3CR2A 4ORBB 4MZLA 4CFQA 2BE6A 1BOCA 1T14A 2FJYA 3ZNIA 3FWCA 2KLEA 1XFXO 1LS8A 4JQ0D 5GQQC 5FI2A 1M45A 1OQPA 2LVJA 3CZ2A 1L7ZA 3IQOA 1QLKA 2BKHB 1YVLA 1SL7A 2LP2A 5I2OA 2PMYA 3BJHA 3D73A 1U5IA 3LK1A 2K60A 2LLSA 3GK1A 3L4LA 1JF0A 1KQMC 2SCPA 1CM4A 2YGUA 4XYNA 1NCXA 2KAYA 1XFYO 2LMVA 1SBJA 1DJIA 1S5GZ 3BOWA 1MXLC 1K9KA 2K2AA 4PCWA 4TNCA 5CSNA 4A4BA 3KPXA 4IL1A 2LLTA 2QEBA 2ZFDA 1N65A 4GNKB 4HREE 2K2FA 4N5XA 1ALVA 1DTLA 1SPYA 1HQVA 1GQMA 2LMTA 1FF1A 1WDCC 5FI7A 5TNCA 3O4XA 1OZSA 4BY4A 1J7RA 3I5GC 1PSBA 1WRZA 5DICA 2KLDA 1GGWA 2RGIA 3JTDB 5AERA 1MF8B 1YUSA 2L98A 3CDNA 1NX0A 2JWWA 4HSZA 2LVVA 4L9MA 4C0LA 4QJ3B 1A29A 1A4PA 3K1EA 2H2KA 2PQLA 1CFPA 5D7FA 4ORAB 4PE4A 5AANA 2V53A 2Y1NA 1LKJA 2M9GA 1M31A 3CYZA 1SNLA 2F3YA 2PVBA 1M39A 1QS7A 2NZ0A 2MBXA 4C0JA 4PE0A 1JBAA 1OOGA 3B6XA 1DGVA 3IVTA 2FCDA 1PVBA 3DYEA 1SR6B 1JSAA 1IIOA 1QX2A 3TUYB 1D1OA 2PALA 1CDPA 5IBWA 2WNDA 3HCMA 1OSAA 3SG7A 3PFVA 1CLBA 4MZKA 5AXIA 1HT9A 1TWOA 1R2UA 3V2LA 4A4CA 1ODBA 2EGDA 3CZ0A 3D74A 5CSJA 2MRDA 3FS7A 2M7NA 3PJIA 1FW4A 2QEVA 3NSOA 2WCKA 4WRIA 3SG3A 3OX6A 2K7BA 2WC8A 3LL8B 5KU1A 3FE8A 3NSLA 1XYDA 5DKNA 2KOTA 3K21A 2B1UA 1CFFA 2BBMA 2O5GA 3SJSA 4GAOA 1ZOTB 1TRFA 2L50A 3OX5A 1DJWA 3VB1A 3OGNA 2WCLA 1QXPA 1OOJA 2L4HA 3CTNA 1DJXA 2I2RE 1CTRA 1EG4A 1KSMA 1MUXA 1KK7Y 2ZNDA 3EVRA 1PVAA 1UHIA 3S0AA 1EL4A 2HPSA 2LNKA 3OB2B 4ICBA 1B1GA 3S0FA 1IQ5A 1K95A 1YX8A 2CCMA 4DUQA 1SCMC 1DJYA 5EL2A 4AOMA 2KYCA 2BCAA 1QTXA 3JVTC 1KSOA 4NDDA 2KAXA 3E3RA 4OCIA 3FIAA 1VRKA 1MR8A 1Z4HA 4ZCVA 2JXCA 1N2DA 2E30A 3LLEA 4AQJA 5I2QA 4MRYA 4YBHB 4QJ5B 2A4JA 2WCFA 4I5LB 1A2XA 2PRUA 2LMUA 3DZTA 1AJ4A 1FPWA 2GTEA 3SS5A 4INXA 1C7VA 2WCHA 1DEKA 3R1OA 1ZUZA 4Q04A 1UHKA 1BR4B 2AAOA 1B7TZ 3D75A 2K8MB 2KBIA 3LCPC 2LHLA 4FQTA 3WXAA 2MLEC 1F54A 1F8HA 1B8CA 2OS8B 2I18A 1OMRA 3PSRA 1XVJA 2F8PA 3KHEA 1QV0A 2WC6A 2WCEA 1BJFA 1WRKA 2BBNA 1RTP1 1K9PA 1EG3A 3BXKA 2M49B 2WOSA 4NDBA 2Y5IA 4F0ZB 1AVSA 1NYAA 2K61A 1DF0A 2AUCA 1Z2CB 4XJKB 1SCVA 1TN4A 5K89A 1IJ6A 2I7AA 1JWDA 1QIVA 2OTGC 3BFHA 3H4SE 1X02A 3ZWHA 5HLVA 1JFJA 1WDCB 1ZMZA 2BCXA 2KQYA 2EC6B 2H8VA 2JNFA 1IGVA 2JXLA 3I5GB 1XK4A 1ALWA 1NCYA 2WCJA 2K0JA 1AP4A 2IS9A 3B86A 2G2BA 1YX7A 1QVIY 1SYMA 2LC5A 2M3WA 1NCZA 3BUWB 3EG5B 1BMOA 3B7AA 1TNPA 2ZRTA 3KEVA 2AMIA 2JTTA 1M63B 2WC5A 2QPTA 2R2IA 1QATA 5KTYA 1JUOA 1MQ1A 2CNPA 2KHNA 2JPTA 4M2QA 5FYXA 1NUBA 1XFWO 1K96A 3AAKA 2L2CA 1J7PA 1BODA 1NSHA 4UPGA 2KI4C 3TDZA 2BL0C 2JULA 2NLNA 4WQ3A 2Y1MA 3VRNA 1LA3A 3UO9A 1J1EA 2LV7A 4N1GA 3L4AA 3LK0A 1C3ZA 3I5IC 5HLOA 2F33A 3PATA 2ZN9A 1QWVA 5ER5A 2QDIA 1S3PA 3KF9A 1RJVA 3CZ1A 2VRGA 3TZ1A 2KNEA 1L2OC 2JOJA 1TUZA 2K7DA 3PALA 1J7QA 2FJUB 1F4QA 1XFVO 4R1EA 1F70A 3TS5C 1KCYA 2LVKA 2MLFC 3OBVA 1E8AA 1EH2A 3I5HC 3BUNB 4P2YB 1SKTA 1J1DA 1S6JA 1FBVA 2QEHA 1W7JB 2EHBA 3IQQA 4N1FA 3CR5X 5F6TA 3AKAA 1LVCD 1F4OA 4M2PA 1DELA 1W9ZA 4YGDB 2ZNEA 1AUIB 3I5FC 4MLWA 2CT9A 4DCKA 5AFPA 5JOLA 1J55A 4JD9A 4PT1A 3AKBA 4AQIA 1OE9B 1FI5A 1JF2A 1SCMB 2LHIA 2LLUA 2QEOA 1YRUB 1KFXL 1YTZC 3CLNA 3HX4A 4MEWA 2MAZA 4C0KA 1SL9A 4QJ4B 3PLFB 4OVNF 3JVTB 4PHJA 4U8DA 1TCOB 3RM1A 2JT8A 5I8NA 3SG6A 1YR5A 2KFHA 1IH0A 1S36A 1OZOA 3A4UB 3R1VA 1RWYA 3BYAA 1KWOC 1S26D 4CIDA 2M0RA 2E6WA 1BF5A 1H8BA 2F2PA 1C7WA 3D10A 1BT6A 4I5NB 1ZACA 2BKIB 5J3XA 2Q91A 4MRXA 1G33A 1CDMA 4GGFA 3D0YB 2D8NA 3M0WA 3PM8A 2P70A 2DOQA 5AEQA 3VRQA 2JRFA 3Q8IA 4YRUA 1G8IA 1TNQA 2BE4A 3BQ3A 4PE1A 1CKKA 1SRAA 2WORA 2LUCA 3DXLA 2COLB 3PN7C 2HF5A 1B8RA 4GPLB 1S5GY 1OMDA 3B88A 3EKHA 4GBAA 1CFDA 4NDCA 1P28A 2HETA 5I94A 1C3YA 1S6CA 1B8LA 5CSIA 4P5OE 1BR1B 3TUYC 2KGBC 5DKRA 1DGUA 3VRRA 2GGZA 5ER4X 4INWA 1M46A 5CPVA 5BPJA 1CB1A 3BUXB 2JC2A 1SK6D 2JT3A 3D77A 1CDNA 2FOTA 1NX1A 4YI9A 4CPVA 1NWDA 3O6BA 1IRJA 1K8UA 1K9UA 4D1EA 1QASA 1TTXA 3KO0A 1MXEA 3DVKA 3UNWA 4DRWA 4OKHA 1KQMB 2F3ZA 1DJZA 2LCPA 3BFBA 3VRPA 1AJ5A 1IKUA 4GFTA 1DT7B 1B4CA 5B8IB 1K2HA 1A75B 2F2OA 2P71A 3FE9A 1UHHA 1CDLA 2M29A 2MA2A 1AK8A 3MSEB 1KFUL 1KQVA 1MHOA 2KI6C 3SIBA 4YGCB 2ERBA 2LVIA 4OV2A 2P6BB 1XFZO 4GGNA 4I5JA 1DJGA 3O78A 1RROA 4JWQA 4USLA 3O2PA 4ETOA 2K7OA 2M1KB 1UURA 3CABA 3I5IB 3SG5A 3DF0B 2QACA 1DVIA 1GM0A 3PM2A 1KFXS 2M97A 3NHTA 4HRGA 2KFFA 3ICBA 1Q80A 1QIWA 2CXJA 1C07A 2GGMA 1OOHA 3R72A 3NXAA 4YGAA 2NCOA 3S0DA 1B47A 3TS5B 1FI6A 1R6PA 3I5HB 2H61A 1NP8A 2GV5A 3GK4X 3GOFA 3CWGA 1QX7A 2I94A 1B9AA 1KK7Z 1UHJA 1RFJA 4MSPA 1WLMA 2OS8C 3NGVA 1KK8C 2G9BA 2KFGA 5HYDA 4MVFA 1Y0VH 3I5FB 3N7HA 1BLQA 4GGFC 1K90D 2Q4UA 3EK8A 1J7OA 3NSKA 1Y1XA 3VGOA 3IF7A 2JTZA 2KBMA 3DVJA 1H4BA 2NXQA 3C1VA 1CMGA 1UP5A 2CBLA 3NHIA 1IG5A 1K93D 1TNXA 1NPQA 1NIWA 3CS1A 1W7IB 4HRHA 1DC1A 3DVEA 5HKYA 1OOIX
chains in the Genus database with same CATH topology
3EKJA 1QV1A 3EK7A 3NSIA 3TDIA 1S1EA 4PE7A 1YVHA 2EC6C 1DF0B 1WY9A 2KGRA 2MHHA 1A03A 1KWOB 2O60A 1SY9A 1MWNA 3OHMB 1B7TY 1TNWA 5D69A 2JT0A 4BY5A 3D0YA 2LANA 1QJTA 2SASA 2KYFA 2L2EA 1TOPA 2CTNA 1XFUO 3EVVA 1F55A 1GGZA 1TCFA 1XO5A 1C07A 4ZCUA 1U5IB 5KSZA 4MZJA 1IQ3A 5JJGA 1YUTA 1TIZA 5PALA 4OR9B 4PALA 1WLZA 1UWOA 3PN7B 1PALA 2FCEA 1KFUS 3BOWB 3BUMB 3SG4A 2ZRSA 1F71A 1Y6WA 1CNPA 2WCBA 3RLZA 4WQ2A 4YGEB 3JTDC 2LM5A 4PHMA 4DS7A 2L5XB 4I5KA 5HKZA 1YUUA 1XK4C 1ZFSA 1UHNA 1QVIZ 3A8RA 4E68A 1DMOA 4FTGA 2ZN8A 2ZKMX 4ORCB 1UUSA 3SG2A 1V1GA 5G08A 3SIAA 1SW8A 2M7LA 1A75A 2JNXA 4JPZB 4MN0A 2LAPA 1G4YR 3OB1B 2MJWB 1S6IA 1OMVA 1RK9A 4XJKA 4NQGA 3WNXB 3CR4X 2JQ6A 3FWBA 2BCBA 1SR6C 2H61C 1YRTB 1RECA 2KQ6A 1PK0D 2KDHA 3TDUA 3DF0A 2OTGB 1N0YA 1Y1UA 2ISDA 1QX5B 1JFKA 1QLSA 1YURA 1IWQA 2PSRA 1LINA 4DIRA 2KI6D 1SL8A 4FQOA 3CZTX 1WRLA 1PSRA 2L4IA 1XA5A 3DD4A 1EXRA 4YGBB 3BUOB 4GUKA 1PULA 2L51A 1IJ5A 4PDZA 5I2LA 3DVMA 3EK4A 4CLNA 2Y4QA 3OP0A 4M2OA 3O4YA 2NCPA 4PHNA 4MBEA 3WHUB 2HQ8A 2KI4B 3EVUA 2BL0B 2JZIA 2M1UA 1CMFA 3F45A 1EJ3A 2KSPA 2KAVA 1GJYA 3WHTB 2LE9B 2TN4A 1PRWA 2JU0A 1KK8B 1K94A 4PHKA 3VROA 1V1FA 1AHRA 4CFRA 1CM1A 2L0PA 1NX2A 2BECA 2LUXA 1CLLA 1LA0A 1CFCA 1BU3A 1Y1AA 1DJHA 1NX3A 3QRXA 3AAJA 3GK2A 2PASA 1L2OB 5CSFA 1BG1A 2OPOA 2LP3A 1LXFC 1CLMA 3CGAA 2K7CA 2HQWA 5DKQA 2M8UA 4YI8A 5HKWA 1SMGA 1JC2A 3CR2A 4ORBB 4MZLA 4CFQA 2BE6A 1BOCA 3ZNIA 3FWCA 4JQ0D 1XFXO 5GQQC 1M45A 1OQPA 2LVJA 1L7ZA 3IQOA 1QLKA 2BKHB 1YVLA 1SL7A 2LP2A 5I2OA 2PMYA 1U5IA 3LK1A 2LLSA 3GK1A 1JF0A 1KQMC 2SCPA 1CM4A 4XYNA 1NCXA 2KAYA 1XFYO 2LMVA 1SBJA 1DJIA 1S5GZ 3BOWA 1MXLC 1K9KA 2K2AA 4PCWA 4TNCA 5CSNA 4A4BA 3KPXA 4IL1A 2LLTA 2ZFDA 4N5XA 1N65A 4GNKB 4HREE 2K2FA 1ALVA 1DTLA 1SPYA 1HQVA 1GQMA 2LMTA 1FF1A 1WDCC 5TNCA 1OZSA 4BY4A 1J7RA 3I5GC 1PSBA 1WRZA 1GGWA 2RGIA 3JTDB 5AERA 1MF8B 1YUSA 2L98A 1NX0A 2JWWA 4HSZA 2LVVA 4L9MA 4C0LA 4QJ3B 1A29A 1A4PA 2H2KA 1CFPA 5D7FA 4ORAB 4PE4A 5AANA 2V53A 2Y1NA 1LKJA 2M9GA 1M31A 1SNLA 2F3YA 2PVBA 1M39A 1QS7A 2NZ0A 2MBXA 4C0JA 4PE0A 1JBAA 1DGVA 2FCDA 1PVBA 1SR6B 1JSAA 1QX2A 3TUYB 1D1OA 2PALA 1CDPA 5IBWA 2WNDA 3HCMA 1OSAA 3SG7A 3PFVA 1CLBA 4MZKA 5AXIA 1HT9A 1R2UA 4A4CA 1ODBA 2EGDA 5CSJA 2MRDA 3FS7A 2M7NA 1FW4A 3NSOA 4WRIA 3SG3A 3OX6A 2K7BA 2WC8A 3LL8B 5KU1A 3NSLA 1XYDA 5DKNA 2KOTA 3K21A 2B1UA 1CFFA 2BBMA 2O5GA 3SJSA 4GAOA 1ZOTB 1TRFA 2L50A 3OX5A 1DJWA 1QXPA 1OOJA 2L4HA 3CTNA 1DJXA 2I2RE 1CTRA 1EG4A 1KSMA 1MUXA 1KK7Y 2ZNDA 3EVRA 1PVAA 1UHIA 1EL4A 2HPSA 2LNKA 3OB2B 4ICBA 1B1GA 1IQ5A 1K95A 1YX8A 2CCMA 4DUQA 1SCMC 1DJYA 4AOMA 2KYCA 2BCAA 1QTXA 3JVTC 1KSOA 4NDDA 2KAXA 3E3RA 4OCIA 3FIAA 1VRKA 1MR8A 4ZCVA 2JXCA 1N2DA 2E30A 3LLEA 4AQJA 5I2QA 4MRYA 4YBHB 4QJ5B 2A4JA 2WCFA 4I5LB 1A2XA 2PRUA 2LMUA 1FPWA 1AJ4A 1C7VA 1ZUZA 4Q04A 1UHKA 1BR4B 2AAOA 1B7TZ 2K8MB 2KBIA 3LCPC 2LHLA 3WXAA 2MLEC 1F54A 1F8HA 1B8CA 2OS8B 2I18A 1OMRA 3PSRA 1XVJA 2F8PA 3KHEA 1QV0A 2WCEA 1BJFA 1WRKA 2BBNA 1RTP1 1K9PA 1EG3A 3BXKA 2M49B 2WOSA 4NDBA 2Y5IA 4F0ZB 1AVSA 1NYAA 2K61A 1DF0A 2AUCA 4XJKB 1SCVA 1TN4A 5K89A 1IJ6A 2I7AA 1JWDA 1QIVA 2OTGC 3H4SE 1X02A 3ZWHA 5HLVA 1JFJA 1WDCB 1ZMZA 2BCXA 2KQYA 2EC6B 2JNFA 1IGVA 2JXLA 3I5GB 1XK4A 1ALWA 1NCYA 1AP4A 2K0JA 2IS9A 2G2BA 1YX7A 1QVIY 1SYMA 2LC5A 2M3WA 1NCZA 3BUWB 1BMOA 1TNPA 2ZRTA 3KEVA 2AMIA 2JTTA 1M63B 2QPTA 2R2IA 1QATA 5KTYA 1JUOA 1MQ1A 2CNPA 2KHNA 2JPTA 4M2QA 5FYXA 1NUBA 1XFWO 1K96A 3AAKA 1J7PA 1BODA 1NSHA 4UPGA 2KI4C 3TDZA 2BL0C 2JULA 2NLNA 4WQ3A 2Y1MA 3VRNA 1LA3A 1J1EA 2LV7A 4N1GA 3LK0A 3I5IC 5HLOA 2F33A 3PATA 2ZN9A 5ER5A 1S3PA 3KF9A 1RJVA 2VRGA 3TZ1A 2KNEA 1L2OC 2JOJA 2K7DA 3PALA 1J7QA 2FJUB 1F4QA 1XFVO 4R1EA 1F70A 3TS5C 1KCYA 2LVKA 2MLFC 1E8AA 1EH2A 3I5HC 3BUNB 4P2YB 1SKTA 1J1DA 1S6JA 1FBVA 3IQQA 1W7JB 2EHBA 4N1FA 3CR5X 5F6TA 3AKAA 1LVCD 1F4OA 4M2PA 4YGDB 2ZNEA 1AUIB 3I5FC 4MLWA 2CT9A 4DCKA 5AFPA 5JOLA 1J55A 3AKBA 4AQIA 1OE9B 1FI5A 1JF2A 1SCMB 2LHIA 2LLUA 1YRUB 1KFXL 1YTZC 3CLNA 3HX4A 4MEWA 2MAZA 4C0KA 1SL9A 4QJ4B 3PLFB 4OVNF 3JVTB 4PHJA 4U8DA 1TCOB 3RM1A 2JT8A 5I8NA 3SG6A 1YR5A 2KFHA 1IH0A 1S36A 1OZOA 3A4UB 1RWYA 3BYAA 1KWOC 1S26D 4CIDA 2M0RA 2E6WA 1BF5A 1H8BA 2F2PA 1C7WA 3D10A 1BT6A 4I5NB 1ZACA 2BKIB 5J3XA 2Q91A 4MRXA 1G33A 1CDMA 4GGFA 3D0YB 2D8NA 3M0WA 3PM8A 2DOQA 5AEQA 3VRQA 2JRFA 4YRUA 1G8IA 1TNQA 2BE4A 3BQ3A 4PE1A 1CKKA 1SRAA 2WORA 2LUCA 2COLB 3PN7C 2HF5A 1B8RA 4GPLB 1S5GY 1OMDA 3EKHA 4GBAA 1CFDA 4NDCA 2HETA 1S6CA 1B8LA 5CSIA 4P5OE 1BR1B 3TUYC 2KGBC 5DKRA 1DGUA 3VRRA 2GGZA 5ER4X 1M46A 5CPVA 5BPJA 1CB1A 3BUXB 2JC2A 1SK6D 2JT3A 1CDNA 2FOTA 1NX1A 4YI9A 4CPVA 1NWDA 3O6BA 1IRJA 1K8UA 1K9UA 4D1EA 1QASA 1TTXA 3KO0A 1MXEA 3DVKA 4DRWA 4OKHA 1KQMB 2F3ZA 1DJZA 2LCPA 3VRPA 1AJ5A 1IKUA 4GFTA 1DT7B 1B4CA 5B8IB 1K2HA 1A75B 2F2OA 1UHHA 1CDLA 2M29A 2MA2A 1AK8A 3MSEB 1KFUL 1KQVA 1MHOA 2KI6C 3SIBA 4YGCB 2LVIA 4OV2A 2P6BB 1XFZO 4GGNA 4I5JA 1DJGA 3O78A 1RROA 4JWQA 4USLA 3O2PA 4ETOA 2K7OA 2M1KB 1UURA 3I5IB 3SG5A 3DF0B 2QACA 1DVIA 1KFXS 2M97A 4HRGA 2KFFA 3ICBA 1Q80A 1QIWA 2CXJA 2GGMA 3NXAA 4YGAA 2NCOA 1B47A 3TS5B 1FI6A 1R6PA 3I5HB 2H61A 1NP8A 2GV5A 3GK4X 3GOFA 3CWGA 1QX7A 2I94A 1B9AA 1KK7Z 1UHJA 1RFJA 4MSPA 1WLMA 2OS8C 1KK8C 2G9BA 2KFGA 5HYDA 4MVFA 1Y0VH 3I5FB 1BLQA 4GGFC 1K90D 2Q4UA 3EK8A 1J7OA 3NSKA 1Y1XA 3VGOA 3IF7A 2JTZA 2KBMA 3DVJA 1H4BA 2NXQA 3C1VA 1CMGA 1UP5A 2CBLA 1IG5A 1K93D 1TNXA 1NPQA 1NIWA 3CS1A 1W7IB 4HRHA 3DVEA 5HKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKJ A;  1QV1 A;  3EK7 A;  3NSI A;  3TDI A;  1S1E A;  4PE7 A;  1YVH A;  2EC6 C;  1DF0 B;  1WY9 A;  2KGR A;  2MHH A;  1A03 A;  1KWO B;  2O60 A;  1SY9 A;  1MWN A;  3OHM B;  1B7T Y;  1TNW A;  5D69 A;  2JT0 A;  4BY5 A;  3D0Y A;  2LAN A;  1QJT A;  2SAS A;  2KYF A;  2L2E A;  1TOP A;  2CTN A;  1XFU O;  3EVV A;  1F55 A;  1GGZ A;  1TCF A;  1XO5 A;  1C07 A;  4ZCU A;  1U5I B;  5KSZ A;  4MZJ A;  1IQ3 A;  5JJG A;  1YUT A;  1TIZ A;  5PAL A;  4OR9 B;  4PAL A;  1WLZ A;  1UWO A;  3PN7 B;  1PAL A;  2FCE A;  1KFU S;  3BOW B;  3BUM B;  3SG4 A;  2ZRS A;  1F71 A;  1Y6W A;  1CNP A;  2WCB A;  3RLZ A;  4WQ2 A;  4YGE B;  3JTD C;  2LM5 A;  4PHM A;  4DS7 A;  2L5X B;  4I5K A;  5HKZ A;  1YUU A;  1XK4 C;  1ZFS A;  1UHN A;  1QVI Z;  3A8R A;  4E68 A;  1DMO A;  4FTG A;  2ZN8 A;  2ZKM X;  4ORC B;  1UUS A;  3SG2 A;  1V1G A;  5G08 A;  3SIA A;  1SW8 A;  2M7L A;  1A75 A;  2JNX A;  4JPZ B;  4MN0 A;  2LAP A;  1G4Y R;  3OB1 B;  2MJW B;  1S6I A;  1OMV A;  1RK9 A;  4XJK A;  4NQG A;  3WNX B;  3CR4 X;  2JQ6 A;  3FWB A;  2BCB A;  1SR6 C;  2H61 C;  1YRT B;  1REC A;  2KQ6 A;  1PK0 D;  2KDH A;  3TDU A;  3DF0 A;  2OTG B;  1N0Y A;  1Y1U A;  2ISD A;  1QX5 B;  1JFK A;  1QLS A;  1YUR A;  1IWQ A;  2PSR A;  1LIN A;  4DIR A;  2KI6 D;  1SL8 A;  4FQO A;  3CZT X;  1WRL A;  1PSR A;  2L4I A;  1XA5 A;  3DD4 A;  1EXR A;  4YGB B;  3BUO B;  4GUK A;  1PUL A;  2L51 A;  1IJ5 A;  4PDZ A;  5I2L A;  3DVM A;  3EK4 A;  4CLN A;  2Y4Q A;  3OP0 A;  4M2O A;  3O4Y A;  2NCP A;  4PHN A;  4MBE A;  3WHU B;  2HQ8 A;  2KI4 B;  3EVU A;  2BL0 B;  2JZI A;  2M1U A;  1CMF A;  3F45 A;  1EJ3 A;  2KSP A;  2KAV A;  1GJY A;  3WHT B;  2LE9 B;  2TN4 A;  1PRW A;  2JU0 A;  1KK8 B;  1K94 A;  4PHK A;  3VRO A;  1V1F A;  1AHR A;  4CFR A;  1CM1 A;  2L0P A;  1NX2 A;  2BEC A;  2LUX A;  1CLL A;  1LA0 A;  1CFC A;  1BU3 A;  1Y1A A;  1DJH A;  1NX3 A;  3QRX A;  3AAJ A;  3GK2 A;  2PAS A;  1L2O B;  5CSF A;  1BG1 A;  2OPO A;  2LP3 A;  1LXF C;  1CLM A;  3CGA A;  2K7C A;  2HQW A;  5DKQ A;  2M8U A;  4YI8 A;  5HKW A;  1SMG A;  1JC2 A;  3CR2 A;  4ORB B;  4MZL A;  4CFQ A;  2BE6 A;  1BOC A;  3ZNI A;  3FWC A;  4JQ0 D;  1XFX O;  5GQQ C;  1M45 A;  1OQP A;  2LVJ A;  1L7Z A;  3IQO A;  1QLK A;  2BKH B;  1YVL A;  1SL7 A;  2LP2 A;  5I2O A;  2PMY A;  1U5I A;  3LK1 A;  2LLS A;  3GK1 A;  1JF0 A;  1KQM C;  2SCP A;  1CM4 A;  4XYN A;  1NCX A;  2KAY A;  1XFY O;  2LMV A;  1SBJ A;  1DJI A;  1S5G Z;  3BOW A;  1MXL C;  1K9K A;  2K2A A;  4PCW A;  4TNC A;  5CSN A;  4A4B A;  3KPX A;  4IL1 A;  2LLT A;  2ZFD A;  4N5X A;  1N65 A;  4GNK B;  4HRE E;  2K2F A;  1ALV A;  1DTL A;  1SPY A;  1HQV A;  1GQM A;  2LMT A;  1FF1 A;  1WDC C;  5TNC A;  1OZS A;  4BY4 A;  1J7R A;  3I5G C;  1PSB A;  1WRZ A;  1GGW A;  2RGI A;  3JTD B;  5AER A;  1MF8 B;  1YUS A;  2L98 A;  1NX0 A;  2JWW A;  4HSZ A;  2LVV A;  4L9M A;  4C0L A;  4QJ3 B;  1A29 A;  1A4P A;  2H2K A;  1CFP A;  5D7F A;  4ORA B;  4PE4 A;  5AAN A;  2V53 A;  2Y1N A;  1LKJ A;  2M9G A;  1M31 A;  1SNL A;  2F3Y A;  2PVB A;  1M39 A;  1QS7 A;  2NZ0 A;  2MBX A;  4C0J A;  4PE0 A;  1JBA A;  1DGV A;  2FCD A;  1PVB A;  1SR6 B;  1JSA A;  1QX2 A;  3TUY B;  1D1O A;  2PAL A;  1CDP A;  5IBW A;  2WND A;  3HCM A;  1OSA A;  3SG7 A;  3PFV A;  1CLB A;  4MZK A;  5AXI A;  1HT9 A;  1R2U A;  4A4C A;  1ODB A;  2EGD A;  5CSJ A;  2MRD A;  3FS7 A;  2M7N A;  1FW4 A;  3NSO A;  4WRI A;  3SG3 A;  3OX6 A;  2K7B A;  2WC8 A;  3LL8 B;  5KU1 A;  3NSL A;  1XYD A;  5DKN A;  2KOT A;  3K21 A;  2B1U A;  1CFF A;  2BBM A;  2O5G A;  3SJS A;  4GAO A;  1ZOT B;  1TRF A;  2L50 A;  3OX5 A;  1DJW A;  1QXP A;  1OOJ A;  2L4H A;  3CTN A;  1DJX A;  2I2R E;  1CTR A;  1EG4 A;  1KSM A;  1MUX A;  1KK7 Y;  2ZND A;  3EVR A;  1PVA A;  1UHI A;  1EL4 A;  2HPS A;  2LNK A;  3OB2 B;  4ICB A;  1B1G A;  1IQ5 A;  1K95 A;  1YX8 A;  2CCM A;  4DUQ A;  1SCM C;  1DJY A;  4AOM A;  2KYC A;  2BCA A;  1QTX A;  3JVT C;  1KSO A;  4NDD A;  2KAX A;  3E3R A;  4OCI A;  3FIA A;  1VRK A;  1MR8 A;  4ZCV A;  2JXC A;  1N2D A;  2E30 A;  3LLE A;  4AQJ A;  5I2Q A;  4MRY A;  4YBH B;  4QJ5 B;  2A4J A;  2WCF A;  4I5L B;  1A2X A;  2PRU A;  2LMU A;  1FPW A;  1AJ4 A;  1C7V A;  1ZUZ A;  4Q04 A;  1UHK A;  1BR4 B;  2AAO A;  1B7T Z;  2K8M B;  2KBI A;  3LCP C;  2LHL A;  3WXA A;  2MLE C;  1F54 A;  1F8H A;  1B8C A;  2OS8 B;  2I18 A;  1OMR A;  3PSR A;  1XVJ A;  2F8P A;  3KHE A;  1QV0 A;  2WCE A;  1BJF A;  1WRK A;  2BBN A;  1RTP 1;  1K9P A;  1EG3 A;  3BXK A;  2M49 B;  2WOS A;  4NDB A;  2Y5I A;  4F0Z B;  1AVS A;  1NYA A;  2K61 A;  1DF0 A;  2AUC A;  4XJK B;  1SCV A;  1TN4 A;  5K89 A;  1IJ6 A;  2I7A A;  1JWD A;  1QIV A;  2OTG C;  3H4S E;  1X02 A;  3ZWH A;  5HLV A;  1JFJ A;  1WDC B;  1ZMZ A;  2BCX A;  2KQY A;  2EC6 B;  2JNF A;  1IGV A;  2JXL A;  3I5G B;  1XK4 A;  1ALW A;  1NCY A;  1AP4 A;  2K0J A;  2IS9 A;  2G2B A;  1YX7 A;  1QVI Y;  1SYM A;  2LC5 A;  2M3W A;  1NCZ A;  3BUW B;  1BMO A;  1TNP A;  2ZRT A;  3KEV A;  2AMI A;  2JTT A;  1M63 B;  2QPT A;  2R2I A;  1QAT A;  5KTY A;  1JUO A;  1MQ1 A;  2CNP A;  2KHN A;  2JPT A;  4M2Q A;  5FYX A;  1NUB A;  1XFW O;  1K96 A;  3AAK A;  1J7P A;  1BOD A;  1NSH A;  4UPG A;  2KI4 C;  3TDZ A;  2BL0 C;  2JUL A;  2NLN A;  4WQ3 A;  2Y1M A;  3VRN A;  1LA3 A;  1J1E A;  2LV7 A;  4N1G A;  3LK0 A;  3I5I C;  5HLO A;  2F33 A;  3PAT A;  2ZN9 A;  5ER5 A;  1S3P A;  3KF9 A;  1RJV A;  2VRG A;  3TZ1 A;  2KNE A;  1L2O C;  2JOJ A;  2K7D A;  3PAL A;  1J7Q A;  2FJU B;  1F4Q A;  1XFV O;  4R1E A;  1F70 A;  3TS5 C;  1KCY A;  2LVK A;  2MLF C;  1E8A A;  1EH2 A;  3I5H C;  3BUN B;  4P2Y B;  1SKT A;  1J1D A;  1S6J A;  1FBV A;  3IQQ A;  1W7J B;  2EHB A;  4N1F A;  3CR5 X;  5F6T A;  3AKA A;  1LVC D;  1F4O A;  4M2P A;  4YGD B;  2ZNE A;  1AUI B;  3I5F C;  4MLW A;  2CT9 A;  4DCK A;  5AFP A;  5JOL A;  1J55 A;  3AKB A;  4AQI A;  1OE9 B;  1FI5 A;  1JF2 A;  1SCM B;  2LHI A;  2LLU A;  1YRU B;  1KFX L;  1YTZ C;  3CLN A;  3HX4 A;  4MEW A;  2MAZ A;  4C0K A;  1SL9 A;  4QJ4 B;  3PLF B;  4OVN F;  3JVT B;  4PHJ A;  4U8D A;  1TCO B;  3RM1 A;  2JT8 A;  5I8N A;  3SG6 A;  1YR5 A;  2KFH A;  1IH0 A;  1S36 A;  1OZO A;  3A4U B;  1RWY A;  3BYA A;  1KWO C;  1S26 D;  4CID A;  2M0R A;  2E6W A;  1BF5 A;  1H8B A;  2F2P A;  1C7W A;  3D10 A;  1BT6 A;  4I5N B;  1ZAC A;  2BKI B;  5J3X A;  2Q91 A;  4MRX A;  1G33 A;  1CDM A;  4GGF A;  3D0Y B;  2D8N A;  3M0W A;  3PM8 A;  2DOQ A;  5AEQ A;  3VRQ A;  2JRF A;  4YRU A;  1G8I A;  1TNQ A;  2BE4 A;  3BQ3 A;  4PE1 A;  1CKK A;  1SRA A;  2WOR A;  2LUC A;  2COL B;  3PN7 C;  2HF5 A;  1B8R A;  4GPL B;  1S5G Y;  1OMD A;  3EKH A;  4GBA A;  1CFD A;  4NDC A;  2HET A;  1S6C A;  1B8L A;  5CSI A;  4P5O E;  1BR1 B;  3TUY C;  2KGB C;  5DKR A;  1DGU A;  3VRR A;  2GGZ A;  5ER4 X;  1M46 A;  5CPV A;  5BPJ A;  1CB1 A;  3BUX B;  2JC2 A;  1SK6 D;  2JT3 A;  1CDN A;  2FOT A;  1NX1 A;  4YI9 A;  4CPV A;  1NWD A;  3O6B A;  1IRJ A;  1K8U A;  1K9U A;  4D1E A;  1QAS A;  1TTX A;  3KO0 A;  1MXE A;  3DVK A;  4DRW A;  4OKH A;  1KQM B;  2F3Z A;  1DJZ A;  2LCP A;  3VRP A;  1AJ5 A;  1IKU A;  4GFT A;  1DT7 B;  1B4C A;  5B8I B;  1K2H A;  1A75 B;  2F2O A;  1UHH A;  1CDL A;  2M29 A;  2MA2 A;  1AK8 A;  3MSE B;  1KFU L;  1KQV A;  1MHO A;  2KI6 C;  3SIB A;  4YGC B;  2LVI A;  4OV2 A;  2P6B B;  1XFZ O;  4GGN A;  4I5J A;  1DJG A;  3O78 A;  1RRO A;  4JWQ A;  4USL A;  3O2P A;  4ETO A;  2K7O A;  2M1K B;  1UUR A;  3I5I B;  3SG5 A;  3DF0 B;  2QAC A;  1DVI A;  1KFX S;  2M97 A;  4HRG A;  2KFF A;  3ICB A;  1Q80 A;  1QIW A;  2CXJ A;  2GGM A;  3NXA A;  4YGA A;  2NCO A;  1B47 A;  3TS5 B;  1FI6 A;  1R6P A;  3I5H B;  2H61 A;  1NP8 A;  2GV5 A;  3GK4 X;  3GOF A;  3CWG A;  1QX7 A;  2I94 A;  1B9A A;  1KK7 Z;  1UHJ A;  1RFJ A;  4MSP A;  1WLM A;  2OS8 C;  1KK8 C;  2G9B A;  2KFG A;  5HYD A;  4MVF A;  1Y0V H;  3I5F B;  1BLQ A;  4GGF C;  1K90 D;  2Q4U A;  3EK8 A;  1J7O A;  3NSK A;  1Y1X A;  3VGO A;  3IF7 A;  2JTZ A;  2KBM A;  3DVJ A;  1H4B A;  2NXQ A;  3C1V A;  1CMG A;  1UP5 A;  2CBL A;  1IG5 A;  1K93 D;  1TNX A;  1NPQ A;  1NIW A;  3CS1 A;  1W7I B;  4HRH A;  3DVE A;  5HKY A; 
#chains in the Genus database with same CATH topology
 3EKJ A;  1QV1 A;  3EK7 A;  3NSI A;  3TDI A;  1S1E A;  4PE7 A;  1YVH A;  2EC6 C;  1DF0 B;  1WY9 A;  2KGR A;  1XFR A;  2MHH A;  1A03 A;  1KWO B;  2O60 A;  1SY9 A;  1MWN A;  3OHM B;  1B7T Y;  1ORG A;  1TNW A;  5D69 A;  2JT0 A;  4BY5 A;  3D0Y A;  2LAN A;  4KYN A;  1QJT A;  2SAS A;  2KYF A;  2L2E A;  1TOP A;  2CTN A;  1XFU O;  3EVV A;  3S0G A;  1F55 A;  1GGZ A;  1OW4 A;  1TCF A;  1XO5 A;  2BAP A;  4ZCU A;  1U5I B;  3S0E A;  3D78 A;  4IJ7 A;  4MZJ A;  3SS3 A;  5KSZ A;  1IQ3 A;  5JJG A;  1YUT A;  1TIZ A;  5PAL A;  4OR9 B;  4PAL A;  1WLZ A;  1UWO A;  3PN7 B;  1PAL A;  2FCE A;  1KFU S;  3BOW B;  3DY9 A;  3BUM B;  3SG4 A;  1TUJ A;  3RZS A;  2ZRS A;  1F71 A;  1Y6W A;  1CNP A;  2WCB A;  3RLZ A;  4WQ2 A;  3BFA A;  3JTD C;  4YGE B;  2LM5 A;  4PHM A;  3S0B A;  4DS7 A;  4F7F A;  2L5X B;  4I5K A;  5HKZ A;  1YUU A;  1XK4 C;  1ZFS A;  1UHN A;  1QVI Z;  3A8R A;  4E68 A;  1DMO A;  4FTG A;  2ZN8 A;  2ZKM X;  4ORC B;  1UUS A;  3SG2 A;  1V1G A;  3QME A;  5G08 A;  3SIA A;  2BNX A;  1SW8 A;  4JKT A;  2M7L A;  1A75 A;  2JNX A;  4JPZ B;  4MN0 A;  2LAP A;  1G4Y R;  3OB1 B;  2MJW B;  3R1P A;  1S6I A;  1OMV A;  1RK9 A;  4XJK A;  4NQG A;  3WNX B;  3CR4 X;  2JQ6 A;  3FWB A;  2BCB A;  1SR6 C;  2H61 C;  1OOF A;  1YRT B;  1REC A;  2KQ6 A;  1PK0 D;  2L5Y A;  2KDH A;  3TDU A;  3DF0 A;  2OTG B;  1N0Y A;  1Y1U A;  2ISD A;  1QX5 B;  1JFK A;  1QLS A;  1YUR A;  1IWQ A;  2PSR A;  1LIN A;  4DIR A;  2KI6 D;  1SL8 A;  3D76 A;  4FQO A;  3CZT X;  1WRL A;  1PSR A;  2L4I A;  1XA5 A;  3DD4 A;  5D3O A;  1EXR A;  3FE6 A;  4YGB B;  3L47 A;  3BUO B;  4GUK A;  1PUL A;  2L51 A;  1IJ5 A;  4PDZ A;  5I2L A;  5HL1 A;  3DVM A;  2KPH A;  3EK4 A;  4CLN A;  2Y4Q A;  3OP0 A;  4M2O A;  3O4Y A;  2NCP A;  4OZD A;  1DQE A;  4PHN A;  4MBE A;  3WHU B;  2HQ8 A;  2KI4 B;  3EVU A;  5FI6 A;  2BL0 B;  3B87 A;  2JZI A;  2M1U A;  1SSE B;  2WCM A;  3F45 A;  1EJ3 A;  2KSP A;  2KAV A;  1CMF A;  1GJY A;  3WHT B;  2LE9 B;  2TN4 A;  1PRW A;  2JU0 A;  1KK8 B;  1K94 A;  4PHK A;  3VRO A;  1V1F A;  1AHR A;  4CFR A;  1CM1 A;  3SS4 A;  2L0P A;  1NX2 A;  2BEC A;  2LUX A;  1CLL A;  1LA0 A;  1CFC A;  1BU3 A;  1Y1A A;  1DJH A;  1NX3 A;  3QRX A;  3AAJ A;  3GK2 A;  2PAS A;  1L2O B;  5CSF A;  1BG1 A;  2PYQ A;  2OPO A;  2LP3 A;  1LXF C;  1CLM A;  3CGA A;  2K7C A;  2HQW A;  5DKQ A;  2M8U A;  2JPO A;  4YI8 A;  5HKW A;  1SMG A;  1JC2 A;  3CR2 A;  4ORB B;  4MZL A;  4CFQ A;  2BE6 A;  1BOC A;  1T14 A;  2FJY A;  3ZNI A;  3FWC A;  2KLE A;  1XFX O;  1LS8 A;  4JQ0 D;  5GQQ C;  5FI2 A;  1M45 A;  1OQP A;  2LVJ A;  3CZ2 A;  1L7Z A;  3IQO A;  1QLK A;  2BKH B;  1YVL A;  1SL7 A;  2LP2 A;  5I2O A;  2PMY A;  3BJH A;  3D73 A;  1U5I A;  3LK1 A;  2K60 A;  2LLS A;  3GK1 A;  3L4L A;  1JF0 A;  1KQM C;  2SCP A;  1CM4 A;  2YGU A;  4XYN A;  1NCX A;  2KAY A;  1XFY O;  2LMV A;  1SBJ A;  1DJI A;  1S5G Z;  3BOW A;  1MXL C;  1K9K A;  2K2A A;  4PCW A;  4TNC A;  5CSN A;  4A4B A;  3KPX A;  4IL1 A;  2LLT A;  2QEB A;  2ZFD A;  1N65 A;  4GNK B;  4HRE E;  2K2F A;  4N5X A;  1ALV A;  1DTL A;  1SPY A;  1HQV A;  1GQM A;  2LMT A;  1FF1 A;  1WDC C;  5FI7 A;  5TNC A;  3O4X A;  1OZS A;  4BY4 A;  1J7R A;  3I5G C;  1PSB A;  1WRZ A;  5DIC A;  2KLD A;  1GGW A;  2RGI A;  3JTD B;  5AER A;  1MF8 B;  1YUS A;  2L98 A;  3CDN A;  1NX0 A;  2JWW A;  4HSZ A;  2LVV A;  4L9M A;  4C0L A;  4QJ3 B;  1A29 A;  1A4P A;  3K1E A;  2H2K A;  2PQL A;  1CFP A;  5D7F A;  4ORA B;  4PE4 A;  5AAN A;  2V53 A;  2Y1N A;  1LKJ A;  2M9G A;  1M31 A;  3CYZ A;  1SNL A;  2F3Y A;  2PVB A;  1M39 A;  1QS7 A;  2NZ0 A;  2MBX A;  4C0J A;  4PE0 A;  1JBA A;  1OOG A;  3B6X A;  1DGV A;  3IVT A;  2FCD A;  1PVB A;  3DYE A;  1SR6 B;  1JSA A;  1IIO A;  1QX2 A;  3TUY B;  1D1O A;  2PAL A;  1CDP A;  5IBW A;  2WND A;  3HCM A;  1OSA A;  3SG7 A;  3PFV A;  1CLB A;  4MZK A;  5AXI A;  1HT9 A;  1TWO A;  1R2U A;  3V2L A;  4A4C A;  1ODB A;  2EGD A;  3CZ0 A;  3D74 A;  5CSJ A;  2MRD A;  3FS7 A;  2M7N A;  3PJI A;  1FW4 A;  2QEV A;  3NSO A;  2WCK A;  4WRI A;  3SG3 A;  3OX6 A;  2K7B A;  2WC8 A;  3LL8 B;  5KU1 A;  3FE8 A;  3NSL A;  1XYD A;  5DKN A;  2KOT A;  3K21 A;  2B1U A;  1CFF A;  2BBM A;  2O5G A;  3SJS A;  4GAO A;  1ZOT B;  1TRF A;  2L50 A;  3OX5 A;  1DJW A;  3VB1 A;  3OGN A;  2WCL A;  1QXP A;  1OOJ A;  2L4H A;  3CTN A;  1DJX A;  2I2R E;  1CTR A;  1EG4 A;  1KSM A;  1MUX A;  1KK7 Y;  2ZND A;  3EVR A;  1PVA A;  1UHI A;  3S0A A;  1EL4 A;  2HPS A;  2LNK A;  3OB2 B;  4ICB A;  1B1G A;  3S0F A;  1IQ5 A;  1K95 A;  1YX8 A;  2CCM A;  4DUQ A;  1SCM C;  1DJY A;  5EL2 A;  4AOM A;  2KYC A;  2BCA A;  1QTX A;  3JVT C;  1KSO A;  4NDD A;  2KAX A;  3E3R A;  4OCI A;  3FIA A;  1VRK A;  1MR8 A;  1Z4H A;  4ZCV A;  2JXC A;  1N2D A;  2E30 A;  3LLE A;  4AQJ A;  5I2Q A;  4MRY A;  4YBH B;  4QJ5 B;  2A4J A;  2WCF A;  4I5L B;  1A2X A;  2PRU A;  2LMU A;  3DZT A;  1AJ4 A;  1FPW A;  2GTE A;  3SS5 A;  4INX A;  1C7V A;  2WCH A;  1DEK A;  3R1O A;  1ZUZ A;  4Q04 A;  1UHK A;  1BR4 B;  2AAO A;  1B7T Z;  3D75 A;  2K8M B;  2KBI A;  3LCP C;  2LHL A;  4FQT A;  3WXA A;  2MLE C;  1F54 A;  1F8H A;  1B8C A;  2OS8 B;  2I18 A;  1OMR A;  3PSR A;  1XVJ A;  2F8P A;  3KHE A;  1QV0 A;  2WC6 A;  2WCE A;  1BJF A;  1WRK A;  2BBN A;  1RTP 1;  1K9P A;  1EG3 A;  3BXK A;  2M49 B;  2WOS A;  4NDB A;  2Y5I A;  4F0Z B;  1AVS A;  1NYA A;  2K61 A;  1DF0 A;  2AUC A;  1Z2C B;  4XJK B;  1SCV A;  1TN4 A;  5K89 A;  1IJ6 A;  2I7A A;  1JWD A;  1QIV A;  2OTG C;  3BFH A;  3H4S E;  1X02 A;  3ZWH A;  5HLV A;  1JFJ A;  1WDC B;  1ZMZ A;  2BCX A;  2KQY A;  2EC6 B;  2H8V A;  2JNF A;  1IGV A;  2JXL A;  3I5G B;  1XK4 A;  1ALW A;  1NCY A;  2WCJ A;  2K0J A;  1AP4 A;  2IS9 A;  3B86 A;  2G2B A;  1YX7 A;  1QVI Y;  1SYM A;  2LC5 A;  2M3W A;  1NCZ A;  3BUW B;  3EG5 B;  1BMO A;  3B7A A;  1TNP A;  2ZRT A;  3KEV A;  2AMI A;  2JTT A;  1M63 B;  2WC5 A;  2QPT A;  2R2I A;  1QAT A;  5KTY A;  1JUO A;  1MQ1 A;  2CNP A;  2KHN A;  2JPT A;  4M2Q A;  5FYX A;  1NUB A;  1XFW O;  1K96 A;  3AAK A;  2L2C A;  1J7P A;  1BOD A;  1NSH A;  4UPG A;  2KI4 C;  3TDZ A;  2BL0 C;  2JUL A;  2NLN A;  4WQ3 A;  2Y1M A;  3VRN A;  1LA3 A;  3UO9 A;  1J1E A;  2LV7 A;  4N1G A;  3L4A A;  3LK0 A;  1C3Z A;  3I5I C;  5HLO A;  2F33 A;  3PAT A;  2ZN9 A;  1QWV A;  5ER5 A;  2QDI A;  1S3P A;  3KF9 A;  1RJV A;  3CZ1 A;  2VRG A;  3TZ1 A;  2KNE A;  1L2O C;  2JOJ A;  1TUZ A;  2K7D A;  3PAL A;  1J7Q A;  2FJU B;  1F4Q A;  1XFV O;  4R1E A;  1F70 A;  3TS5 C;  1KCY A;  2LVK A;  2MLF C;  3OBV A;  1E8A A;  1EH2 A;  3I5H C;  3BUN B;  4P2Y B;  1SKT A;  1J1D A;  1S6J A;  1FBV A;  2QEH A;  1W7J B;  2EHB A;  3IQQ A;  4N1F A;  3CR5 X;  5F6T A;  3AKA A;  1LVC D;  1F4O A;  4M2P A;  1DEL A;  1W9Z A;  4YGD B;  2ZNE A;  1AUI B;  3I5F C;  4MLW A;  2CT9 A;  4DCK A;  5AFP A;  5JOL A;  1J55 A;  4JD9 A;  4PT1 A;  3AKB A;  4AQI A;  1OE9 B;  1FI5 A;  1JF2 A;  1SCM B;  2LHI A;  2LLU A;  2QEO A;  1YRU B;  1KFX L;  1YTZ C;  3CLN A;  3HX4 A;  4MEW A;  2MAZ A;  4C0K A;  1SL9 A;  4QJ4 B;  3PLF B;  4OVN F;  3JVT B;  4PHJ A;  4U8D A;  1TCO B;  3RM1 A;  2JT8 A;  5I8N A;  3SG6 A;  1YR5 A;  2KFH A;  1IH0 A;  1S36 A;  1OZO A;  3A4U B;  3R1V A;  1RWY A;  3BYA A;  1KWO C;  1S26 D;  4CID A;  2M0R A;  2E6W A;  1BF5 A;  1H8B A;  2F2P A;  1C7W A;  3D10 A;  1BT6 A;  4I5N B;  1ZAC A;  2BKI B;  5J3X A;  2Q91 A;  4MRX A;  1G33 A;  1CDM A;  4GGF A;  3D0Y B;  2D8N A;  3M0W A;  3PM8 A;  2P70 A;  2DOQ A;  5AEQ A;  3VRQ A;  2JRF A;  3Q8I A;  4YRU A;  1G8I A;  1TNQ A;  2BE4 A;  3BQ3 A;  4PE1 A;  1CKK A;  1SRA A;  2WOR A;  2LUC A;  3DXL A;  2COL B;  3PN7 C;  2HF5 A;  1B8R A;  4GPL B;  1S5G Y;  1OMD A;  3B88 A;  3EKH A;  4GBA A;  1CFD A;  4NDC A;  1P28 A;  2HET A;  5I94 A;  1C3Y A;  1S6C A;  1B8L A;  5CSI A;  4P5O E;  1BR1 B;  3TUY C;  2KGB C;  5DKR A;  1DGU A;  3VRR A;  2GGZ A;  5ER4 X;  4INW A;  1M46 A;  5CPV A;  5BPJ A;  1CB1 A;  3BUX B;  2JC2 A;  1SK6 D;  2JT3 A;  3D77 A;  1CDN A;  2FOT A;  1NX1 A;  4YI9 A;  4CPV A;  1NWD A;  3O6B A;  1IRJ A;  1K8U A;  1K9U A;  4D1E A;  1QAS A;  1TTX A;  3KO0 A;  1MXE A;  3DVK A;  3UNW A;  4DRW A;  4OKH A;  1KQM B;  2F3Z A;  1DJZ A;  2LCP A;  3BFB A;  3VRP A;  1AJ5 A;  1IKU A;  4GFT A;  1DT7 B;  1B4C A;  5B8I B;  1K2H A;  1A75 B;  2F2O A;  2P71 A;  3FE9 A;  1UHH A;  1CDL A;  2M29 A;  2MA2 A;  1AK8 A;  3MSE B;  1KFU L;  1KQV A;  1MHO A;  2KI6 C;  3SIB A;  4YGC B;  2ERB A;  2LVI A;  4OV2 A;  2P6B B;  1XFZ O;  4GGN A;  4I5J A;  1DJG A;  3O78 A;  1RRO A;  4JWQ A;  4USL A;  3O2P A;  4ETO A;  2K7O A;  2M1K B;  1UUR A;  3CAB A;  3I5I B;  3SG5 A;  3DF0 B;  2QAC A;  1DVI A;  1GM0 A;  3PM2 A;  1KFX S;  2M97 A;  3NHT A;  4HRG A;  2KFF A;  3ICB A;  1Q80 A;  1QIW A;  2CXJ A;  1C07 A;  2GGM A;  1OOH A;  3R72 A;  3NXA A;  4YGA A;  2NCO A;  3S0D A;  1B47 A;  3TS5 B;  1FI6 A;  1R6P A;  3I5H B;  2H61 A;  1NP8 A;  2GV5 A;  3GK4 X;  3GOF A;  3CWG A;  1QX7 A;  2I94 A;  1B9A A;  1KK7 Z;  1UHJ A;  1RFJ A;  4MSP A;  1WLM A;  2OS8 C;  3NGV A;  1KK8 C;  2G9B A;  2KFG A;  5HYD A;  4MVF A;  1Y0V H;  3I5F B;  3N7H A;  1BLQ A;  4GGF C;  1K90 D;  2Q4U A;  3EK8 A;  1J7O A;  3NSK A;  1Y1X A;  3VGO A;  3IF7 A;  2JTZ A;  2KBM A;  3DVJ A;  1H4B A;  2NXQ A;  3C1V A;  1CMG A;  1UP5 A;  2CBL A;  3NHI A;  1IG5 A;  1K93 D;  1TNX A;  1NPQ A;  1NIW A;  3CS1 A;  1W7I B;  4HRH A;  1DC1 A;  3DVE A;  5HKY A;  1OOI X; 
#chains in the Genus database with same CATH homology
 3EKJ A;  1QV1 A;  3EK7 A;  3NSI A;  3TDI A;  1S1E A;  4PE7 A;  1YVH A;  2EC6 C;  1DF0 B;  1WY9 A;  2KGR A;  2MHH A;  1A03 A;  1KWO B;  2O60 A;  1SY9 A;  1MWN A;  3OHM B;  1B7T Y;  1TNW A;  5D69 A;  2JT0 A;  4BY5 A;  3D0Y A;  2LAN A;  1QJT A;  2SAS A;  2KYF A;  2L2E A;  1TOP A;  2CTN A;  1XFU O;  3EVV A;  1F55 A;  1GGZ A;  1TCF A;  1XO5 A;  1C07 A;  4ZCU A;  1U5I B;  5KSZ A;  4MZJ A;  1IQ3 A;  5JJG A;  1YUT A;  1TIZ A;  5PAL A;  4OR9 B;  4PAL A;  1WLZ A;  1UWO A;  3PN7 B;  1PAL A;  2FCE A;  1KFU S;  3BOW B;  3BUM B;  3SG4 A;  2ZRS A;  1F71 A;  1Y6W A;  1CNP A;  2WCB A;  3RLZ A;  4WQ2 A;  4YGE B;  3JTD C;  2LM5 A;  4PHM A;  4DS7 A;  2L5X B;  4I5K A;  5HKZ A;  1YUU A;  1XK4 C;  1ZFS A;  1UHN A;  1QVI Z;  3A8R A;  4E68 A;  1DMO A;  4FTG A;  2ZN8 A;  2ZKM X;  4ORC B;  1UUS A;  3SG2 A;  1V1G A;  5G08 A;  3SIA A;  1SW8 A;  2M7L A;  1A75 A;  2JNX A;  4JPZ B;  4MN0 A;  2LAP A;  1G4Y R;  3OB1 B;  2MJW B;  1S6I A;  1OMV A;  1RK9 A;  4XJK A;  4NQG A;  3WNX B;  3CR4 X;  2JQ6 A;  3FWB A;  2BCB A;  1SR6 C;  2H61 C;  1YRT B;  1REC A;  2KQ6 A;  1PK0 D;  2KDH A;  3TDU A;  3DF0 A;  2OTG B;  1N0Y A;  1Y1U A;  2ISD A;  1QX5 B;  1JFK A;  1QLS A;  1YUR A;  1IWQ A;  2PSR A;  1LIN A;  4DIR A;  2KI6 D;  1SL8 A;  4FQO A;  3CZT X;  1WRL A;  1PSR A;  2L4I A;  1XA5 A;  3DD4 A;  1EXR A;  4YGB B;  3BUO B;  4GUK A;  1PUL A;  2L51 A;  1IJ5 A;  4PDZ A;  5I2L A;  3DVM A;  3EK4 A;  4CLN A;  2Y4Q A;  3OP0 A;  4M2O A;  3O4Y A;  2NCP A;  4PHN A;  4MBE A;  3WHU B;  2HQ8 A;  2KI4 B;  3EVU A;  2BL0 B;  2JZI A;  2M1U A;  1CMF A;  3F45 A;  1EJ3 A;  2KSP A;  2KAV A;  1GJY A;  3WHT B;  2LE9 B;  2TN4 A;  1PRW A;  2JU0 A;  1KK8 B;  1K94 A;  4PHK A;  3VRO A;  1V1F A;  1AHR A;  4CFR A;  1CM1 A;  2L0P A;  1NX2 A;  2BEC A;  2LUX A;  1CLL A;  1LA0 A;  1CFC A;  1BU3 A;  1Y1A A;  1DJH A;  1NX3 A;  3QRX A;  3AAJ A;  3GK2 A;  2PAS A;  1L2O B;  5CSF A;  1BG1 A;  2OPO A;  2LP3 A;  1LXF C;  1CLM A;  3CGA A;  2K7C A;  2HQW A;  5DKQ A;  2M8U A;  4YI8 A;  5HKW A;  1SMG A;  1JC2 A;  3CR2 A;  4ORB B;  4MZL A;  4CFQ A;  2BE6 A;  1BOC A;  3ZNI A;  3FWC A;  4JQ0 D;  1XFX O;  5GQQ C;  1M45 A;  1OQP A;  2LVJ A;  1L7Z A;  3IQO A;  1QLK A;  2BKH B;  1YVL A;  1SL7 A;  2LP2 A;  5I2O A;  2PMY A;  1U5I A;  3LK1 A;  2LLS A;  3GK1 A;  1JF0 A;  1KQM C;  2SCP A;  1CM4 A;  4XYN A;  1NCX A;  2KAY A;  1XFY O;  2LMV A;  1SBJ A;  1DJI A;  1S5G Z;  3BOW A;  1MXL C;  1K9K A;  2K2A A;  4PCW A;  4TNC A;  5CSN A;  4A4B A;  3KPX A;  4IL1 A;  2LLT A;  2ZFD A;  4N5X A;  1N65 A;  4GNK B;  4HRE E;  2K2F A;  1ALV A;  1DTL A;  1SPY A;  1HQV A;  1GQM A;  2LMT A;  1FF1 A;  1WDC C;  5TNC A;  1OZS A;  4BY4 A;  1J7R A;  3I5G C;  1PSB A;  1WRZ A;  1GGW A;  2RGI A;  3JTD B;  5AER A;  1MF8 B;  1YUS A;  2L98 A;  1NX0 A;  2JWW A;  4HSZ A;  2LVV A;  4L9M A;  4C0L A;  4QJ3 B;  1A29 A;  1A4P A;  2H2K A;  1CFP A;  5D7F A;  4ORA B;  4PE4 A;  5AAN A;  2V53 A;  2Y1N A;  1LKJ A;  2M9G A;  1M31 A;  1SNL A;  2F3Y A;  2PVB A;  1M39 A;  1QS7 A;  2NZ0 A;  2MBX A;  4C0J A;  4PE0 A;  1JBA A;  1DGV A;  2FCD A;  1PVB A;  1SR6 B;  1JSA A;  1QX2 A;  3TUY B;  1D1O A;  2PAL A;  1CDP A;  5IBW A;  2WND A;  3HCM A;  1OSA A;  3SG7 A;  3PFV A;  1CLB A;  4MZK A;  5AXI A;  1HT9 A;  1R2U A;  4A4C A;  1ODB A;  2EGD A;  5CSJ A;  2MRD A;  3FS7 A;  2M7N A;  1FW4 A;  3NSO A;  4WRI A;  3SG3 A;  3OX6 A;  2K7B A;  2WC8 A;  3LL8 B;  5KU1 A;  3NSL A;  1XYD A;  5DKN A;  2KOT A;  3K21 A;  2B1U A;  1CFF A;  2BBM A;  2O5G A;  3SJS A;  4GAO A;  1ZOT B;  1TRF A;  2L50 A;  3OX5 A;  1DJW A;  1QXP A;  1OOJ A;  2L4H A;  3CTN A;  1DJX A;  2I2R E;  1CTR A;  1EG4 A;  1KSM A;  1MUX A;  1KK7 Y;  2ZND A;  3EVR A;  1PVA A;  1UHI A;  1EL4 A;  2HPS A;  2LNK A;  3OB2 B;  4ICB A;  1B1G A;  1IQ5 A;  1K95 A;  1YX8 A;  2CCM A;  4DUQ A;  1SCM C;  1DJY A;  4AOM A;  2KYC A;  2BCA A;  1QTX A;  3JVT C;  1KSO A;  4NDD A;  2KAX A;  3E3R A;  4OCI A;  3FIA A;  1VRK A;  1MR8 A;  4ZCV A;  2JXC A;  1N2D A;  2E30 A;  3LLE A;  4AQJ A;  5I2Q A;  4MRY A;  4YBH B;  4QJ5 B;  2A4J A;  2WCF A;  4I5L B;  1A2X A;  2PRU A;  2LMU A;  1FPW A;  1AJ4 A;  1C7V A;  1ZUZ A;  4Q04 A;  1UHK A;  1BR4 B;  2AAO A;  1B7T Z;  2K8M B;  2KBI A;  3LCP C;  2LHL A;  3WXA A;  2MLE C;  1F54 A;  1F8H A;  1B8C A;  2OS8 B;  2I18 A;  1OMR A;  3PSR A;  1XVJ A;  2F8P A;  3KHE A;  1QV0 A;  2WCE A;  1BJF A;  1WRK A;  2BBN A;  1RTP 1;  1K9P A;  1EG3 A;  3BXK A;  2M49 B;  2WOS A;  4NDB A;  2Y5I A;  4F0Z B;  1AVS A;  1NYA A;  2K61 A;  1DF0 A;  2AUC A;  4XJK B;  1SCV A;  1TN4 A;  5K89 A;  1IJ6 A;  2I7A A;  1JWD A;  1QIV A;  2OTG C;  3H4S E;  1X02 A;  3ZWH A;  5HLV A;  1JFJ A;  1WDC B;  1ZMZ A;  2BCX A;  2KQY A;  2EC6 B;  2JNF A;  1IGV A;  2JXL A;  3I5G B;  1XK4 A;  1ALW A;  1NCY A;  1AP4 A;  2K0J A;  2IS9 A;  2G2B A;  1YX7 A;  1QVI Y;  1SYM A;  2LC5 A;  2M3W A;  1NCZ A;  3BUW B;  1BMO A;  1TNP A;  2ZRT A;  3KEV A;  2AMI A;  2JTT A;  1M63 B;  2QPT A;  2R2I A;  1QAT A;  5KTY A;  1JUO A;  1MQ1 A;  2CNP A;  2KHN A;  2JPT A;  4M2Q A;  5FYX A;  1NUB A;  1XFW O;  1K96 A;  3AAK A;  1J7P A;  1BOD A;  1NSH A;  4UPG A;  2KI4 C;  3TDZ A;  2BL0 C;  2JUL A;  2NLN A;  4WQ3 A;  2Y1M A;  3VRN A;  1LA3 A;  1J1E A;  2LV7 A;  4N1G A;  3LK0 A;  3I5I C;  5HLO A;  2F33 A;  3PAT A;  2ZN9 A;  5ER5 A;  1S3P A;  3KF9 A;  1RJV A;  2VRG A;  3TZ1 A;  2KNE A;  1L2O C;  2JOJ A;  2K7D A;  3PAL A;  1J7Q A;  2FJU B;  1F4Q A;  1XFV O;  4R1E A;  1F70 A;  3TS5 C;  1KCY A;  2LVK A;  2MLF C;  1E8A A;  1EH2 A;  3I5H C;  3BUN B;  4P2Y B;  1SKT A;  1J1D A;  1S6J A;  1FBV A;  3IQQ A;  1W7J B;  2EHB A;  4N1F A;  3CR5 X;  5F6T A;  3AKA A;  1LVC D;  1F4O A;  4M2P A;  4YGD B;  2ZNE A;  1AUI B;  3I5F C;  4MLW A;  2CT9 A;  4DCK A;  5AFP A;  5JOL A;  1J55 A;  3AKB A;  4AQI A;  1OE9 B;  1FI5 A;  1JF2 A;  1SCM B;  2LHI A;  2LLU A;  1YRU B;  1KFX L;  1YTZ C;  3CLN A;  3HX4 A;  4MEW A;  2MAZ A;  4C0K A;  1SL9 A;  4QJ4 B;  3PLF B;  4OVN F;  3JVT B;  4PHJ A;  4U8D A;  1TCO B;  3RM1 A;  2JT8 A;  5I8N A;  3SG6 A;  1YR5 A;  2KFH A;  1IH0 A;  1S36 A;  1OZO A;  3A4U B;  1RWY A;  3BYA A;  1KWO C;  1S26 D;  4CID A;  2M0R A;  2E6W A;  1BF5 A;  1H8B A;  2F2P A;  1C7W A;  3D10 A;  1BT6 A;  4I5N B;  1ZAC A;  2BKI B;  5J3X A;  2Q91 A;  4MRX A;  1G33 A;  1CDM A;  4GGF A;  3D0Y B;  2D8N A;  3M0W A;  3PM8 A;  2DOQ A;  5AEQ A;  3VRQ A;  2JRF A;  4YRU A;  1G8I A;  1TNQ A;  2BE4 A;  3BQ3 A;  4PE1 A;  1CKK A;  1SRA A;  2WOR A;  2LUC A;  2COL B;  3PN7 C;  2HF5 A;  1B8R A;  4GPL B;  1S5G Y;  1OMD A;  3EKH A;  4GBA A;  1CFD A;  4NDC A;  2HET A;  1S6C A;  1B8L A;  5CSI A;  4P5O E;  1BR1 B;  3TUY C;  2KGB C;  5DKR A;  1DGU A;  3VRR A;  2GGZ A;  5ER4 X;  1M46 A;  5CPV A;  5BPJ A;  1CB1 A;  3BUX B;  2JC2 A;  1SK6 D;  2JT3 A;  1CDN A;  2FOT A;  1NX1 A;  4YI9 A;  4CPV A;  1NWD A;  3O6B A;  1IRJ A;  1K8U A;  1K9U A;  4D1E A;  1QAS A;  1TTX A;  3KO0 A;  1MXE A;  3DVK A;  4DRW A;  4OKH A;  1KQM B;  2F3Z A;  1DJZ A;  2LCP A;  3VRP A;  1AJ5 A;  1IKU A;  4GFT A;  1DT7 B;  1B4C A;  5B8I B;  1K2H A;  1A75 B;  2F2O A;  1UHH A;  1CDL A;  2M29 A;  2MA2 A;  1AK8 A;  3MSE B;  1KFU L;  1KQV A;  1MHO A;  2KI6 C;  3SIB A;  4YGC B;  2LVI A;  4OV2 A;  2P6B B;  1XFZ O;  4GGN A;  4I5J A;  1DJG A;  3O78 A;  1RRO A;  4JWQ A;  4USL A;  3O2P A;  4ETO A;  2K7O A;  2M1K B;  1UUR A;  3I5I B;  3SG5 A;  3DF0 B;  2QAC A;  1DVI A;  1KFX S;  2M97 A;  4HRG A;  2KFF A;  3ICB A;  1Q80 A;  1QIW A;  2CXJ A;  2GGM A;  3NXA A;  4YGA A;  2NCO A;  1B47 A;  3TS5 B;  1FI6 A;  1R6P A;  3I5H B;  2H61 A;  1NP8 A;  2GV5 A;  3GK4 X;  3GOF A;  3CWG A;  1QX7 A;  2I94 A;  1B9A A;  1KK7 Z;  1UHJ A;  1RFJ A;  4MSP A;  1WLM A;  2OS8 C;  1KK8 C;  2G9B A;  2KFG A;  5HYD A;  4MVF A;  1Y0V H;  3I5F B;  1BLQ A;  4GGF C;  1K90 D;  2Q4U A;  3EK8 A;  1J7O A;  3NSK A;  1Y1X A;  3VGO A;  3IF7 A;  2JTZ A;  2KBM A;  3DVJ A;  1H4B A;  2NXQ A;  3C1V A;  1CMG A;  1UP5 A;  2CBL A;  1IG5 A;  1K93 D;  1TNX A;  1NPQ A;  1NIW A;  3CS1 A;  1W7I B;  4HRH A;  3DVE A;  5HKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...