1TTXA

Solution structure of human beta parvalbumin (oncomodulin) refined with a paramagnetism based strategy
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oncomodulin
publication title Solution Structure of Human beta-Parvalbumin and Structural Comparison with Its Paralog alpha-Parvalbumin and with Their Rat Orthologs(,)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 31
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ttxA00
2K7OA 1CLMA 1Y6WA 1J7QA 1YX7A 2EHBA 1NCZA 2G2BA 1QX7A 3I5IB 3NSOA 5HLVA 3PALA 4MSPA 5FYXA 4GUKA 1J7PA 2HF5A 1GGWA 4MEWA 1WY9A 1PVAA 2L51A 1JSAA 3EK4A 2PMYA 1XFUO 4YGCB 1IQ5A 4MRXA 2LVJA 2FCEA 2JTTA 2F3YA 1BU3A 2LUCA 3PLFB 1JF2A 3EK8A 1FI6A 4GGNA 4AQJA 4CIDA 1DGVA 1UHIA 1QV0A 1QLKA 4TNCA 3PFVA 1NIWA 1Q80A 1TNWA 2LAPA 2Y4QA 1KFUS 3BXKA 1F54A 1DF0A 3CR2A 2KYCA 2NXQA 4I5JA 5F6TA 2D8NA 3TDIA 1AP4A 1TNXA 3EVRA 2HQ8A 4MVFA 2WC8A 4MZJA 1KSMA 3CZTX 2CBLA 1Y1XA 1AJ5A 1SCMB 3EKJA 4GFTA 1A03A 2OS8C 4HREE 3OB2B 5AXIA 2GV5A 1LA3A 2K2FA 3LK0A 1S5GZ 1S3PA 3QRXA 1AHRA 1CFPA 3NSKA 1GJYA 2K61A 4XJKB 1N0YA 4MZKA 5ER4X 1TNPA 2A4JA 2M0RA 2WCBA 5KTYA 1YURA 3BUNB 3K21A 2COLB 2KGRA 5AERA 2B1UA 2JPTA 4AOMA 2K2AA 2WNDA 1QLSA 2JOJA 1K95A 1MHOA 1A4PA 1B7TZ 5HKYA 2CNPA 2MRDA 1IG5A 1F70A 1R2UA 2F8PA 1H8BA 1BG1A 1QTXA 2O60A 1SYMA 3BYAA 1QVIZ 3VRNA 1Y1UA 1DJIA 1QV1A 2I18A 2JULA 3TS5C 1IH0A 4QJ4B 1CMGA 2M1KB 4CFRA 1IJ6A 1M63B 1SY9A 1EJ3A 1S6JA 1W7JB 3EVUA 3SG7A 1KQMC 1KK8C 3CGAA 4F0ZB 4D1EA 1F55A 1SCMC 3CTNA 1RROA 1JFJA 2L50A 1EXRA 1QXPA 2MHHA 4UPGA 2KQ6A 1KSOA 5AEQA 1CDNA 1DF0B 2SCPA 2NCPA 1PVBA 2JNFA 1DJHA 2BCAA 4JQ0D 3JTDC 1XFZO 1G33A 1QASA 1SRAA 4N5XA 4YGDB 2K7DA 3PN7C 5HYDA 4ETOA 1F4QA 1CTRA 1YUSA 2ZRTA 2Y5IA 1TTXA 1UHNA 1B7TY 2K0JA 3CWGA 3TDUA 1AK8A 2JXCA 1DT7B 2BE6A 1LINA 2LCPA 1A75A 2V53A 5GQQC 1Y0VH 4MLWA 1ZUZA 2JU0A 4OV2A 1S6IA 1BR4B 1OE9B 1NPQA 1LVCD 1CKKA 1QVIY 2EC6C 1NX2A 4NQGA 1YVHA 2PRUA 1DVIA 1WDCC 2F2OA 4BY5A 1SL7A 3OX5A 4WQ2A 2L5XB 2WORA 1OZOA 1CFCA 1XK4A 1PSRA 2I2RE 5CSNA 1KQVA 1CFDA 2MLEC 3NSIA 3O4YA 3D0YA 1WRLA 2M3WA 1WRKA 4I5LB 5G08A 1YVLA 2LVKA 5J3XA 2L2EA 1FBVA 2NZ0A 1DMOA 2CTNA 2VRGA 1J1EA 3SG2A 2PSRA 2OS8B 1GGZA 1N2DA 2Q4UA 3VROA 1NWDA 1K96A 4NDCA 4WQ3A 1BOCA 3I5GB 1E8AA 2JNXA 2L98A 5ER5A 1AJ4A 2AUCA 4YGAA 1RTP1 4FTGA 1G8IA 1S26D 1J7OA 2KFHA 1DGUA 4MN0A 5DKRA 1S36A 1QIVA 5KU1A 2KAYA 1L7ZA 4PHJA 4ORBB 1R6PA 4CFQA 2KHNA 4YGBB 1F4OA 1WRZA 2KI4C 4OCIA 1IRJA 1JUOA 1C07A 1HT9A 2Y1NA 3DVMA 2LC5A 1QX2A 1C7VA 1B9AA 3O6BA 2ZKMX 5PALA 1BR1B 3IF7A 4HRGA 2KGBC 4M2PA 1L2OC 1KK7Z 2G9BA 3CS1A 2ZNEA 4AQIA 5JOLA 1M31A 2F2PA 2M9GA 1FPWA 1W7IB 3BUMB 3OHMB 4GBAA 3TS5B 2LUXA 4C0LA 2LMVA 1OSAA 5DKNA 2CCMA 4PDZA 1A75B 1NP8A 1M39A 4I5KA 1YUUA 3KEVA 1CFFA 1KQMB 1KK8B 3SG4A 1XFVO 4L9MA 1SKTA 5JJGA 3SIBA 1DJXA 3O78A 3I5GC 4ORAB 1UWOA 2LE9B 1K94A 1DJWA 1PULA 2JQ6A 4MRYA 5HKWA 4ICBA 3OB1B 1GQMA 2WCFA 3D0YB 4N1GA 1IWQA 1CM1A 2BCBA 3JTDB 1IQ3A 2JTZA 1DJZA 2KOTA 1ALVA 1CLLA 1J1DA 3PN7B 2KQYA 2QACA 1K93D 1V1GA 2LMTA 3FIAA 2JWWA 5AANA 1NX0A 2K7CA 1CDMA 4HRHA 1EH2A 1SBJA 1SW8A 1B8LA 3DVEA 2MBXA 1BLQA 1KFXL 3A8RA 3PM8A 2LLSA 2BBMA 1KK7Y 4ZCVA 1NX3A 2BBNA 2KI6C 2KFGA 1UP5A 4N1FA 2EC6B 1JBAA 2RGIA 1WDCB 2I7AA 2H61C 1S6CA 1MXEA 3PSRA 3DVJA 1CNPA 5CSFA 2KI6D 2HPSA 2I94A 3H4SE 1MQ1A 4FQOA 1QIWA 1KWOC 2KAVA 4C0JA 4QJ5B 3CR4X 1TRFA 2ZN8A 1TN4A 3EK7A 3BOWA 1C7WA 3KO0A 4PE7A 2LNKA 1MF8B 1PSBA 3FS7A 1SCVA 1WLZA 1DJYA 1MXLC 1ZFSA 1XK4C 4JWQA 2IS9A 1EG3A 2OTGB 2WCEA 4YGEB 4M2QA 3ZNIA 1RJVA 3OP0A 1SL8A 2H61A 4YRUA 1ZOTB 1RK9A 1J7RA 1YTZC 2KI4B 2JZIA 2LP2A 3A4UB 2LV7A 2KDHA 2M29A 5TNCA 4NDBA 2M7NA 1K9KA 1EG4A 1TIZA 4P5OE 5D69A 5D7FA 3EKHA 2M8UA 1HQVA 3M0WA 1L2OB 1UUSA 2NLNA 4PHKA 1K2HA 1CDPA 1YX8A 3ICBA 4PCWA 1B1GA 1KCYA 2MA2A 2KFFA 1NCYA 3VRQA 1J55A 4PE0A 2FJUB 3CLNA 4PHNA 1EL4A 2BKIB 1UHJA 4DIRA 3IQOA 3OX6A 1V1FA 4YI8A 1YUTA 2KBMA 3KPXA 1KFUL 1IKUA 3LL8B 1YRTB 3DD4A 3VGOA 1U5IA 3EVVA 4YBHB 1BODA 3E3RA 2BCXA 3NSLA 2JXLA 1CDLA 4E68A 2OTGC 3I5HB 2WOSA 4ORCB 1CMFA 3BQ3A 1NX1A 1A2XA 3TDZA 4DRWA 1OQPA 1H4BA 1UHKA 1G4YR 3HCMA 2HQWA 3AKAA 4P2YB 2FCDA 1JF0A 4OKHA 2O5GA 3BOWB 1OMVA 1WLMA 2LHLA 2F3ZA 1LKJA 1ODBA 1K90D 5IBWA 2L4HA 1BF5A 2JC2A 1RFJA 2KAXA 2M97A 1NYAA 3I5FC 2LP3A 1DJGA 1SNLA 4JPZB 1QX5B 4PALA 1XFYO 2NCOA 1BJFA 2LLUA 3RLZA 4DS7A 2LVIA 1RWYA 2ZN9A 1B4CA 2BL0B 1OMDA 3DVKA 3KF9A 1F71A 1KWOB 3LLEA 2AMIA 4GPLB 1DTLA 1SPYA 5I8NA 2BE4A 2FOTA 1XO5A 4GGFC 1XA5A 1PK0D 3WNXB 4R1EA 3VRPA 3TUYB 3FWCA 1NSHA 4MZLA 4Q04A 3SG3A 1K9PA 4CPVA 4U8DA 1MWNA 2JT0A 1IGVA 1OZSA 2KNEA 2BKHB 5AFPA 1IJ5A 1SK6D 1B8RA 3ZWHA 3I5HC 5HKZA 3D10A 1JC2A 4MBEA 3AKBA 4ZCUA 1ZACA 1S1EA 3VRRA 5CSIA 3DF0A 1QJTA 2HETA 2MLFC 3GK2A 1PRWA 1BMOA 2GGMA 2LHIA 1TOPA 3GK1A 2GGZA 1X02A 3NXAA 1U5IB 2CT9A 4A4CA 4M2OA 4HSZA 4USLA 3PATA 4GGFA 4I5NB 3WXAA 4BY4A 3CR5X 1A29A 2F33A 2P6BB 1F8HA 3I5IC 5BPJA 5K89A 1SMGA 2OPOA 2BL0C 1FI5A 1VRKA 5CPVA 2ZNDA 1AVSA 4DUQA 2Q91A 2ZRSA 1TCFA 1FW4A 1XYDA 3BUXB 1K9UA 3MSEB 4PHMA 3WHUB 3JVTB 1JWDA 1YR5A 2K8MB 2TN4A 1SR6B 1B47A 4PE4A 1D1OA 3TZ1A 3TUYC 1XVJA 5DKQA 4GAOA 2EGDA 2LVVA 1JFKA 1QS7A 3SJSA 4OR9B 1PALA 4C0KA 1QATA 3RM1A 1LXFC 2DOQA 2L4IA 3SG5A 3AAKA 5CSJA 1LA0A 1K8UA 2JT3A 3HX4A 2BECA 4NDDA 3WHTB 2PVBA 1YRUB 2LANA 4XYNA 1M46A 2E6WA 5I2OA 1CLBA 5KSZA 1BT6A 1CB1A 1UHHA 2KBIA 3GK4X 2AAOA 1S5GY 3C1VA 3SIAA 4WRIA 2M1UA 2H2KA 3AAJA 3F45A 3FWBA 3I5FB 4CLNA 1NCXA 5B8IB 2L0PA 2LM5A 4QJ3B 4GNKB 2R2IA 1KFXS 1CM4A 1OMRA 2Y1MA 1FF1A 1MUXA 2K7BA 4OVNF 3DF0B 3LCPC 1ALWA 2JT8A 1TNQA 2LLTA 3BUOB 4YI9A 1ZMZA 1N65A 3SG6A 2QPTA 1AUIB 5I2LA 4PE1A 2SASA 5I2QA 2PASA 2MAZA 3O2PA 2PALA 2ISDA 1UURA 2MJWB 3JVTC 3LK1A 5HLOA 1NUBA 2KSPA 1SR6C 1XFWO 1RECA 1M45A 2CXJA 2M49B 1OOJA 2LMUA 3KHEA 2ZFDA 3IQQA 1XFXO 2M7LA 2E30A 3GOFA 1TCOB 4XJKA 1B8CA 1Y1AA 4A4BA 2KYFA 4DCKA 1MR8A 1SL9A 3BUWB 2JRFA 4IL1A
chains in the Genus database with same CATH superfamily
2K7OA 1CLMA 1Y6WA 1J7QA 1YX7A 3D74A 2EHBA 1NCZA 3S0FA 2G2BA 1QX7A 3I5IB 3NSOA 5HLVA 3PALA 4MSPA 5FYXA 4GUKA 1J7PA 2HF5A 4INWA 1GGWA 4MEWA 1Z4HA 1WY9A 1PVAA 2L51A 1JSAA 3EK4A 1Z2CB 1XFUO 2PMYA 4YGCB 1IQ5A 4MRXA 2LVJA 2FCEA 2JTTA 2F3YA 1BU3A 2LUCA 3PLFB 1DC1A 1JF2A 3EK8A 1FI6A 4GGNA 4AQJA 4CIDA 1DGVA 1UHIA 1QV0A 1QLKA 4TNCA 3PFVA 1NIWA 1Q80A 1TNWA 2LAPA 2Y4QA 1KFUS 3BXKA 3OGNA 1F54A 1DF0A 3CR2A 2KYCA 2NXQA 4I5JA 5F6TA 2D8NA 3BFBA 3TDIA 1TNXA 1AP4A 3EVRA 2HQ8A 3OBVA 4MVFA 2WC8A 4MZJA 1KSMA 3CZTX 2CBLA 1Y1XA 1AJ5A 1SCMB 3EKJA 4GFTA 1A03A 2OS8C 4HREE 3OB2B 5AXIA 2GV5A 1LA3A 2K2FA 3LK0A 1S5GZ 1S3PA 3QRXA 1AHRA 4JKTA 3NSKA 1CFPA 1GJYA 2K61A 4XJKB 1N0YA 4MZKA 5ER4X 1TNPA 2A4JA 2M0RA 2WCBA 5KTYA 1YURA 3BUNB 2L5YA 3K21A 2COLB 2KGRA 5AERA 2B1UA 2JPTA 4AOMA 2K2AA 2WNDA 1QLSA 3UO9A 2JOJA 3L4AA 1LS8A 2L2CA 5I94A 1K95A 1MHOA 1ORGA 1A4PA 1B7TZ 5HKYA 2CNPA 2MRDA 1IG5A 3DXLA 3R1PA 1F70A 1R2UA 2F8PA 1H8BA 1BG1A 1QTXA 2O60A 1SYMA 3BYAA 1QVIZ 3S0DA 3VRNA 1Y1UA 1DJIA 1QV1A 1DEKA 2I18A 2JULA 3TS5C 1IH0A 1DELA 4QJ4B 1CMGA 2M1KB 4CFRA 1IJ6A 3CDNA 1M63B 1SY9A 1EJ3A 1W7JB 1S6JA 3EVUA 3SG7A 1KQMC 1KK8C 3CGAA 4F0ZB 3IVTA 2ERBA 4D1EA 1SCMC 1F55A 3CTNA 1RROA 1JFJA 2L50A 1EXRA 1QXPA 2MHHA 4UPGA 2KQ6A 1KSOA 2JPOA 5AEQA 1DF0B 2SCPA 1CDNA 3N7HA 2NCPA 3S0AA 1PVBA 2JNFA 1DJHA 2BCAA 3NHIA 3QMEA 4JQ0D 3JTDC 1XFZO 1G33A 1QASA 1SRAA 4N5XA 4YGDB 2K7DA 3PN7C 5HYDA 4ETOA 1F4QA 1CTRA 1YUSA 2ZRTA 2Y5IA 1TTXA 1UHNA 1B7TY 2K0JA 3CWGA 3TDUA 1AK8A 3NGVA 1IIOA 2JXCA 1DT7B 2BE6A 1LINA 2LCPA 1A75A 2V53A 5GQQC 1Y0VH 4MLWA 1ZUZA 2JU0A 4OV2A 1S6IA 1BR4B 1OE9B 1P28A 2P71A 1NPQA 1LVCD 2WCMA 1QVIY 1SSEB 2EC6C 1NX2A 1CKKA 4NQGA 1YVHA 2PRUA 1DVIA 1WDCC 2F2OA 4BY5A 1SL7A 2PQLA 3OX5A 4WQ2A 2L5XB 2WORA 1OZOA 1CFCA 1XK4A 1PSRA 2I2RE 5CSNA 1KQVA 1CFDA 2MLEC 3FE6A 3NSIA 3O4YA 3D0YA 1WRLA 2M3WA 1WRKA 4I5LB 5G08A 1YVLA 2LVKA 5J3XA 3B87A 2L2EA 1FBVA 2NZ0A 1DMOA 2CTNA 2VRGA 1J1EA 3NHTA 3SG2A 3CZ0A 2PSRA 2OS8B 1GGZA 1N2DA 2Q4UA 3VROA 1NWDA 1K96A 4NDCA 4WQ3A 1BOCA 3I5GB 1E8AA 2JNXA 2L98A 5ER5A 1AJ4A 1C3ZA 2AUCA 4YGAA 1RTP1 4FTGA 1G8IA 1S26D 1J7OA 2KFHA 1DGUA 4OZDA 4MN0A 5DKRA 5FI2A 1S36A 1QIVA 5KU1A 3BJHA 2KAYA 1L7ZA 2WCJA 4PHJA 4ORBB 1R6PA 4CFQA 2KHNA 4YGBB 1F4OA 1WRZA 2KI4C 2QEVA 4OCIA 1IRJA 1JUOA 1C07A 1HT9A 2Y1NA 3DVMA 2LC5A 1QX2A 1C7VA 1B9AA 3O6BA 2ZKMX 5PALA 1BR1B 3IF7A 4HRGA 2KGBC 2QEOA 4M2PA 1L2OC 1KK7Z 2G9BA 3CS1A 2ZNEA 4F7FA 4AQIA 5JOLA 1M31A 2F2PA 2M9GA 1FPWA 1W7IB 2BNXA 3BUMB 3OHMB 1C3YA 4GBAA 3TS5B 2LUXA 4C0LA 2LMVA 1OSAA 3D73A 5DKNA 2CCMA 4INXA 4PDZA 1A75B 1NP8A 1M39A 4I5KA 1YUUA 3KEVA 1CFFA 1KQMB 1KK8B 3SG4A 1XFVO 4L9MA 1SKTA 5JJGA 3SIBA 1DJXA 3S0EA 3O78A 3I5GC 4ORAB 1UWOA 2LE9B 1K94A 1DJWA 1PULA 2JQ6A 4MRYA 5HKWA 3CYZA 4ICBA 3OB1B 1GQMA 2WCFA 3D0YB 3L4LA 4N1GA 1IWQA 1CM1A 2BCBA 3JTDB 1IQ3A 2JTZA 1DJZA 2KOTA 1ALVA 1CLLA 2H8VA 1J1DA 3PN7B 2KQYA 2QACA 1K93D 1V1GA 2LMTA 3FIAA 2JWWA 5AANA 1NX0A 2K7CA 1CDMA 4HRHA 1EH2A 1SBJA 1SW8A 1B8LA 3DVEA 4FQTA 2MBXA 1BLQA 1KFXL 3A8RA 3PM8A 2LLSA 3D78A 2BBMA 1KK7Y 5EL2A 4ZCVA 1NX3A 2BBNA 2KI6C 2KFGA 1UP5A 4N1FA 2EC6B 1JBAA 2RGIA 4PT1A 1WDCB 2I7AA 2H61C 1S6CA 1MXEA 2YGUA 3PSRA 3DVJA 1CNPA 3PM2A 5CSFA 2KI6D 2HPSA 2I94A 1TUZA 1MQ1A 3H4SE 2QEHA 4FQOA 1QIWA 1KWOC 2KAVA 5D3OA 4C0JA 4QJ5B 3CR4X 1TRFA 2ZN8A 1TN4A 3DY9A 3EK7A 3R1VA 3BOWA 1C7WA 3KO0A 4PE7A 2LNKA 1MF8B 1PSBA 3FS7A 1SCVA 1WLZA 1DJYA 1MXLC 1ZFSA 3DZTA 1XK4C 4JWQA 2IS9A 1EG3A 2OTGB 2WCEA 4YGEB 4M2QA 3ZNIA 1RJVA 3OP0A 1SL8A 2H61A 4YRUA 1ZOTB 3D76A 3B88A 1RK9A 3FE8A 1OOGA 1J7RA 3Q8IA 1YTZC 2KI4B 2JZIA 2LP2A 3A4UB 2LV7A 2KDHA 2M29A 2KLDA 5TNCA 2QDIA 1OOFA 3K1EA 2FJYA 4NDBA 2M7NA 1K9KA 1EG4A 1TIZA 4P5OE 5D69A 5D7FA 3EKHA 2M8UA 1HQVA 3M0WA 1L2OB 1UUSA 2NLNA 4PHKA 1K2HA 1CDPA 3EG5B 1YX8A 3ICBA 4PCWA 2KLEA 1B1GA 1KCYA 2MA2A 2KFFA 1NCYA 3VRQA 1J55A 3CABA 4PE0A 2FJUB 3CLNA 4PHNA 1EL4A 2BKIB 1UHJA 4DIRA 3IQOA 3OX6A 1V1FA 4YI8A 1YUTA 3V2LA 2KBMA 2PYQA 3KPXA 1KFUL 3R1OA 1IKUA 3LL8B 1YRTB 3DD4A 3VGOA 3DYEA 1U5IA 3EVVA 4YBHB 1BODA 3E3RA 2BCXA 3NSLA 2JXLA 1CDLA 4E68A 2OTGC 3PJIA 3I5HB 2WOSA 4ORCB 1CMFA 3BQ3A 1NX1A 1A2XA 3TDZA 4DRWA 1OQPA 1H4BA 1UHKA 1G4YR 3HCMA 2HQWA 3BFHA 3AKAA 4P2YB 2FCDA 2WC6A 1JF0A 4OKHA 2O5GA 3BOWB 1OMVA 1WLMA 2LHLA 2F3ZA 1LKJA 1ODBA 1K90D 5IBWA 3SS5A 2L4HA 1BF5A 2JC2A 1RFJA 2KAXA 2M97A 1NYAA 3I5FC 2LP3A 2BAPA 1DQEA 1DJGA 1SNLA 4IJ7A 1QX5B 4JPZB 4PALA 1XFYO 2NCOA 1BJFA 2LLUA 4KYNA 1TUJA 3RLZA 4DS7A 3SS3A 2LVIA 1RWYA 2ZN9A 1B4CA 2BL0B 1OMDA 2K60A 3DVKA 3KF9A 2WC5A 1F71A 1KWOB 3LLEA 2AMIA 4GPLB 1DTLA 1SPYA 5I8NA 2BE4A 2FOTA 1XO5A 4GGFC 1XA5A 1PK0D 3WNXB 2WCLA 1XFRA 4R1EA 3VRPA 1QWVA 3FWCA 3TUYB 1NSHA 4MZLA 4Q04A 3SG3A 1K9PA 5FI7A 4CPVA 4U8DA 1MWNA 2JT0A 1IGVA 1OZSA 2KNEA 2BKHB 5AFPA 1IJ5A 1SK6D 1B8RA 3ZWHA 3I5HC 5HKZA 3D10A 1JC2A 4MBEA 3AKBA 4ZCUA 1ZACA 1S1EA 3L47A 3VRRA 5CSIA 3DF0A 1QJTA 2HETA 3O4XA 2MLFC 3GK2A 1PRWA 1BMOA 2GGMA 2LHIA 1TOPA 3GK1A 2GGZA 1OW4A 1X02A 3NXAA 1U5IB 2CT9A 4A4CA 3S0GA 4M2OA 4HSZA 4USLA 3PATA 1TWOA 4GGFA 4I5NB 3R72A 2P70A 3WXAA 4BY4A 3CR5X 1A29A 2F33A 2P6BB 1F8HA 3I5IC 5BPJA 5K89A 1SMGA 3FE9A 2OPOA 2BL0C 3CZ1A 1FI5A 1VRKA 5CPVA 2ZNDA 3B86A 1AVSA 4DUQA 2Q91A 2ZRSA 1TCFA 1FW4A 1XYDA 3BUXB 1K9UA 3MSEB 4PHMA 3WHUB 3CZ2A 3JVTB 1JWDA 1YR5A 2K8MB 2TN4A 1SR6B 1B47A 4PE4A 1D1OA 3TZ1A 3RZSA 3TUYC 3UNWA 1XVJA 5DKQA 4GAOA 2EGDA 3D77A 2LVVA 1JFKA 1OOHA 3SS4A 1QS7A 1W9ZA 3SJSA 3S0BA 1OOIX 4OR9B 1PALA 4C0KA 1QATA 5FI6A 3RM1A 1LXFC 2DOQA 2L4IA 3SG5A 3AAKA 5CSJA 1LA0A 1K8UA 2JT3A 5HL1A 1GM0A 3HX4A 2BECA 4NDDA 3WHTB 2PVBA 1YRUB 2LANA 4XYNA 1M46A 2E6WA 2WCHA 5I2OA 1CLBA 5KSZA 1BT6A 1CB1A 1UHHA 2KBIA 3GK4X 2AAOA 1S5GY 3C1VA 3SIAA 4WRIA 2M1UA 2H2KA 3AAJA 3F45A 3FWBA 3I5FB 4CLNA 1NCXA 5B8IB 2L0PA 2LM5A 4QJ3B 4GNKB 2R2IA 1KFXS 1CM4A 1OMRA 2Y1MA 1FF1A 2QEBA 1MUXA 2K7BA 4OVNF 3DF0B 3LCPC 1ALWA 2JT8A 1TNQA 4JD9A 2LLTA 3BUOB 4YI9A 1ZMZA 1N65A 3SG6A 2QPTA 1AUIB 5I2LA 4PE1A 2SASA 5I2QA 2PASA 2MAZA 3O2PA 2PALA 2ISDA 1UURA 2KPHA 2MJWB 3JVTC 3LK1A 5HLOA 1NUBA 2KSPA 2GTEA 1SR6C 1XFWO 1RECA 1M45A 3B6XA 2CXJA 2M49B 1OOJA 2LMUA 3VB1A 3KHEA 2ZFDA 3IQQA 1XFXO 2M7LA 2WCKA 2E30A 1T14A 3GOFA 1TCOB 4XJKA 1B8CA 1Y1AA 4A4BA 3D75A 2KYFA 3B7AA 4DCKA 1MR8A 5DICA 1SL9A 3BUWB 3BFAA 2JRFA 4IL1A
chains in the Genus database with same CATH topology
2K7OA 1CLMA 1Y6WA 1J7QA 1YX7A 2EHBA 1NCZA 2G2BA 1QX7A 3I5IB 3NSOA 5HLVA 3PALA 4MSPA 5FYXA 4GUKA 1J7PA 2HF5A 1GGWA 4MEWA 1WY9A 1PVAA 2L51A 1JSAA 3EK4A 2PMYA 1XFUO 4YGCB 1IQ5A 4MRXA 2LVJA 2FCEA 2JTTA 2F3YA 1BU3A 2LUCA 3PLFB 1JF2A 3EK8A 1FI6A 4GGNA 4AQJA 4CIDA 1DGVA 1UHIA 1QV0A 1QLKA 4TNCA 3PFVA 1NIWA 1Q80A 1TNWA 2LAPA 2Y4QA 1KFUS 3BXKA 1F54A 1DF0A 3CR2A 2KYCA 2NXQA 4I5JA 5F6TA 2D8NA 3TDIA 1AP4A 1TNXA 3EVRA 2HQ8A 4MVFA 2WC8A 4MZJA 1KSMA 3CZTX 2CBLA 1Y1XA 1AJ5A 1SCMB 3EKJA 4GFTA 1A03A 2OS8C 4HREE 3OB2B 5AXIA 2GV5A 1LA3A 2K2FA 3LK0A 1S5GZ 1S3PA 3QRXA 1AHRA 1CFPA 3NSKA 1GJYA 2K61A 4XJKB 1N0YA 4MZKA 5ER4X 1TNPA 2A4JA 2M0RA 2WCBA 5KTYA 1YURA 3BUNB 3K21A 2COLB 2KGRA 5AERA 2B1UA 2JPTA 4AOMA 2K2AA 2WNDA 1QLSA 2JOJA 1K95A 1MHOA 1A4PA 1B7TZ 5HKYA 2CNPA 2MRDA 1IG5A 1F70A 1R2UA 2F8PA 1H8BA 1BG1A 1QTXA 2O60A 1SYMA 3BYAA 1QVIZ 3VRNA 1Y1UA 1DJIA 1QV1A 2I18A 2JULA 3TS5C 1IH0A 4QJ4B 1CMGA 2M1KB 4CFRA 1IJ6A 1M63B 1SY9A 1EJ3A 1S6JA 1W7JB 3EVUA 3SG7A 1KQMC 1KK8C 3CGAA 4F0ZB 4D1EA 1F55A 1SCMC 3CTNA 1RROA 1JFJA 2L50A 1EXRA 1QXPA 2MHHA 4UPGA 2KQ6A 1KSOA 5AEQA 1CDNA 1DF0B 2SCPA 2NCPA 1PVBA 2JNFA 1DJHA 2BCAA 4JQ0D 3JTDC 1XFZO 1G33A 1QASA 1SRAA 4N5XA 4YGDB 2K7DA 3PN7C 5HYDA 4ETOA 1F4QA 1CTRA 1YUSA 2ZRTA 2Y5IA 1TTXA 1UHNA 1B7TY 2K0JA 3CWGA 3TDUA 1AK8A 2JXCA 1DT7B 2BE6A 1LINA 2LCPA 1A75A 2V53A 5GQQC 1Y0VH 4MLWA 1ZUZA 2JU0A 4OV2A 1S6IA 1BR4B 1OE9B 1NPQA 1LVCD 1CKKA 1QVIY 2EC6C 1NX2A 4NQGA 1YVHA 2PRUA 1DVIA 1WDCC 2F2OA 4BY5A 1SL7A 3OX5A 4WQ2A 2L5XB 2WORA 1OZOA 1CFCA 1XK4A 1PSRA 2I2RE 5CSNA 1KQVA 1CFDA 2MLEC 3NSIA 3O4YA 3D0YA 1WRLA 2M3WA 1WRKA 4I5LB 5G08A 1YVLA 2LVKA 5J3XA 2L2EA 1FBVA 2NZ0A 1DMOA 2CTNA 2VRGA 1J1EA 3SG2A 2PSRA 2OS8B 1GGZA 1N2DA 2Q4UA 3VROA 1NWDA 1K96A 4NDCA 4WQ3A 1BOCA 3I5GB 1E8AA 2JNXA 2L98A 5ER5A 1AJ4A 2AUCA 4YGAA 1RTP1 4FTGA 1G8IA 1S26D 1J7OA 2KFHA 1DGUA 4MN0A 5DKRA 1S36A 1QIVA 5KU1A 2KAYA 1L7ZA 4PHJA 4ORBB 1R6PA 4CFQA 2KHNA 4YGBB 1F4OA 1WRZA 2KI4C 4OCIA 1IRJA 1JUOA 1C07A 1HT9A 2Y1NA 3DVMA 2LC5A 1QX2A 1C7VA 1B9AA 3O6BA 2ZKMX 5PALA 1BR1B 3IF7A 4HRGA 2KGBC 4M2PA 1L2OC 1KK7Z 2G9BA 3CS1A 2ZNEA 4AQIA 5JOLA 1M31A 2F2PA 2M9GA 1FPWA 1W7IB 3BUMB 3OHMB 4GBAA 3TS5B 2LUXA 4C0LA 2LMVA 1OSAA 5DKNA 2CCMA 4PDZA 1A75B 1NP8A 1M39A 4I5KA 1YUUA 3KEVA 1CFFA 1KQMB 1KK8B 3SG4A 1XFVO 4L9MA 1SKTA 5JJGA 3SIBA 1DJXA 3O78A 3I5GC 4ORAB 1UWOA 2LE9B 1K94A 1DJWA 1PULA 2JQ6A 4MRYA 5HKWA 4ICBA 3OB1B 1GQMA 2WCFA 3D0YB 4N1GA 1IWQA 1CM1A 2BCBA 3JTDB 1IQ3A 2JTZA 1DJZA 2KOTA 1ALVA 1CLLA 1J1DA 3PN7B 2KQYA 2QACA 1K93D 1V1GA 2LMTA 3FIAA 2JWWA 5AANA 1NX0A 2K7CA 1CDMA 4HRHA 1EH2A 1SBJA 1SW8A 1B8LA 3DVEA 2MBXA 1BLQA 1KFXL 3A8RA 3PM8A 2LLSA 2BBMA 1KK7Y 4ZCVA 1NX3A 2BBNA 2KI6C 2KFGA 1UP5A 4N1FA 2EC6B 1JBAA 2RGIA 1WDCB 2I7AA 2H61C 1S6CA 1MXEA 3PSRA 3DVJA 1CNPA 5CSFA 2KI6D 2HPSA 2I94A 3H4SE 1MQ1A 4FQOA 1QIWA 1KWOC 2KAVA 4C0JA 4QJ5B 3CR4X 1TRFA 2ZN8A 1TN4A 3EK7A 3BOWA 1C7WA 3KO0A 4PE7A 2LNKA 1MF8B 1PSBA 3FS7A 1SCVA 1WLZA 1DJYA 1MXLC 1ZFSA 1XK4C 4JWQA 2IS9A 1EG3A 2OTGB 2WCEA 4YGEB 4M2QA 3ZNIA 1RJVA 3OP0A 1SL8A 2H61A 4YRUA 1ZOTB 1RK9A 1J7RA 1YTZC 2KI4B 2JZIA 2LP2A 3A4UB 2LV7A 2KDHA 2M29A 5TNCA 4NDBA 2M7NA 1K9KA 1EG4A 1TIZA 4P5OE 5D69A 5D7FA 3EKHA 2M8UA 1HQVA 3M0WA 1L2OB 1UUSA 2NLNA 4PHKA 1K2HA 1CDPA 1YX8A 3ICBA 4PCWA 1B1GA 1KCYA 2MA2A 2KFFA 1NCYA 3VRQA 1J55A 4PE0A 2FJUB 3CLNA 4PHNA 1EL4A 2BKIB 1UHJA 4DIRA 3IQOA 3OX6A 1V1FA 4YI8A 1YUTA 2KBMA 3KPXA 1KFUL 1IKUA 3LL8B 1YRTB 3DD4A 3VGOA 1U5IA 3EVVA 4YBHB 1BODA 3E3RA 2BCXA 3NSLA 2JXLA 1CDLA 4E68A 2OTGC 3I5HB 2WOSA 4ORCB 1CMFA 3BQ3A 1NX1A 1A2XA 3TDZA 4DRWA 1OQPA 1H4BA 1UHKA 1G4YR 3HCMA 2HQWA 3AKAA 4P2YB 2FCDA 1JF0A 4OKHA 2O5GA 3BOWB 1OMVA 1WLMA 2LHLA 2F3ZA 1LKJA 1ODBA 1K90D 5IBWA 2L4HA 1BF5A 2JC2A 1RFJA 2KAXA 2M97A 1NYAA 3I5FC 2LP3A 1DJGA 1SNLA 4JPZB 1QX5B 4PALA 1XFYO 2NCOA 1BJFA 2LLUA 3RLZA 4DS7A 2LVIA 1RWYA 2ZN9A 1B4CA 2BL0B 1OMDA 3DVKA 3KF9A 1F71A 1KWOB 3LLEA 2AMIA 4GPLB 1DTLA 1SPYA 5I8NA 2BE4A 2FOTA 1XO5A 4GGFC 1XA5A 1PK0D 3WNXB 4R1EA 3VRPA 3TUYB 3FWCA 1NSHA 4MZLA 4Q04A 3SG3A 1K9PA 4CPVA 4U8DA 1MWNA 2JT0A 1IGVA 1OZSA 2KNEA 2BKHB 5AFPA 1IJ5A 1SK6D 1B8RA 3ZWHA 3I5HC 5HKZA 3D10A 1JC2A 4MBEA 3AKBA 4ZCUA 1ZACA 1S1EA 3VRRA 5CSIA 3DF0A 1QJTA 2HETA 2MLFC 3GK2A 1PRWA 1BMOA 2GGMA 2LHIA 1TOPA 3GK1A 2GGZA 1X02A 3NXAA 1U5IB 2CT9A 4A4CA 4M2OA 4HSZA 4USLA 3PATA 4GGFA 4I5NB 3WXAA 4BY4A 3CR5X 1A29A 2F33A 2P6BB 1F8HA 3I5IC 5BPJA 5K89A 1SMGA 2OPOA 2BL0C 1FI5A 1VRKA 5CPVA 2ZNDA 1AVSA 4DUQA 2Q91A 2ZRSA 1TCFA 1FW4A 1XYDA 3BUXB 1K9UA 3MSEB 4PHMA 3WHUB 3JVTB 1JWDA 1YR5A 2K8MB 2TN4A 1SR6B 1B47A 4PE4A 1D1OA 3TZ1A 3TUYC 1XVJA 5DKQA 4GAOA 2EGDA 2LVVA 1JFKA 1QS7A 3SJSA 4OR9B 1PALA 4C0KA 1QATA 3RM1A 1LXFC 2DOQA 2L4IA 3SG5A 3AAKA 5CSJA 1LA0A 1K8UA 2JT3A 3HX4A 2BECA 4NDDA 3WHTB 2PVBA 1YRUB 2LANA 4XYNA 1M46A 2E6WA 5I2OA 1CLBA 5KSZA 1BT6A 1CB1A 1UHHA 2KBIA 3GK4X 2AAOA 1S5GY 3C1VA 3SIAA 4WRIA 2M1UA 2H2KA 3AAJA 3F45A 3FWBA 3I5FB 4CLNA 1NCXA 5B8IB 2L0PA 2LM5A 4QJ3B 4GNKB 2R2IA 1KFXS 1CM4A 1OMRA 2Y1MA 1FF1A 1MUXA 2K7BA 4OVNF 3DF0B 3LCPC 1ALWA 2JT8A 1TNQA 2LLTA 3BUOB 4YI9A 1ZMZA 1N65A 3SG6A 2QPTA 1AUIB 5I2LA 4PE1A 2SASA 5I2QA 2PASA 2MAZA 3O2PA 2PALA 2ISDA 1UURA 2MJWB 3JVTC 3LK1A 5HLOA 1NUBA 2KSPA 1SR6C 1XFWO 1RECA 1M45A 2CXJA 2M49B 1OOJA 2LMUA 3KHEA 2ZFDA 3IQQA 1XFXO 2M7LA 2E30A 3GOFA 1TCOB 4XJKA 1B8CA 1Y1AA 4A4BA 2KYFA 4DCKA 1MR8A 1SL9A 3BUWB 2JRFA 4IL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7O A;  1CLM A;  1Y6W A;  1J7Q A;  1YX7 A;  2EHB A;  1NCZ A;  2G2B A;  1QX7 A;  3I5I B;  3NSO A;  5HLV A;  3PAL A;  4MSP A;  5FYX A;  4GUK A;  1J7P A;  2HF5 A;  1GGW A;  4MEW A;  1WY9 A;  1PVA A;  2L51 A;  1JSA A;  3EK4 A;  2PMY A;  1XFU O;  4YGC B;  1IQ5 A;  4MRX A;  2LVJ A;  2FCE A;  2JTT A;  2F3Y A;  1BU3 A;  2LUC A;  3PLF B;  1JF2 A;  3EK8 A;  1FI6 A;  4GGN A;  4AQJ A;  4CID A;  1DGV A;  1UHI A;  1QV0 A;  1QLK A;  4TNC A;  3PFV A;  1NIW A;  1Q80 A;  1TNW A;  2LAP A;  2Y4Q A;  1KFU S;  3BXK A;  1F54 A;  1DF0 A;  3CR2 A;  2KYC A;  2NXQ A;  4I5J A;  5F6T A;  2D8N A;  3TDI A;  1AP4 A;  1TNX A;  3EVR A;  2HQ8 A;  4MVF A;  2WC8 A;  4MZJ A;  1KSM A;  3CZT X;  2CBL A;  1Y1X A;  1AJ5 A;  1SCM B;  3EKJ A;  4GFT A;  1A03 A;  2OS8 C;  4HRE E;  3OB2 B;  5AXI A;  2GV5 A;  1LA3 A;  2K2F A;  3LK0 A;  1S5G Z;  1S3P A;  3QRX A;  1AHR A;  1CFP A;  3NSK A;  1GJY A;  2K61 A;  4XJK B;  1N0Y A;  4MZK A;  5ER4 X;  1TNP A;  2A4J A;  2M0R A;  2WCB A;  5KTY A;  1YUR A;  3BUN B;  3K21 A;  2COL B;  2KGR A;  5AER A;  2B1U A;  2JPT A;  4AOM A;  2K2A A;  2WND A;  1QLS A;  2JOJ A;  1K95 A;  1MHO A;  1A4P A;  1B7T Z;  5HKY A;  2CNP A;  2MRD A;  1IG5 A;  1F70 A;  1R2U A;  2F8P A;  1H8B A;  1BG1 A;  1QTX A;  2O60 A;  1SYM A;  3BYA A;  1QVI Z;  3VRN A;  1Y1U A;  1DJI A;  1QV1 A;  2I18 A;  2JUL A;  3TS5 C;  1IH0 A;  4QJ4 B;  1CMG A;  2M1K B;  4CFR A;  1IJ6 A;  1M63 B;  1SY9 A;  1EJ3 A;  1S6J A;  1W7J B;  3EVU A;  3SG7 A;  1KQM C;  1KK8 C;  3CGA A;  4F0Z B;  4D1E A;  1F55 A;  1SCM C;  3CTN A;  1RRO A;  1JFJ A;  2L50 A;  1EXR A;  1QXP A;  2MHH A;  4UPG A;  2KQ6 A;  1KSO A;  5AEQ A;  1CDN A;  1DF0 B;  2SCP A;  2NCP A;  1PVB A;  2JNF A;  1DJH A;  2BCA A;  4JQ0 D;  3JTD C;  1XFZ O;  1G33 A;  1QAS A;  1SRA A;  4N5X A;  4YGD B;  2K7D A;  3PN7 C;  5HYD A;  4ETO A;  1F4Q A;  1CTR A;  1YUS A;  2ZRT A;  2Y5I A;  1TTX A;  1UHN A;  1B7T Y;  2K0J A;  3CWG A;  3TDU A;  1AK8 A;  2JXC A;  1DT7 B;  2BE6 A;  1LIN A;  2LCP A;  1A75 A;  2V53 A;  5GQQ C;  1Y0V H;  4MLW A;  1ZUZ A;  2JU0 A;  4OV2 A;  1S6I A;  1BR4 B;  1OE9 B;  1NPQ A;  1LVC D;  1CKK A;  1QVI Y;  2EC6 C;  1NX2 A;  4NQG A;  1YVH A;  2PRU A;  1DVI A;  1WDC C;  2F2O A;  4BY5 A;  1SL7 A;  3OX5 A;  4WQ2 A;  2L5X B;  2WOR A;  1OZO A;  1CFC A;  1XK4 A;  1PSR A;  2I2R E;  5CSN A;  1KQV A;  1CFD A;  2MLE C;  3NSI A;  3O4Y A;  3D0Y A;  1WRL A;  2M3W A;  1WRK A;  4I5L B;  5G08 A;  1YVL A;  2LVK A;  5J3X A;  2L2E A;  1FBV A;  2NZ0 A;  1DMO A;  2CTN A;  2VRG A;  1J1E A;  3SG2 A;  2PSR A;  2OS8 B;  1GGZ A;  1N2D A;  2Q4U A;  3VRO A;  1NWD A;  1K96 A;  4NDC A;  4WQ3 A;  1BOC A;  3I5G B;  1E8A A;  2JNX A;  2L98 A;  5ER5 A;  1AJ4 A;  2AUC A;  4YGA A;  1RTP 1;  4FTG A;  1G8I A;  1S26 D;  1J7O A;  2KFH A;  1DGU A;  4MN0 A;  5DKR A;  1S36 A;  1QIV A;  5KU1 A;  2KAY A;  1L7Z A;  4PHJ A;  4ORB B;  1R6P A;  4CFQ A;  2KHN A;  4YGB B;  1F4O A;  1WRZ A;  2KI4 C;  4OCI A;  1IRJ A;  1JUO A;  1C07 A;  1HT9 A;  2Y1N A;  3DVM A;  2LC5 A;  1QX2 A;  1C7V A;  1B9A A;  3O6B A;  2ZKM X;  5PAL A;  1BR1 B;  3IF7 A;  4HRG A;  2KGB C;  4M2P A;  1L2O C;  1KK7 Z;  2G9B A;  3CS1 A;  2ZNE A;  4AQI A;  5JOL A;  1M31 A;  2F2P A;  2M9G A;  1FPW A;  1W7I B;  3BUM B;  3OHM B;  4GBA A;  3TS5 B;  2LUX A;  4C0L A;  2LMV A;  1OSA A;  5DKN A;  2CCM A;  4PDZ A;  1A75 B;  1NP8 A;  1M39 A;  4I5K A;  1YUU A;  3KEV A;  1CFF A;  1KQM B;  1KK8 B;  3SG4 A;  1XFV O;  4L9M A;  1SKT A;  5JJG A;  3SIB A;  1DJX A;  3O78 A;  3I5G C;  4ORA B;  1UWO A;  2LE9 B;  1K94 A;  1DJW A;  1PUL A;  2JQ6 A;  4MRY A;  5HKW A;  4ICB A;  3OB1 B;  1GQM A;  2WCF A;  3D0Y B;  4N1G A;  1IWQ A;  1CM1 A;  2BCB A;  3JTD B;  1IQ3 A;  2JTZ A;  1DJZ A;  2KOT A;  1ALV A;  1CLL A;  1J1D A;  3PN7 B;  2KQY A;  2QAC A;  1K93 D;  1V1G A;  2LMT A;  3FIA A;  2JWW A;  5AAN A;  1NX0 A;  2K7C A;  1CDM A;  4HRH A;  1EH2 A;  1SBJ A;  1SW8 A;  1B8L A;  3DVE A;  2MBX A;  1BLQ A;  1KFX L;  3A8R A;  3PM8 A;  2LLS A;  2BBM A;  1KK7 Y;  4ZCV A;  1NX3 A;  2BBN A;  2KI6 C;  2KFG A;  1UP5 A;  4N1F A;  2EC6 B;  1JBA A;  2RGI A;  1WDC B;  2I7A A;  2H61 C;  1S6C A;  1MXE A;  3PSR A;  3DVJ A;  1CNP A;  5CSF A;  2KI6 D;  2HPS A;  2I94 A;  3H4S E;  1MQ1 A;  4FQO A;  1QIW A;  1KWO C;  2KAV A;  4C0J A;  4QJ5 B;  3CR4 X;  1TRF A;  2ZN8 A;  1TN4 A;  3EK7 A;  3BOW A;  1C7W A;  3KO0 A;  4PE7 A;  2LNK A;  1MF8 B;  1PSB A;  3FS7 A;  1SCV A;  1WLZ A;  1DJY A;  1MXL C;  1ZFS A;  1XK4 C;  4JWQ A;  2IS9 A;  1EG3 A;  2OTG B;  2WCE A;  4YGE B;  4M2Q A;  3ZNI A;  1RJV A;  3OP0 A;  1SL8 A;  2H61 A;  4YRU A;  1ZOT B;  1RK9 A;  1J7R A;  1YTZ C;  2KI4 B;  2JZI A;  2LP2 A;  3A4U B;  2LV7 A;  2KDH A;  2M29 A;  5TNC A;  4NDB A;  2M7N A;  1K9K A;  1EG4 A;  1TIZ A;  4P5O E;  5D69 A;  5D7F A;  3EKH A;  2M8U A;  1HQV A;  3M0W A;  1L2O B;  1UUS A;  2NLN A;  4PHK A;  1K2H A;  1CDP A;  1YX8 A;  3ICB A;  4PCW A;  1B1G A;  1KCY A;  2MA2 A;  2KFF A;  1NCY A;  3VRQ A;  1J55 A;  4PE0 A;  2FJU B;  3CLN A;  4PHN A;  1EL4 A;  2BKI B;  1UHJ A;  4DIR A;  3IQO A;  3OX6 A;  1V1F A;  4YI8 A;  1YUT A;  2KBM A;  3KPX A;  1KFU L;  1IKU A;  3LL8 B;  1YRT B;  3DD4 A;  3VGO A;  1U5I A;  3EVV A;  4YBH B;  1BOD A;  3E3R A;  2BCX A;  3NSL A;  2JXL A;  1CDL A;  4E68 A;  2OTG C;  3I5H B;  2WOS A;  4ORC B;  1CMF A;  3BQ3 A;  1NX1 A;  1A2X A;  3TDZ A;  4DRW A;  1OQP A;  1H4B A;  1UHK A;  1G4Y R;  3HCM A;  2HQW A;  3AKA A;  4P2Y B;  2FCD A;  1JF0 A;  4OKH A;  2O5G A;  3BOW B;  1OMV A;  1WLM A;  2LHL A;  2F3Z A;  1LKJ A;  1ODB A;  1K90 D;  5IBW A;  2L4H A;  1BF5 A;  2JC2 A;  1RFJ A;  2KAX A;  2M97 A;  1NYA A;  3I5F C;  2LP3 A;  1DJG A;  1SNL A;  4JPZ B;  1QX5 B;  4PAL A;  1XFY O;  2NCO A;  1BJF A;  2LLU A;  3RLZ A;  4DS7 A;  2LVI A;  1RWY A;  2ZN9 A;  1B4C A;  2BL0 B;  1OMD A;  3DVK A;  3KF9 A;  1F71 A;  1KWO B;  3LLE A;  2AMI A;  4GPL B;  1DTL A;  1SPY A;  5I8N A;  2BE4 A;  2FOT A;  1XO5 A;  4GGF C;  1XA5 A;  1PK0 D;  3WNX B;  4R1E A;  3VRP A;  3TUY B;  3FWC A;  1NSH A;  4MZL A;  4Q04 A;  3SG3 A;  1K9P A;  4CPV A;  4U8D A;  1MWN A;  2JT0 A;  1IGV A;  1OZS A;  2KNE A;  2BKH B;  5AFP A;  1IJ5 A;  1SK6 D;  1B8R A;  3ZWH A;  3I5H C;  5HKZ A;  3D10 A;  1JC2 A;  4MBE A;  3AKB A;  4ZCU A;  1ZAC A;  1S1E A;  3VRR A;  5CSI A;  3DF0 A;  1QJT A;  2HET A;  2MLF C;  3GK2 A;  1PRW A;  1BMO A;  2GGM A;  2LHI A;  1TOP A;  3GK1 A;  2GGZ A;  1X02 A;  3NXA A;  1U5I B;  2CT9 A;  4A4C A;  4M2O A;  4HSZ A;  4USL A;  3PAT A;  4GGF A;  4I5N B;  3WXA A;  4BY4 A;  3CR5 X;  1A29 A;  2F33 A;  2P6B B;  1F8H A;  3I5I C;  5BPJ A;  5K89 A;  1SMG A;  2OPO A;  2BL0 C;  1FI5 A;  1VRK A;  5CPV A;  2ZND A;  1AVS A;  4DUQ A;  2Q91 A;  2ZRS A;  1TCF A;  1FW4 A;  1XYD A;  3BUX B;  1K9U A;  3MSE B;  4PHM A;  3WHU B;  3JVT B;  1JWD A;  1YR5 A;  2K8M B;  2TN4 A;  1SR6 B;  1B47 A;  4PE4 A;  1D1O A;  3TZ1 A;  3TUY C;  1XVJ A;  5DKQ A;  4GAO A;  2EGD A;  2LVV A;  1JFK A;  1QS7 A;  3SJS A;  4OR9 B;  1PAL A;  4C0K A;  1QAT A;  3RM1 A;  1LXF C;  2DOQ A;  2L4I A;  3SG5 A;  3AAK A;  5CSJ A;  1LA0 A;  1K8U A;  2JT3 A;  3HX4 A;  2BEC A;  4NDD A;  3WHT B;  2PVB A;  1YRU B;  2LAN A;  4XYN A;  1M46 A;  2E6W A;  5I2O A;  1CLB A;  5KSZ A;  1BT6 A;  1CB1 A;  1UHH A;  2KBI A;  3GK4 X;  2AAO A;  1S5G Y;  3C1V A;  3SIA A;  4WRI A;  2M1U A;  2H2K A;  3AAJ A;  3F45 A;  3FWB A;  3I5F B;  4CLN A;  1NCX A;  5B8I B;  2L0P A;  2LM5 A;  4QJ3 B;  4GNK B;  2R2I A;  1KFX S;  1CM4 A;  1OMR A;  2Y1M A;  1FF1 A;  1MUX A;  2K7B A;  4OVN F;  3DF0 B;  3LCP C;  1ALW A;  2JT8 A;  1TNQ A;  2LLT A;  3BUO B;  4YI9 A;  1ZMZ A;  1N65 A;  3SG6 A;  2QPT A;  1AUI B;  5I2L A;  4PE1 A;  2SAS A;  5I2Q A;  2PAS A;  2MAZ A;  3O2P A;  2PAL A;  2ISD A;  1UUR A;  2MJW B;  3JVT C;  3LK1 A;  5HLO A;  1NUB A;  2KSP A;  1SR6 C;  1XFW O;  1REC A;  1M45 A;  2CXJ A;  2M49 B;  1OOJ A;  2LMU A;  3KHE A;  2ZFD A;  3IQQ A;  1XFX O;  2M7L A;  2E30 A;  3GOF A;  1TCO B;  4XJK A;  1B8C A;  1Y1A A;  4A4B A;  2KYF A;  4DCK A;  1MR8 A;  1SL9 A;  3BUW B;  2JRF A;  4IL1 A; 
#chains in the Genus database with same CATH topology
 2K7O A;  1CLM A;  1Y6W A;  1J7Q A;  1YX7 A;  3D74 A;  2EHB A;  1NCZ A;  3S0F A;  2G2B A;  1QX7 A;  3I5I B;  3NSO A;  5HLV A;  3PAL A;  4MSP A;  5FYX A;  4GUK A;  1J7P A;  2HF5 A;  4INW A;  1GGW A;  4MEW A;  1Z4H A;  1WY9 A;  1PVA A;  2L51 A;  1JSA A;  3EK4 A;  1Z2C B;  1XFU O;  2PMY A;  4YGC B;  1IQ5 A;  4MRX A;  2LVJ A;  2FCE A;  2JTT A;  2F3Y A;  1BU3 A;  2LUC A;  3PLF B;  1DC1 A;  1JF2 A;  3EK8 A;  1FI6 A;  4GGN A;  4AQJ A;  4CID A;  1DGV A;  1UHI A;  1QV0 A;  1QLK A;  4TNC A;  3PFV A;  1NIW A;  1Q80 A;  1TNW A;  2LAP A;  2Y4Q A;  1KFU S;  3BXK A;  3OGN A;  1F54 A;  1DF0 A;  3CR2 A;  2KYC A;  2NXQ A;  4I5J A;  5F6T A;  2D8N A;  3BFB A;  3TDI A;  1TNX A;  1AP4 A;  3EVR A;  2HQ8 A;  3OBV A;  4MVF A;  2WC8 A;  4MZJ A;  1KSM A;  3CZT X;  2CBL A;  1Y1X A;  1AJ5 A;  1SCM B;  3EKJ A;  4GFT A;  1A03 A;  2OS8 C;  4HRE E;  3OB2 B;  5AXI A;  2GV5 A;  1LA3 A;  2K2F A;  3LK0 A;  1S5G Z;  1S3P A;  3QRX A;  1AHR A;  4JKT A;  3NSK A;  1CFP A;  1GJY A;  2K61 A;  4XJK B;  1N0Y A;  4MZK A;  5ER4 X;  1TNP A;  2A4J A;  2M0R A;  2WCB A;  5KTY A;  1YUR A;  3BUN B;  2L5Y A;  3K21 A;  2COL B;  2KGR A;  5AER A;  2B1U A;  2JPT A;  4AOM A;  2K2A A;  2WND A;  1QLS A;  3UO9 A;  2JOJ A;  3L4A A;  1LS8 A;  2L2C A;  5I94 A;  1K95 A;  1MHO A;  1ORG A;  1A4P A;  1B7T Z;  5HKY A;  2CNP A;  2MRD A;  1IG5 A;  3DXL A;  3R1P A;  1F70 A;  1R2U A;  2F8P A;  1H8B A;  1BG1 A;  1QTX A;  2O60 A;  1SYM A;  3BYA A;  1QVI Z;  3S0D A;  3VRN A;  1Y1U A;  1DJI A;  1QV1 A;  1DEK A;  2I18 A;  2JUL A;  3TS5 C;  1IH0 A;  1DEL A;  4QJ4 B;  1CMG A;  2M1K B;  4CFR A;  1IJ6 A;  3CDN A;  1M63 B;  1SY9 A;  1EJ3 A;  1W7J B;  1S6J A;  3EVU A;  3SG7 A;  1KQM C;  1KK8 C;  3CGA A;  4F0Z B;  3IVT A;  2ERB A;  4D1E A;  1SCM C;  1F55 A;  3CTN A;  1RRO A;  1JFJ A;  2L50 A;  1EXR A;  1QXP A;  2MHH A;  4UPG A;  2KQ6 A;  1KSO A;  2JPO A;  5AEQ A;  1DF0 B;  2SCP A;  1CDN A;  3N7H A;  2NCP A;  3S0A A;  1PVB A;  2JNF A;  1DJH A;  2BCA A;  3NHI A;  3QME A;  4JQ0 D;  3JTD C;  1XFZ O;  1G33 A;  1QAS A;  1SRA A;  4N5X A;  4YGD B;  2K7D A;  3PN7 C;  5HYD A;  4ETO A;  1F4Q A;  1CTR A;  1YUS A;  2ZRT A;  2Y5I A;  1TTX A;  1UHN A;  1B7T Y;  2K0J A;  3CWG A;  3TDU A;  1AK8 A;  3NGV A;  1IIO A;  2JXC A;  1DT7 B;  2BE6 A;  1LIN A;  2LCP A;  1A75 A;  2V53 A;  5GQQ C;  1Y0V H;  4MLW A;  1ZUZ A;  2JU0 A;  4OV2 A;  1S6I A;  1BR4 B;  1OE9 B;  1P28 A;  2P71 A;  1NPQ A;  1LVC D;  2WCM A;  1QVI Y;  1SSE B;  2EC6 C;  1NX2 A;  1CKK A;  4NQG A;  1YVH A;  2PRU A;  1DVI A;  1WDC C;  2F2O A;  4BY5 A;  1SL7 A;  2PQL A;  3OX5 A;  4WQ2 A;  2L5X B;  2WOR A;  1OZO A;  1CFC A;  1XK4 A;  1PSR A;  2I2R E;  5CSN A;  1KQV A;  1CFD A;  2MLE C;  3FE6 A;  3NSI A;  3O4Y A;  3D0Y A;  1WRL A;  2M3W A;  1WRK A;  4I5L B;  5G08 A;  1YVL A;  2LVK A;  5J3X A;  3B87 A;  2L2E A;  1FBV A;  2NZ0 A;  1DMO A;  2CTN A;  2VRG A;  1J1E A;  3NHT A;  3SG2 A;  3CZ0 A;  2PSR A;  2OS8 B;  1GGZ A;  1N2D A;  2Q4U A;  3VRO A;  1NWD A;  1K96 A;  4NDC A;  4WQ3 A;  1BOC A;  3I5G B;  1E8A A;  2JNX A;  2L98 A;  5ER5 A;  1AJ4 A;  1C3Z A;  2AUC A;  4YGA A;  1RTP 1;  4FTG A;  1G8I A;  1S26 D;  1J7O A;  2KFH A;  1DGU A;  4OZD A;  4MN0 A;  5DKR A;  5FI2 A;  1S36 A;  1QIV A;  5KU1 A;  3BJH A;  2KAY A;  1L7Z A;  2WCJ A;  4PHJ A;  4ORB B;  1R6P A;  4CFQ A;  2KHN A;  4YGB B;  1F4O A;  1WRZ A;  2KI4 C;  2QEV A;  4OCI A;  1IRJ A;  1JUO A;  1C07 A;  1HT9 A;  2Y1N A;  3DVM A;  2LC5 A;  1QX2 A;  1C7V A;  1B9A A;  3O6B A;  2ZKM X;  5PAL A;  1BR1 B;  3IF7 A;  4HRG A;  2KGB C;  2QEO A;  4M2P A;  1L2O C;  1KK7 Z;  2G9B A;  3CS1 A;  2ZNE A;  4F7F A;  4AQI A;  5JOL A;  1M31 A;  2F2P A;  2M9G A;  1FPW A;  1W7I B;  2BNX A;  3BUM B;  3OHM B;  1C3Y A;  4GBA A;  3TS5 B;  2LUX A;  4C0L A;  2LMV A;  1OSA A;  3D73 A;  5DKN A;  2CCM A;  4INX A;  4PDZ A;  1A75 B;  1NP8 A;  1M39 A;  4I5K A;  1YUU A;  3KEV A;  1CFF A;  1KQM B;  1KK8 B;  3SG4 A;  1XFV O;  4L9M A;  1SKT A;  5JJG A;  3SIB A;  1DJX A;  3S0E A;  3O78 A;  3I5G C;  4ORA B;  1UWO A;  2LE9 B;  1K94 A;  1DJW A;  1PUL A;  2JQ6 A;  4MRY A;  5HKW A;  3CYZ A;  4ICB A;  3OB1 B;  1GQM A;  2WCF A;  3D0Y B;  3L4L A;  4N1G A;  1IWQ A;  1CM1 A;  2BCB A;  3JTD B;  1IQ3 A;  2JTZ A;  1DJZ A;  2KOT A;  1ALV A;  1CLL A;  2H8V A;  1J1D A;  3PN7 B;  2KQY A;  2QAC A;  1K93 D;  1V1G A;  2LMT A;  3FIA A;  2JWW A;  5AAN A;  1NX0 A;  2K7C A;  1CDM A;  4HRH A;  1EH2 A;  1SBJ A;  1SW8 A;  1B8L A;  3DVE A;  4FQT A;  2MBX A;  1BLQ A;  1KFX L;  3A8R A;  3PM8 A;  2LLS A;  3D78 A;  2BBM A;  1KK7 Y;  5EL2 A;  4ZCV A;  1NX3 A;  2BBN A;  2KI6 C;  2KFG A;  1UP5 A;  4N1F A;  2EC6 B;  1JBA A;  2RGI A;  4PT1 A;  1WDC B;  2I7A A;  2H61 C;  1S6C A;  1MXE A;  2YGU A;  3PSR A;  3DVJ A;  1CNP A;  3PM2 A;  5CSF A;  2KI6 D;  2HPS A;  2I94 A;  1TUZ A;  1MQ1 A;  3H4S E;  2QEH A;  4FQO A;  1QIW A;  1KWO C;  2KAV A;  5D3O A;  4C0J A;  4QJ5 B;  3CR4 X;  1TRF A;  2ZN8 A;  1TN4 A;  3DY9 A;  3EK7 A;  3R1V A;  3BOW A;  1C7W A;  3KO0 A;  4PE7 A;  2LNK A;  1MF8 B;  1PSB A;  3FS7 A;  1SCV A;  1WLZ A;  1DJY A;  1MXL C;  1ZFS A;  3DZT A;  1XK4 C;  4JWQ A;  2IS9 A;  1EG3 A;  2OTG B;  2WCE A;  4YGE B;  4M2Q A;  3ZNI A;  1RJV A;  3OP0 A;  1SL8 A;  2H61 A;  4YRU A;  1ZOT B;  3D76 A;  3B88 A;  1RK9 A;  3FE8 A;  1OOG A;  1J7R A;  3Q8I A;  1YTZ C;  2KI4 B;  2JZI A;  2LP2 A;  3A4U B;  2LV7 A;  2KDH A;  2M29 A;  2KLD A;  5TNC A;  2QDI A;  1OOF A;  3K1E A;  2FJY A;  4NDB A;  2M7N A;  1K9K A;  1EG4 A;  1TIZ A;  4P5O E;  5D69 A;  5D7F A;  3EKH A;  2M8U A;  1HQV A;  3M0W A;  1L2O B;  1UUS A;  2NLN A;  4PHK A;  1K2H A;  1CDP A;  3EG5 B;  1YX8 A;  3ICB A;  4PCW A;  2KLE A;  1B1G A;  1KCY A;  2MA2 A;  2KFF A;  1NCY A;  3VRQ A;  1J55 A;  3CAB A;  4PE0 A;  2FJU B;  3CLN A;  4PHN A;  1EL4 A;  2BKI B;  1UHJ A;  4DIR A;  3IQO A;  3OX6 A;  1V1F A;  4YI8 A;  1YUT A;  3V2L A;  2KBM A;  2PYQ A;  3KPX A;  1KFU L;  3R1O A;  1IKU A;  3LL8 B;  1YRT B;  3DD4 A;  3VGO A;  3DYE A;  1U5I A;  3EVV A;  4YBH B;  1BOD A;  3E3R A;  2BCX A;  3NSL A;  2JXL A;  1CDL A;  4E68 A;  2OTG C;  3PJI A;  3I5H B;  2WOS A;  4ORC B;  1CMF A;  3BQ3 A;  1NX1 A;  1A2X A;  3TDZ A;  4DRW A;  1OQP A;  1H4B A;  1UHK A;  1G4Y R;  3HCM A;  2HQW A;  3BFH A;  3AKA A;  4P2Y B;  2FCD A;  2WC6 A;  1JF0 A;  4OKH A;  2O5G A;  3BOW B;  1OMV A;  1WLM A;  2LHL A;  2F3Z A;  1LKJ A;  1ODB A;  1K90 D;  5IBW A;  3SS5 A;  2L4H A;  1BF5 A;  2JC2 A;  1RFJ A;  2KAX A;  2M97 A;  1NYA A;  3I5F C;  2LP3 A;  2BAP A;  1DQE A;  1DJG A;  1SNL A;  4IJ7 A;  1QX5 B;  4JPZ B;  4PAL A;  1XFY O;  2NCO A;  1BJF A;  2LLU A;  4KYN A;  1TUJ A;  3RLZ A;  4DS7 A;  3SS3 A;  2LVI A;  1RWY A;  2ZN9 A;  1B4C A;  2BL0 B;  1OMD A;  2K60 A;  3DVK A;  3KF9 A;  2WC5 A;  1F71 A;  1KWO B;  3LLE A;  2AMI A;  4GPL B;  1DTL A;  1SPY A;  5I8N A;  2BE4 A;  2FOT A;  1XO5 A;  4GGF C;  1XA5 A;  1PK0 D;  3WNX B;  2WCL A;  1XFR A;  4R1E A;  3VRP A;  1QWV A;  3FWC A;  3TUY B;  1NSH A;  4MZL A;  4Q04 A;  3SG3 A;  1K9P A;  5FI7 A;  4CPV A;  4U8D A;  1MWN A;  2JT0 A;  1IGV A;  1OZS A;  2KNE A;  2BKH B;  5AFP A;  1IJ5 A;  1SK6 D;  1B8R A;  3ZWH A;  3I5H C;  5HKZ A;  3D10 A;  1JC2 A;  4MBE A;  3AKB A;  4ZCU A;  1ZAC A;  1S1E A;  3L47 A;  3VRR A;  5CSI A;  3DF0 A;  1QJT A;  2HET A;  3O4X A;  2MLF C;  3GK2 A;  1PRW A;  1BMO A;  2GGM A;  2LHI A;  1TOP A;  3GK1 A;  2GGZ A;  1OW4 A;  1X02 A;  3NXA A;  1U5I B;  2CT9 A;  4A4C A;  3S0G A;  4M2O A;  4HSZ A;  4USL A;  3PAT A;  1TWO A;  4GGF A;  4I5N B;  3R72 A;  2P70 A;  3WXA A;  4BY4 A;  3CR5 X;  1A29 A;  2F33 A;  2P6B B;  1F8H A;  3I5I C;  5BPJ A;  5K89 A;  1SMG A;  3FE9 A;  2OPO A;  2BL0 C;  3CZ1 A;  1FI5 A;  1VRK A;  5CPV A;  2ZND A;  3B86 A;  1AVS A;  4DUQ A;  2Q91 A;  2ZRS A;  1TCF A;  1FW4 A;  1XYD A;  3BUX B;  1K9U A;  3MSE B;  4PHM A;  3WHU B;  3CZ2 A;  3JVT B;  1JWD A;  1YR5 A;  2K8M B;  2TN4 A;  1SR6 B;  1B47 A;  4PE4 A;  1D1O A;  3TZ1 A;  3RZS A;  3TUY C;  3UNW A;  1XVJ A;  5DKQ A;  4GAO A;  2EGD A;  3D77 A;  2LVV A;  1JFK A;  1OOH A;  3SS4 A;  1QS7 A;  1W9Z A;  3SJS A;  3S0B A;  1OOI X;  4OR9 B;  1PAL A;  4C0K A;  1QAT A;  5FI6 A;  3RM1 A;  1LXF C;  2DOQ A;  2L4I A;  3SG5 A;  3AAK A;  5CSJ A;  1LA0 A;  1K8U A;  2JT3 A;  5HL1 A;  1GM0 A;  3HX4 A;  2BEC A;  4NDD A;  3WHT B;  2PVB A;  1YRU B;  2LAN A;  4XYN A;  1M46 A;  2E6W A;  2WCH A;  5I2O A;  1CLB A;  5KSZ A;  1BT6 A;  1CB1 A;  1UHH A;  2KBI A;  3GK4 X;  2AAO A;  1S5G Y;  3C1V A;  3SIA A;  4WRI A;  2M1U A;  2H2K A;  3AAJ A;  3F45 A;  3FWB A;  3I5F B;  4CLN A;  1NCX A;  5B8I B;  2L0P A;  2LM5 A;  4QJ3 B;  4GNK B;  2R2I A;  1KFX S;  1CM4 A;  1OMR A;  2Y1M A;  1FF1 A;  2QEB A;  1MUX A;  2K7B A;  4OVN F;  3DF0 B;  3LCP C;  1ALW A;  2JT8 A;  1TNQ A;  4JD9 A;  2LLT A;  3BUO B;  4YI9 A;  1ZMZ A;  1N65 A;  3SG6 A;  2QPT A;  1AUI B;  5I2L A;  4PE1 A;  2SAS A;  5I2Q A;  2PAS A;  2MAZ A;  3O2P A;  2PAL A;  2ISD A;  1UUR A;  2KPH A;  2MJW B;  3JVT C;  3LK1 A;  5HLO A;  1NUB A;  2KSP A;  2GTE A;  1SR6 C;  1XFW O;  1REC A;  1M45 A;  3B6X A;  2CXJ A;  2M49 B;  1OOJ A;  2LMU A;  3VB1 A;  3KHE A;  2ZFD A;  3IQQ A;  1XFX O;  2M7L A;  2WCK A;  2E30 A;  1T14 A;  3GOF A;  1TCO B;  4XJK A;  1B8C A;  1Y1A A;  4A4B A;  3D75 A;  2KYF A;  3B7A A;  4DCK A;  1MR8 A;  5DIC A;  1SL9 A;  3BUW B;  3BFA A;  2JRF A;  4IL1 A; 
#chains in the Genus database with same CATH homology
 2K7O A;  1CLM A;  1Y6W A;  1J7Q A;  1YX7 A;  2EHB A;  1NCZ A;  2G2B A;  1QX7 A;  3I5I B;  3NSO A;  5HLV A;  3PAL A;  4MSP A;  5FYX A;  4GUK A;  1J7P A;  2HF5 A;  1GGW A;  4MEW A;  1WY9 A;  1PVA A;  2L51 A;  1JSA A;  3EK4 A;  2PMY A;  1XFU O;  4YGC B;  1IQ5 A;  4MRX A;  2LVJ A;  2FCE A;  2JTT A;  2F3Y A;  1BU3 A;  2LUC A;  3PLF B;  1JF2 A;  3EK8 A;  1FI6 A;  4GGN A;  4AQJ A;  4CID A;  1DGV A;  1UHI A;  1QV0 A;  1QLK A;  4TNC A;  3PFV A;  1NIW A;  1Q80 A;  1TNW A;  2LAP A;  2Y4Q A;  1KFU S;  3BXK A;  1F54 A;  1DF0 A;  3CR2 A;  2KYC A;  2NXQ A;  4I5J A;  5F6T A;  2D8N A;  3TDI A;  1AP4 A;  1TNX A;  3EVR A;  2HQ8 A;  4MVF A;  2WC8 A;  4MZJ A;  1KSM A;  3CZT X;  2CBL A;  1Y1X A;  1AJ5 A;  1SCM B;  3EKJ A;  4GFT A;  1A03 A;  2OS8 C;  4HRE E;  3OB2 B;  5AXI A;  2GV5 A;  1LA3 A;  2K2F A;  3LK0 A;  1S5G Z;  1S3P A;  3QRX A;  1AHR A;  1CFP A;  3NSK A;  1GJY A;  2K61 A;  4XJK B;  1N0Y A;  4MZK A;  5ER4 X;  1TNP A;  2A4J A;  2M0R A;  2WCB A;  5KTY A;  1YUR A;  3BUN B;  3K21 A;  2COL B;  2KGR A;  5AER A;  2B1U A;  2JPT A;  4AOM A;  2K2A A;  2WND A;  1QLS A;  2JOJ A;  1K95 A;  1MHO A;  1A4P A;  1B7T Z;  5HKY A;  2CNP A;  2MRD A;  1IG5 A;  1F70 A;  1R2U A;  2F8P A;  1H8B A;  1BG1 A;  1QTX A;  2O60 A;  1SYM A;  3BYA A;  1QVI Z;  3VRN A;  1Y1U A;  1DJI A;  1QV1 A;  2I18 A;  2JUL A;  3TS5 C;  1IH0 A;  4QJ4 B;  1CMG A;  2M1K B;  4CFR A;  1IJ6 A;  1M63 B;  1SY9 A;  1EJ3 A;  1S6J A;  1W7J B;  3EVU A;  3SG7 A;  1KQM C;  1KK8 C;  3CGA A;  4F0Z B;  4D1E A;  1F55 A;  1SCM C;  3CTN A;  1RRO A;  1JFJ A;  2L50 A;  1EXR A;  1QXP A;  2MHH A;  4UPG A;  2KQ6 A;  1KSO A;  5AEQ A;  1CDN A;  1DF0 B;  2SCP A;  2NCP A;  1PVB A;  2JNF A;  1DJH A;  2BCA A;  4JQ0 D;  3JTD C;  1XFZ O;  1G33 A;  1QAS A;  1SRA A;  4N5X A;  4YGD B;  2K7D A;  3PN7 C;  5HYD A;  4ETO A;  1F4Q A;  1CTR A;  1YUS A;  2ZRT A;  2Y5I A;  1TTX A;  1UHN A;  1B7T Y;  2K0J A;  3CWG A;  3TDU A;  1AK8 A;  2JXC A;  1DT7 B;  2BE6 A;  1LIN A;  2LCP A;  1A75 A;  2V53 A;  5GQQ C;  1Y0V H;  4MLW A;  1ZUZ A;  2JU0 A;  4OV2 A;  1S6I A;  1BR4 B;  1OE9 B;  1NPQ A;  1LVC D;  1CKK A;  1QVI Y;  2EC6 C;  1NX2 A;  4NQG A;  1YVH A;  2PRU A;  1DVI A;  1WDC C;  2F2O A;  4BY5 A;  1SL7 A;  3OX5 A;  4WQ2 A;  2L5X B;  2WOR A;  1OZO A;  1CFC A;  1XK4 A;  1PSR A;  2I2R E;  5CSN A;  1KQV A;  1CFD A;  2MLE C;  3NSI A;  3O4Y A;  3D0Y A;  1WRL A;  2M3W A;  1WRK A;  4I5L B;  5G08 A;  1YVL A;  2LVK A;  5J3X A;  2L2E A;  1FBV A;  2NZ0 A;  1DMO A;  2CTN A;  2VRG A;  1J1E A;  3SG2 A;  2PSR A;  2OS8 B;  1GGZ A;  1N2D A;  2Q4U A;  3VRO A;  1NWD A;  1K96 A;  4NDC A;  4WQ3 A;  1BOC A;  3I5G B;  1E8A A;  2JNX A;  2L98 A;  5ER5 A;  1AJ4 A;  2AUC A;  4YGA A;  1RTP 1;  4FTG A;  1G8I A;  1S26 D;  1J7O A;  2KFH A;  1DGU A;  4MN0 A;  5DKR A;  1S36 A;  1QIV A;  5KU1 A;  2KAY A;  1L7Z A;  4PHJ A;  4ORB B;  1R6P A;  4CFQ A;  2KHN A;  4YGB B;  1F4O A;  1WRZ A;  2KI4 C;  4OCI A;  1IRJ A;  1JUO A;  1C07 A;  1HT9 A;  2Y1N A;  3DVM A;  2LC5 A;  1QX2 A;  1C7V A;  1B9A A;  3O6B A;  2ZKM X;  5PAL A;  1BR1 B;  3IF7 A;  4HRG A;  2KGB C;  4M2P A;  1L2O C;  1KK7 Z;  2G9B A;  3CS1 A;  2ZNE A;  4AQI A;  5JOL A;  1M31 A;  2F2P A;  2M9G A;  1FPW A;  1W7I B;  3BUM B;  3OHM B;  4GBA A;  3TS5 B;  2LUX A;  4C0L A;  2LMV A;  1OSA A;  5DKN A;  2CCM A;  4PDZ A;  1A75 B;  1NP8 A;  1M39 A;  4I5K A;  1YUU A;  3KEV A;  1CFF A;  1KQM B;  1KK8 B;  3SG4 A;  1XFV O;  4L9M A;  1SKT A;  5JJG A;  3SIB A;  1DJX A;  3O78 A;  3I5G C;  4ORA B;  1UWO A;  2LE9 B;  1K94 A;  1DJW A;  1PUL A;  2JQ6 A;  4MRY A;  5HKW A;  4ICB A;  3OB1 B;  1GQM A;  2WCF A;  3D0Y B;  4N1G A;  1IWQ A;  1CM1 A;  2BCB A;  3JTD B;  1IQ3 A;  2JTZ A;  1DJZ A;  2KOT A;  1ALV A;  1CLL A;  1J1D A;  3PN7 B;  2KQY A;  2QAC A;  1K93 D;  1V1G A;  2LMT A;  3FIA A;  2JWW A;  5AAN A;  1NX0 A;  2K7C A;  1CDM A;  4HRH A;  1EH2 A;  1SBJ A;  1SW8 A;  1B8L A;  3DVE A;  2MBX A;  1BLQ A;  1KFX L;  3A8R A;  3PM8 A;  2LLS A;  2BBM A;  1KK7 Y;  4ZCV A;  1NX3 A;  2BBN A;  2KI6 C;  2KFG A;  1UP5 A;  4N1F A;  2EC6 B;  1JBA A;  2RGI A;  1WDC B;  2I7A A;  2H61 C;  1S6C A;  1MXE A;  3PSR A;  3DVJ A;  1CNP A;  5CSF A;  2KI6 D;  2HPS A;  2I94 A;  3H4S E;  1MQ1 A;  4FQO A;  1QIW A;  1KWO C;  2KAV A;  4C0J A;  4QJ5 B;  3CR4 X;  1TRF A;  2ZN8 A;  1TN4 A;  3EK7 A;  3BOW A;  1C7W A;  3KO0 A;  4PE7 A;  2LNK A;  1MF8 B;  1PSB A;  3FS7 A;  1SCV A;  1WLZ A;  1DJY A;  1MXL C;  1ZFS A;  1XK4 C;  4JWQ A;  2IS9 A;  1EG3 A;  2OTG B;  2WCE A;  4YGE B;  4M2Q A;  3ZNI A;  1RJV A;  3OP0 A;  1SL8 A;  2H61 A;  4YRU A;  1ZOT B;  1RK9 A;  1J7R A;  1YTZ C;  2KI4 B;  2JZI A;  2LP2 A;  3A4U B;  2LV7 A;  2KDH A;  2M29 A;  5TNC A;  4NDB A;  2M7N A;  1K9K A;  1EG4 A;  1TIZ A;  4P5O E;  5D69 A;  5D7F A;  3EKH A;  2M8U A;  1HQV A;  3M0W A;  1L2O B;  1UUS A;  2NLN A;  4PHK A;  1K2H A;  1CDP A;  1YX8 A;  3ICB A;  4PCW A;  1B1G A;  1KCY A;  2MA2 A;  2KFF A;  1NCY A;  3VRQ A;  1J55 A;  4PE0 A;  2FJU B;  3CLN A;  4PHN A;  1EL4 A;  2BKI B;  1UHJ A;  4DIR A;  3IQO A;  3OX6 A;  1V1F A;  4YI8 A;  1YUT A;  2KBM A;  3KPX A;  1KFU L;  1IKU A;  3LL8 B;  1YRT B;  3DD4 A;  3VGO A;  1U5I A;  3EVV A;  4YBH B;  1BOD A;  3E3R A;  2BCX A;  3NSL A;  2JXL A;  1CDL A;  4E68 A;  2OTG C;  3I5H B;  2WOS A;  4ORC B;  1CMF A;  3BQ3 A;  1NX1 A;  1A2X A;  3TDZ A;  4DRW A;  1OQP A;  1H4B A;  1UHK A;  1G4Y R;  3HCM A;  2HQW A;  3AKA A;  4P2Y B;  2FCD A;  1JF0 A;  4OKH A;  2O5G A;  3BOW B;  1OMV A;  1WLM A;  2LHL A;  2F3Z A;  1LKJ A;  1ODB A;  1K90 D;  5IBW A;  2L4H A;  1BF5 A;  2JC2 A;  1RFJ A;  2KAX A;  2M97 A;  1NYA A;  3I5F C;  2LP3 A;  1DJG A;  1SNL A;  4JPZ B;  1QX5 B;  4PAL A;  1XFY O;  2NCO A;  1BJF A;  2LLU A;  3RLZ A;  4DS7 A;  2LVI A;  1RWY A;  2ZN9 A;  1B4C A;  2BL0 B;  1OMD A;  3DVK A;  3KF9 A;  1F71 A;  1KWO B;  3LLE A;  2AMI A;  4GPL B;  1DTL A;  1SPY A;  5I8N A;  2BE4 A;  2FOT A;  1XO5 A;  4GGF C;  1XA5 A;  1PK0 D;  3WNX B;  4R1E A;  3VRP A;  3TUY B;  3FWC A;  1NSH A;  4MZL A;  4Q04 A;  3SG3 A;  1K9P A;  4CPV A;  4U8D A;  1MWN A;  2JT0 A;  1IGV A;  1OZS A;  2KNE A;  2BKH B;  5AFP A;  1IJ5 A;  1SK6 D;  1B8R A;  3ZWH A;  3I5H C;  5HKZ A;  3D10 A;  1JC2 A;  4MBE A;  3AKB A;  4ZCU A;  1ZAC A;  1S1E A;  3VRR A;  5CSI A;  3DF0 A;  1QJT A;  2HET A;  2MLF C;  3GK2 A;  1PRW A;  1BMO A;  2GGM A;  2LHI A;  1TOP A;  3GK1 A;  2GGZ A;  1X02 A;  3NXA A;  1U5I B;  2CT9 A;  4A4C A;  4M2O A;  4HSZ A;  4USL A;  3PAT A;  4GGF A;  4I5N B;  3WXA A;  4BY4 A;  3CR5 X;  1A29 A;  2F33 A;  2P6B B;  1F8H A;  3I5I C;  5BPJ A;  5K89 A;  1SMG A;  2OPO A;  2BL0 C;  1FI5 A;  1VRK A;  5CPV A;  2ZND A;  1AVS A;  4DUQ A;  2Q91 A;  2ZRS A;  1TCF A;  1FW4 A;  1XYD A;  3BUX B;  1K9U A;  3MSE B;  4PHM A;  3WHU B;  3JVT B;  1JWD A;  1YR5 A;  2K8M B;  2TN4 A;  1SR6 B;  1B47 A;  4PE4 A;  1D1O A;  3TZ1 A;  3TUY C;  1XVJ A;  5DKQ A;  4GAO A;  2EGD A;  2LVV A;  1JFK A;  1QS7 A;  3SJS A;  4OR9 B;  1PAL A;  4C0K A;  1QAT A;  3RM1 A;  1LXF C;  2DOQ A;  2L4I A;  3SG5 A;  3AAK A;  5CSJ A;  1LA0 A;  1K8U A;  2JT3 A;  3HX4 A;  2BEC A;  4NDD A;  3WHT B;  2PVB A;  1YRU B;  2LAN A;  4XYN A;  1M46 A;  2E6W A;  5I2O A;  1CLB A;  5KSZ A;  1BT6 A;  1CB1 A;  1UHH A;  2KBI A;  3GK4 X;  2AAO A;  1S5G Y;  3C1V A;  3SIA A;  4WRI A;  2M1U A;  2H2K A;  3AAJ A;  3F45 A;  3FWB A;  3I5F B;  4CLN A;  1NCX A;  5B8I B;  2L0P A;  2LM5 A;  4QJ3 B;  4GNK B;  2R2I A;  1KFX S;  1CM4 A;  1OMR A;  2Y1M A;  1FF1 A;  1MUX A;  2K7B A;  4OVN F;  3DF0 B;  3LCP C;  1ALW A;  2JT8 A;  1TNQ A;  2LLT A;  3BUO B;  4YI9 A;  1ZMZ A;  1N65 A;  3SG6 A;  2QPT A;  1AUI B;  5I2L A;  4PE1 A;  2SAS A;  5I2Q A;  2PAS A;  2MAZ A;  3O2P A;  2PAL A;  2ISD A;  1UUR A;  2MJW B;  3JVT C;  3LK1 A;  5HLO A;  1NUB A;  2KSP A;  1SR6 C;  1XFW O;  1REC A;  1M45 A;  2CXJ A;  2M49 B;  1OOJ A;  2LMU A;  3KHE A;  2ZFD A;  3IQQ A;  1XFX O;  2M7L A;  2E30 A;  3GOF A;  1TCO B;  4XJK A;  1B8C A;  1Y1A A;  4A4B A;  2KYF A;  4DCK A;  1MR8 A;  1SL9 A;  3BUW B;  2JRF A;  4IL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...