1TTXA

Solution structure of human beta parvalbumin (oncomodulin) refined with a paramagnetism based strategy
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
b'MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oncomodulin
publication title Solution Structure of Human beta-Parvalbumin and Structural Comparison with Its Paralog alpha-Parvalbumin and with Their Rat Orthologs(,)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 31
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ttxA00
1QLSA 4MZKA 2KSPA 1B8LA 4DIRA 1F71A 1CFDA 5CSFA 2KBIA 1J7OA 2I94A 3O4YA 1ZOTB 2KAYA 1YVLA 2F8PA 2WCFA 4M2QA 3DF0A 2Y1MA 4WQ2A 4YBHB 3NXAA 4MRXA 1QX5B 5AANA 3NSKA 1K94A 1K95A 3EK4A 1AP4A 1QV0A 3JTDC 4XJKB 1TIZA 2BBNA 3SG7A 1S3PA 5KU1A 3SG4A 2M3WA 1BR1B 2P6BB 3JTDB 2MLEC 3EKJA 2I7AA 2V53A 1C7WA 1JWDA 1V1FA 1ODBA 1C7VA 2JZIA 1R6PA 1LA0A 1U5IA 3QRXA 4D1EA 2K7BA 1DVIA 5DKNA 1CB1A 2KNEA 1NCXA 1CDNA 1SL7A 2NZ0A 2SCPA 4YGCB 1FBVA 4F0ZB 1J1DA 1MXEA 1F54A 2JRFA 4OVNF 2BCBA 2PVBA 3BUXB 1G4YR 1K96A 1KK7Z 2M49B 1DJIA 1YX7A 3HX4A 1V1GA 3RLZA 5ER4X 3TDUA 4YGDB 1BJFA 1G33A 3KF9A 1IRJA 2Q4UA 1SYMA 1MHOA 4A4BA 1TRFA 3OB1B 3D0YA 4PE4A 3BUWB 1BLQA 4AQIA 2GV5A 3H4SE 2M9GA 1TCFA 5ER5A 4M2PA 2CBLA 3NSIA 1QX2A 2OTGB 1OE9B 4ORCB 4PE1A 2L51A 1PVBA 3WHUB 1B47A 1KFXL 5CSJA 1S1EA 2G9BA 1S26D 4HRGA 3TS5B 4GGFA 2MRDA 1QIVA 2KAXA 5HKYA 1NPQA 2K61A 3PN7C 5HYDA 1SPYA 2HPSA 1A2XA 1PRWA 4I5NB 1JF2A 3PN7B 5HLOA 1EXRA 1IG5A 1K8UA 1J1EA 1AJ4A 1BG1A 1M45A 2DOQA 1MUXA 1AHRA 2L5XB 2LC5A 4HRHA 1CLBA 5B8IB 2ZN8A 2AMIA 5GQQC 1SR6C 1TCOB 1UP5A 3BQ3A 1PSRA 2K0JA 1XK4A 3LK0A 4GNKB 5G08A 5PALA 2LP2A 1NIWA 4DRWA 1S6JA 1WLMA 1QTXA 3MSEB 4BY5A 1LXFC 2LMVA 4I5JA 1PALA 4USLA 2LM5A 2WNDA 1QV1A 2Q91A 4YGBB 1DTLA 1M31A 1S5GY 3KO0A 1KK8C 2FCEA 2H61C 4MBEA 3CR4X 3CR2A 1DJYA 1K9KA 1KK8B 4GAOA 2HF5A 1HT9A 2LAPA 3CLNA 2L0PA 2K8MB 1DJHA 4TNCA 3KPXA 2MJWB 3VRQA 4ZCUA 1BODA 1LINA 1TNWA 2WOSA 1XFXO 2MHHA 1X02A 1DMOA 2M29A 2WCEA 2KBMA 1MXLC 1B8RA 2PSRA 3HCMA 5JJGA 3SJSA 2F3YA 4HSZA 1MWNA 1ALWA 2VRGA 3PALA 1Q80A 1YR5A 3AAKA 3IQQA 1NX0A 4ETOA 3FIAA 1M39A 1IQ5A 1SL9A 1EG4A 1DF0A 2JTTA 3AKAA 1FI5A 4ZCVA 1S5GZ 4OR9B 1IJ5A 3ZWHA 1S6CA 2WORA 1CFPA 2JPTA 1MR8A 1QASA 3BUMB 4C0JA 4P5OE 4JPZB 1YVHA 2KAVA 3DF0B 5HLVA 2ZRTA 2ZN9A 4CPVA 1QS7A 3WHTB 3OX5A 4OKHA 1KFUS 1M63B 5I2LA 1KCYA 3O6BA 1N65A 2LVJA 2M8UA 4Q04A 1XFUO 1XFWO 2JT0A 1U5IB 1YURA 4FQOA 4GGNA 1DT7B 1H8BA 1OQPA 4CLNA 2KI4C 3CGAA 2NCOA 1PK0D 1KWOC 1JUOA 3GK2A 3VROA 3EVRA 5K89A 1IGVA 2KI4B 4UPGA 2JNXA 3VRPA 1KWOB 2COLB 1TNXA 1KQMC 2WC8A 2O5GA 2Y4QA 1CMGA 3CR5X 1SMGA 3M0WA 1EH2A 4CIDA 1GQMA 1KQMB 1RJVA 5BPJA 4MVFA 1NSHA 2M1KB 1DJWA 3D0YB 1SCMC 1TNQA 1W7JB 3I5IC 1WRKA 5AERA 2AUCA 1SCMB 1F4OA 3I5IB 1TOPA 1FW4A 2ZNEA 4WRIA 2Y1NA 2M1UA 2O60A 1NCZA 5CSNA 4YGAA 1WRZA 2M0RA 5HKZA 1M46A 4GGFC 2A4JA 2QPTA 2KFFA 4C0LA 1SKTA 1EL4A 2L4IA 1JF0A 3E3RA 2K7DA 1KSOA 4L9MA 1G8IA 1QIWA 4I5LB 1RTP1 1XK4C 1UHHA 4YRUA 1CM1A 4QJ5B 1N0YA 3KHEA 2JT8A 4MEWA 2BCAA 2WCBA 4PHJA 1JFJA 1F70A 1J7PA 1AJ5A 3C1VA 1UURA 3LCPC 3PM8A 1DJXA 2R2IA 4IL1A 1YX8A 3OP0A 5AFPA 1PSBA 2GGZA 3TDIA 1W7IB 3EKHA 1IQ3A 4MRYA 1YTZC 2LANA 3AAJA 1B7TY 3BXKA 4PHKA 2K2AA 3OHMB 3CZTX 2LLSA 1B9AA 3A8RA 2LHIA 2BL0C 2FCDA 1OSAA 1LKJA 1VRKA 2KYFA 2LMUA 2LP3A 1DGUA 4AQJA 1SR6B 2BL0B 1NUBA 2KHNA 1NP8A 1OOJA 4HREE 5J3XA 3TZ1A 3SG6A 2L2EA 1ZFSA 2SASA 1YUSA 3OX6A 5CPVA 1UHKA 1MF8B 1TTXA 3I5GC 2LLTA 3PFVA 1CKKA 3VRNA 3I5GB 3LK1A 1CMFA 1CTRA 1XYDA 1J7QA 1KQVA 1CNPA 4NDDA 1DF0B 3F45A 2JWWA 2ZKMX 1KFXS 1Y0VH 1YUTA 3JVTC 4GFTA 4P2YB 2BKHB 4YGEB 5D69A 3JVTB 1F8HA 2ISDA 1B7TZ 3AKBA 1Y1UA 1OMRA 3SG5A 2RGIA 5AEQA 1OMVA 4U8DA 3GOFA 4N1FA 2BE4A 1UHNA 1PVAA 4DUQA 1D1OA 1ZMZA 1JC2A 1B8CA 1LVCD 4GUKA 5HKWA 1XA5A 4PE0A 2FJUB 5AXIA 3BOWA 1GGWA 2M7NA 3O78A 2KGBC 1YUUA 1K2HA 3CWGA 1SW8A 1NX2A 2MA2A 4ICBA 1XFYO 4YI9A 4OCIA 4C0KA 1WDCC 5IBWA 4QJ3B 4OV2A 1RFJA 1J55A 4GBAA 5F6TA 1WDCB 2F33A 1DGVA 2QACA 1A03A 1K9UA 2NXQA 3VRRA 2OS8C 1OZSA 1NYAA 2L98A 1A75A 4GPLB 2OS8B 4MSPA 2BKIB 2JXLA 1RWYA 1Y1AA 3DVMA 4NDBA 2LCPA 1S36A 1HQVA 2Y5IA 1IKUA 1XVJA 3BUNB 4YI8A 1WY9A 2K7CA 2F3ZA 1FI6A 2E6WA 2L50A 1B4CA 3WXAA 4AOMA 1CLLA 2K7OA 3A4UB 3SIAA 1SY9A 3EVUA 1UHJA 3DD4A 3PATA 1CDPA 1DJZA 2BCXA 1IJ6A 4PCWA 1QJTA 2EC6C 2CCMA 2CXJA 4XYNA 3DVJA 2KYCA 2EC6B 2LNKA 2CTNA 2F2OA 2KI6C 1AK8A 2ZNDA 1NX1A 2CT9A 2LLUA 1XO5A 2LV7A 1UWOA 2PALA 2JXCA 2KDHA 2PASA 3ZNIA 2CNPA 2LUXA 1LA3A 3WNXB 1TN4A 2LVIA 4PE7A 4PHNA 3TUYC 4MLWA 1AVSA 3IQOA 2BBMA 1RECA 2JTZA 3CTNA 1FF1A 3TUYB 4E68A 1BR4B 1SBJA 1E8AA 2L4HA 4JWQA 4CFRA 4DS7A 4ORAB 5D7FA 4CFQA 1EG3A 3TDZA 1UHIA 5I2OA 3I5FC 2LUCA 3FS7A 3I5FB 4N5XA 1F4QA 1K90D 4XJKA 3RM1A 2MBXA 1K93D 1L7ZA 3BUOB 1QX7A 3GK1A 2FOTA 1UUSA 2I2RE 2JT3A 1XFZO 2K2FA 5CSIA 1JSAA 3PLFB 2NCPA 4I5KA 4BY4A 3DVKA 2HETA 1SL8A 1BMOA 3NSLA 1BOCA 3PSRA 1H4BA 3SG2A 1QLKA 1WLZA 2I18A 3KEVA 3SIBA 1DJGA 2G2BA 1A4PA 2OTGC 1GJYA 3LL8B 4NDCA 1NWDA 1FPWA 2ZRSA 1IWQA 4MZLA 3CS1A 2MAZA 3D10A 4JQ0D 3TS5C 4PDZA 4NQGA 1RK9A 1NX3A 3FWBA 2GGMA 2LVVA 5I2QA 1JFKA 2AAOA 2KGRA 5JOLA 3O2PA 3SG3A 1F55A 1SCVA 2M7LA 1CDMA 2IS9A 2LHLA 3EK7A 1SRAA 2BE6A 2LMTA 2KFHA 3EK8A 3K21A 3IF7A 1ZACA 3GK4X 3LLEA 3BOWB 2KQYA 4MZJA 1BF5A 1SNLA 1QXPA 3BYAA 3FWCA 2H2KA 5TNCA 1C07A 1GGZA 2HQWA 1CM4A 1OZOA 1KFUL 4PALA 2KFGA 4A4CA 5I8NA 2B1UA 2PMYA 2NLNA 3ICBA 1CFCA 1MQ1A 2OPOA 4DCKA 1CFFA 5KTYA 1QATA 1BU3A 2MLFC 1BT6A 1A75B 1TNPA 1EJ3A 4PHMA 1OMDA 1QVIY 3DVEA 2TN4A 2ZFDA 1PULA 2PRUA 4QJ4B 3VGOA 1IH0A 5DKRA 5FYXA 1S6IA 1ALVA 2JULA 1R2UA 2JQ6A 1KSMA 4WQ3A 1Y6WA 2EGDA 2JU0A 2JC2A 3I5HC 5DKQA 2H61A 1A29A 1N2DA 3I5HB 1AUIB 2HQ8A 4ORBB 1B1GA 2KOTA 2LVKA 4N1GA 1ZUZA 2BECA 1CDLA 2LE9B 2KQ6A 1YRTB 4MN0A 1CLMA 2KI6D 4M2OA 5KSZA 1JBAA 3OB2B 1K9PA 2EHBA 3NSOA 4R1EA 2M97A 1QVIZ 3EVVA 1L2OC 4FTGA 2JOJA 2E30A 1YRUB 2JNFA 1L2OB 1NCYA 1XFVO 1RROA 1SK6D 1WRLA 2D8NA 1Y1XA 2F2PA 1J7RA 1KK7Y
chains in the Genus database with same CATH superfamily
1QLSA 4MZKA 2KSPA 1B8LA 4DIRA 1F71A 1CFDA 5CSFA 2KBIA 1J7OA 2I94A 3O4YA 1ZOTB 2KAYA 1YVLA 2F8PA 2WCFA 4M2QA 3DF0A 2Y1MA 4WQ2A 4YBHB 3NXAA 4MRXA 1QX5B 1TWOA 2JPOA 3NSKA 1K94A 1K95A 3EK4A 3UO9A 1AP4A 1QV0A 3JTDC 4XJKB 1TIZA 2BBNA 3SG7A 1S3PA 5KU1A 3SG4A 2M3WA 1BR1B 2P6BB 3JTDB 2MLEC 3EKJA 2I7AA 2V53A 1C7WA 1JWDA 1V1FA 1ODBA 1C7VA 2JZIA 1R6PA 5I94A 1LA0A 1U5IA 3PM2A 3QRXA 4D1EA 2K7BA 1DVIA 5DKNA 1CB1A 2KNEA 1NCXA 1CDNA 1SL7A 2NZ0A 2SCPA 4YGCB 1FBVA 4F0ZB 1J1DA 1TUJA 1MXEA 1F54A 2JRFA 4OVNF 2BCBA 2PVBA 3BUXB 1G4YR 1K96A 1KK7Z 2M49B 1DJIA 4PT1A 1YX7A 3HX4A 1V1GA 3RLZA 5ER4X 3TDUA 1OOFA 4YGDB 1BJFA 1G33A 3KF9A 1IRJA 2Q4UA 1SYMA 1MHOA 4A4BA 1TRFA 3OB1B 3D0YA 4PE4A 3BUWB 1BLQA 4AQIA 2GV5A 3H4SE 2M9GA 1TCFA 5ER5A 4M2PA 2CBLA 3NSIA 1QX2A 2OTGB 1OE9B 4ORCB 4PE1A 2L51A 1PVBA 3WHUB 2WCLA 1B47A 1KFXL 5CSJA 1OOHA 1S1EA 4JKTA 2G9BA 1S26D 2L2CA 4HRGA 3TS5B 4GGFA 2MRDA 2KLDA 1QIVA 2KAXA 3DXLA 5HKYA 1NPQA 2K61A 4OZDA 3PN7C 2WCJA 5HYDA 1SPYA 2HPSA 1A2XA 1PRWA 4I5NB 1JF2A 3PN7B 5HLOA 1EXRA 1IG5A 1K8UA 1J1EA 1AJ4A 3BFHA 2WCKA 1BG1A 1M45A 2DOQA 1MUXA 1AHRA 2L5XB 2LC5A 2PQLA 4HRHA 1CLBA 5B8IB 2ZN8A 2AMIA 5GQQC 1SR6C 1TCOB 1UP5A 3BQ3A 1PSRA 2K0JA 1XK4A 3LK0A 4GNKB 5G08A 5PALA 2LP2A 1NIWA 4DRWA 1S6JA 1WLMA 1QTXA 3MSEB 4BY5A 1LXFC 2LMVA 4I5JA 1PALA 4USLA 2LM5A 2WNDA 1QV1A 2Q91A 2WCHA 1IIOA 4YGBB 1DTLA 1M31A 1S5GY 3KO0A 1KK8C 3S0FA 2FCEA 2H61C 4MBEA 4INXA 3CR4X 2BAPA 3CR2A 1DJYA 1K9KA 1KK8B 1DQEA 2HF5A 4GAOA 1HT9A 2LAPA 3CLNA 2L0PA 2K8MB 1DJHA 4TNCA 3KPXA 2MJWB 3VRQA 4ZCUA 1BODA 1LINA 1TNWA 2WOSA 3OGNA 1XFXO 2MHHA 1X02A 1DMOA 2M29A 2WCEA 2KBMA 1MXLC 1GM0A 1B8RA 2PSRA 3HCMA 5JJGA 3SJSA 2F3YA 4HSZA 3CZ1A 1MWNA 3SS4A 1ALWA 2VRGA 3PALA 1Q80A 1YR5A 3AAKA 3IQQA 1NX0A 4ETOA 3FIAA 1M39A 1IQ5A 1SL9A 1EG4A 3R72A 1DF0A 3D75A 2JTTA 3AKAA 1FI5A 4ZCVA 1S5GZ 4OR9B 1IJ5A 3S0DA 3ZWHA 1S6CA 2WORA 1CFPA 2JPTA 1MR8A 1QASA 3BUMB 4C0JA 4P5OE 2WC5A 4JPZB 3D74A 1YVHA 2KAVA 3DF0B 5HLVA 3S0BA 2KPHA 2ZRTA 2ZN9A 4CPVA 1QS7A 3WHTB 3OX5A 4OKHA 1KFUS 1M63B 3EG5B 5I2LA 1KCYA 3O6BA 1N65A 2LVJA 2M8UA 3CYZA 4Q04A 1TUZA 1XFUO 1XFWO 2JT0A 1U5IB 1YURA 4FQOA 4GGNA 1DT7B 1H8BA 1OQPA 4CLNA 2KI4C 3CZ0A 3CGAA 2NCOA 1PK0D 1KWOC 3FE8A 1JUOA 3GK2A 3VROA 3EVRA 5K89A 1IGVA 2KI4B 4UPGA 2JNXA 4F7FA 2QDIA 1KWOB 3DYEA 3VRPA 2COLB 2WCMA 1TNXA 1KQMC 2WC8A 2O5GA 2Y4QA 1CMGA 3CR5X 1SMGA 3M0WA 2WC6A 4CIDA 1EH2A 2H8VA 1GQMA 1KQMB 1RJVA 5BPJA 4MVFA 1NSHA 2M1KB 3NGVA 1DJWA 3D0YB 1SCMC 1TNQA 1W7JB 3I5IC 1WRKA 2PYQA 2AUCA 5AERA 3PJIA 1SCMB 1F4OA 3I5IB 2QEBA 1TOPA 1FW4A 2ZNEA 3R1VA 4WRIA 2Y1NA 2M1UA 2K60A 2O60A 1NCZA 5CSNA 4YGAA 2ERBA 1WRZA 2M0RA 5HKZA 1M46A 4GGFC 1DC1A 2A4JA 2QPTA 2KFFA 4C0LA 1SKTA 2QEVA 1EL4A 3L4AA 2L4IA 1JF0A 3E3RA 4INWA 2K7DA 1KSOA 4L9MA 1G8IA 1QIWA 3BJHA 1LS8A 4I5LB 1RTP1 1XK4C 1UHHA 4YRUA 1CM1A 4QJ5B 1N0YA 3KHEA 2JT8A 4MEWA 2BCAA 2WCBA 4PHJA 1JFJA 1F70A 1J7PA 1AJ5A 3C1VA 1UURA 3LCPC 3PM8A 1DJXA 2R2IA 4IL1A 1YX8A 3OP0A 5AFPA 1PSBA 1DEKA 2GGZA 3TDIA 1W7IB 3EKHA 1IQ3A 4MRYA 1XFRA 3FE6A 1C3YA 1YTZC 2LANA 3AAJA 1B7TY 3BXKA 4PHKA 1OOGA 2K2AA 3OHMB 3CZTX 2LLSA 1B9AA 3A8RA 2LHIA 2BL0C 2FCDA 1OSAA 1LKJA 1VRKA 2KYFA 2LMUA 2LP3A 1DGUA 4AQJA 1SR6B 2BL0B 1NUBA 2KHNA 1NP8A 1OOJA 4HREE 5J3XA 3TZ1A 3SG6A 2L2EA 3K1EA 1ZFSA 2SASA 1YUSA 3OX6A 5CPVA 1UHKA 1MF8B 3VB1A 1TTXA 3I5GC 2LLTA 3PFVA 1CKKA 3VRNA 3I5GB 3RZSA 3LK1A 1CMFA 1CTRA 1XYDA 1J7QA 1KQVA 1CNPA 4NDDA 1DF0B 3F45A 2JWWA 2ZKMX 1KFXS 1Y0VH 1YUTA 3JVTC 4GFTA 4P2YB 2BKHB 4YGEB 5D69A 5HL1A 2GTEA 3BFBA 3D77A 3JVTB 1F8HA 2ISDA 1B7TZ 3AKBA 5FI2A 1Y1UA 1OMRA 3SG5A 2RGIA 5AEQA 1OMVA 3D73A 3GOFA 4JD9A 4N1FA 2BE4A 4U8DA 1UHNA 1PVAA 4DUQA 1D1OA 1ZMZA 1JC2A 1B8CA 1LVCD 4GUKA 5HKWA 1XA5A 4PE0A 2FJUB 5AXIA 3BOWA 1GGWA 2M7NA 3O78A 3SS5A 2KGBC 5D3OA 2P70A 1YUUA 3BFAA 1K2HA 3CWGA 1SW8A 1NX2A 2MA2A 4ICBA 1XFYO 4YI9A 4OCIA 4C0KA 1WDCC 5IBWA 3L47A 4OV2A 4QJ3B 1RFJA 1J55A 4GBAA 5F6TA 1WDCB 2F33A 3B86A 1DGVA 2QACA 1A03A 1K9UA 2NXQA 3VRRA 4FQTA 2OS8C 1OZSA 3FE9A 1NYAA 2L98A 1A75A 4GPLB 1OW4A 2OS8B 4MSPA 2BKIB 2JXLA 1RWYA 1Y1AA 3DVMA 4NDBA 2LCPA 3Q8IA 1S36A 1HQVA 2Y5IA 1IKUA 1XVJA 3BUNB 1C3ZA 4YI8A 1WY9A 2K7CA 2F3ZA 1FI6A 2E6WA 3L4LA 2L50A 1B4CA 3WXAA 4AOMA 1CLLA 2K7OA 3A4UB 3SIAA 1SY9A 3EVUA 1UHJA 3DD4A 3PATA 1CDPA 3QMEA 1QWVA 1DJZA 2BCXA 1IJ6A 4PCWA 1QJTA 2EC6C 3OBVA 2CCMA 2CXJA 4XYNA 3DVJA 3B87A 2KYCA 2EC6B 2LNKA 2CTNA 2F2OA 2KI6C 1AK8A 3NHIA 2ZNDA 1NX1A 2CT9A 2LLUA 1XO5A 2LV7A 1UWOA 2PALA 2JXCA 2KDHA 2PASA 3B6XA 3ZNIA 3V2LA 2CNPA 2LUXA 1LA3A 3WNXB 1OOIX 1TN4A 2LVIA 2BNXA 4PE7A 4PHNA 3TUYC 4KYNA 4MLWA 1AVSA 3IQOA 2BBMA 1RECA 2JTZA 3CTNA 1FF1A 3TUYB 4E68A 1BR4B 5EL2A 1SBJA 1E8AA 2L4HA 4JWQA 4CFRA 4DS7A 4ORAB 5D7FA 4CFQA 1EG3A 3TDZA 1UHIA 5I2OA 3I5FC 2LUCA 2QEOA 3FS7A 3CABA 3I5FB 4N5XA 1F4QA 1K90D 4XJKA 3RM1A 2MBXA 1K93D 1L7ZA 3BUOB 1QX7A 3GK1A 2FOTA 1UUSA 2I2RE 2JT3A 1XFZO 2K2FA 5CSIA 1JSAA 3D76A 5AANA 3PLFB 2NCPA 4I5KA 4BY4A 3DVKA 2HETA 1SL8A 1BMOA 3CZ2A 3NSLA 3PSRA 1BOCA 1H4BA 3SG2A 1QLKA 1WLZA 2I18A 3KEVA 3SIBA 1DJGA 2G2BA 1A4PA 2OTGC 1GJYA 3LL8B 4NDCA 3S0AA 1NWDA 1FPWA 2ZRSA 2QEHA 3R1OA 1IWQA 2L5YA 3S0GA 3O4XA 4MZLA 3CS1A 2MAZA 3D10A 4JQ0D 3TS5C 4PDZA 4NQGA 1RK9A 1NX3A 3FWBA 3UNWA 2GGMA 2LVVA 3CDNA 3DY9A 5I2QA 1JFKA 3B7AA 2AAOA 5FI6A 3B88A 2KGRA 5JOLA 3O2PA 3SG3A 1W9ZA 3N7HA 1SCVA 1F55A 2M7LA 1CDMA 2IS9A 2LHLA 2P71A 1SSEB 3EK7A 1SRAA 1Z4HA 2BE6A 2LMTA 2KFHA 3DZTA 3EK8A 3K21A 3IF7A 1ZACA 2FJYA 3GK4X 3LLEA 3BOWB 2KQYA 4MZJA 1BF5A 1SNLA 1QXPA 3BYAA 3FWCA 2H2KA 5TNCA 3R1PA 1C07A 1GGZA 2HQWA 1CM4A 1OZOA 1KFUL 1P28A 2KFGA 4PALA 4A4CA 2B1UA 5I8NA 2PMYA 2NLNA 3ICBA 1CFCA 1MQ1A 2OPOA 1DELA 4DCKA 3S0EA 5KTYA 1CFFA 1QATA 1BU3A 2MLFC 3IVTA 1BT6A 1A75B 5DICA 1TNPA 1EJ3A 4PHMA 1OMDA 1QVIY 3D78A 3DVEA 2TN4A 2ZFDA 1PULA 2PRUA 4QJ4B 3VGOA 1IH0A 5DKRA 5FYXA 1S6IA 1ALVA 2JULA 1R2UA 2JQ6A 1KSMA 4WQ3A 3SS3A 1Y6WA 1Z2CB 2EGDA 2JU0A 2JC2A 3I5HC 5DKQA 2H61A 2YGUA 1A29A 1N2DA 3I5HB 4IJ7A 1AUIB 2HQ8A 4ORBB 1B1GA 2KOTA 2LVKA 4N1GA 3NHTA 1ZUZA 2BECA 1CDLA 2LE9B 2KQ6A 1YRTB 4MN0A 1CLMA 2KI6D 4M2OA 5KSZA 1JBAA 3OB2B 1ORGA 1K9PA 2EHBA 3NSOA 4R1EA 2M97A 1QVIZ 3EVVA 1L2OC 4FTGA 5FI7A 1T14A 2JOJA 2KLEA 2E30A 1YRUB 2JNFA 1L2OB 1NCYA 1XFVO 1RROA 1SK6D 1WRLA 2D8NA 1Y1XA 2F2PA 1J7RA 1KK7Y
chains in the Genus database with same CATH topology
1QLSA 4MZKA 2KSPA 1B8LA 4DIRA 1F71A 1CFDA 5CSFA 2KBIA 1J7OA 2I94A 3O4YA 1ZOTB 2KAYA 1YVLA 2F8PA 2WCFA 4M2QA 3DF0A 2Y1MA 4WQ2A 4YBHB 3NXAA 4MRXA 1QX5B 5AANA 3NSKA 1K94A 1K95A 3EK4A 1AP4A 1QV0A 3JTDC 4XJKB 1TIZA 2BBNA 3SG7A 1S3PA 5KU1A 3SG4A 2M3WA 1BR1B 2P6BB 3JTDB 2MLEC 3EKJA 2I7AA 2V53A 1C7WA 1JWDA 1V1FA 1ODBA 1C7VA 2JZIA 1R6PA 1LA0A 1U5IA 3QRXA 4D1EA 2K7BA 1DVIA 5DKNA 1CB1A 2KNEA 1NCXA 1CDNA 1SL7A 2NZ0A 2SCPA 4YGCB 1FBVA 4F0ZB 1J1DA 1MXEA 1F54A 2JRFA 4OVNF 2BCBA 2PVBA 3BUXB 1G4YR 1K96A 1KK7Z 2M49B 1DJIA 1YX7A 3HX4A 1V1GA 3RLZA 5ER4X 3TDUA 4YGDB 1BJFA 1G33A 3KF9A 1IRJA 2Q4UA 1SYMA 1MHOA 4A4BA 1TRFA 3OB1B 3D0YA 4PE4A 3BUWB 1BLQA 4AQIA 2GV5A 3H4SE 2M9GA 1TCFA 5ER5A 4M2PA 2CBLA 3NSIA 1QX2A 2OTGB 1OE9B 4ORCB 4PE1A 2L51A 1PVBA 3WHUB 1B47A 1KFXL 5CSJA 1S1EA 2G9BA 1S26D 4HRGA 3TS5B 4GGFA 2MRDA 1QIVA 2KAXA 5HKYA 1NPQA 2K61A 3PN7C 5HYDA 1SPYA 2HPSA 1A2XA 1PRWA 4I5NB 1JF2A 3PN7B 5HLOA 1EXRA 1IG5A 1K8UA 1J1EA 1AJ4A 1BG1A 1M45A 2DOQA 1MUXA 1AHRA 2L5XB 2LC5A 4HRHA 1CLBA 5B8IB 2ZN8A 2AMIA 5GQQC 1SR6C 1TCOB 1UP5A 3BQ3A 1PSRA 2K0JA 1XK4A 3LK0A 4GNKB 5G08A 5PALA 2LP2A 1NIWA 4DRWA 1S6JA 1WLMA 1QTXA 3MSEB 4BY5A 1LXFC 2LMVA 4I5JA 1PALA 4USLA 2LM5A 2WNDA 1QV1A 2Q91A 4YGBB 1DTLA 1M31A 1S5GY 3KO0A 1KK8C 2FCEA 2H61C 4MBEA 3CR4X 3CR2A 1DJYA 1K9KA 1KK8B 4GAOA 2HF5A 1HT9A 2LAPA 3CLNA 2L0PA 2K8MB 1DJHA 4TNCA 3KPXA 2MJWB 3VRQA 4ZCUA 1BODA 1LINA 1TNWA 2WOSA 1XFXO 2MHHA 1X02A 1DMOA 2M29A 2WCEA 2KBMA 1MXLC 1B8RA 2PSRA 3HCMA 5JJGA 3SJSA 2F3YA 4HSZA 1MWNA 1ALWA 2VRGA 3PALA 1Q80A 1YR5A 3AAKA 3IQQA 1NX0A 4ETOA 3FIAA 1M39A 1IQ5A 1SL9A 1EG4A 1DF0A 2JTTA 3AKAA 1FI5A 4ZCVA 1S5GZ 4OR9B 1IJ5A 3ZWHA 1S6CA 2WORA 1CFPA 2JPTA 1MR8A 1QASA 3BUMB 4C0JA 4P5OE 4JPZB 1YVHA 2KAVA 3DF0B 5HLVA 2ZRTA 2ZN9A 4CPVA 1QS7A 3WHTB 3OX5A 4OKHA 1KFUS 1M63B 5I2LA 1KCYA 3O6BA 1N65A 2LVJA 2M8UA 4Q04A 1XFUO 1XFWO 2JT0A 1U5IB 1YURA 4FQOA 4GGNA 1DT7B 1H8BA 1OQPA 4CLNA 2KI4C 3CGAA 2NCOA 1PK0D 1KWOC 1JUOA 3GK2A 3VROA 3EVRA 5K89A 1IGVA 2KI4B 4UPGA 2JNXA 3VRPA 1KWOB 2COLB 1TNXA 1KQMC 2WC8A 2O5GA 2Y4QA 1CMGA 3CR5X 1SMGA 3M0WA 1EH2A 4CIDA 1GQMA 1KQMB 1RJVA 5BPJA 4MVFA 1NSHA 2M1KB 1DJWA 3D0YB 1SCMC 1TNQA 1W7JB 3I5IC 1WRKA 5AERA 2AUCA 1SCMB 1F4OA 3I5IB 1TOPA 1FW4A 2ZNEA 4WRIA 2Y1NA 2M1UA 2O60A 1NCZA 5CSNA 4YGAA 1WRZA 2M0RA 5HKZA 1M46A 4GGFC 2A4JA 2QPTA 2KFFA 4C0LA 1SKTA 1EL4A 2L4IA 1JF0A 3E3RA 2K7DA 1KSOA 4L9MA 1G8IA 1QIWA 4I5LB 1RTP1 1XK4C 1UHHA 4YRUA 1CM1A 4QJ5B 1N0YA 3KHEA 2JT8A 4MEWA 2BCAA 2WCBA 4PHJA 1JFJA 1F70A 1J7PA 1AJ5A 3C1VA 1UURA 3LCPC 3PM8A 1DJXA 2R2IA 4IL1A 1YX8A 3OP0A 5AFPA 1PSBA 2GGZA 3TDIA 1W7IB 3EKHA 1IQ3A 4MRYA 1YTZC 2LANA 3AAJA 1B7TY 3BXKA 4PHKA 2K2AA 3OHMB 3CZTX 2LLSA 1B9AA 3A8RA 2LHIA 2BL0C 2FCDA 1OSAA 1LKJA 1VRKA 2KYFA 2LMUA 2LP3A 1DGUA 4AQJA 1SR6B 2BL0B 1NUBA 2KHNA 1NP8A 1OOJA 4HREE 5J3XA 3TZ1A 3SG6A 2L2EA 1ZFSA 2SASA 1YUSA 3OX6A 5CPVA 1UHKA 1MF8B 1TTXA 3I5GC 2LLTA 3PFVA 1CKKA 3VRNA 3I5GB 3LK1A 1CMFA 1CTRA 1XYDA 1J7QA 1KQVA 1CNPA 4NDDA 1DF0B 3F45A 2JWWA 2ZKMX 1KFXS 1Y0VH 1YUTA 3JVTC 4GFTA 4P2YB 2BKHB 4YGEB 5D69A 3JVTB 1F8HA 2ISDA 1B7TZ 3AKBA 1Y1UA 1OMRA 3SG5A 2RGIA 5AEQA 1OMVA 4U8DA 3GOFA 4N1FA 2BE4A 1UHNA 1PVAA 4DUQA 1D1OA 1ZMZA 1JC2A 1B8CA 1LVCD 4GUKA 5HKWA 1XA5A 4PE0A 2FJUB 5AXIA 3BOWA 1GGWA 2M7NA 3O78A 2KGBC 1YUUA 1K2HA 3CWGA 1SW8A 1NX2A 2MA2A 4ICBA 1XFYO 4YI9A 4OCIA 4C0KA 1WDCC 5IBWA 4QJ3B 4OV2A 1RFJA 1J55A 4GBAA 5F6TA 1WDCB 2F33A 1DGVA 2QACA 1A03A 1K9UA 2NXQA 3VRRA 2OS8C 1OZSA 1NYAA 2L98A 1A75A 4GPLB 2OS8B 4MSPA 2BKIB 2JXLA 1RWYA 1Y1AA 3DVMA 4NDBA 2LCPA 1S36A 1HQVA 2Y5IA 1IKUA 1XVJA 3BUNB 4YI8A 1WY9A 2K7CA 2F3ZA 1FI6A 2E6WA 2L50A 1B4CA 3WXAA 4AOMA 1CLLA 2K7OA 3A4UB 3SIAA 1SY9A 3EVUA 1UHJA 3DD4A 3PATA 1CDPA 1DJZA 2BCXA 1IJ6A 4PCWA 1QJTA 2EC6C 2CCMA 2CXJA 4XYNA 3DVJA 2KYCA 2EC6B 2LNKA 2CTNA 2F2OA 2KI6C 1AK8A 2ZNDA 1NX1A 2CT9A 2LLUA 1XO5A 2LV7A 1UWOA 2PALA 2JXCA 2KDHA 2PASA 3ZNIA 2CNPA 2LUXA 1LA3A 3WNXB 1TN4A 2LVIA 4PE7A 4PHNA 3TUYC 4MLWA 1AVSA 3IQOA 2BBMA 1RECA 2JTZA 3CTNA 1FF1A 3TUYB 4E68A 1BR4B 1SBJA 1E8AA 2L4HA 4JWQA 4CFRA 4DS7A 4ORAB 5D7FA 4CFQA 1EG3A 3TDZA 1UHIA 5I2OA 3I5FC 2LUCA 3FS7A 3I5FB 4N5XA 1F4QA 1K90D 4XJKA 3RM1A 2MBXA 1K93D 1L7ZA 3BUOB 1QX7A 3GK1A 2FOTA 1UUSA 2I2RE 2JT3A 1XFZO 2K2FA 5CSIA 1JSAA 3PLFB 2NCPA 4I5KA 4BY4A 3DVKA 2HETA 1SL8A 1BMOA 3NSLA 1BOCA 3PSRA 1H4BA 3SG2A 1QLKA 1WLZA 2I18A 3KEVA 3SIBA 1DJGA 2G2BA 1A4PA 2OTGC 1GJYA 3LL8B 4NDCA 1NWDA 1FPWA 2ZRSA 1IWQA 4MZLA 3CS1A 2MAZA 3D10A 4JQ0D 3TS5C 4PDZA 4NQGA 1RK9A 1NX3A 3FWBA 2GGMA 2LVVA 5I2QA 1JFKA 2AAOA 2KGRA 5JOLA 3O2PA 3SG3A 1F55A 1SCVA 2M7LA 1CDMA 2IS9A 2LHLA 3EK7A 1SRAA 2BE6A 2LMTA 2KFHA 3EK8A 3K21A 3IF7A 1ZACA 3GK4X 3LLEA 3BOWB 2KQYA 4MZJA 1BF5A 1SNLA 1QXPA 3BYAA 3FWCA 2H2KA 5TNCA 1C07A 1GGZA 2HQWA 1CM4A 1OZOA 1KFUL 4PALA 2KFGA 4A4CA 5I8NA 2B1UA 2PMYA 2NLNA 3ICBA 1CFCA 1MQ1A 2OPOA 4DCKA 1CFFA 5KTYA 1QATA 1BU3A 2MLFC 1BT6A 1A75B 1TNPA 1EJ3A 4PHMA 1OMDA 1QVIY 3DVEA 2TN4A 2ZFDA 1PULA 2PRUA 4QJ4B 3VGOA 1IH0A 5DKRA 5FYXA 1S6IA 1ALVA 2JULA 1R2UA 2JQ6A 1KSMA 4WQ3A 1Y6WA 2EGDA 2JU0A 2JC2A 3I5HC 5DKQA 2H61A 1A29A 1N2DA 3I5HB 1AUIB 2HQ8A 4ORBB 1B1GA 2KOTA 2LVKA 4N1GA 1ZUZA 2BECA 1CDLA 2LE9B 2KQ6A 1YRTB 4MN0A 1CLMA 2KI6D 4M2OA 5KSZA 1JBAA 3OB2B 1K9PA 2EHBA 3NSOA 4R1EA 2M97A 1QVIZ 3EVVA 1L2OC 4FTGA 2JOJA 2E30A 1YRUB 2JNFA 1L2OB 1NCYA 1XFVO 1RROA 1SK6D 1WRLA 2D8NA 1Y1XA 2F2PA 1J7RA 1KK7Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLS A;  4MZK A;  2KSP A;  1B8L A;  4DIR A;  1F71 A;  1CFD A;  5CSF A;  2KBI A;  1J7O A;  2I94 A;  3O4Y A;  1ZOT B;  2KAY A;  1YVL A;  2F8P A;  2WCF A;  4M2Q A;  3DF0 A;  2Y1M A;  4WQ2 A;  4YBH B;  3NXA A;  4MRX A;  1QX5 B;  5AAN A;  3NSK A;  1K94 A;  1K95 A;  3EK4 A;  1AP4 A;  1QV0 A;  3JTD C;  4XJK B;  1TIZ A;  2BBN A;  3SG7 A;  1S3P A;  5KU1 A;  3SG4 A;  2M3W A;  1BR1 B;  2P6B B;  3JTD B;  2MLE C;  3EKJ A;  2I7A A;  2V53 A;  1C7W A;  1JWD A;  1V1F A;  1ODB A;  1C7V A;  2JZI A;  1R6P A;  1LA0 A;  1U5I A;  3QRX A;  4D1E A;  2K7B A;  1DVI A;  5DKN A;  1CB1 A;  2KNE A;  1NCX A;  1CDN A;  1SL7 A;  2NZ0 A;  2SCP A;  4YGC B;  1FBV A;  4F0Z B;  1J1D A;  1MXE A;  1F54 A;  2JRF A;  4OVN F;  2BCB A;  2PVB A;  3BUX B;  1G4Y R;  1K96 A;  1KK7 Z;  2M49 B;  1DJI A;  1YX7 A;  3HX4 A;  1V1G A;  3RLZ A;  5ER4 X;  3TDU A;  4YGD B;  1BJF A;  1G33 A;  3KF9 A;  1IRJ A;  2Q4U A;  1SYM A;  1MHO A;  4A4B A;  1TRF A;  3OB1 B;  3D0Y A;  4PE4 A;  3BUW B;  1BLQ A;  4AQI A;  2GV5 A;  3H4S E;  2M9G A;  1TCF A;  5ER5 A;  4M2P A;  2CBL A;  3NSI A;  1QX2 A;  2OTG B;  1OE9 B;  4ORC B;  4PE1 A;  2L51 A;  1PVB A;  3WHU B;  1B47 A;  1KFX L;  5CSJ A;  1S1E A;  2G9B A;  1S26 D;  4HRG A;  3TS5 B;  4GGF A;  2MRD A;  1QIV A;  2KAX A;  5HKY A;  1NPQ A;  2K61 A;  3PN7 C;  5HYD A;  1SPY A;  2HPS A;  1A2X A;  1PRW A;  4I5N B;  1JF2 A;  3PN7 B;  5HLO A;  1EXR A;  1IG5 A;  1K8U A;  1J1E A;  1AJ4 A;  1BG1 A;  1M45 A;  2DOQ A;  1MUX A;  1AHR A;  2L5X B;  2LC5 A;  4HRH A;  1CLB A;  5B8I B;  2ZN8 A;  2AMI A;  5GQQ C;  1SR6 C;  1TCO B;  1UP5 A;  3BQ3 A;  1PSR A;  2K0J A;  1XK4 A;  3LK0 A;  4GNK B;  5G08 A;  5PAL A;  2LP2 A;  1NIW A;  4DRW A;  1S6J A;  1WLM A;  1QTX A;  3MSE B;  4BY5 A;  1LXF C;  2LMV A;  4I5J A;  1PAL A;  4USL A;  2LM5 A;  2WND A;  1QV1 A;  2Q91 A;  4YGB B;  1DTL A;  1M31 A;  1S5G Y;  3KO0 A;  1KK8 C;  2FCE A;  2H61 C;  4MBE A;  3CR4 X;  3CR2 A;  1DJY A;  1K9K A;  1KK8 B;  4GAO A;  2HF5 A;  1HT9 A;  2LAP A;  3CLN A;  2L0P A;  2K8M B;  1DJH A;  4TNC A;  3KPX A;  2MJW B;  3VRQ A;  4ZCU A;  1BOD A;  1LIN A;  1TNW A;  2WOS A;  1XFX O;  2MHH A;  1X02 A;  1DMO A;  2M29 A;  2WCE A;  2KBM A;  1MXL C;  1B8R A;  2PSR A;  3HCM A;  5JJG A;  3SJS A;  2F3Y A;  4HSZ A;  1MWN A;  1ALW A;  2VRG A;  3PAL A;  1Q80 A;  1YR5 A;  3AAK A;  3IQQ A;  1NX0 A;  4ETO A;  3FIA A;  1M39 A;  1IQ5 A;  1SL9 A;  1EG4 A;  1DF0 A;  2JTT A;  3AKA A;  1FI5 A;  4ZCV A;  1S5G Z;  4OR9 B;  1IJ5 A;  3ZWH A;  1S6C A;  2WOR A;  1CFP A;  2JPT A;  1MR8 A;  1QAS A;  3BUM B;  4C0J A;  4P5O E;  4JPZ B;  1YVH A;  2KAV A;  3DF0 B;  5HLV A;  2ZRT A;  2ZN9 A;  4CPV A;  1QS7 A;  3WHT B;  3OX5 A;  4OKH A;  1KFU S;  1M63 B;  5I2L A;  1KCY A;  3O6B A;  1N65 A;  2LVJ A;  2M8U A;  4Q04 A;  1XFU O;  1XFW O;  2JT0 A;  1U5I B;  1YUR A;  4FQO A;  4GGN A;  1DT7 B;  1H8B A;  1OQP A;  4CLN A;  2KI4 C;  3CGA A;  2NCO A;  1PK0 D;  1KWO C;  1JUO A;  3GK2 A;  3VRO A;  3EVR A;  5K89 A;  1IGV A;  2KI4 B;  4UPG A;  2JNX A;  3VRP A;  1KWO B;  2COL B;  1TNX A;  1KQM C;  2WC8 A;  2O5G A;  2Y4Q A;  1CMG A;  3CR5 X;  1SMG A;  3M0W A;  1EH2 A;  4CID A;  1GQM A;  1KQM B;  1RJV A;  5BPJ A;  4MVF A;  1NSH A;  2M1K B;  1DJW A;  3D0Y B;  1SCM C;  1TNQ A;  1W7J B;  3I5I C;  1WRK A;  5AER A;  2AUC A;  1SCM B;  1F4O A;  3I5I B;  1TOP A;  1FW4 A;  2ZNE A;  4WRI A;  2Y1N A;  2M1U A;  2O60 A;  1NCZ A;  5CSN A;  4YGA A;  1WRZ A;  2M0R A;  5HKZ A;  1M46 A;  4GGF C;  2A4J A;  2QPT A;  2KFF A;  4C0L A;  1SKT A;  1EL4 A;  2L4I A;  1JF0 A;  3E3R A;  2K7D A;  1KSO A;  4L9M A;  1G8I A;  1QIW A;  4I5L B;  1RTP 1;  1XK4 C;  1UHH A;  4YRU A;  1CM1 A;  4QJ5 B;  1N0Y A;  3KHE A;  2JT8 A;  4MEW A;  2BCA A;  2WCB A;  4PHJ A;  1JFJ A;  1F70 A;  1J7P A;  1AJ5 A;  3C1V A;  1UUR A;  3LCP C;  3PM8 A;  1DJX A;  2R2I A;  4IL1 A;  1YX8 A;  3OP0 A;  5AFP A;  1PSB A;  2GGZ A;  3TDI A;  1W7I B;  3EKH A;  1IQ3 A;  4MRY A;  1YTZ C;  2LAN A;  3AAJ A;  1B7T Y;  3BXK A;  4PHK A;  2K2A A;  3OHM B;  3CZT X;  2LLS A;  1B9A A;  3A8R A;  2LHI A;  2BL0 C;  2FCD A;  1OSA A;  1LKJ A;  1VRK A;  2KYF A;  2LMU A;  2LP3 A;  1DGU A;  4AQJ A;  1SR6 B;  2BL0 B;  1NUB A;  2KHN A;  1NP8 A;  1OOJ A;  4HRE E;  5J3X A;  3TZ1 A;  3SG6 A;  2L2E A;  1ZFS A;  2SAS A;  1YUS A;  3OX6 A;  5CPV A;  1UHK A;  1MF8 B;  1TTX A;  3I5G C;  2LLT A;  3PFV A;  1CKK A;  3VRN A;  3I5G B;  3LK1 A;  1CMF A;  1CTR A;  1XYD A;  1J7Q A;  1KQV A;  1CNP A;  4NDD A;  1DF0 B;  3F45 A;  2JWW A;  2ZKM X;  1KFX S;  1Y0V H;  1YUT A;  3JVT C;  4GFT A;  4P2Y B;  2BKH B;  4YGE B;  5D69 A;  3JVT B;  1F8H A;  2ISD A;  1B7T Z;  3AKB A;  1Y1U A;  1OMR A;  3SG5 A;  2RGI A;  5AEQ A;  1OMV A;  4U8D A;  3GOF A;  4N1F A;  2BE4 A;  1UHN A;  1PVA A;  4DUQ A;  1D1O A;  1ZMZ A;  1JC2 A;  1B8C A;  1LVC D;  4GUK A;  5HKW A;  1XA5 A;  4PE0 A;  2FJU B;  5AXI A;  3BOW A;  1GGW A;  2M7N A;  3O78 A;  2KGB C;  1YUU A;  1K2H A;  3CWG A;  1SW8 A;  1NX2 A;  2MA2 A;  4ICB A;  1XFY O;  4YI9 A;  4OCI A;  4C0K A;  1WDC C;  5IBW A;  4QJ3 B;  4OV2 A;  1RFJ A;  1J55 A;  4GBA A;  5F6T A;  1WDC B;  2F33 A;  1DGV A;  2QAC A;  1A03 A;  1K9U A;  2NXQ A;  3VRR A;  2OS8 C;  1OZS A;  1NYA A;  2L98 A;  1A75 A;  4GPL B;  2OS8 B;  4MSP A;  2BKI B;  2JXL A;  1RWY A;  1Y1A A;  3DVM A;  4NDB A;  2LCP A;  1S36 A;  1HQV A;  2Y5I A;  1IKU A;  1XVJ A;  3BUN B;  4YI8 A;  1WY9 A;  2K7C A;  2F3Z A;  1FI6 A;  2E6W A;  2L50 A;  1B4C A;  3WXA A;  4AOM A;  1CLL A;  2K7O A;  3A4U B;  3SIA A;  1SY9 A;  3EVU A;  1UHJ A;  3DD4 A;  3PAT A;  1CDP A;  1DJZ A;  2BCX A;  1IJ6 A;  4PCW A;  1QJT A;  2EC6 C;  2CCM A;  2CXJ A;  4XYN A;  3DVJ A;  2KYC A;  2EC6 B;  2LNK A;  2CTN A;  2F2O A;  2KI6 C;  1AK8 A;  2ZND A;  1NX1 A;  2CT9 A;  2LLU A;  1XO5 A;  2LV7 A;  1UWO A;  2PAL A;  2JXC A;  2KDH A;  2PAS A;  3ZNI A;  2CNP A;  2LUX A;  1LA3 A;  3WNX B;  1TN4 A;  2LVI A;  4PE7 A;  4PHN A;  3TUY C;  4MLW A;  1AVS A;  3IQO A;  2BBM A;  1REC A;  2JTZ A;  3CTN A;  1FF1 A;  3TUY B;  4E68 A;  1BR4 B;  1SBJ A;  1E8A A;  2L4H A;  4JWQ A;  4CFR A;  4DS7 A;  4ORA B;  5D7F A;  4CFQ A;  1EG3 A;  3TDZ A;  1UHI A;  5I2O A;  3I5F C;  2LUC A;  3FS7 A;  3I5F B;  4N5X A;  1F4Q A;  1K90 D;  4XJK A;  3RM1 A;  2MBX A;  1K93 D;  1L7Z A;  3BUO B;  1QX7 A;  3GK1 A;  2FOT A;  1UUS A;  2I2R E;  2JT3 A;  1XFZ O;  2K2F A;  5CSI A;  1JSA A;  3PLF B;  2NCP A;  4I5K A;  4BY4 A;  3DVK A;  2HET A;  1SL8 A;  1BMO A;  3NSL A;  1BOC A;  3PSR A;  1H4B A;  3SG2 A;  1QLK A;  1WLZ A;  2I18 A;  3KEV A;  3SIB A;  1DJG A;  2G2B A;  1A4P A;  2OTG C;  1GJY A;  3LL8 B;  4NDC A;  1NWD A;  1FPW A;  2ZRS A;  1IWQ A;  4MZL A;  3CS1 A;  2MAZ A;  3D10 A;  4JQ0 D;  3TS5 C;  4PDZ A;  4NQG A;  1RK9 A;  1NX3 A;  3FWB A;  2GGM A;  2LVV A;  5I2Q A;  1JFK A;  2AAO A;  2KGR A;  5JOL A;  3O2P A;  3SG3 A;  1F55 A;  1SCV A;  2M7L A;  1CDM A;  2IS9 A;  2LHL A;  3EK7 A;  1SRA A;  2BE6 A;  2LMT A;  2KFH A;  3EK8 A;  3K21 A;  3IF7 A;  1ZAC A;  3GK4 X;  3LLE A;  3BOW B;  2KQY A;  4MZJ A;  1BF5 A;  1SNL A;  1QXP A;  3BYA A;  3FWC A;  2H2K A;  5TNC A;  1C07 A;  1GGZ A;  2HQW A;  1CM4 A;  1OZO A;  1KFU L;  4PAL A;  2KFG A;  4A4C A;  5I8N A;  2B1U A;  2PMY A;  2NLN A;  3ICB A;  1CFC A;  1MQ1 A;  2OPO A;  4DCK A;  1CFF A;  5KTY A;  1QAT A;  1BU3 A;  2MLF C;  1BT6 A;  1A75 B;  1TNP A;  1EJ3 A;  4PHM A;  1OMD A;  1QVI Y;  3DVE A;  2TN4 A;  2ZFD A;  1PUL A;  2PRU A;  4QJ4 B;  3VGO A;  1IH0 A;  5DKR A;  5FYX A;  1S6I A;  1ALV A;  2JUL A;  1R2U A;  2JQ6 A;  1KSM A;  4WQ3 A;  1Y6W A;  2EGD A;  2JU0 A;  2JC2 A;  3I5H C;  5DKQ A;  2H61 A;  1A29 A;  1N2D A;  3I5H B;  1AUI B;  2HQ8 A;  4ORB B;  1B1G A;  2KOT A;  2LVK A;  4N1G A;  1ZUZ A;  2BEC A;  1CDL A;  2LE9 B;  2KQ6 A;  1YRT B;  4MN0 A;  1CLM A;  2KI6 D;  4M2O A;  5KSZ A;  1JBA A;  3OB2 B;  1K9P A;  2EHB A;  3NSO A;  4R1E A;  2M97 A;  1QVI Z;  3EVV A;  1L2O C;  4FTG A;  2JOJ A;  2E30 A;  1YRU B;  2JNF A;  1L2O B;  1NCY A;  1XFV O;  1RRO A;  1SK6 D;  1WRL A;  2D8N A;  1Y1X A;  2F2P A;  1J7R A;  1KK7 Y; 
#chains in the Genus database with same CATH topology
 1QLS A;  4MZK A;  2KSP A;  1B8L A;  4DIR A;  1F71 A;  1CFD A;  5CSF A;  2KBI A;  1J7O A;  2I94 A;  3O4Y A;  1ZOT B;  2KAY A;  1YVL A;  2F8P A;  2WCF A;  4M2Q A;  3DF0 A;  2Y1M A;  4WQ2 A;  4YBH B;  3NXA A;  4MRX A;  1QX5 B;  1TWO A;  2JPO A;  3NSK A;  1K94 A;  1K95 A;  3EK4 A;  3UO9 A;  1AP4 A;  1QV0 A;  3JTD C;  4XJK B;  1TIZ A;  2BBN A;  3SG7 A;  1S3P A;  5KU1 A;  3SG4 A;  2M3W A;  1BR1 B;  2P6B B;  3JTD B;  2MLE C;  3EKJ A;  2I7A A;  2V53 A;  1C7W A;  1JWD A;  1V1F A;  1ODB A;  1C7V A;  2JZI A;  1R6P A;  5I94 A;  1LA0 A;  1U5I A;  3PM2 A;  3QRX A;  4D1E A;  2K7B A;  1DVI A;  5DKN A;  1CB1 A;  2KNE A;  1NCX A;  1CDN A;  1SL7 A;  2NZ0 A;  2SCP A;  4YGC B;  1FBV A;  4F0Z B;  1J1D A;  1TUJ A;  1MXE A;  1F54 A;  2JRF A;  4OVN F;  2BCB A;  2PVB A;  3BUX B;  1G4Y R;  1K96 A;  1KK7 Z;  2M49 B;  1DJI A;  4PT1 A;  1YX7 A;  3HX4 A;  1V1G A;  3RLZ A;  5ER4 X;  3TDU A;  1OOF A;  4YGD B;  1BJF A;  1G33 A;  3KF9 A;  1IRJ A;  2Q4U A;  1SYM A;  1MHO A;  4A4B A;  1TRF A;  3OB1 B;  3D0Y A;  4PE4 A;  3BUW B;  1BLQ A;  4AQI A;  2GV5 A;  3H4S E;  2M9G A;  1TCF A;  5ER5 A;  4M2P A;  2CBL A;  3NSI A;  1QX2 A;  2OTG B;  1OE9 B;  4ORC B;  4PE1 A;  2L51 A;  1PVB A;  3WHU B;  2WCL A;  1B47 A;  1KFX L;  5CSJ A;  1OOH A;  1S1E A;  4JKT A;  2G9B A;  1S26 D;  2L2C A;  4HRG A;  3TS5 B;  4GGF A;  2MRD A;  2KLD A;  1QIV A;  2KAX A;  3DXL A;  5HKY A;  1NPQ A;  2K61 A;  4OZD A;  3PN7 C;  2WCJ A;  5HYD A;  1SPY A;  2HPS A;  1A2X A;  1PRW A;  4I5N B;  1JF2 A;  3PN7 B;  5HLO A;  1EXR A;  1IG5 A;  1K8U A;  1J1E A;  1AJ4 A;  3BFH A;  2WCK A;  1BG1 A;  1M45 A;  2DOQ A;  1MUX A;  1AHR A;  2L5X B;  2LC5 A;  2PQL A;  4HRH A;  1CLB A;  5B8I B;  2ZN8 A;  2AMI A;  5GQQ C;  1SR6 C;  1TCO B;  1UP5 A;  3BQ3 A;  1PSR A;  2K0J A;  1XK4 A;  3LK0 A;  4GNK B;  5G08 A;  5PAL A;  2LP2 A;  1NIW A;  4DRW A;  1S6J A;  1WLM A;  1QTX A;  3MSE B;  4BY5 A;  1LXF C;  2LMV A;  4I5J A;  1PAL A;  4USL A;  2LM5 A;  2WND A;  1QV1 A;  2Q91 A;  2WCH A;  1IIO A;  4YGB B;  1DTL A;  1M31 A;  1S5G Y;  3KO0 A;  1KK8 C;  3S0F A;  2FCE A;  2H61 C;  4MBE A;  4INX A;  3CR4 X;  2BAP A;  3CR2 A;  1DJY A;  1K9K A;  1KK8 B;  1DQE A;  2HF5 A;  4GAO A;  1HT9 A;  2LAP A;  3CLN A;  2L0P A;  2K8M B;  1DJH A;  4TNC A;  3KPX A;  2MJW B;  3VRQ A;  4ZCU A;  1BOD A;  1LIN A;  1TNW A;  2WOS A;  3OGN A;  1XFX O;  2MHH A;  1X02 A;  1DMO A;  2M29 A;  2WCE A;  2KBM A;  1MXL C;  1GM0 A;  1B8R A;  2PSR A;  3HCM A;  5JJG A;  3SJS A;  2F3Y A;  4HSZ A;  3CZ1 A;  1MWN A;  3SS4 A;  1ALW A;  2VRG A;  3PAL A;  1Q80 A;  1YR5 A;  3AAK A;  3IQQ A;  1NX0 A;  4ETO A;  3FIA A;  1M39 A;  1IQ5 A;  1SL9 A;  1EG4 A;  3R72 A;  1DF0 A;  3D75 A;  2JTT A;  3AKA A;  1FI5 A;  4ZCV A;  1S5G Z;  4OR9 B;  1IJ5 A;  3S0D A;  3ZWH A;  1S6C A;  2WOR A;  1CFP A;  2JPT A;  1MR8 A;  1QAS A;  3BUM B;  4C0J A;  4P5O E;  2WC5 A;  4JPZ B;  3D74 A;  1YVH A;  2KAV A;  3DF0 B;  5HLV A;  3S0B A;  2KPH A;  2ZRT A;  2ZN9 A;  4CPV A;  1QS7 A;  3WHT B;  3OX5 A;  4OKH A;  1KFU S;  1M63 B;  3EG5 B;  5I2L A;  1KCY A;  3O6B A;  1N65 A;  2LVJ A;  2M8U A;  3CYZ A;  4Q04 A;  1TUZ A;  1XFU O;  1XFW O;  2JT0 A;  1U5I B;  1YUR A;  4FQO A;  4GGN A;  1DT7 B;  1H8B A;  1OQP A;  4CLN A;  2KI4 C;  3CZ0 A;  3CGA A;  2NCO A;  1PK0 D;  1KWO C;  3FE8 A;  1JUO A;  3GK2 A;  3VRO A;  3EVR A;  5K89 A;  1IGV A;  2KI4 B;  4UPG A;  2JNX A;  4F7F A;  2QDI A;  1KWO B;  3DYE A;  3VRP A;  2COL B;  2WCM A;  1TNX A;  1KQM C;  2WC8 A;  2O5G A;  2Y4Q A;  1CMG A;  3CR5 X;  1SMG A;  3M0W A;  2WC6 A;  4CID A;  1EH2 A;  2H8V A;  1GQM A;  1KQM B;  1RJV A;  5BPJ A;  4MVF A;  1NSH A;  2M1K B;  3NGV A;  1DJW A;  3D0Y B;  1SCM C;  1TNQ A;  1W7J B;  3I5I C;  1WRK A;  2PYQ A;  2AUC A;  5AER A;  3PJI A;  1SCM B;  1F4O A;  3I5I B;  2QEB A;  1TOP A;  1FW4 A;  2ZNE A;  3R1V A;  4WRI A;  2Y1N A;  2M1U A;  2K60 A;  2O60 A;  1NCZ A;  5CSN A;  4YGA A;  2ERB A;  1WRZ A;  2M0R A;  5HKZ A;  1M46 A;  4GGF C;  1DC1 A;  2A4J A;  2QPT A;  2KFF A;  4C0L A;  1SKT A;  2QEV A;  1EL4 A;  3L4A A;  2L4I A;  1JF0 A;  3E3R A;  4INW A;  2K7D A;  1KSO A;  4L9M A;  1G8I A;  1QIW A;  3BJH A;  1LS8 A;  4I5L B;  1RTP 1;  1XK4 C;  1UHH A;  4YRU A;  1CM1 A;  4QJ5 B;  1N0Y A;  3KHE A;  2JT8 A;  4MEW A;  2BCA A;  2WCB A;  4PHJ A;  1JFJ A;  1F70 A;  1J7P A;  1AJ5 A;  3C1V A;  1UUR A;  3LCP C;  3PM8 A;  1DJX A;  2R2I A;  4IL1 A;  1YX8 A;  3OP0 A;  5AFP A;  1PSB A;  1DEK A;  2GGZ A;  3TDI A;  1W7I B;  3EKH A;  1IQ3 A;  4MRY A;  1XFR A;  3FE6 A;  1C3Y A;  1YTZ C;  2LAN A;  3AAJ A;  1B7T Y;  3BXK A;  4PHK A;  1OOG A;  2K2A A;  3OHM B;  3CZT X;  2LLS A;  1B9A A;  3A8R A;  2LHI A;  2BL0 C;  2FCD A;  1OSA A;  1LKJ A;  1VRK A;  2KYF A;  2LMU A;  2LP3 A;  1DGU A;  4AQJ A;  1SR6 B;  2BL0 B;  1NUB A;  2KHN A;  1NP8 A;  1OOJ A;  4HRE E;  5J3X A;  3TZ1 A;  3SG6 A;  2L2E A;  3K1E A;  1ZFS A;  2SAS A;  1YUS A;  3OX6 A;  5CPV A;  1UHK A;  1MF8 B;  3VB1 A;  1TTX A;  3I5G C;  2LLT A;  3PFV A;  1CKK A;  3VRN A;  3I5G B;  3RZS A;  3LK1 A;  1CMF A;  1CTR A;  1XYD A;  1J7Q A;  1KQV A;  1CNP A;  4NDD A;  1DF0 B;  3F45 A;  2JWW A;  2ZKM X;  1KFX S;  1Y0V H;  1YUT A;  3JVT C;  4GFT A;  4P2Y B;  2BKH B;  4YGE B;  5D69 A;  5HL1 A;  2GTE A;  3BFB A;  3D77 A;  3JVT B;  1F8H A;  2ISD A;  1B7T Z;  3AKB A;  5FI2 A;  1Y1U A;  1OMR A;  3SG5 A;  2RGI A;  5AEQ A;  1OMV A;  3D73 A;  3GOF A;  4JD9 A;  4N1F A;  2BE4 A;  4U8D A;  1UHN A;  1PVA A;  4DUQ A;  1D1O A;  1ZMZ A;  1JC2 A;  1B8C A;  1LVC D;  4GUK A;  5HKW A;  1XA5 A;  4PE0 A;  2FJU B;  5AXI A;  3BOW A;  1GGW A;  2M7N A;  3O78 A;  3SS5 A;  2KGB C;  5D3O A;  2P70 A;  1YUU A;  3BFA A;  1K2H A;  3CWG A;  1SW8 A;  1NX2 A;  2MA2 A;  4ICB A;  1XFY O;  4YI9 A;  4OCI A;  4C0K A;  1WDC C;  5IBW A;  3L47 A;  4OV2 A;  4QJ3 B;  1RFJ A;  1J55 A;  4GBA A;  5F6T A;  1WDC B;  2F33 A;  3B86 A;  1DGV A;  2QAC A;  1A03 A;  1K9U A;  2NXQ A;  3VRR A;  4FQT A;  2OS8 C;  1OZS A;  3FE9 A;  1NYA A;  2L98 A;  1A75 A;  4GPL B;  1OW4 A;  2OS8 B;  4MSP A;  2BKI B;  2JXL A;  1RWY A;  1Y1A A;  3DVM A;  4NDB A;  2LCP A;  3Q8I A;  1S36 A;  1HQV A;  2Y5I A;  1IKU A;  1XVJ A;  3BUN B;  1C3Z A;  4YI8 A;  1WY9 A;  2K7C A;  2F3Z A;  1FI6 A;  2E6W A;  3L4L A;  2L50 A;  1B4C A;  3WXA A;  4AOM A;  1CLL A;  2K7O A;  3A4U B;  3SIA A;  1SY9 A;  3EVU A;  1UHJ A;  3DD4 A;  3PAT A;  1CDP A;  3QME A;  1QWV A;  1DJZ A;  2BCX A;  1IJ6 A;  4PCW A;  1QJT A;  2EC6 C;  3OBV A;  2CCM A;  2CXJ A;  4XYN A;  3DVJ A;  3B87 A;  2KYC A;  2EC6 B;  2LNK A;  2CTN A;  2F2O A;  2KI6 C;  1AK8 A;  3NHI A;  2ZND A;  1NX1 A;  2CT9 A;  2LLU A;  1XO5 A;  2LV7 A;  1UWO A;  2PAL A;  2JXC A;  2KDH A;  2PAS A;  3B6X A;  3ZNI A;  3V2L A;  2CNP A;  2LUX A;  1LA3 A;  3WNX B;  1OOI X;  1TN4 A;  2LVI A;  2BNX A;  4PE7 A;  4PHN A;  3TUY C;  4KYN A;  4MLW A;  1AVS A;  3IQO A;  2BBM A;  1REC A;  2JTZ A;  3CTN A;  1FF1 A;  3TUY B;  4E68 A;  1BR4 B;  5EL2 A;  1SBJ A;  1E8A A;  2L4H A;  4JWQ A;  4CFR A;  4DS7 A;  4ORA B;  5D7F A;  4CFQ A;  1EG3 A;  3TDZ A;  1UHI A;  5I2O A;  3I5F C;  2LUC A;  2QEO A;  3FS7 A;  3CAB A;  3I5F B;  4N5X A;  1F4Q A;  1K90 D;  4XJK A;  3RM1 A;  2MBX A;  1K93 D;  1L7Z A;  3BUO B;  1QX7 A;  3GK1 A;  2FOT A;  1UUS A;  2I2R E;  2JT3 A;  1XFZ O;  2K2F A;  5CSI A;  1JSA A;  3D76 A;  5AAN A;  3PLF B;  2NCP A;  4I5K A;  4BY4 A;  3DVK A;  2HET A;  1SL8 A;  1BMO A;  3CZ2 A;  3NSL A;  3PSR A;  1BOC A;  1H4B A;  3SG2 A;  1QLK A;  1WLZ A;  2I18 A;  3KEV A;  3SIB A;  1DJG A;  2G2B A;  1A4P A;  2OTG C;  1GJY A;  3LL8 B;  4NDC A;  3S0A A;  1NWD A;  1FPW A;  2ZRS A;  2QEH A;  3R1O A;  1IWQ A;  2L5Y A;  3S0G A;  3O4X A;  4MZL A;  3CS1 A;  2MAZ A;  3D10 A;  4JQ0 D;  3TS5 C;  4PDZ A;  4NQG A;  1RK9 A;  1NX3 A;  3FWB A;  3UNW A;  2GGM A;  2LVV A;  3CDN A;  3DY9 A;  5I2Q A;  1JFK A;  3B7A A;  2AAO A;  5FI6 A;  3B88 A;  2KGR A;  5JOL A;  3O2P A;  3SG3 A;  1W9Z A;  3N7H A;  1SCV A;  1F55 A;  2M7L A;  1CDM A;  2IS9 A;  2LHL A;  2P71 A;  1SSE B;  3EK7 A;  1SRA A;  1Z4H A;  2BE6 A;  2LMT A;  2KFH A;  3DZT A;  3EK8 A;  3K21 A;  3IF7 A;  1ZAC A;  2FJY A;  3GK4 X;  3LLE A;  3BOW B;  2KQY A;  4MZJ A;  1BF5 A;  1SNL A;  1QXP A;  3BYA A;  3FWC A;  2H2K A;  5TNC A;  3R1P A;  1C07 A;  1GGZ A;  2HQW A;  1CM4 A;  1OZO A;  1KFU L;  1P28 A;  2KFG A;  4PAL A;  4A4C A;  2B1U A;  5I8N A;  2PMY A;  2NLN A;  3ICB A;  1CFC A;  1MQ1 A;  2OPO A;  1DEL A;  4DCK A;  3S0E A;  5KTY A;  1CFF A;  1QAT A;  1BU3 A;  2MLF C;  3IVT A;  1BT6 A;  1A75 B;  5DIC A;  1TNP A;  1EJ3 A;  4PHM A;  1OMD A;  1QVI Y;  3D78 A;  3DVE A;  2TN4 A;  2ZFD A;  1PUL A;  2PRU A;  4QJ4 B;  3VGO A;  1IH0 A;  5DKR A;  5FYX A;  1S6I A;  1ALV A;  2JUL A;  1R2U A;  2JQ6 A;  1KSM A;  4WQ3 A;  3SS3 A;  1Y6W A;  1Z2C B;  2EGD A;  2JU0 A;  2JC2 A;  3I5H C;  5DKQ A;  2H61 A;  2YGU A;  1A29 A;  1N2D A;  3I5H B;  4IJ7 A;  1AUI B;  2HQ8 A;  4ORB B;  1B1G A;  2KOT A;  2LVK A;  4N1G A;  3NHT A;  1ZUZ A;  2BEC A;  1CDL A;  2LE9 B;  2KQ6 A;  1YRT B;  4MN0 A;  1CLM A;  2KI6 D;  4M2O A;  5KSZ A;  1JBA A;  3OB2 B;  1ORG A;  1K9P A;  2EHB A;  3NSO A;  4R1E A;  2M97 A;  1QVI Z;  3EVV A;  1L2O C;  4FTG A;  5FI7 A;  1T14 A;  2JOJ A;  2KLE A;  2E30 A;  1YRU B;  2JNF A;  1L2O B;  1NCY A;  1XFV O;  1RRO A;  1SK6 D;  1WRL A;  2D8N A;  1Y1X A;  2F2P A;  1J7R A;  1KK7 Y; 
#chains in the Genus database with same CATH homology
 1QLS A;  4MZK A;  2KSP A;  1B8L A;  4DIR A;  1F71 A;  1CFD A;  5CSF A;  2KBI A;  1J7O A;  2I94 A;  3O4Y A;  1ZOT B;  2KAY A;  1YVL A;  2F8P A;  2WCF A;  4M2Q A;  3DF0 A;  2Y1M A;  4WQ2 A;  4YBH B;  3NXA A;  4MRX A;  1QX5 B;  5AAN A;  3NSK A;  1K94 A;  1K95 A;  3EK4 A;  1AP4 A;  1QV0 A;  3JTD C;  4XJK B;  1TIZ A;  2BBN A;  3SG7 A;  1S3P A;  5KU1 A;  3SG4 A;  2M3W A;  1BR1 B;  2P6B B;  3JTD B;  2MLE C;  3EKJ A;  2I7A A;  2V53 A;  1C7W A;  1JWD A;  1V1F A;  1ODB A;  1C7V A;  2JZI A;  1R6P A;  1LA0 A;  1U5I A;  3QRX A;  4D1E A;  2K7B A;  1DVI A;  5DKN A;  1CB1 A;  2KNE A;  1NCX A;  1CDN A;  1SL7 A;  2NZ0 A;  2SCP A;  4YGC B;  1FBV A;  4F0Z B;  1J1D A;  1MXE A;  1F54 A;  2JRF A;  4OVN F;  2BCB A;  2PVB A;  3BUX B;  1G4Y R;  1K96 A;  1KK7 Z;  2M49 B;  1DJI A;  1YX7 A;  3HX4 A;  1V1G A;  3RLZ A;  5ER4 X;  3TDU A;  4YGD B;  1BJF A;  1G33 A;  3KF9 A;  1IRJ A;  2Q4U A;  1SYM A;  1MHO A;  4A4B A;  1TRF A;  3OB1 B;  3D0Y A;  4PE4 A;  3BUW B;  1BLQ A;  4AQI A;  2GV5 A;  3H4S E;  2M9G A;  1TCF A;  5ER5 A;  4M2P A;  2CBL A;  3NSI A;  1QX2 A;  2OTG B;  1OE9 B;  4ORC B;  4PE1 A;  2L51 A;  1PVB A;  3WHU B;  1B47 A;  1KFX L;  5CSJ A;  1S1E A;  2G9B A;  1S26 D;  4HRG A;  3TS5 B;  4GGF A;  2MRD A;  1QIV A;  2KAX A;  5HKY A;  1NPQ A;  2K61 A;  3PN7 C;  5HYD A;  1SPY A;  2HPS A;  1A2X A;  1PRW A;  4I5N B;  1JF2 A;  3PN7 B;  5HLO A;  1EXR A;  1IG5 A;  1K8U A;  1J1E A;  1AJ4 A;  1BG1 A;  1M45 A;  2DOQ A;  1MUX A;  1AHR A;  2L5X B;  2LC5 A;  4HRH A;  1CLB A;  5B8I B;  2ZN8 A;  2AMI A;  5GQQ C;  1SR6 C;  1TCO B;  1UP5 A;  3BQ3 A;  1PSR A;  2K0J A;  1XK4 A;  3LK0 A;  4GNK B;  5G08 A;  5PAL A;  2LP2 A;  1NIW A;  4DRW A;  1S6J A;  1WLM A;  1QTX A;  3MSE B;  4BY5 A;  1LXF C;  2LMV A;  4I5J A;  1PAL A;  4USL A;  2LM5 A;  2WND A;  1QV1 A;  2Q91 A;  4YGB B;  1DTL A;  1M31 A;  1S5G Y;  3KO0 A;  1KK8 C;  2FCE A;  2H61 C;  4MBE A;  3CR4 X;  3CR2 A;  1DJY A;  1K9K A;  1KK8 B;  4GAO A;  2HF5 A;  1HT9 A;  2LAP A;  3CLN A;  2L0P A;  2K8M B;  1DJH A;  4TNC A;  3KPX A;  2MJW B;  3VRQ A;  4ZCU A;  1BOD A;  1LIN A;  1TNW A;  2WOS A;  1XFX O;  2MHH A;  1X02 A;  1DMO A;  2M29 A;  2WCE A;  2KBM A;  1MXL C;  1B8R A;  2PSR A;  3HCM A;  5JJG A;  3SJS A;  2F3Y A;  4HSZ A;  1MWN A;  1ALW A;  2VRG A;  3PAL A;  1Q80 A;  1YR5 A;  3AAK A;  3IQQ A;  1NX0 A;  4ETO A;  3FIA A;  1M39 A;  1IQ5 A;  1SL9 A;  1EG4 A;  1DF0 A;  2JTT A;  3AKA A;  1FI5 A;  4ZCV A;  1S5G Z;  4OR9 B;  1IJ5 A;  3ZWH A;  1S6C A;  2WOR A;  1CFP A;  2JPT A;  1MR8 A;  1QAS A;  3BUM B;  4C0J A;  4P5O E;  4JPZ B;  1YVH A;  2KAV A;  3DF0 B;  5HLV A;  2ZRT A;  2ZN9 A;  4CPV A;  1QS7 A;  3WHT B;  3OX5 A;  4OKH A;  1KFU S;  1M63 B;  5I2L A;  1KCY A;  3O6B A;  1N65 A;  2LVJ A;  2M8U A;  4Q04 A;  1XFU O;  1XFW O;  2JT0 A;  1U5I B;  1YUR A;  4FQO A;  4GGN A;  1DT7 B;  1H8B A;  1OQP A;  4CLN A;  2KI4 C;  3CGA A;  2NCO A;  1PK0 D;  1KWO C;  1JUO A;  3GK2 A;  3VRO A;  3EVR A;  5K89 A;  1IGV A;  2KI4 B;  4UPG A;  2JNX A;  3VRP A;  1KWO B;  2COL B;  1TNX A;  1KQM C;  2WC8 A;  2O5G A;  2Y4Q A;  1CMG A;  3CR5 X;  1SMG A;  3M0W A;  1EH2 A;  4CID A;  1GQM A;  1KQM B;  1RJV A;  5BPJ A;  4MVF A;  1NSH A;  2M1K B;  1DJW A;  3D0Y B;  1SCM C;  1TNQ A;  1W7J B;  3I5I C;  1WRK A;  5AER A;  2AUC A;  1SCM B;  1F4O A;  3I5I B;  1TOP A;  1FW4 A;  2ZNE A;  4WRI A;  2Y1N A;  2M1U A;  2O60 A;  1NCZ A;  5CSN A;  4YGA A;  1WRZ A;  2M0R A;  5HKZ A;  1M46 A;  4GGF C;  2A4J A;  2QPT A;  2KFF A;  4C0L A;  1SKT A;  1EL4 A;  2L4I A;  1JF0 A;  3E3R A;  2K7D A;  1KSO A;  4L9M A;  1G8I A;  1QIW A;  4I5L B;  1RTP 1;  1XK4 C;  1UHH A;  4YRU A;  1CM1 A;  4QJ5 B;  1N0Y A;  3KHE A;  2JT8 A;  4MEW A;  2BCA A;  2WCB A;  4PHJ A;  1JFJ A;  1F70 A;  1J7P A;  1AJ5 A;  3C1V A;  1UUR A;  3LCP C;  3PM8 A;  1DJX A;  2R2I A;  4IL1 A;  1YX8 A;  3OP0 A;  5AFP A;  1PSB A;  2GGZ A;  3TDI A;  1W7I B;  3EKH A;  1IQ3 A;  4MRY A;  1YTZ C;  2LAN A;  3AAJ A;  1B7T Y;  3BXK A;  4PHK A;  2K2A A;  3OHM B;  3CZT X;  2LLS A;  1B9A A;  3A8R A;  2LHI A;  2BL0 C;  2FCD A;  1OSA A;  1LKJ A;  1VRK A;  2KYF A;  2LMU A;  2LP3 A;  1DGU A;  4AQJ A;  1SR6 B;  2BL0 B;  1NUB A;  2KHN A;  1NP8 A;  1OOJ A;  4HRE E;  5J3X A;  3TZ1 A;  3SG6 A;  2L2E A;  1ZFS A;  2SAS A;  1YUS A;  3OX6 A;  5CPV A;  1UHK A;  1MF8 B;  1TTX A;  3I5G C;  2LLT A;  3PFV A;  1CKK A;  3VRN A;  3I5G B;  3LK1 A;  1CMF A;  1CTR A;  1XYD A;  1J7Q A;  1KQV A;  1CNP A;  4NDD A;  1DF0 B;  3F45 A;  2JWW A;  2ZKM X;  1KFX S;  1Y0V H;  1YUT A;  3JVT C;  4GFT A;  4P2Y B;  2BKH B;  4YGE B;  5D69 A;  3JVT B;  1F8H A;  2ISD A;  1B7T Z;  3AKB A;  1Y1U A;  1OMR A;  3SG5 A;  2RGI A;  5AEQ A;  1OMV A;  4U8D A;  3GOF A;  4N1F A;  2BE4 A;  1UHN A;  1PVA A;  4DUQ A;  1D1O A;  1ZMZ A;  1JC2 A;  1B8C A;  1LVC D;  4GUK A;  5HKW A;  1XA5 A;  4PE0 A;  2FJU B;  5AXI A;  3BOW A;  1GGW A;  2M7N A;  3O78 A;  2KGB C;  1YUU A;  1K2H A;  3CWG A;  1SW8 A;  1NX2 A;  2MA2 A;  4ICB A;  1XFY O;  4YI9 A;  4OCI A;  4C0K A;  1WDC C;  5IBW A;  4QJ3 B;  4OV2 A;  1RFJ A;  1J55 A;  4GBA A;  5F6T A;  1WDC B;  2F33 A;  1DGV A;  2QAC A;  1A03 A;  1K9U A;  2NXQ A;  3VRR A;  2OS8 C;  1OZS A;  1NYA A;  2L98 A;  1A75 A;  4GPL B;  2OS8 B;  4MSP A;  2BKI B;  2JXL A;  1RWY A;  1Y1A A;  3DVM A;  4NDB A;  2LCP A;  1S36 A;  1HQV A;  2Y5I A;  1IKU A;  1XVJ A;  3BUN B;  4YI8 A;  1WY9 A;  2K7C A;  2F3Z A;  1FI6 A;  2E6W A;  2L50 A;  1B4C A;  3WXA A;  4AOM A;  1CLL A;  2K7O A;  3A4U B;  3SIA A;  1SY9 A;  3EVU A;  1UHJ A;  3DD4 A;  3PAT A;  1CDP A;  1DJZ A;  2BCX A;  1IJ6 A;  4PCW A;  1QJT A;  2EC6 C;  2CCM A;  2CXJ A;  4XYN A;  3DVJ A;  2KYC A;  2EC6 B;  2LNK A;  2CTN A;  2F2O A;  2KI6 C;  1AK8 A;  2ZND A;  1NX1 A;  2CT9 A;  2LLU A;  1XO5 A;  2LV7 A;  1UWO A;  2PAL A;  2JXC A;  2KDH A;  2PAS A;  3ZNI A;  2CNP A;  2LUX A;  1LA3 A;  3WNX B;  1TN4 A;  2LVI A;  4PE7 A;  4PHN A;  3TUY C;  4MLW A;  1AVS A;  3IQO A;  2BBM A;  1REC A;  2JTZ A;  3CTN A;  1FF1 A;  3TUY B;  4E68 A;  1BR4 B;  1SBJ A;  1E8A A;  2L4H A;  4JWQ A;  4CFR A;  4DS7 A;  4ORA B;  5D7F A;  4CFQ A;  1EG3 A;  3TDZ A;  1UHI A;  5I2O A;  3I5F C;  2LUC A;  3FS7 A;  3I5F B;  4N5X A;  1F4Q A;  1K90 D;  4XJK A;  3RM1 A;  2MBX A;  1K93 D;  1L7Z A;  3BUO B;  1QX7 A;  3GK1 A;  2FOT A;  1UUS A;  2I2R E;  2JT3 A;  1XFZ O;  2K2F A;  5CSI A;  1JSA A;  3PLF B;  2NCP A;  4I5K A;  4BY4 A;  3DVK A;  2HET A;  1SL8 A;  1BMO A;  3NSL A;  1BOC A;  3PSR A;  1H4B A;  3SG2 A;  1QLK A;  1WLZ A;  2I18 A;  3KEV A;  3SIB A;  1DJG A;  2G2B A;  1A4P A;  2OTG C;  1GJY A;  3LL8 B;  4NDC A;  1NWD A;  1FPW A;  2ZRS A;  1IWQ A;  4MZL A;  3CS1 A;  2MAZ A;  3D10 A;  4JQ0 D;  3TS5 C;  4PDZ A;  4NQG A;  1RK9 A;  1NX3 A;  3FWB A;  2GGM A;  2LVV A;  5I2Q A;  1JFK A;  2AAO A;  2KGR A;  5JOL A;  3O2P A;  3SG3 A;  1F55 A;  1SCV A;  2M7L A;  1CDM A;  2IS9 A;  2LHL A;  3EK7 A;  1SRA A;  2BE6 A;  2LMT A;  2KFH A;  3EK8 A;  3K21 A;  3IF7 A;  1ZAC A;  3GK4 X;  3LLE A;  3BOW B;  2KQY A;  4MZJ A;  1BF5 A;  1SNL A;  1QXP A;  3BYA A;  3FWC A;  2H2K A;  5TNC A;  1C07 A;  1GGZ A;  2HQW A;  1CM4 A;  1OZO A;  1KFU L;  4PAL A;  2KFG A;  4A4C A;  5I8N A;  2B1U A;  2PMY A;  2NLN A;  3ICB A;  1CFC A;  1MQ1 A;  2OPO A;  4DCK A;  1CFF A;  5KTY A;  1QAT A;  1BU3 A;  2MLF C;  1BT6 A;  1A75 B;  1TNP A;  1EJ3 A;  4PHM A;  1OMD A;  1QVI Y;  3DVE A;  2TN4 A;  2ZFD A;  1PUL A;  2PRU A;  4QJ4 B;  3VGO A;  1IH0 A;  5DKR A;  5FYX A;  1S6I A;  1ALV A;  2JUL A;  1R2U A;  2JQ6 A;  1KSM A;  4WQ3 A;  1Y6W A;  2EGD A;  2JU0 A;  2JC2 A;  3I5H C;  5DKQ A;  2H61 A;  1A29 A;  1N2D A;  3I5H B;  1AUI B;  2HQ8 A;  4ORB B;  1B1G A;  2KOT A;  2LVK A;  4N1G A;  1ZUZ A;  2BEC A;  1CDL A;  2LE9 B;  2KQ6 A;  1YRT B;  4MN0 A;  1CLM A;  2KI6 D;  4M2O A;  5KSZ A;  1JBA A;  3OB2 B;  1K9P A;  2EHB A;  3NSO A;  4R1E A;  2M97 A;  1QVI Z;  3EVV A;  1L2O C;  4FTG A;  2JOJ A;  2E30 A;  1YRU B;  2JNF A;  1L2O B;  1NCY A;  1XFV O;  1RRO A;  1SK6 D;  1WRL A;  2D8N A;  1Y1X A;  2F2P A;  1J7R A;  1KK7 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...