1MHOA

The 2.0 a structure of holo s100b from bovine brain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of target recognition suggested by the 2.0 A structure of holo S100B from bovine brain.
pubmed doi rcsb
molecule tags Calcium-binding
molecule keywords S-100 PROTEIN
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mhoA00
1IRJA 3CZTX 4TNCA 1CB1A 3LK0A 4XJKB 1FI5A 1HQVA 1DT7B 1R6PA 4E68A 2LHIA 5I2LA 1S6IA 1QX2A 1TTXA 2KYCA 1DJXA 3KEVA 1PK0D 3BUOB 3LK1A 1FPWA 1MR8A 1NCYA 2EGDA 1CM4A 1KWOB 1NX3A 5CSJA 4DRWA 4NDCA 2MA2A 5FYXA 2ISDA 1S3PA 1LINA 1AVSA 1C7VA 1TRFA 1A03A 3VROA 1KQVA 2BL0C 3TS5C 3H4SE 1K94A 1UHJA 4MLWA 3BUWB 1H4BA 3LL8B 1K9PA 2LCPA 4JQ0D 1K9KA 1RFJA 2FOTA 1SR6B 1C07A 5HLVA 5HLOA 2M1KB 1NX2A 1WDCB 1KK8C 1N2DA 2G2BA 1K2HA 1IH0A 4OVNF 5G08A 4N1FA 2BECA 2BE6A 4PCWA 4AQJA 3ZNIA 1YUSA 2K2AA 1XVJA 1CKKA 4PHKA 4L9MA 1QJTA 3QRXA 3SG5A 3CWGA 2ZN9A 3PLFB 3VRNA 5I2OA 1V1FA 4ZCVA 2CTNA 1F71A 1ZFSA 1RROA 1ZOTB 4A4CA 4CLNA 1FI6A 1CFFA 4PE7A 1UHHA 2JXLA 3SIBA 3VRQA 3PN7B 2JQ6A 1CTRA 2LMTA 1H8BA 1CDNA 1DGUA 1KQMB 3CTNA 1SCMB 4MVFA 5HKYA 1A2XA 1SCVA 1QASA 1IG5A 1N65A 2GGMA 2H2KA 2NCOA 4ORBB 4R1EA 3WNXB 1XFUO 1G33A 3TDIA 1SY9A 3EVUA 2O60A 1OZSA 2KBIA 1EJ3A 1AJ4A 3NSOA 4UPGA 1YUUA 2LVJA 3AAJA 4HRHA 1QLSA 3NXAA 4OR9B 2M1UA 1OMVA 1SR6C 5HYDA 5IBWA 1Y6WA 1OMDA 3RLZA 1EG3A 5J3XA 1QVIZ 2I94A 1JSAA 1UHKA 1L7ZA 2NXQA 3VRRA 1MWNA 3VGOA 2M7LA 1OE9B 5AFPA 3O78A 3DF0B 2KGRA 3SG6A 1B8CA 1XO5A 2LVKA 1L2OC 1KQMC 3BXKA 5CSNA 3DVJA 5AERA 1NCXA 2M9GA 2JT3A 1K8UA 3DD4A 4OCIA 1UUSA 1NUBA 3DVKA 1IJ6A 5D7FA 3CGAA 3OX5A 4ORCB 2NZ0A 1PULA 4GGFA 3WHTB 4PE0A 1YR5A 2EC6B 2JRFA 4C0JA 2JTTA 3IF7A 2FJUB 1B4CA 4MSPA 2BCXA 1AK8A 2WCBA 2K8MB 3PFVA 1ZUZA 4YRUA 1RWYA 2AAOA 1BT6A 1PVAA 3WXAA 5JOLA 1MXEA 4I5KA 2JPTA 2PASA 1QX5B 1RECA 1S6JA 1PRWA 2BCBA 5AANA 4M2PA 4C0LA 3SIAA 4PHMA 3BUXB 2MRDA 1BMOA 3CLNA 1TOPA 2KDHA 5I8NA 1OSAA 4HRGA 3KF9A 1A75B 1FW4A 3OB1B 1CMGA 1PALA 1UHNA 3O6BA 2MHHA 2WCEA 4AQIA 3ZWHA 1PVBA 1YURA 1S36A 2K0JA 3FWBA 4PHNA 1WLMA 2KAVA 4BY4A 2JWWA 4P2YB 2QPTA 1YRUB 1F4OA 2Y4QA 3EK4A 1QXPA 1Y1AA 5KU1A 1SL7A 2L4IA 1QVIY 2E6WA 2HPSA 4OV2A 5ER5A 3CR5X 4HSZA 3SG3A 4YI8A 2HF5A 3EKHA 3JTDC 1AP4A 3BOWA 1YX7A 4M2QA 4GUKA 1BG1A 2LC5A 1TNPA 3TUYC 1XFXO 1S6CA 2GV5A 5GQQC 1YVHA 1DJZA 2LP3A 2DOQA 3EK7A 3VRPA 2ZN8A 2MLFC 5AXIA 1KK7Y 4ORAB 2R2IA 1SCMC 2WORA 2CNPA 4Q04A 1W7IB 2KSPA 3TDUA 1JWDA 4MZJA 1CM1A 2K7CA 2M97A 1Y1UA 2HQ8A 1B8RA 3ICBA 1PSBA 1M31A 1SPYA 1XFZO 4OKHA 2LM5A 1SK6D 2HETA 2KOTA 3HX4A 4MRXA 3MSEB 4WQ3A 1B9AA 2KQYA 1JUOA 1ZMZA 2HQWA 1BLQA 2MLEC 1HT9A 1DMOA 2Y5IA 2JOJA 1S26D 2GGZA 1M46A 1QIVA 2BKHB 3A4UB 1AJ5A 1UWOA 1FF1A 3TZ1A 1WRLA 1C7WA 2KGBC 4ZCUA 3AKBA 2RGIA 4GGFC 1KFUL 1F70A 2JU0A 1NCZA 3CS1A 1SYMA 1Q80A 2BBMA 3I5GC 4YI9A 2IS9A 2SCPA 2F33A 4I5NB 1TNWA 3NSIA 2OTGB 1SRAA 5HKZA 1EH2A 4WRIA 2BKIB 5F6TA 1KSOA 4GFTA 1WLZA 3I5GB 1B7TY 3K21A 1QS7A 4PE1A 4HREE 1MQ1A 3GK2A 1J1EA 4NDDA 2O5GA 1QLKA 2M29A 4MN0A 4IL1A 2BE4A 4DUQA 1CLMA 1CDPA 4DCKA 2KBMA 2KQ6A 1BR4B 3GK1A 1U5IB 1XFWO 2LAPA 3OX6A 2NCPA 4PHJA 2LE9B 4N5XA 1KK7Z 3D10A 4JPZB 5CPVA 2K61A 3PSRA 4MRYA 3O2PA 1UHIA 1J1DA 2MBXA 4XYNA 1GJYA 2PRUA 1SW8A 2WOSA 4CIDA 1GQMA 4CPVA 3I5IB 1JC2A 1CFDA 2F2PA 2LP2A 1DJHA 3KO0A 2CT9A 1QX7A 2LHLA 2LV7A 2WCFA 3OB2B 4I5LB 2JC2A 2L5XB 4U8DA 1DJYA 2P6BB 1KFXL 1RTP1 2ZFDA 2WNDA 3BUNB 4DIRA 2MAZA 2PMYA 1A4PA 1W7JB 3AAKA 3AKAA 1CLBA 1L2OB 5D69A 1DTLA 1VRKA 2LLUA 1K95A 1TNQA 1YX8A 1BR1B 2PSRA 1J7OA 1BODA 1G4YR 2JULA 2CCMA 5ER4X 1OQPA 4QJ3B 2KI4B 2M8UA 2L2EA 4GPLB 1RK9A 4FTGA 1OOJA 1MUXA 1N0YA 1NX1A 2KHNA 3M0WA 2L51A 4GAOA 1R2UA 3DF0A 1BOCA 1XFYO 2K7DA 2QACA 1CNPA 3DVMA 3F45A 1U5IA 1DJGA 2KAYA 4PALA 3EK8A 3TUYB 1ALWA 2LUXA 1NIWA 1JFKA 2E30A 1NX0A 3JVTB 3JTDB 2LMUA 1IQ3A 1IGVA 2A4JA 4GBAA 2NLNA 1CDMA 1M63B 1AHRA 3C1VA 2KI6D 1B7TZ 1IJ5A 2BL0B 2LVVA 3TS5B 1K96A 1K9UA 3FWCA 3BOWB 2BBNA 4C0KA 5I2QA 1KWOC 1S5GY 1S5GZ 1DJWA 2LUCA 1XA5A 1DJIA 1CMFA 1YRTB 2JNFA 3I5FC 1MXLC 3I5HC 1XFVO 1TNXA 3CR4X 1TIZA 4WQ2A 2KI6C 2OS8B 2CBLA 2JZIA 3NSLA 3BYAA 1QIWA 2EC6C 1PSRA 2LVIA 3I5HB 1J7QA 1M45A 1GGZA 3CR2A 5K89A 1BF5A 1Y1XA 1JF0A 3EVVA 3JVTC 1TCFA 3KHEA 2M7NA 1A29A 4MBEA 2K2FA 1EL4A 1B47A 1QTXA 1NSHA 4XJKA 4YGBB 1J55A 1LVCD 1NPQA 4YBHB 1ALVA 2JXCA 5DKNA 1KFXS 2ZNEA 4MZKA 4GGNA 3PALA 1TCOB 2L4HA 3FS7A 2KFGA 2KFFA 1EG4A 2F3YA 3HCMA 4MZLA 1FBVA 4D1EA 4GNKB 5BPJA 3IQQA 1JFJA 2F3ZA 1ODBA 5DKQA 3GOFA 1J7RA 2M49B 2PVBA 1E8AA 2F2OA 4I5JA 1SKTA 2B1UA 3OP0A 4YGCB 2JNXA 3PN7C 1B1GA 2ZRTA 2ZNDA 3KPXA 2K7OA 3SG2A 2H61A 1D1OA 1B8LA 1WRZA 1A75A 4USLA 4FQOA 1DGVA 1G8IA 1SBJA 2ZRSA 2V53A 3EVRA 1SL8A 4CFRA 4QJ5B 2BCAA 1SMGA 3D0YB 4YGDB 2TN4A 1SNLA 3LLEA 2I18A 1LXFC 3I5IC 3SG7A 5B8IB 4MEWA 2PALA 1Y0VH 2EHBA 1KK8B 2AMIA 2VRGA 2F8PA 1AUIB 1MF8B 1EXRA 1LA0A 4NQGA 1LKJA 2JTZA 1CFCA 1QV0A 3O4YA 2JT0A 2KYFA 2LNKA 4N1GA 4YGAA 2LMVA 2KAXA 3IQOA 1BU3A 1TN4A 2OS8C 3OHMB 3D0YA 2I7AA 3BQ3A 5PALA 1WY9A 1XYDA 5KSZA 1XK4A 3I5FB 5JJGA 1V1GA 2M3WA 3BUMB 1LA3A 1NWDA 1K93D 2CXJA 4ICBA 4PDZA 1IWQA 2H61C 2Y1NA 3TDZA 2COLB 1UP5A 2Y1MA 3A8RA 4DS7A 1GGWA 1DF0A 1CFPA 3E3RA 1F55A 1XK4C 1F4QA 1KCYA 2WC8A 1QATA 4JWQA 1J7PA 5TNCA 5AEQA 3SG4A 5KTYA 5CSIA 2LANA 4M2OA 2K7BA 2OPOA 1OMRA 3PM8A 1QV1A 2KI4C 2L50A 2FCDA 1NYAA 4YGEB 2L0PA 3PATA 2MJWB 2LLSA 5DKRA 3RM1A 4PE4A 1JF2A 4AOMA 3NSKA 3LCPC 3WHUB 5CSFA 1JBAA 1CDLA 1YTZC 3EKJA 4BY5A 3SJSA 1IKUA 1X02A 2JT8A 2I2RE 4CFQA 4ETOA 3DVEA 3GK4X 2LLTA 1SL9A 1BJFA 4QJ4B 2D8NA 1RJVA 2KNEA 5HKWA 1K90D 2L98A 2G9BA 1NP8A 4A4BA 2KFHA 4P5OE 4F0ZB 2Q4UA 1IQ5A 1F8HA 3FIAA 2M0RA 1MHOA 1UURA 1ZACA 1KFUS 1KSMA 1F54A 2SASA 1YUTA 1DF0B 2FCEA 2AUCA 2OTGC 1CLLA 1OZOA 1WDCC 4NDBA 2Q91A 1S1EA 1M39A 1YVLA 1DVIA 1WRKA 2ZKMX
chains in the Genus database with same CATH superfamily
1IRJA 3CZTX 4TNCA 1CB1A 3LK0A 4XJKB 3S0FA 1FI5A 1HQVA 1DT7B 1R6PA 1LS8A 4E68A 2LHIA 5I2LA 1S6IA 1QX2A 2WC6A 1TTXA 2KYCA 1DJXA 3KEVA 1PK0D 3BUOB 2QDIA 3LK1A 1FPWA 1MR8A 1NCYA 2EGDA 1CM4A 1KWOB 1NX3A 5CSJA 4DRWA 4NDCA 2MA2A 3CZ1A 5FYXA 2ISDA 1S3PA 3R1PA 1LINA 3S0AA 1AVSA 1C7VA 1TRFA 3SS3A 1A03A 3VROA 1KQVA 2BL0C 3TS5C 3H4SE 1K94A 1UHJA 4MLWA 3BUWB 1H4BA 2WCLA 3LL8B 1K9PA 2LCPA 4JQ0D 1K9KA 1RFJA 2FOTA 1SR6B 1C07A 5HLVA 5HLOA 4JD9A 2M1KB 1NX2A 1WDCB 1KK8C 1N2DA 2G2BA 1K2HA 1IH0A 4OVNF 5G08A 4N1FA 1P28A 2BECA 2BE6A 4PCWA 4AQJA 3ZNIA 1YUSA 2K2AA 1XVJA 1DC1A 1CKKA 4PHKA 4L9MA 1QJTA 3QRXA 3SG5A 3CWGA 2ZN9A 3PLFB 3VRNA 5I2OA 1V1FA 4ZCVA 3D73A 3S0GA 2CTNA 1F71A 1ZFSA 1RROA 1ZOTB 4A4CA 4CLNA 1FI6A 1CFFA 4PE7A 3B86A 1C3YA 3CZ0A 1UHHA 2JXLA 3SIBA 5D3OA 3VRQA 3PN7B 2JQ6A 1CTRA 2LMTA 1H8BA 1CDNA 1DGUA 1KQMB 2L5YA 3CTNA 1SCMB 4MVFA 5HKYA 1A2XA 1SCVA 1QASA 1IG5A 1N65A 1OOFA 2GGMA 2H2KA 2NCOA 4ORBB 4R1EA 1XFUO 3WNXB 1G33A 3TDIA 1SY9A 3EVUA 2O60A 1OZSA 1DEKA 1EJ3A 2KBIA 1AJ4A 3NSOA 4UPGA 1YUUA 2LVJA 3AAJA 4HRHA 1QLSA 3NHTA 3NXAA 4OR9B 2M1UA 1SSEB 1OMVA 1SR6C 5HYDA 5IBWA 1Y6WA 1OMDA 3RLZA 1EG3A 3S0DA 5J3XA 1QVIZ 2I94A 1JSAA 1UHKA 1L7ZA 2NXQA 3VRRA 1MWNA 3VGOA 2M7LA 1OE9B 3DXLA 1OOGA 5AFPA 3O78A 3DF0B 2KGRA 2ERBA 5FI6A 3SG6A 1B8CA 3D75A 1XO5A 2LVKA 1L2OC 1KQMC 3BXKA 2BNXA 5CSNA 3DVJA 5AERA 1NCXA 2M9GA 2JT3A 1K8UA 3DD4A 4OCIA 1UUSA 1NUBA 3DVKA 1IJ6A 5D7FA 3CGAA 3OX5A 4ORCB 2KLEA 1PULA 2NZ0A 4GGFA 3WHTB 4PE0A 1YR5A 2EC6B 2JRFA 4C0JA 2JTTA 3IF7A 2FJUB 1B4CA 4MSPA 2BCXA 3N7HA 1AK8A 2WCBA 2K8MB 3PFVA 1ZUZA 5FI7A 4YRUA 1RWYA 3PJIA 2AAOA 1BT6A 1PVAA 4IJ7A 3WXAA 5JOLA 1MXEA 3R1OA 1T14A 4I5KA 3IVTA 2JPTA 2PASA 1QX5B 1RECA 3B88A 5I94A 1S6JA 1PRWA 2BCBA 5AANA 4F7FA 4M2PA 4C0LA 3SIAA 4PHMA 3DY9A 3BUXB 2MRDA 1BMOA 3CLNA 2QEHA 1TOPA 2KDHA 3B87A 1XFRA 5I8NA 1OSAA 4HRGA 3KF9A 1A75B 1FW4A 3OB1B 1CMGA 1PALA 1UHNA 1W9ZA 3O6BA 2MHHA 2WCEA 4AQIA 3ZWHA 3CDNA 1PVBA 1YURA 1S36A 2K0JA 3FWBA 4PHNA 1WLMA 2KAVA 4BY4A 2JWWA 4P2YB 2QPTA 1YRUB 1F4OA 2KPHA 2Y4QA 3EK4A 1QXPA 1Y1AA 5DICA 5KU1A 1SL7A 2L4IA 1QVIY 2E6WA 2HPSA 1ORGA 4OV2A 5ER5A 3CR5X 4HSZA 3SG3A 4YI8A 2HF5A 3EKHA 3JTDC 1DELA 3VB1A 1AP4A 3BOWA 1YX7A 4M2QA 4GUKA 1BG1A 2LC5A 1TNPA 3FE6A 3TUYC 1XFXO 1S6CA 2GV5A 5GQQC 1YVHA 1DJZA 2LP3A 2DOQA 3EK7A 3VRPA 2ZN8A 2MLFC 5AXIA 1KK7Y 4ORAB 2R2IA 1SCMC 2WORA 2CNPA 3BJHA 1W7IB 2KSPA 4Q04A 3TDUA 1JWDA 4MZJA 1CM1A 2K7CA 2M97A 1Y1UA 2HQ8A 1B8RA 2QEVA 3ICBA 3SS5A 1PSBA 1M31A 1SPYA 1XFZO 4OKHA 2LM5A 2P70A 1SK6D 2HETA 2KOTA 3HX4A 4MRXA 3MSEB 4WQ3A 4JKTA 1B9AA 3FE9A 2KQYA 1JUOA 1ZMZA 3K1EA 2HQWA 1BLQA 2MLEC 1HT9A 3FE8A 1DMOA 3S0EA 2Y5IA 3QMEA 2JOJA 1S26D 2GGZA 1M46A 1QIVA 2BKHB 3DYEA 3A4UB 5HL1A 1AJ5A 1UWOA 1FF1A 3TZ1A 3R1VA 1WRLA 1C7WA 2KGBC 4ZCUA 2QEBA 3AKBA 2RGIA 4GGFC 1KFUL 1F70A 2JU0A 1NCZA 3CS1A 1SYMA 1Q80A 2BBMA 3I5GC 4YI9A 2IS9A 1TWOA 2SCPA 2F33A 4I5NB 1TNWA 3NSIA 2OTGB 1SRAA 1DQEA 3R72A 5HKZA 1EH2A 4WRIA 2BKIB 5F6TA 1KSOA 4GFTA 2WCJA 1WLZA 3I5GB 1B7TY 2L2CA 3K21A 1QS7A 4PE1A 4HREE 1MQ1A 3GK2A 1J1EA 4NDDA 2O5GA 1QLKA 2M29A 4MN0A 4IL1A 2BE4A 4DUQA 1CLMA 1CDPA 4DCKA 3SS4A 2PQLA 2KBMA 2KQ6A 1BR4B 3GK1A 1U5IB 1XFWO 2LAPA 3NGVA 3OX6A 2NCPA 4PHJA 2LE9B 2JPOA 4N5XA 1KK7Z 3D10A 2GTEA 4JPZB 5CPVA 2K61A 3PSRA 4MRYA 3O2PA 1UHIA 1J1DA 2MBXA 3CYZA 4XYNA 1GJYA 2PRUA 1SW8A 2WOSA 4CIDA 1GQMA 4CPVA 3I5IB 1JC2A 1CFDA 2F2PA 2LP2A 1DJHA 3KO0A 2CT9A 1QX7A 2LHLA 2LV7A 2WCFA 3OB2B 4I5LB 2JC2A 2L5XB 4U8DA 1DJYA 2P6BB 1KFXL 1RTP1 2ZFDA 2WNDA 3BUNB 4DIRA 2MAZA 2PMYA 3EG5B 1A4PA 1W7JB 3AAKA 3AKAA 1CLBA 1L2OB 3OBVA 5D69A 2H8VA 1DTLA 1VRKA 2LLUA 1K95A 1TNQA 1YX8A 3BFAA 1BR1B 2PSRA 1J7OA 3DZTA 1BODA 1G4YR 2JULA 2CCMA 5ER4X 1OQPA 4QJ3B 2KI4B 2M8UA 2L2EA 2K60A 1RK9A 4FTGA 4GPLB 1OOJA 3CZ2A 1MUXA 1N0YA 1NX1A 2KHNA 3M0WA 2L51A 4GAOA 1R2UA 3DF0A 1BOCA 1XFYO 2K7DA 2QACA 1CNPA 3DVMA 3F45A 1U5IA 1DJGA 2KAYA 4PALA 3EK8A 3TUYB 1ALWA 2LUXA 1NIWA 1JFKA 1Z4HA 1NX0A 2E30A 3JVTB 3JTDB 2LMUA 3L4LA 1IQ3A 1IGVA 2A4JA 4GBAA 1OOIX 2NLNA 1CDMA 1M63B 1AHRA 3C1VA 2KI6D 1B7TZ 1IJ5A 2BL0B 2LVVA 3TS5B 1K96A 1K9UA 3FWCA 3UO9A 3BOWB 2BBNA 4C0KA 5I2QA 1KWOC 1S5GY 3PM2A 1S5GZ 1DJWA 2LUCA 5EL2A 1XA5A 1DJIA 2WC5A 1CMFA 1YRTB 2JNFA 3I5FC 1MXLC 3D74A 3I5HC 1XFVO 1TNXA 3CR4X 1TIZA 4WQ2A 2KI6C 2OS8B 2CBLA 2JZIA 3BFHA 3NSLA 3BYAA 1QIWA 2EC6C 1PSRA 2LVIA 3I5HB 5FI2A 1J7QA 1M45A 1GGZA 2YGUA 3B6XA 3CR2A 5K89A 1BF5A 1Y1XA 1JF0A 3EVVA 3JVTC 1TCFA 3KHEA 3Q8IA 2M7NA 1A29A 4MBEA 2K2FA 1EL4A 1GM0A 1B47A 1QTXA 1NSHA 4XJKA 4YGBB 1J55A 1LVCD 1NPQA 2WCMA 4YBHB 1OW4A 1ALVA 2JXCA 5DKNA 1KFXS 2ZNEA 2KLDA 4GGNA 4MZKA 3PALA 1TCOB 2L4HA 3FS7A 2KFGA 2KFFA 4OZDA 1EG4A 2F3YA 3HCMA 4MZLA 1FBVA 4D1EA 4GNKB 5BPJA 3IQQA 1JFJA 1TUZA 2F3ZA 1ODBA 5DKQA 3GOFA 1J7RA 2M49B 2PVBA 1E8AA 2F2OA 4I5JA 4FQTA 1SKTA 2B1UA 3OP0A 4YGCB 2JNXA 3PN7C 1B1GA 1OOHA 2ZRTA 2ZNDA 3KPXA 2K7OA 3SG2A 2H61A 1D1OA 1B8LA 1WRZA 1A75A 4USLA 4FQOA 1DGVA 3UNWA 1G8IA 1SBJA 2ZRSA 2V53A 3EVRA 1SL8A 4CFRA 4QJ5B 2BCAA 1C3ZA 1SMGA 3D0YB 4YGDB 2TN4A 1SNLA 3LLEA 2I18A 1LXFC 3D76A 3I5IC 4INXA 3SG7A 5B8IB 4MEWA 2PALA 1Y0VH 2EHBA 2P71A 1KK8B 2AMIA 2VRGA 2F8PA 1AUIB 4PT1A 1MF8B 1EXRA 1LA0A 4NQGA 1LKJA 3L47A 2JTZA 1CFCA 1QV0A 3O4YA 2JT0A 2KYFA 2LNKA 4N1GA 4YGAA 3S0BA 2LMVA 2KAXA 3IQOA 1BU3A 1TN4A 2OS8C 3OHMB 3D0YA 2I7AA 3BQ3A 5PALA 1WY9A 1XYDA 5KSZA 1XK4A 3I5FB 5JJGA 2QEOA 3CABA 1V1GA 2M3WA 3BUMB 1LA3A 1NWDA 1K93D 2CXJA 4ICBA 4PDZA 1IWQA 2H61C 2Y1NA 3TDZA 2COLB 1UP5A 3BFBA 2Y1MA 3A8RA 4DS7A 1GGWA 1DF0A 1CFPA 3E3RA 3D78A 1F55A 3NHIA 1XK4C 1F4QA 2FJYA 2WC8A 1QATA 4JWQA 1J7PA 1KCYA 5TNCA 5AEQA 3SG4A 5KTYA 5CSIA 2LANA 4M2OA 2K7BA 2OPOA 1OMRA 3PM8A 1QV1A 2KI4C 2L50A 3O4XA 2FCDA 4KYNA 1NYAA 4YGEB 2L0PA 3PATA 2MJWB 2LLSA 5DKRA 3RM1A 4PE4A 1JF2A 1IIOA 4AOMA 3NSKA 3LCPC 1TUJA 3WHUB 5CSFA 1JBAA 1CDLA 1YTZC 3EKJA 4BY5A 3SJSA 1IKUA 1X02A 2JT8A 2I2RE 4CFQA 3RZSA 4ETOA 3DVEA 3GK4X 2LLTA 1SL9A 1BJFA 3B7AA 4QJ4B 2D8NA 1RJVA 2BAPA 2KNEA 2WCHA 5HKWA 1K90D 2L98A 2G9BA 1NP8A 4A4BA 1Z2CB 2KFHA 4P5OE 4F0ZB 3V2LA 2Q4UA 1IQ5A 1F8HA 2PYQA 2M0RA 3FIAA 1MHOA 1UURA 1ZACA 4INWA 1KFUS 1KSMA 1F54A 3OGNA 2SASA 1YUTA 1DF0B 2FCEA 2AUCA 3L4AA 2OTGC 3D77A 1CLLA 1QWVA 1OZOA 2WCKA 1WDCC 4NDBA 2Q91A 1S1EA 1M39A 1YVLA 1DVIA 1WRKA 2ZKMX
chains in the Genus database with same CATH topology
1IRJA 3CZTX 4TNCA 1CB1A 3LK0A 4XJKB 1FI5A 1HQVA 1DT7B 1R6PA 4E68A 2LHIA 5I2LA 1S6IA 1QX2A 1TTXA 2KYCA 1DJXA 3KEVA 1PK0D 3BUOB 3LK1A 1FPWA 1MR8A 1NCYA 2EGDA 1CM4A 1KWOB 1NX3A 5CSJA 4DRWA 4NDCA 2MA2A 5FYXA 2ISDA 1S3PA 1LINA 1AVSA 1C7VA 1TRFA 1A03A 3VROA 1KQVA 2BL0C 3TS5C 3H4SE 1K94A 1UHJA 4MLWA 3BUWB 1H4BA 3LL8B 1K9PA 2LCPA 4JQ0D 1K9KA 1RFJA 2FOTA 1SR6B 1C07A 5HLVA 5HLOA 2M1KB 1NX2A 1WDCB 1KK8C 1N2DA 2G2BA 1K2HA 1IH0A 4OVNF 5G08A 4N1FA 2BECA 2BE6A 4PCWA 4AQJA 3ZNIA 1YUSA 2K2AA 1XVJA 1CKKA 4PHKA 4L9MA 1QJTA 3QRXA 3SG5A 3CWGA 2ZN9A 3PLFB 3VRNA 5I2OA 1V1FA 4ZCVA 2CTNA 1F71A 1ZFSA 1RROA 1ZOTB 4A4CA 4CLNA 1FI6A 1CFFA 4PE7A 1UHHA 2JXLA 3SIBA 3VRQA 3PN7B 2JQ6A 1CTRA 2LMTA 1H8BA 1CDNA 1DGUA 1KQMB 3CTNA 1SCMB 4MVFA 5HKYA 1A2XA 1SCVA 1QASA 1IG5A 1N65A 2GGMA 2H2KA 2NCOA 4ORBB 4R1EA 3WNXB 1XFUO 1G33A 3TDIA 1SY9A 3EVUA 2O60A 1OZSA 2KBIA 1EJ3A 1AJ4A 3NSOA 4UPGA 1YUUA 2LVJA 3AAJA 4HRHA 1QLSA 3NXAA 4OR9B 2M1UA 1OMVA 1SR6C 5HYDA 5IBWA 1Y6WA 1OMDA 3RLZA 1EG3A 5J3XA 1QVIZ 2I94A 1JSAA 1UHKA 1L7ZA 2NXQA 3VRRA 1MWNA 3VGOA 2M7LA 1OE9B 5AFPA 3O78A 3DF0B 2KGRA 3SG6A 1B8CA 1XO5A 2LVKA 1L2OC 1KQMC 3BXKA 5CSNA 3DVJA 5AERA 1NCXA 2M9GA 2JT3A 1K8UA 3DD4A 4OCIA 1UUSA 1NUBA 3DVKA 1IJ6A 5D7FA 3CGAA 3OX5A 4ORCB 2NZ0A 1PULA 4GGFA 3WHTB 4PE0A 1YR5A 2EC6B 2JRFA 4C0JA 2JTTA 3IF7A 2FJUB 1B4CA 4MSPA 2BCXA 1AK8A 2WCBA 2K8MB 3PFVA 1ZUZA 4YRUA 1RWYA 2AAOA 1BT6A 1PVAA 3WXAA 5JOLA 1MXEA 4I5KA 2JPTA 2PASA 1QX5B 1RECA 1S6JA 1PRWA 2BCBA 5AANA 4M2PA 4C0LA 3SIAA 4PHMA 3BUXB 2MRDA 1BMOA 3CLNA 1TOPA 2KDHA 5I8NA 1OSAA 4HRGA 3KF9A 1A75B 1FW4A 3OB1B 1CMGA 1PALA 1UHNA 3O6BA 2MHHA 2WCEA 4AQIA 3ZWHA 1PVBA 1YURA 1S36A 2K0JA 3FWBA 4PHNA 1WLMA 2KAVA 4BY4A 2JWWA 4P2YB 2QPTA 1YRUB 1F4OA 2Y4QA 3EK4A 1QXPA 1Y1AA 5KU1A 1SL7A 2L4IA 1QVIY 2E6WA 2HPSA 4OV2A 5ER5A 3CR5X 4HSZA 3SG3A 4YI8A 2HF5A 3EKHA 3JTDC 1AP4A 3BOWA 1YX7A 4M2QA 4GUKA 1BG1A 2LC5A 1TNPA 3TUYC 1XFXO 1S6CA 2GV5A 5GQQC 1YVHA 1DJZA 2LP3A 2DOQA 3EK7A 3VRPA 2ZN8A 2MLFC 5AXIA 1KK7Y 4ORAB 2R2IA 1SCMC 2WORA 2CNPA 4Q04A 1W7IB 2KSPA 3TDUA 1JWDA 4MZJA 1CM1A 2K7CA 2M97A 1Y1UA 2HQ8A 1B8RA 3ICBA 1PSBA 1M31A 1SPYA 1XFZO 4OKHA 2LM5A 1SK6D 2HETA 2KOTA 3HX4A 4MRXA 3MSEB 4WQ3A 1B9AA 2KQYA 1JUOA 1ZMZA 2HQWA 1BLQA 2MLEC 1HT9A 1DMOA 2Y5IA 2JOJA 1S26D 2GGZA 1M46A 1QIVA 2BKHB 3A4UB 1AJ5A 1UWOA 1FF1A 3TZ1A 1WRLA 1C7WA 2KGBC 4ZCUA 3AKBA 2RGIA 4GGFC 1KFUL 1F70A 2JU0A 1NCZA 3CS1A 1SYMA 1Q80A 2BBMA 3I5GC 4YI9A 2IS9A 2SCPA 2F33A 4I5NB 1TNWA 3NSIA 2OTGB 1SRAA 5HKZA 1EH2A 4WRIA 2BKIB 5F6TA 1KSOA 4GFTA 1WLZA 3I5GB 1B7TY 3K21A 1QS7A 4PE1A 4HREE 1MQ1A 3GK2A 1J1EA 4NDDA 2O5GA 1QLKA 2M29A 4MN0A 4IL1A 2BE4A 4DUQA 1CLMA 1CDPA 4DCKA 2KBMA 2KQ6A 1BR4B 3GK1A 1U5IB 1XFWO 2LAPA 3OX6A 2NCPA 4PHJA 2LE9B 4N5XA 1KK7Z 3D10A 4JPZB 5CPVA 2K61A 3PSRA 4MRYA 3O2PA 1UHIA 1J1DA 2MBXA 4XYNA 1GJYA 2PRUA 1SW8A 2WOSA 4CIDA 1GQMA 4CPVA 3I5IB 1JC2A 1CFDA 2F2PA 2LP2A 1DJHA 3KO0A 2CT9A 1QX7A 2LHLA 2LV7A 2WCFA 3OB2B 4I5LB 2JC2A 2L5XB 4U8DA 1DJYA 2P6BB 1KFXL 1RTP1 2ZFDA 2WNDA 3BUNB 4DIRA 2MAZA 2PMYA 1A4PA 1W7JB 3AAKA 3AKAA 1CLBA 1L2OB 5D69A 1DTLA 1VRKA 2LLUA 1K95A 1TNQA 1YX8A 1BR1B 2PSRA 1J7OA 1BODA 1G4YR 2JULA 2CCMA 5ER4X 1OQPA 4QJ3B 2KI4B 2M8UA 2L2EA 4GPLB 1RK9A 4FTGA 1OOJA 1MUXA 1N0YA 1NX1A 2KHNA 3M0WA 2L51A 4GAOA 1R2UA 3DF0A 1BOCA 1XFYO 2K7DA 2QACA 1CNPA 3DVMA 3F45A 1U5IA 1DJGA 2KAYA 4PALA 3EK8A 3TUYB 1ALWA 2LUXA 1NIWA 1JFKA 2E30A 1NX0A 3JVTB 3JTDB 2LMUA 1IQ3A 1IGVA 2A4JA 4GBAA 2NLNA 1CDMA 1M63B 1AHRA 3C1VA 2KI6D 1B7TZ 1IJ5A 2BL0B 2LVVA 3TS5B 1K96A 1K9UA 3FWCA 3BOWB 2BBNA 4C0KA 5I2QA 1KWOC 1S5GY 1S5GZ 1DJWA 2LUCA 1XA5A 1DJIA 1CMFA 1YRTB 2JNFA 3I5FC 1MXLC 3I5HC 1XFVO 1TNXA 3CR4X 1TIZA 4WQ2A 2KI6C 2OS8B 2CBLA 2JZIA 3NSLA 3BYAA 1QIWA 2EC6C 1PSRA 2LVIA 3I5HB 1J7QA 1M45A 1GGZA 3CR2A 5K89A 1BF5A 1Y1XA 1JF0A 3EVVA 3JVTC 1TCFA 3KHEA 2M7NA 1A29A 4MBEA 2K2FA 1EL4A 1B47A 1QTXA 1NSHA 4XJKA 4YGBB 1J55A 1LVCD 1NPQA 4YBHB 1ALVA 2JXCA 5DKNA 1KFXS 2ZNEA 4MZKA 4GGNA 3PALA 1TCOB 2L4HA 3FS7A 2KFGA 2KFFA 1EG4A 2F3YA 3HCMA 4MZLA 1FBVA 4D1EA 4GNKB 5BPJA 3IQQA 1JFJA 2F3ZA 1ODBA 5DKQA 3GOFA 1J7RA 2M49B 2PVBA 1E8AA 2F2OA 4I5JA 1SKTA 2B1UA 3OP0A 4YGCB 2JNXA 3PN7C 1B1GA 2ZRTA 2ZNDA 3KPXA 2K7OA 3SG2A 2H61A 1D1OA 1B8LA 1WRZA 1A75A 4USLA 4FQOA 1DGVA 1G8IA 1SBJA 2ZRSA 2V53A 3EVRA 1SL8A 4CFRA 4QJ5B 2BCAA 1SMGA 3D0YB 4YGDB 2TN4A 1SNLA 3LLEA 2I18A 1LXFC 3I5IC 3SG7A 5B8IB 4MEWA 2PALA 1Y0VH 2EHBA 1KK8B 2AMIA 2VRGA 2F8PA 1AUIB 1MF8B 1EXRA 1LA0A 4NQGA 1LKJA 2JTZA 1CFCA 1QV0A 3O4YA 2JT0A 2KYFA 2LNKA 4N1GA 4YGAA 2LMVA 2KAXA 3IQOA 1BU3A 1TN4A 2OS8C 3OHMB 3D0YA 2I7AA 3BQ3A 5PALA 1WY9A 1XYDA 5KSZA 1XK4A 3I5FB 5JJGA 1V1GA 2M3WA 3BUMB 1LA3A 1NWDA 1K93D 2CXJA 4ICBA 4PDZA 1IWQA 2H61C 2Y1NA 3TDZA 2COLB 1UP5A 2Y1MA 3A8RA 4DS7A 1GGWA 1DF0A 1CFPA 3E3RA 1F55A 1XK4C 1F4QA 1KCYA 2WC8A 1QATA 4JWQA 1J7PA 5TNCA 5AEQA 3SG4A 5KTYA 5CSIA 2LANA 4M2OA 2K7BA 2OPOA 1OMRA 3PM8A 1QV1A 2KI4C 2L50A 2FCDA 1NYAA 4YGEB 2L0PA 3PATA 2MJWB 2LLSA 5DKRA 3RM1A 4PE4A 1JF2A 4AOMA 3NSKA 3LCPC 3WHUB 5CSFA 1JBAA 1CDLA 1YTZC 3EKJA 4BY5A 3SJSA 1IKUA 1X02A 2JT8A 2I2RE 4CFQA 4ETOA 3DVEA 3GK4X 2LLTA 1SL9A 1BJFA 4QJ4B 2D8NA 1RJVA 2KNEA 5HKWA 1K90D 2L98A 2G9BA 1NP8A 4A4BA 2KFHA 4P5OE 4F0ZB 2Q4UA 1IQ5A 1F8HA 3FIAA 2M0RA 1MHOA 1UURA 1ZACA 1KFUS 1KSMA 1F54A 2SASA 1YUTA 1DF0B 2FCEA 2AUCA 2OTGC 1CLLA 1OZOA 1WDCC 4NDBA 2Q91A 1S1EA 1M39A 1YVLA 1DVIA 1WRKA 2ZKMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRJ A;  3CZT X;  4TNC A;  1CB1 A;  3LK0 A;  4XJK B;  1FI5 A;  1HQV A;  1DT7 B;  1R6P A;  4E68 A;  2LHI A;  5I2L A;  1S6I A;  1QX2 A;  1TTX A;  2KYC A;  1DJX A;  3KEV A;  1PK0 D;  3BUO B;  3LK1 A;  1FPW A;  1MR8 A;  1NCY A;  2EGD A;  1CM4 A;  1KWO B;  1NX3 A;  5CSJ A;  4DRW A;  4NDC A;  2MA2 A;  5FYX A;  2ISD A;  1S3P A;  1LIN A;  1AVS A;  1C7V A;  1TRF A;  1A03 A;  3VRO A;  1KQV A;  2BL0 C;  3TS5 C;  3H4S E;  1K94 A;  1UHJ A;  4MLW A;  3BUW B;  1H4B A;  3LL8 B;  1K9P A;  2LCP A;  4JQ0 D;  1K9K A;  1RFJ A;  2FOT A;  1SR6 B;  1C07 A;  5HLV A;  5HLO A;  2M1K B;  1NX2 A;  1WDC B;  1KK8 C;  1N2D A;  2G2B A;  1K2H A;  1IH0 A;  4OVN F;  5G08 A;  4N1F A;  2BEC A;  2BE6 A;  4PCW A;  4AQJ A;  3ZNI A;  1YUS A;  2K2A A;  1XVJ A;  1CKK A;  4PHK A;  4L9M A;  1QJT A;  3QRX A;  3SG5 A;  3CWG A;  2ZN9 A;  3PLF B;  3VRN A;  5I2O A;  1V1F A;  4ZCV A;  2CTN A;  1F71 A;  1ZFS A;  1RRO A;  1ZOT B;  4A4C A;  4CLN A;  1FI6 A;  1CFF A;  4PE7 A;  1UHH A;  2JXL A;  3SIB A;  3VRQ A;  3PN7 B;  2JQ6 A;  1CTR A;  2LMT A;  1H8B A;  1CDN A;  1DGU A;  1KQM B;  3CTN A;  1SCM B;  4MVF A;  5HKY A;  1A2X A;  1SCV A;  1QAS A;  1IG5 A;  1N65 A;  2GGM A;  2H2K A;  2NCO A;  4ORB B;  4R1E A;  3WNX B;  1XFU O;  1G33 A;  3TDI A;  1SY9 A;  3EVU A;  2O60 A;  1OZS A;  2KBI A;  1EJ3 A;  1AJ4 A;  3NSO A;  4UPG A;  1YUU A;  2LVJ A;  3AAJ A;  4HRH A;  1QLS A;  3NXA A;  4OR9 B;  2M1U A;  1OMV A;  1SR6 C;  5HYD A;  5IBW A;  1Y6W A;  1OMD A;  3RLZ A;  1EG3 A;  5J3X A;  1QVI Z;  2I94 A;  1JSA A;  1UHK A;  1L7Z A;  2NXQ A;  3VRR A;  1MWN A;  3VGO A;  2M7L A;  1OE9 B;  5AFP A;  3O78 A;  3DF0 B;  2KGR A;  3SG6 A;  1B8C A;  1XO5 A;  2LVK A;  1L2O C;  1KQM C;  3BXK A;  5CSN A;  3DVJ A;  5AER A;  1NCX A;  2M9G A;  2JT3 A;  1K8U A;  3DD4 A;  4OCI A;  1UUS A;  1NUB A;  3DVK A;  1IJ6 A;  5D7F A;  3CGA A;  3OX5 A;  4ORC B;  2NZ0 A;  1PUL A;  4GGF A;  3WHT B;  4PE0 A;  1YR5 A;  2EC6 B;  2JRF A;  4C0J A;  2JTT A;  3IF7 A;  2FJU B;  1B4C A;  4MSP A;  2BCX A;  1AK8 A;  2WCB A;  2K8M B;  3PFV A;  1ZUZ A;  4YRU A;  1RWY A;  2AAO A;  1BT6 A;  1PVA A;  3WXA A;  5JOL A;  1MXE A;  4I5K A;  2JPT A;  2PAS A;  1QX5 B;  1REC A;  1S6J A;  1PRW A;  2BCB A;  5AAN A;  4M2P A;  4C0L A;  3SIA A;  4PHM A;  3BUX B;  2MRD A;  1BMO A;  3CLN A;  1TOP A;  2KDH A;  5I8N A;  1OSA A;  4HRG A;  3KF9 A;  1A75 B;  1FW4 A;  3OB1 B;  1CMG A;  1PAL A;  1UHN A;  3O6B A;  2MHH A;  2WCE A;  4AQI A;  3ZWH A;  1PVB A;  1YUR A;  1S36 A;  2K0J A;  3FWB A;  4PHN A;  1WLM A;  2KAV A;  4BY4 A;  2JWW A;  4P2Y B;  2QPT A;  1YRU B;  1F4O A;  2Y4Q A;  3EK4 A;  1QXP A;  1Y1A A;  5KU1 A;  1SL7 A;  2L4I A;  1QVI Y;  2E6W A;  2HPS A;  4OV2 A;  5ER5 A;  3CR5 X;  4HSZ A;  3SG3 A;  4YI8 A;  2HF5 A;  3EKH A;  3JTD C;  1AP4 A;  3BOW A;  1YX7 A;  4M2Q A;  4GUK A;  1BG1 A;  2LC5 A;  1TNP A;  3TUY C;  1XFX O;  1S6C A;  2GV5 A;  5GQQ C;  1YVH A;  1DJZ A;  2LP3 A;  2DOQ A;  3EK7 A;  3VRP A;  2ZN8 A;  2MLF C;  5AXI A;  1KK7 Y;  4ORA B;  2R2I A;  1SCM C;  2WOR A;  2CNP A;  4Q04 A;  1W7I B;  2KSP A;  3TDU A;  1JWD A;  4MZJ A;  1CM1 A;  2K7C A;  2M97 A;  1Y1U A;  2HQ8 A;  1B8R A;  3ICB A;  1PSB A;  1M31 A;  1SPY A;  1XFZ O;  4OKH A;  2LM5 A;  1SK6 D;  2HET A;  2KOT A;  3HX4 A;  4MRX A;  3MSE B;  4WQ3 A;  1B9A A;  2KQY A;  1JUO A;  1ZMZ A;  2HQW A;  1BLQ A;  2MLE C;  1HT9 A;  1DMO A;  2Y5I A;  2JOJ A;  1S26 D;  2GGZ A;  1M46 A;  1QIV A;  2BKH B;  3A4U B;  1AJ5 A;  1UWO A;  1FF1 A;  3TZ1 A;  1WRL A;  1C7W A;  2KGB C;  4ZCU A;  3AKB A;  2RGI A;  4GGF C;  1KFU L;  1F70 A;  2JU0 A;  1NCZ A;  3CS1 A;  1SYM A;  1Q80 A;  2BBM A;  3I5G C;  4YI9 A;  2IS9 A;  2SCP A;  2F33 A;  4I5N B;  1TNW A;  3NSI A;  2OTG B;  1SRA A;  5HKZ A;  1EH2 A;  4WRI A;  2BKI B;  5F6T A;  1KSO A;  4GFT A;  1WLZ A;  3I5G B;  1B7T Y;  3K21 A;  1QS7 A;  4PE1 A;  4HRE E;  1MQ1 A;  3GK2 A;  1J1E A;  4NDD A;  2O5G A;  1QLK A;  2M29 A;  4MN0 A;  4IL1 A;  2BE4 A;  4DUQ A;  1CLM A;  1CDP A;  4DCK A;  2KBM A;  2KQ6 A;  1BR4 B;  3GK1 A;  1U5I B;  1XFW O;  2LAP A;  3OX6 A;  2NCP A;  4PHJ A;  2LE9 B;  4N5X A;  1KK7 Z;  3D10 A;  4JPZ B;  5CPV A;  2K61 A;  3PSR A;  4MRY A;  3O2P A;  1UHI A;  1J1D A;  2MBX A;  4XYN A;  1GJY A;  2PRU A;  1SW8 A;  2WOS A;  4CID A;  1GQM A;  4CPV A;  3I5I B;  1JC2 A;  1CFD A;  2F2P A;  2LP2 A;  1DJH A;  3KO0 A;  2CT9 A;  1QX7 A;  2LHL A;  2LV7 A;  2WCF A;  3OB2 B;  4I5L B;  2JC2 A;  2L5X B;  4U8D A;  1DJY A;  2P6B B;  1KFX L;  1RTP 1;  2ZFD A;  2WND A;  3BUN B;  4DIR A;  2MAZ A;  2PMY A;  1A4P A;  1W7J B;  3AAK A;  3AKA A;  1CLB A;  1L2O B;  5D69 A;  1DTL A;  1VRK A;  2LLU A;  1K95 A;  1TNQ A;  1YX8 A;  1BR1 B;  2PSR A;  1J7O A;  1BOD A;  1G4Y R;  2JUL A;  2CCM A;  5ER4 X;  1OQP A;  4QJ3 B;  2KI4 B;  2M8U A;  2L2E A;  4GPL B;  1RK9 A;  4FTG A;  1OOJ A;  1MUX A;  1N0Y A;  1NX1 A;  2KHN A;  3M0W A;  2L51 A;  4GAO A;  1R2U A;  3DF0 A;  1BOC A;  1XFY O;  2K7D A;  2QAC A;  1CNP A;  3DVM A;  3F45 A;  1U5I A;  1DJG A;  2KAY A;  4PAL A;  3EK8 A;  3TUY B;  1ALW A;  2LUX A;  1NIW A;  1JFK A;  2E30 A;  1NX0 A;  3JVT B;  3JTD B;  2LMU A;  1IQ3 A;  1IGV A;  2A4J A;  4GBA A;  2NLN A;  1CDM A;  1M63 B;  1AHR A;  3C1V A;  2KI6 D;  1B7T Z;  1IJ5 A;  2BL0 B;  2LVV A;  3TS5 B;  1K96 A;  1K9U A;  3FWC A;  3BOW B;  2BBN A;  4C0K A;  5I2Q A;  1KWO C;  1S5G Y;  1S5G Z;  1DJW A;  2LUC A;  1XA5 A;  1DJI A;  1CMF A;  1YRT B;  2JNF A;  3I5F C;  1MXL C;  3I5H C;  1XFV O;  1TNX A;  3CR4 X;  1TIZ A;  4WQ2 A;  2KI6 C;  2OS8 B;  2CBL A;  2JZI A;  3NSL A;  3BYA A;  1QIW A;  2EC6 C;  1PSR A;  2LVI A;  3I5H B;  1J7Q A;  1M45 A;  1GGZ A;  3CR2 A;  5K89 A;  1BF5 A;  1Y1X A;  1JF0 A;  3EVV A;  3JVT C;  1TCF A;  3KHE A;  2M7N A;  1A29 A;  4MBE A;  2K2F A;  1EL4 A;  1B47 A;  1QTX A;  1NSH A;  4XJK A;  4YGB B;  1J55 A;  1LVC D;  1NPQ A;  4YBH B;  1ALV A;  2JXC A;  5DKN A;  1KFX S;  2ZNE A;  4MZK A;  4GGN A;  3PAL A;  1TCO B;  2L4H A;  3FS7 A;  2KFG A;  2KFF A;  1EG4 A;  2F3Y A;  3HCM A;  4MZL A;  1FBV A;  4D1E A;  4GNK B;  5BPJ A;  3IQQ A;  1JFJ A;  2F3Z A;  1ODB A;  5DKQ A;  3GOF A;  1J7R A;  2M49 B;  2PVB A;  1E8A A;  2F2O A;  4I5J A;  1SKT A;  2B1U A;  3OP0 A;  4YGC B;  2JNX A;  3PN7 C;  1B1G A;  2ZRT A;  2ZND A;  3KPX A;  2K7O A;  3SG2 A;  2H61 A;  1D1O A;  1B8L A;  1WRZ A;  1A75 A;  4USL A;  4FQO A;  1DGV A;  1G8I A;  1SBJ A;  2ZRS A;  2V53 A;  3EVR A;  1SL8 A;  4CFR A;  4QJ5 B;  2BCA A;  1SMG A;  3D0Y B;  4YGD B;  2TN4 A;  1SNL A;  3LLE A;  2I18 A;  1LXF C;  3I5I C;  3SG7 A;  5B8I B;  4MEW A;  2PAL A;  1Y0V H;  2EHB A;  1KK8 B;  2AMI A;  2VRG A;  2F8P A;  1AUI B;  1MF8 B;  1EXR A;  1LA0 A;  4NQG A;  1LKJ A;  2JTZ A;  1CFC A;  1QV0 A;  3O4Y A;  2JT0 A;  2KYF A;  2LNK A;  4N1G A;  4YGA A;  2LMV A;  2KAX A;  3IQO A;  1BU3 A;  1TN4 A;  2OS8 C;  3OHM B;  3D0Y A;  2I7A A;  3BQ3 A;  5PAL A;  1WY9 A;  1XYD A;  5KSZ A;  1XK4 A;  3I5F B;  5JJG A;  1V1G A;  2M3W A;  3BUM B;  1LA3 A;  1NWD A;  1K93 D;  2CXJ A;  4ICB A;  4PDZ A;  1IWQ A;  2H61 C;  2Y1N A;  3TDZ A;  2COL B;  1UP5 A;  2Y1M A;  3A8R A;  4DS7 A;  1GGW A;  1DF0 A;  1CFP A;  3E3R A;  1F55 A;  1XK4 C;  1F4Q A;  1KCY A;  2WC8 A;  1QAT A;  4JWQ A;  1J7P A;  5TNC A;  5AEQ A;  3SG4 A;  5KTY A;  5CSI A;  2LAN A;  4M2O A;  2K7B A;  2OPO A;  1OMR A;  3PM8 A;  1QV1 A;  2KI4 C;  2L50 A;  2FCD A;  1NYA A;  4YGE B;  2L0P A;  3PAT A;  2MJW B;  2LLS A;  5DKR A;  3RM1 A;  4PE4 A;  1JF2 A;  4AOM A;  3NSK A;  3LCP C;  3WHU B;  5CSF A;  1JBA A;  1CDL A;  1YTZ C;  3EKJ A;  4BY5 A;  3SJS A;  1IKU A;  1X02 A;  2JT8 A;  2I2R E;  4CFQ A;  4ETO A;  3DVE A;  3GK4 X;  2LLT A;  1SL9 A;  1BJF A;  4QJ4 B;  2D8N A;  1RJV A;  2KNE A;  5HKW A;  1K90 D;  2L98 A;  2G9B A;  1NP8 A;  4A4B A;  2KFH A;  4P5O E;  4F0Z B;  2Q4U A;  1IQ5 A;  1F8H A;  3FIA A;  2M0R A;  1MHO A;  1UUR A;  1ZAC A;  1KFU S;  1KSM A;  1F54 A;  2SAS A;  1YUT A;  1DF0 B;  2FCE A;  2AUC A;  2OTG C;  1CLL A;  1OZO A;  1WDC C;  4NDB A;  2Q91 A;  1S1E A;  1M39 A;  1YVL A;  1DVI A;  1WRK A;  2ZKM X; 
#chains in the Genus database with same CATH topology
 1IRJ A;  3CZT X;  4TNC A;  1CB1 A;  3LK0 A;  4XJK B;  3S0F A;  1FI5 A;  1HQV A;  1DT7 B;  1R6P A;  1LS8 A;  4E68 A;  2LHI A;  5I2L A;  1S6I A;  1QX2 A;  2WC6 A;  1TTX A;  2KYC A;  1DJX A;  3KEV A;  1PK0 D;  3BUO B;  2QDI A;  3LK1 A;  1FPW A;  1MR8 A;  1NCY A;  2EGD A;  1CM4 A;  1KWO B;  1NX3 A;  5CSJ A;  4DRW A;  4NDC A;  2MA2 A;  3CZ1 A;  5FYX A;  2ISD A;  1S3P A;  3R1P A;  1LIN A;  3S0A A;  1AVS A;  1C7V A;  1TRF A;  3SS3 A;  1A03 A;  3VRO A;  1KQV A;  2BL0 C;  3TS5 C;  3H4S E;  1K94 A;  1UHJ A;  4MLW A;  3BUW B;  1H4B A;  2WCL A;  3LL8 B;  1K9P A;  2LCP A;  4JQ0 D;  1K9K A;  1RFJ A;  2FOT A;  1SR6 B;  1C07 A;  5HLV A;  5HLO A;  4JD9 A;  2M1K B;  1NX2 A;  1WDC B;  1KK8 C;  1N2D A;  2G2B A;  1K2H A;  1IH0 A;  4OVN F;  5G08 A;  4N1F A;  1P28 A;  2BEC A;  2BE6 A;  4PCW A;  4AQJ A;  3ZNI A;  1YUS A;  2K2A A;  1XVJ A;  1DC1 A;  1CKK A;  4PHK A;  4L9M A;  1QJT A;  3QRX A;  3SG5 A;  3CWG A;  2ZN9 A;  3PLF B;  3VRN A;  5I2O A;  1V1F A;  4ZCV A;  3D73 A;  3S0G A;  2CTN A;  1F71 A;  1ZFS A;  1RRO A;  1ZOT B;  4A4C A;  4CLN A;  1FI6 A;  1CFF A;  4PE7 A;  3B86 A;  1C3Y A;  3CZ0 A;  1UHH A;  2JXL A;  3SIB A;  5D3O A;  3VRQ A;  3PN7 B;  2JQ6 A;  1CTR A;  2LMT A;  1H8B A;  1CDN A;  1DGU A;  1KQM B;  2L5Y A;  3CTN A;  1SCM B;  4MVF A;  5HKY A;  1A2X A;  1SCV A;  1QAS A;  1IG5 A;  1N65 A;  1OOF A;  2GGM A;  2H2K A;  2NCO A;  4ORB B;  4R1E A;  1XFU O;  3WNX B;  1G33 A;  3TDI A;  1SY9 A;  3EVU A;  2O60 A;  1OZS A;  1DEK A;  1EJ3 A;  2KBI A;  1AJ4 A;  3NSO A;  4UPG A;  1YUU A;  2LVJ A;  3AAJ A;  4HRH A;  1QLS A;  3NHT A;  3NXA A;  4OR9 B;  2M1U A;  1SSE B;  1OMV A;  1SR6 C;  5HYD A;  5IBW A;  1Y6W A;  1OMD A;  3RLZ A;  1EG3 A;  3S0D A;  5J3X A;  1QVI Z;  2I94 A;  1JSA A;  1UHK A;  1L7Z A;  2NXQ A;  3VRR A;  1MWN A;  3VGO A;  2M7L A;  1OE9 B;  3DXL A;  1OOG A;  5AFP A;  3O78 A;  3DF0 B;  2KGR A;  2ERB A;  5FI6 A;  3SG6 A;  1B8C A;  3D75 A;  1XO5 A;  2LVK A;  1L2O C;  1KQM C;  3BXK A;  2BNX A;  5CSN A;  3DVJ A;  5AER A;  1NCX A;  2M9G A;  2JT3 A;  1K8U A;  3DD4 A;  4OCI A;  1UUS A;  1NUB A;  3DVK A;  1IJ6 A;  5D7F A;  3CGA A;  3OX5 A;  4ORC B;  2KLE A;  1PUL A;  2NZ0 A;  4GGF A;  3WHT B;  4PE0 A;  1YR5 A;  2EC6 B;  2JRF A;  4C0J A;  2JTT A;  3IF7 A;  2FJU B;  1B4C A;  4MSP A;  2BCX A;  3N7H A;  1AK8 A;  2WCB A;  2K8M B;  3PFV A;  1ZUZ A;  5FI7 A;  4YRU A;  1RWY A;  3PJI A;  2AAO A;  1BT6 A;  1PVA A;  4IJ7 A;  3WXA A;  5JOL A;  1MXE A;  3R1O A;  1T14 A;  4I5K A;  3IVT A;  2JPT A;  2PAS A;  1QX5 B;  1REC A;  3B88 A;  5I94 A;  1S6J A;  1PRW A;  2BCB A;  5AAN A;  4F7F A;  4M2P A;  4C0L A;  3SIA A;  4PHM A;  3DY9 A;  3BUX B;  2MRD A;  1BMO A;  3CLN A;  2QEH A;  1TOP A;  2KDH A;  3B87 A;  1XFR A;  5I8N A;  1OSA A;  4HRG A;  3KF9 A;  1A75 B;  1FW4 A;  3OB1 B;  1CMG A;  1PAL A;  1UHN A;  1W9Z A;  3O6B A;  2MHH A;  2WCE A;  4AQI A;  3ZWH A;  3CDN A;  1PVB A;  1YUR A;  1S36 A;  2K0J A;  3FWB A;  4PHN A;  1WLM A;  2KAV A;  4BY4 A;  2JWW A;  4P2Y B;  2QPT A;  1YRU B;  1F4O A;  2KPH A;  2Y4Q A;  3EK4 A;  1QXP A;  1Y1A A;  5DIC A;  5KU1 A;  1SL7 A;  2L4I A;  1QVI Y;  2E6W A;  2HPS A;  1ORG A;  4OV2 A;  5ER5 A;  3CR5 X;  4HSZ A;  3SG3 A;  4YI8 A;  2HF5 A;  3EKH A;  3JTD C;  1DEL A;  3VB1 A;  1AP4 A;  3BOW A;  1YX7 A;  4M2Q A;  4GUK A;  1BG1 A;  2LC5 A;  1TNP A;  3FE6 A;  3TUY C;  1XFX O;  1S6C A;  2GV5 A;  5GQQ C;  1YVH A;  1DJZ A;  2LP3 A;  2DOQ A;  3EK7 A;  3VRP A;  2ZN8 A;  2MLF C;  5AXI A;  1KK7 Y;  4ORA B;  2R2I A;  1SCM C;  2WOR A;  2CNP A;  3BJH A;  1W7I B;  2KSP A;  4Q04 A;  3TDU A;  1JWD A;  4MZJ A;  1CM1 A;  2K7C A;  2M97 A;  1Y1U A;  2HQ8 A;  1B8R A;  2QEV A;  3ICB A;  3SS5 A;  1PSB A;  1M31 A;  1SPY A;  1XFZ O;  4OKH A;  2LM5 A;  2P70 A;  1SK6 D;  2HET A;  2KOT A;  3HX4 A;  4MRX A;  3MSE B;  4WQ3 A;  4JKT A;  1B9A A;  3FE9 A;  2KQY A;  1JUO A;  1ZMZ A;  3K1E A;  2HQW A;  1BLQ A;  2MLE C;  1HT9 A;  3FE8 A;  1DMO A;  3S0E A;  2Y5I A;  3QME A;  2JOJ A;  1S26 D;  2GGZ A;  1M46 A;  1QIV A;  2BKH B;  3DYE A;  3A4U B;  5HL1 A;  1AJ5 A;  1UWO A;  1FF1 A;  3TZ1 A;  3R1V A;  1WRL A;  1C7W A;  2KGB C;  4ZCU A;  2QEB A;  3AKB A;  2RGI A;  4GGF C;  1KFU L;  1F70 A;  2JU0 A;  1NCZ A;  3CS1 A;  1SYM A;  1Q80 A;  2BBM A;  3I5G C;  4YI9 A;  2IS9 A;  1TWO A;  2SCP A;  2F33 A;  4I5N B;  1TNW A;  3NSI A;  2OTG B;  1SRA A;  1DQE A;  3R72 A;  5HKZ A;  1EH2 A;  4WRI A;  2BKI B;  5F6T A;  1KSO A;  4GFT A;  2WCJ A;  1WLZ A;  3I5G B;  1B7T Y;  2L2C A;  3K21 A;  1QS7 A;  4PE1 A;  4HRE E;  1MQ1 A;  3GK2 A;  1J1E A;  4NDD A;  2O5G A;  1QLK A;  2M29 A;  4MN0 A;  4IL1 A;  2BE4 A;  4DUQ A;  1CLM A;  1CDP A;  4DCK A;  3SS4 A;  2PQL A;  2KBM A;  2KQ6 A;  1BR4 B;  3GK1 A;  1U5I B;  1XFW O;  2LAP A;  3NGV A;  3OX6 A;  2NCP A;  4PHJ A;  2LE9 B;  2JPO A;  4N5X A;  1KK7 Z;  3D10 A;  2GTE A;  4JPZ B;  5CPV A;  2K61 A;  3PSR A;  4MRY A;  3O2P A;  1UHI A;  1J1D A;  2MBX A;  3CYZ A;  4XYN A;  1GJY A;  2PRU A;  1SW8 A;  2WOS A;  4CID A;  1GQM A;  4CPV A;  3I5I B;  1JC2 A;  1CFD A;  2F2P A;  2LP2 A;  1DJH A;  3KO0 A;  2CT9 A;  1QX7 A;  2LHL A;  2LV7 A;  2WCF A;  3OB2 B;  4I5L B;  2JC2 A;  2L5X B;  4U8D A;  1DJY A;  2P6B B;  1KFX L;  1RTP 1;  2ZFD A;  2WND A;  3BUN B;  4DIR A;  2MAZ A;  2PMY A;  3EG5 B;  1A4P A;  1W7J B;  3AAK A;  3AKA A;  1CLB A;  1L2O B;  3OBV A;  5D69 A;  2H8V A;  1DTL A;  1VRK A;  2LLU A;  1K95 A;  1TNQ A;  1YX8 A;  3BFA A;  1BR1 B;  2PSR A;  1J7O A;  3DZT A;  1BOD A;  1G4Y R;  2JUL A;  2CCM A;  5ER4 X;  1OQP A;  4QJ3 B;  2KI4 B;  2M8U A;  2L2E A;  2K60 A;  1RK9 A;  4FTG A;  4GPL B;  1OOJ A;  3CZ2 A;  1MUX A;  1N0Y A;  1NX1 A;  2KHN A;  3M0W A;  2L51 A;  4GAO A;  1R2U A;  3DF0 A;  1BOC A;  1XFY O;  2K7D A;  2QAC A;  1CNP A;  3DVM A;  3F45 A;  1U5I A;  1DJG A;  2KAY A;  4PAL A;  3EK8 A;  3TUY B;  1ALW A;  2LUX A;  1NIW A;  1JFK A;  1Z4H A;  1NX0 A;  2E30 A;  3JVT B;  3JTD B;  2LMU A;  3L4L A;  1IQ3 A;  1IGV A;  2A4J A;  4GBA A;  1OOI X;  2NLN A;  1CDM A;  1M63 B;  1AHR A;  3C1V A;  2KI6 D;  1B7T Z;  1IJ5 A;  2BL0 B;  2LVV A;  3TS5 B;  1K96 A;  1K9U A;  3FWC A;  3UO9 A;  3BOW B;  2BBN A;  4C0K A;  5I2Q A;  1KWO C;  1S5G Y;  3PM2 A;  1S5G Z;  1DJW A;  2LUC A;  5EL2 A;  1XA5 A;  1DJI A;  2WC5 A;  1CMF A;  1YRT B;  2JNF A;  3I5F C;  1MXL C;  3D74 A;  3I5H C;  1XFV O;  1TNX A;  3CR4 X;  1TIZ A;  4WQ2 A;  2KI6 C;  2OS8 B;  2CBL A;  2JZI A;  3BFH A;  3NSL A;  3BYA A;  1QIW A;  2EC6 C;  1PSR A;  2LVI A;  3I5H B;  5FI2 A;  1J7Q A;  1M45 A;  1GGZ A;  2YGU A;  3B6X A;  3CR2 A;  5K89 A;  1BF5 A;  1Y1X A;  1JF0 A;  3EVV A;  3JVT C;  1TCF A;  3KHE A;  3Q8I A;  2M7N A;  1A29 A;  4MBE A;  2K2F A;  1EL4 A;  1GM0 A;  1B47 A;  1QTX A;  1NSH A;  4XJK A;  4YGB B;  1J55 A;  1LVC D;  1NPQ A;  2WCM A;  4YBH B;  1OW4 A;  1ALV A;  2JXC A;  5DKN A;  1KFX S;  2ZNE A;  2KLD A;  4GGN A;  4MZK A;  3PAL A;  1TCO B;  2L4H A;  3FS7 A;  2KFG A;  2KFF A;  4OZD A;  1EG4 A;  2F3Y A;  3HCM A;  4MZL A;  1FBV A;  4D1E A;  4GNK B;  5BPJ A;  3IQQ A;  1JFJ A;  1TUZ A;  2F3Z A;  1ODB A;  5DKQ A;  3GOF A;  1J7R A;  2M49 B;  2PVB A;  1E8A A;  2F2O A;  4I5J A;  4FQT A;  1SKT A;  2B1U A;  3OP0 A;  4YGC B;  2JNX A;  3PN7 C;  1B1G A;  1OOH A;  2ZRT A;  2ZND A;  3KPX A;  2K7O A;  3SG2 A;  2H61 A;  1D1O A;  1B8L A;  1WRZ A;  1A75 A;  4USL A;  4FQO A;  1DGV A;  3UNW A;  1G8I A;  1SBJ A;  2ZRS A;  2V53 A;  3EVR A;  1SL8 A;  4CFR A;  4QJ5 B;  2BCA A;  1C3Z A;  1SMG A;  3D0Y B;  4YGD B;  2TN4 A;  1SNL A;  3LLE A;  2I18 A;  1LXF C;  3D76 A;  3I5I C;  4INX A;  3SG7 A;  5B8I B;  4MEW A;  2PAL A;  1Y0V H;  2EHB A;  2P71 A;  1KK8 B;  2AMI A;  2VRG A;  2F8P A;  1AUI B;  4PT1 A;  1MF8 B;  1EXR A;  1LA0 A;  4NQG A;  1LKJ A;  3L47 A;  2JTZ A;  1CFC A;  1QV0 A;  3O4Y A;  2JT0 A;  2KYF A;  2LNK A;  4N1G A;  4YGA A;  3S0B A;  2LMV A;  2KAX A;  3IQO A;  1BU3 A;  1TN4 A;  2OS8 C;  3OHM B;  3D0Y A;  2I7A A;  3BQ3 A;  5PAL A;  1WY9 A;  1XYD A;  5KSZ A;  1XK4 A;  3I5F B;  5JJG A;  2QEO A;  3CAB A;  1V1G A;  2M3W A;  3BUM B;  1LA3 A;  1NWD A;  1K93 D;  2CXJ A;  4ICB A;  4PDZ A;  1IWQ A;  2H61 C;  2Y1N A;  3TDZ A;  2COL B;  1UP5 A;  3BFB A;  2Y1M A;  3A8R A;  4DS7 A;  1GGW A;  1DF0 A;  1CFP A;  3E3R A;  3D78 A;  1F55 A;  3NHI A;  1XK4 C;  1F4Q A;  2FJY A;  2WC8 A;  1QAT A;  4JWQ A;  1J7P A;  1KCY A;  5TNC A;  5AEQ A;  3SG4 A;  5KTY A;  5CSI A;  2LAN A;  4M2O A;  2K7B A;  2OPO A;  1OMR A;  3PM8 A;  1QV1 A;  2KI4 C;  2L50 A;  3O4X A;  2FCD A;  4KYN A;  1NYA A;  4YGE B;  2L0P A;  3PAT A;  2MJW B;  2LLS A;  5DKR A;  3RM1 A;  4PE4 A;  1JF2 A;  1IIO A;  4AOM A;  3NSK A;  3LCP C;  1TUJ A;  3WHU B;  5CSF A;  1JBA A;  1CDL A;  1YTZ C;  3EKJ A;  4BY5 A;  3SJS A;  1IKU A;  1X02 A;  2JT8 A;  2I2R E;  4CFQ A;  3RZS A;  4ETO A;  3DVE A;  3GK4 X;  2LLT A;  1SL9 A;  1BJF A;  3B7A A;  4QJ4 B;  2D8N A;  1RJV A;  2BAP A;  2KNE A;  2WCH A;  5HKW A;  1K90 D;  2L98 A;  2G9B A;  1NP8 A;  4A4B A;  1Z2C B;  2KFH A;  4P5O E;  4F0Z B;  3V2L A;  2Q4U A;  1IQ5 A;  1F8H A;  2PYQ A;  2M0R A;  3FIA A;  1MHO A;  1UUR A;  1ZAC A;  4INW A;  1KFU S;  1KSM A;  1F54 A;  3OGN A;  2SAS A;  1YUT A;  1DF0 B;  2FCE A;  2AUC A;  3L4A A;  2OTG C;  3D77 A;  1CLL A;  1QWV A;  1OZO A;  2WCK A;  1WDC C;  4NDB A;  2Q91 A;  1S1E A;  1M39 A;  1YVL A;  1DVI A;  1WRK A;  2ZKM X; 
#chains in the Genus database with same CATH homology
 1IRJ A;  3CZT X;  4TNC A;  1CB1 A;  3LK0 A;  4XJK B;  1FI5 A;  1HQV A;  1DT7 B;  1R6P A;  4E68 A;  2LHI A;  5I2L A;  1S6I A;  1QX2 A;  1TTX A;  2KYC A;  1DJX A;  3KEV A;  1PK0 D;  3BUO B;  3LK1 A;  1FPW A;  1MR8 A;  1NCY A;  2EGD A;  1CM4 A;  1KWO B;  1NX3 A;  5CSJ A;  4DRW A;  4NDC A;  2MA2 A;  5FYX A;  2ISD A;  1S3P A;  1LIN A;  1AVS A;  1C7V A;  1TRF A;  1A03 A;  3VRO A;  1KQV A;  2BL0 C;  3TS5 C;  3H4S E;  1K94 A;  1UHJ A;  4MLW A;  3BUW B;  1H4B A;  3LL8 B;  1K9P A;  2LCP A;  4JQ0 D;  1K9K A;  1RFJ A;  2FOT A;  1SR6 B;  1C07 A;  5HLV A;  5HLO A;  2M1K B;  1NX2 A;  1WDC B;  1KK8 C;  1N2D A;  2G2B A;  1K2H A;  1IH0 A;  4OVN F;  5G08 A;  4N1F A;  2BEC A;  2BE6 A;  4PCW A;  4AQJ A;  3ZNI A;  1YUS A;  2K2A A;  1XVJ A;  1CKK A;  4PHK A;  4L9M A;  1QJT A;  3QRX A;  3SG5 A;  3CWG A;  2ZN9 A;  3PLF B;  3VRN A;  5I2O A;  1V1F A;  4ZCV A;  2CTN A;  1F71 A;  1ZFS A;  1RRO A;  1ZOT B;  4A4C A;  4CLN A;  1FI6 A;  1CFF A;  4PE7 A;  1UHH A;  2JXL A;  3SIB A;  3VRQ A;  3PN7 B;  2JQ6 A;  1CTR A;  2LMT A;  1H8B A;  1CDN A;  1DGU A;  1KQM B;  3CTN A;  1SCM B;  4MVF A;  5HKY A;  1A2X A;  1SCV A;  1QAS A;  1IG5 A;  1N65 A;  2GGM A;  2H2K A;  2NCO A;  4ORB B;  4R1E A;  3WNX B;  1XFU O;  1G33 A;  3TDI A;  1SY9 A;  3EVU A;  2O60 A;  1OZS A;  2KBI A;  1EJ3 A;  1AJ4 A;  3NSO A;  4UPG A;  1YUU A;  2LVJ A;  3AAJ A;  4HRH A;  1QLS A;  3NXA A;  4OR9 B;  2M1U A;  1OMV A;  1SR6 C;  5HYD A;  5IBW A;  1Y6W A;  1OMD A;  3RLZ A;  1EG3 A;  5J3X A;  1QVI Z;  2I94 A;  1JSA A;  1UHK A;  1L7Z A;  2NXQ A;  3VRR A;  1MWN A;  3VGO A;  2M7L A;  1OE9 B;  5AFP A;  3O78 A;  3DF0 B;  2KGR A;  3SG6 A;  1B8C A;  1XO5 A;  2LVK A;  1L2O C;  1KQM C;  3BXK A;  5CSN A;  3DVJ A;  5AER A;  1NCX A;  2M9G A;  2JT3 A;  1K8U A;  3DD4 A;  4OCI A;  1UUS A;  1NUB A;  3DVK A;  1IJ6 A;  5D7F A;  3CGA A;  3OX5 A;  4ORC B;  2NZ0 A;  1PUL A;  4GGF A;  3WHT B;  4PE0 A;  1YR5 A;  2EC6 B;  2JRF A;  4C0J A;  2JTT A;  3IF7 A;  2FJU B;  1B4C A;  4MSP A;  2BCX A;  1AK8 A;  2WCB A;  2K8M B;  3PFV A;  1ZUZ A;  4YRU A;  1RWY A;  2AAO A;  1BT6 A;  1PVA A;  3WXA A;  5JOL A;  1MXE A;  4I5K A;  2JPT A;  2PAS A;  1QX5 B;  1REC A;  1S6J A;  1PRW A;  2BCB A;  5AAN A;  4M2P A;  4C0L A;  3SIA A;  4PHM A;  3BUX B;  2MRD A;  1BMO A;  3CLN A;  1TOP A;  2KDH A;  5I8N A;  1OSA A;  4HRG A;  3KF9 A;  1A75 B;  1FW4 A;  3OB1 B;  1CMG A;  1PAL A;  1UHN A;  3O6B A;  2MHH A;  2WCE A;  4AQI A;  3ZWH A;  1PVB A;  1YUR A;  1S36 A;  2K0J A;  3FWB A;  4PHN A;  1WLM A;  2KAV A;  4BY4 A;  2JWW A;  4P2Y B;  2QPT A;  1YRU B;  1F4O A;  2Y4Q A;  3EK4 A;  1QXP A;  1Y1A A;  5KU1 A;  1SL7 A;  2L4I A;  1QVI Y;  2E6W A;  2HPS A;  4OV2 A;  5ER5 A;  3CR5 X;  4HSZ A;  3SG3 A;  4YI8 A;  2HF5 A;  3EKH A;  3JTD C;  1AP4 A;  3BOW A;  1YX7 A;  4M2Q A;  4GUK A;  1BG1 A;  2LC5 A;  1TNP A;  3TUY C;  1XFX O;  1S6C A;  2GV5 A;  5GQQ C;  1YVH A;  1DJZ A;  2LP3 A;  2DOQ A;  3EK7 A;  3VRP A;  2ZN8 A;  2MLF C;  5AXI A;  1KK7 Y;  4ORA B;  2R2I A;  1SCM C;  2WOR A;  2CNP A;  4Q04 A;  1W7I B;  2KSP A;  3TDU A;  1JWD A;  4MZJ A;  1CM1 A;  2K7C A;  2M97 A;  1Y1U A;  2HQ8 A;  1B8R A;  3ICB A;  1PSB A;  1M31 A;  1SPY A;  1XFZ O;  4OKH A;  2LM5 A;  1SK6 D;  2HET A;  2KOT A;  3HX4 A;  4MRX A;  3MSE B;  4WQ3 A;  1B9A A;  2KQY A;  1JUO A;  1ZMZ A;  2HQW A;  1BLQ A;  2MLE C;  1HT9 A;  1DMO A;  2Y5I A;  2JOJ A;  1S26 D;  2GGZ A;  1M46 A;  1QIV A;  2BKH B;  3A4U B;  1AJ5 A;  1UWO A;  1FF1 A;  3TZ1 A;  1WRL A;  1C7W A;  2KGB C;  4ZCU A;  3AKB A;  2RGI A;  4GGF C;  1KFU L;  1F70 A;  2JU0 A;  1NCZ A;  3CS1 A;  1SYM A;  1Q80 A;  2BBM A;  3I5G C;  4YI9 A;  2IS9 A;  2SCP A;  2F33 A;  4I5N B;  1TNW A;  3NSI A;  2OTG B;  1SRA A;  5HKZ A;  1EH2 A;  4WRI A;  2BKI B;  5F6T A;  1KSO A;  4GFT A;  1WLZ A;  3I5G B;  1B7T Y;  3K21 A;  1QS7 A;  4PE1 A;  4HRE E;  1MQ1 A;  3GK2 A;  1J1E A;  4NDD A;  2O5G A;  1QLK A;  2M29 A;  4MN0 A;  4IL1 A;  2BE4 A;  4DUQ A;  1CLM A;  1CDP A;  4DCK A;  2KBM A;  2KQ6 A;  1BR4 B;  3GK1 A;  1U5I B;  1XFW O;  2LAP A;  3OX6 A;  2NCP A;  4PHJ A;  2LE9 B;  4N5X A;  1KK7 Z;  3D10 A;  4JPZ B;  5CPV A;  2K61 A;  3PSR A;  4MRY A;  3O2P A;  1UHI A;  1J1D A;  2MBX A;  4XYN A;  1GJY A;  2PRU A;  1SW8 A;  2WOS A;  4CID A;  1GQM A;  4CPV A;  3I5I B;  1JC2 A;  1CFD A;  2F2P A;  2LP2 A;  1DJH A;  3KO0 A;  2CT9 A;  1QX7 A;  2LHL A;  2LV7 A;  2WCF A;  3OB2 B;  4I5L B;  2JC2 A;  2L5X B;  4U8D A;  1DJY A;  2P6B B;  1KFX L;  1RTP 1;  2ZFD A;  2WND A;  3BUN B;  4DIR A;  2MAZ A;  2PMY A;  1A4P A;  1W7J B;  3AAK A;  3AKA A;  1CLB A;  1L2O B;  5D69 A;  1DTL A;  1VRK A;  2LLU A;  1K95 A;  1TNQ A;  1YX8 A;  1BR1 B;  2PSR A;  1J7O A;  1BOD A;  1G4Y R;  2JUL A;  2CCM A;  5ER4 X;  1OQP A;  4QJ3 B;  2KI4 B;  2M8U A;  2L2E A;  4GPL B;  1RK9 A;  4FTG A;  1OOJ A;  1MUX A;  1N0Y A;  1NX1 A;  2KHN A;  3M0W A;  2L51 A;  4GAO A;  1R2U A;  3DF0 A;  1BOC A;  1XFY O;  2K7D A;  2QAC A;  1CNP A;  3DVM A;  3F45 A;  1U5I A;  1DJG A;  2KAY A;  4PAL A;  3EK8 A;  3TUY B;  1ALW A;  2LUX A;  1NIW A;  1JFK A;  2E30 A;  1NX0 A;  3JVT B;  3JTD B;  2LMU A;  1IQ3 A;  1IGV A;  2A4J A;  4GBA A;  2NLN A;  1CDM A;  1M63 B;  1AHR A;  3C1V A;  2KI6 D;  1B7T Z;  1IJ5 A;  2BL0 B;  2LVV A;  3TS5 B;  1K96 A;  1K9U A;  3FWC A;  3BOW B;  2BBN A;  4C0K A;  5I2Q A;  1KWO C;  1S5G Y;  1S5G Z;  1DJW A;  2LUC A;  1XA5 A;  1DJI A;  1CMF A;  1YRT B;  2JNF A;  3I5F C;  1MXL C;  3I5H C;  1XFV O;  1TNX A;  3CR4 X;  1TIZ A;  4WQ2 A;  2KI6 C;  2OS8 B;  2CBL A;  2JZI A;  3NSL A;  3BYA A;  1QIW A;  2EC6 C;  1PSR A;  2LVI A;  3I5H B;  1J7Q A;  1M45 A;  1GGZ A;  3CR2 A;  5K89 A;  1BF5 A;  1Y1X A;  1JF0 A;  3EVV A;  3JVT C;  1TCF A;  3KHE A;  2M7N A;  1A29 A;  4MBE A;  2K2F A;  1EL4 A;  1B47 A;  1QTX A;  1NSH A;  4XJK A;  4YGB B;  1J55 A;  1LVC D;  1NPQ A;  4YBH B;  1ALV A;  2JXC A;  5DKN A;  1KFX S;  2ZNE A;  4MZK A;  4GGN A;  3PAL A;  1TCO B;  2L4H A;  3FS7 A;  2KFG A;  2KFF A;  1EG4 A;  2F3Y A;  3HCM A;  4MZL A;  1FBV A;  4D1E A;  4GNK B;  5BPJ A;  3IQQ A;  1JFJ A;  2F3Z A;  1ODB A;  5DKQ A;  3GOF A;  1J7R A;  2M49 B;  2PVB A;  1E8A A;  2F2O A;  4I5J A;  1SKT A;  2B1U A;  3OP0 A;  4YGC B;  2JNX A;  3PN7 C;  1B1G A;  2ZRT A;  2ZND A;  3KPX A;  2K7O A;  3SG2 A;  2H61 A;  1D1O A;  1B8L A;  1WRZ A;  1A75 A;  4USL A;  4FQO A;  1DGV A;  1G8I A;  1SBJ A;  2ZRS A;  2V53 A;  3EVR A;  1SL8 A;  4CFR A;  4QJ5 B;  2BCA A;  1SMG A;  3D0Y B;  4YGD B;  2TN4 A;  1SNL A;  3LLE A;  2I18 A;  1LXF C;  3I5I C;  3SG7 A;  5B8I B;  4MEW A;  2PAL A;  1Y0V H;  2EHB A;  1KK8 B;  2AMI A;  2VRG A;  2F8P A;  1AUI B;  1MF8 B;  1EXR A;  1LA0 A;  4NQG A;  1LKJ A;  2JTZ A;  1CFC A;  1QV0 A;  3O4Y A;  2JT0 A;  2KYF A;  2LNK A;  4N1G A;  4YGA A;  2LMV A;  2KAX A;  3IQO A;  1BU3 A;  1TN4 A;  2OS8 C;  3OHM B;  3D0Y A;  2I7A A;  3BQ3 A;  5PAL A;  1WY9 A;  1XYD A;  5KSZ A;  1XK4 A;  3I5F B;  5JJG A;  1V1G A;  2M3W A;  3BUM B;  1LA3 A;  1NWD A;  1K93 D;  2CXJ A;  4ICB A;  4PDZ A;  1IWQ A;  2H61 C;  2Y1N A;  3TDZ A;  2COL B;  1UP5 A;  2Y1M A;  3A8R A;  4DS7 A;  1GGW A;  1DF0 A;  1CFP A;  3E3R A;  1F55 A;  1XK4 C;  1F4Q A;  1KCY A;  2WC8 A;  1QAT A;  4JWQ A;  1J7P A;  5TNC A;  5AEQ A;  3SG4 A;  5KTY A;  5CSI A;  2LAN A;  4M2O A;  2K7B A;  2OPO A;  1OMR A;  3PM8 A;  1QV1 A;  2KI4 C;  2L50 A;  2FCD A;  1NYA A;  4YGE B;  2L0P A;  3PAT A;  2MJW B;  2LLS A;  5DKR A;  3RM1 A;  4PE4 A;  1JF2 A;  4AOM A;  3NSK A;  3LCP C;  3WHU B;  5CSF A;  1JBA A;  1CDL A;  1YTZ C;  3EKJ A;  4BY5 A;  3SJS A;  1IKU A;  1X02 A;  2JT8 A;  2I2R E;  4CFQ A;  4ETO A;  3DVE A;  3GK4 X;  2LLT A;  1SL9 A;  1BJF A;  4QJ4 B;  2D8N A;  1RJV A;  2KNE A;  5HKW A;  1K90 D;  2L98 A;  2G9B A;  1NP8 A;  4A4B A;  2KFH A;  4P5O E;  4F0Z B;  2Q4U A;  1IQ5 A;  1F8H A;  3FIA A;  2M0R A;  1MHO A;  1UUR A;  1ZAC A;  1KFU S;  1KSM A;  1F54 A;  2SAS A;  1YUT A;  1DF0 B;  2FCE A;  2AUC A;  2OTG C;  1CLL A;  1OZO A;  1WDC C;  4NDB A;  2Q91 A;  1S1E A;  1M39 A;  1YVL A;  1DVI A;  1WRK A;  2ZKM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...