1TTXA

Solution structure of human beta parvalbumin (oncomodulin) refined with a paramagnetism based strategy
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Oncomodulin
publication title Solution Structure of Human beta-Parvalbumin and Structural Comparison with Its Paralog alpha-Parvalbumin and with Their Rat Orthologs(,)
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ttxA00
1EJ3A 4WQ2A 4AQIA 1LA0A 4ZCUA 1G8IA 3TDUA 4CFQA 1R2UA 2I2RE 1ALVA 1IGVA 1G33A 1SL9A 1YUTA 2JT0A 3IQQA 4TNCA 1SRAA 1S6CA 3RLZA 1S6IA 4YGAA 2KAYA 1M46A 4M2QA 1PVAA 1AUIB 1WY9A 3EK7A 2Q4UA 3NSOA 3JTDC 1IJ6A 1K95A 2LHLA 1Q80A 2L5XB 1IG5A 2ISDA 2M8UA 5KSZA 1J7PA 3DVKA 1YVLA 2M7LA 3O78A 2MBXA 1QATA 3PALA 4N1FA 1BF5A 4I5JA 3BYAA 2K7DA 3SG7A 2HQWA 3HCMA 2MLFC 2F3ZA 5CSNA 4BY4A 3NXAA 1FPWA 2L51A 1MXLC 1A4PA 4PALA 5HLOA 5I2LA 3I5FC 1B9AA 1OZSA 1A75A 1RTP1 1K9KA 2KI6D 2FOTA 1XA5A 2Y4QA 1PULA 1UHIA 3EK8A 4P5OE 2CNPA 1EG3A 1KCYA 4QJ4B 2LLSA 2O5GA 1K9UA 4MVFA 5KU1A 1DMOA 3KF9A 1B7TY 2LLUA 3SJSA 1N0YA 4PE0A 2ZFDA 4YI9A 3SIAA 2R2IA 4MZLA 1W7IB 1TIZA 3D0YA 2FCDA 2ZRSA 3A8RA 1IKUA 1OMVA 1XK4A 3I5IC 1ZUZA 1WLMA 2BBMA 1OMDA 5D69A 4DRWA 2H61C 2KAXA 2LMUA 3WXAA 3TUYC 4YGEB 3EVUA 1Y1AA 5AERA 5AFPA 2LANA 1XVJA 2EC6B 2F2OA 1CB1A 1DJYA 3IF7A 1F55A 1JSAA 5ER4X 2L2EA 4U8DA 1DGVA 2JOJA 1B8RA 4BY5A 2LVJA 2LUCA 2CT9A 3PN7C 3SG3A 2LVKA 5JJGA 1MUXA 1S36A 1UHHA 2H61A 3FS7A 2KFFA 3LCPC 2JRFA 2BCBA 1BJFA 2PMYA 4MN0A 3AKBA 5AXIA 4MRXA 3TS5C 1DVIA 1M39A 1BR1B 4OCIA 2M97A 2EGDA 1PALA 1KWOB 2MJWB 3OB2B 1TCFA 1X02A 2BKHB 5I8NA 1KQMB 1F4OA 2AUCA 3ZNIA 4HRGA 1CLLA 4UPGA 1FF1A 2SASA 1NYAA 1JUOA 3EKHA 3VRQA 1UHJA 2WC8A 3GOFA 3KHEA 1BT6A 3K21A 1K94A 2SCPA 3D10A 5HLVA 2VRGA 1NCZA 2M1KB 5DKRA 1UHKA 4FQOA 2EHBA 3OHMB 2ZN8A 4NQGA 3NSIA 3O2PA 3O6BA 1CFFA 3DF0B 1S26D 5J3XA 1J7QA 4HREE 1JFKA 2LNKA 2M7NA 1QV1A 5CSFA 1L2OC 1YRTB 1SKTA 2PALA 3CLNA 3LLEA 4MZJA 1SCMB 3DVJA 2P6BB 2WORA 5IBWA 3CGAA 3KO0A 1V1GA 1DF0B 1SCVA 2KYCA 2L4HA 2M49B 2JNFA 1CKKA 1RFJA 1N2DA 5DKQA 1PK0D 3CR4X 2MA2A 1XFZO 1GGWA 3VROA 1HQVA 2KFHA 4DUQA 2JZIA 1ODBA 1CMFA 1S5GZ 1JWDA 4HSZA 1NX0A 2LMVA 3DVEA 2OPOA 5CSJA 1PSBA 2F2PA 4PCWA 1K8UA 1DGUA 3BQ3A 1TOPA 1CFCA 4PHKA 2ZRTA 3VGOA 1QS7A 3BOWB 4QJ5B 1M63B 3GK4X 3PSRA 1MF8B 2JU0A 1F8HA 4MRYA 1GQMA 2KI6C 1XFYO 2FJUB 1R6PA 1MWNA 3AKAA 3LL8B 3TZ1A 1SL8A 2K0JA 2KQYA 1NWDA 1V1FA 1L7ZA 4OVNF 3BUMB 2KNEA 3E3RA 1AHRA 4XJKA 2ZNDA 2I18A 2PRUA 2G9BA 2K61A 2LP2A 2BKIB 3CTNA 4M2OA 5I2QA 1MQ1A 2I94A 2OS8B 2KFGA 1IRJA 1MR8A 4N1GA 1CFDA 1QTXA 2JTZA 1BR4B 2KDHA 4PE1A 1OE9B 4PHNA 1XYDA 2NZ0A 3QRXA 1TNXA 5CSIA 2B1UA 1SR6B 4JPZB 3CR2A 1U5IA 2KYFA 4NDDA 1TTXA 2AMIA 2MHHA 3FWBA 1ALWA 1CDLA 1J7OA 4L9MA 2PASA 3OP0A 4GFTA 2K2AA 4CPVA 1KFXL 1QASA 2KOTA 4PHMA 4DS7A 4I5KA 4WRIA 4XYNA 1UHNA 1SR6C 2M9GA 4GGFC 1TNPA 3M0WA 1SYMA 1ZFSA 2LE9B 2BECA 2KHNA 2F3YA 1QVIY 4HRHA 1DJIA 2O60A 1B8LA 2LM5A 4MLWA 1B4CA 1XFVO 1AJ5A 2JC2A 1PSRA 1ZOTB 2JTTA 2L50A 2I7AA 3WNXB 4QJ3B 1OMRA 2WCBA 2EC6C 5CPVA 2BE4A 4NDBA 1UP5A 1DJGA 1XFXO 1M45A 2AAOA 4GUKA 4MZKA 2LLTA 2LVVA 4JWQA 1C7WA 1FI6A 4GBAA 1GGZA 4ZCVA 3PATA 2WOSA 2KGBC 1NSHA 2NLNA 4GPLB 1M31A 3A4UB 1SK6D 2Q91A 2QPTA 1SY9A 1N65A 2E6WA 2JQ6A 1EH2A 1B7TZ 1UUSA 4PHJA 1YUSA 2L4IA 1SW8A 1W7JB 1WDCB 2NXQA 2OTGB 3CZTX 5DKNA 3RM1A 1OZOA 2M3WA 4I5LB 4ORBB 4PE4A 1G4YR 1KWOC 2WNDA 1A29A 1K9PA 1S1EA 1SBJA 2G2BA 1KQMC 2GGMA 3GK2A 1YURA 2CXJA 1YTZC 4PE7A 1H8BA 3TDZA 4MSPA 3NSKA 4Q04A 1UURA 5B8IB 1JBAA 1KQVA 1GJYA 1K96A 1D1OA 2BL0B 1SNLA 2KQ6A 1KK7Y 1CDMA 2LVIA 1KFUS 1K2HA 2HF5A 4NDCA 2Y5IA 5HKWA 1CDNA 2BCAA 4AOMA 1BMOA 1YR5A 2L0PA 3I5GB 3LK1A 2NCPA 1YRUB 5KTYA 2LP3A 2GV5A 3DVMA 1LA3A 1CLBA 3SG4A 4GGNA 4MBEA 1CLMA 3JVTB 3SIBA 1J1EA 1SCMC 1TRFA 1F4QA 3BUOB 1J7RA 1K90D 1EXRA 1Y6WA 5K89A 5D7FA 1HT9A 3NSLA 3BXKA 1A03A 2KSPA 5TNCA 1AVSA 2IS9A 4D1EA 3AAKA 3DF0A 3LK0A 4P2YB 3I5HB 1QLSA 4PDZA 1BOCA 2KI4B 5HKYA 1Y1UA 1DJHA 2KAVA 1B8CA 2MLEC 5PALA 3C1VA 3EVRA 1BLQA 2LAPA 1S6JA 2H2KA 4A4CA 1NX3A 1EL4A 3FIAA 1F54A 2JT3A 1NX2A 1DF0A 1IQ3A 2MAZA 2KI4C 2ZN9A 3VRPA 1ZMZA 3WHUB 1QIVA 3JTDB 4XJKB 4C0LA 1BU3A 2BBNA 4ORAB 1A75B 2E30A 1KK7Z 3BUWB 1YVHA 3EKJA 4OR9B 1IWQA 2KBMA 4A4BA 1A2XA 1VRKA 3IQOA 4ETOA 1CM4A 4CIDA 3SG2A 4YGDB 1RK9A 4R1EA 1KFXS 5F6TA 2CBLA 3F45A 4DCKA 1XFUO 3BOWA 1J1DA 2JWWA 4CLNA 1U5IB 1QXPA 1CDPA 1JFJA 3I5FB 5FYXA 3PFVA 5GQQC 2K2FA 3D0YB 1LINA 1IH0A 1IJ5A 1J55A 2OS8C 4AQJA 3MSEB 1EG4A 2BCXA 2QACA 3OX5A 4CFRA 1B1GA 1WRKA 2CTNA 2JNXA 1OQPA 1NCYA 3KEVA 4N5XA 1CTRA 2BE6A 3H4SE 3WHTB 1F71A 4YGCB 1TN4A 1XK4C 4ICBA 2LMTA 1SMGA 1LKJA 3DD4A 1XO5A 2DOQA 4FTGA 1RWYA 2LV7A 3SG5A 1BODA 1BG1A 5I2OA 3I5IB 5AEQA 1QV0A 2KBIA 2JPTA 1DTLA 2RGIA 1DJWA 2ZKMX 1NCXA 4USLA 1OOJA 3TUYB 2ZNEA 4ORCB 5AANA 1UWOA 1TNWA 1NX1A 1SL7A 3PM8A 2A4JA 3SG6A 2CCMA 5JOLA 2Y1NA 2F33A 4GGFA 1CNPA 3VRNA 1K93D 1Y0VH 4I5NB 1CFPA 1NP8A 1NUBA 1QLKA 4YGBB 1OSAA 4GAOA 5HKZA 1JF0A 2WCFA 2MRDA 3PN7B 2JULA 3VRRA 4YRUA 1QIWA 1QX5B 3OB1B 1IQ5A 5ER5A 1DJZA 2PSRA 2GGZA 2HETA 1DT7B 1NIWA 1JC2A 3TS5B 4OV2A 2WCEA 2JXLA 1LVCD 2K7OA 1PRWA 3ZWHA 1AJ4A 2HPSA 1LXFC 1KK8B 4YI8A 2K7BA 1YX7A 2D8NA 2M1UA 2LUXA 3CWGA 1E8AA 1SPYA 1RECA 2NCOA 1NPQA 1H4BA 1WRZA 3BUXB 1WDCC 1F70A 5HYDA 2L98A 2OTGC 4E68A 1S5GY 1KSMA 1FBVA 2F8PA 4F0ZB 1C07A 1KK8C 1QX2A 1FW4A 2JT8A 1QVIZ 3ICBA 1RJVA 3KPXA 4YBHB 2V53A 1B47A 3HX4A 2K8MB 2M0RA 3CS1A 2FCEA 2PVBA 3TDIA 1XFWO 3CR5X 4OKHA 3EVVA 1ZACA 2LCPA 4C0KA 2BL0C 1TNQA 1WRLA 4GNKB 1L2OB 1MHOA 1WLZA 1CMGA 2KGRA 1PVBA 1C7VA 3AAJA 2COLB 1FI5A 3OX6A 5BPJA 4DIRA 1RROA 3I5GC 3BUNB 2K7CA 1YX8A 2M29A 4WQ3A 1AK8A 1MXEA 3JVTC 3GK1A 1AP4A 1KSOA 1QX7A 4M2PA 3FWCA 2Y1MA 1JF2A 1S3PA 2JXCA 5G08A 1Y1XA 2HQ8A 4IL1A 1TCOB 3PLFB 3EK4A 2TN4A 4C0JA 1CM1A 4JQ0D 1YUUA 1QJTA 2LHIA 3O4YA 4MEWA 2LC5A 3I5HC 1KFUL 1DJXA
chains in the Genus database with same CATH superfamily
3R1PA 3DYEA 1EJ3A 4WQ2A 4AQIA 1LA0A 4ZCUA 1G8IA 3TDUA 4CFQA 1R2UA 2I2RE 1ALVA 1IGVA 1G33A 1SL9A 1YUTA 2GTEA 2JT0A 3IQQA 4TNCA 4INXA 1SRAA 1S6CA 3RLZA 1S6IA 4YGAA 2KAYA 1M46A 4M2QA 1PVAA 1AUIB 1WY9A 3EK7A 2Q4UA 3NSOA 3JTDC 1IJ6A 1K95A 2LHLA 1Q80A 2L5XB 1IG5A 2ISDA 3SS5A 2M8UA 5KSZA 1J7PA 3DVKA 1YVLA 2M7LA 3O78A 2MBXA 1QATA 3PALA 4N1FA 1BF5A 4I5JA 3BYAA 2K7DA 3SG7A 4INWA 2HQWA 3HCMA 2MLFC 2F3ZA 5CSNA 3R1OA 3FE8A 3NXAA 4BY4A 2L51A 1FPWA 1MXLC 1A4PA 4PALA 5HLOA 5I2LA 3L4LA 3I5FC 1B9AA 1OZSA 1A75A 1C3YA 1RTP1 1K9KA 2KI6D 2FOTA 3SS4A 1XA5A 2Y4QA 1PULA 1UHIA 3EK8A 4P5OE 2CNPA 1EG3A 1KCYA 4QJ4B 2LLSA 2O5GA 1K9UA 4MVFA 5KU1A 1DMOA 3KF9A 1B7TY 2LLUA 3SJSA 1N0YA 4PE0A 1W9ZA 2ZFDA 4YI9A 3SIAA 2R2IA 4MZLA 1W7IB 1TIZA 3D0YA 2FCDA 2ZRSA 3A8RA 1IKUA 1OMVA 1XK4A 3I5IC 1ZUZA 1WLMA 2BBMA 3QMEA 1OMDA 5D69A 4DRWA 2H61C 2KAXA 2LMUA 3WXAA 3TUYC 3Q8IA 4YGEB 3EVUA 1Y1AA 5AERA 3S0EA 5AFPA 2LANA 1XVJA 2EC6B 2KLDA 1SSEB 2F2OA 1DJYA 3IF7A 1CB1A 1F55A 3D76A 1JSAA 5ER4X 2L2EA 4U8DA 1DGVA 2JOJA 3PM2A 1B8RA 4BY5A 2LVJA 2LUCA 2CT9A 3PN7C 3R72A 3SG3A 2LVKA 5JJGA 1MUXA 1S36A 1UHHA 2H61A 3FS7A 2KFFA 3LCPC 2JRFA 2BCBA 1BJFA 2PMYA 4MN0A 3AKBA 5AXIA 4MRXA 3TS5C 1DVIA 1M39A 3FE6A 1BR1B 4OCIA 2L5YA 2M97A 3OBVA 2EGDA 1PALA 1KWOB 2MJWB 3B6XA 3OB2B 1TCFA 1X02A 2BKHB 5I8NA 1KQMB 1F4OA 2AUCA 3ZNIA 4HRGA 1CLLA 4UPGA 1FF1A 2SASA 1NYAA 1JUOA 3EKHA 1GM0A 3VRQA 1UHJA 2WC8A 3GOFA 3KHEA 1BT6A 3K21A 1K94A 3OGNA 2SCPA 3D10A 5HLVA 2VRGA 1NCZA 2M1KB 5DKRA 1UHKA 2KLEA 4FQOA 2EHBA 3OHMB 2ZN8A 4NQGA 3NSIA 3O2PA 3O6BA 1CFFA 3DF0B 1S26D 5J3XA 5I94A 4HREE 1J7QA 1JFKA 2LNKA 2M7NA 1QV1A 5CSFA 1L2OC 1YRTB 1SKTA 2PALA 3CLNA 3D73A 3LLEA 4MZJA 1SCMB 3DVJA 2P6BB 2WORA 5IBWA 3CGAA 3KO0A 1V1GA 3L4AA 1DF0B 1SCVA 2KYCA 2L4HA 2M49B 5FI7A 2JNFA 1CKKA 1RFJA 1N2DA 5DKQA 1PK0D 3CR4X 2MA2A 1XFZO 1GGWA 3VROA 1HQVA 2KFHA 4DUQA 2JZIA 1ODBA 1CMFA 1S5GZ 1JWDA 1DQEA 4HSZA 3S0FA 1NX0A 2LMVA 3DVEA 2OPOA 1T14A 5CSJA 1PSBA 2F2PA 4PCWA 1K8UA 1DGUA 3BQ3A 1TOPA 4KYNA 1CFCA 4PHKA 2ZRTA 3VGOA 1QS7A 3BOWB 4QJ5B 1M63B 3GK4X 3PSRA 1MF8B 2JU0A 1F8HA 4MRYA 3S0BA 2QEVA 1GQMA 2KI6C 3O4XA 1QWVA 1XFYO 2FJUB 1R6PA 1MWNA 2BAPA 3AKAA 3LL8B 3B7AA 2WCMA 2L2CA 3TZ1A 3BFHA 3CZ2A 3NHTA 1SL8A 2K0JA 2KQYA 1NWDA 1V1FA 1L7ZA 4OVNF 3BUMB 2KNEA 3E3RA 1AHRA 3NGVA 4XJKA 2ZNDA 2I18A 3PJIA 2PRUA 2G9BA 3D74A 2JPOA 2K61A 2LP2A 2BKIB 3CTNA 4M2OA 5I2QA 1MQ1A 2I94A 2QDIA 2OS8B 2KFGA 1IRJA 1MR8A 3NHIA 4N1GA 3V2LA 1CFDA 3R1VA 1QTXA 2JTZA 1BR4B 2KDHA 4PE1A 1OE9B 4PHNA 1XYDA 2NZ0A 3QRXA 1TNXA 3D77A 5CSIA 2B1UA 1OOFA 1SR6B 4JPZB 3CR2A 1U5IA 2KYFA 4NDDA 1TTXA 2AMIA 2MHHA 3FWBA 1ALWA 1CDLA 1J7OA 4L9MA 2PASA 3OP0A 4GFTA 1DELA 2K2AA 4CPVA 1KFXL 1QASA 2KOTA 4PHMA 4DS7A 4I5KA 2WCJA 4WRIA 4XYNA 3B88A 2PYQA 1UHNA 1SR6C 2M9GA 4GGFC 3SS3A 4IJ7A 1TNPA 3M0WA 1SYMA 1ZFSA 2LE9B 2BECA 2KHNA 2F3YA 1QVIY 4HRHA 1DJIA 2O60A 1B8LA 2ERBA 2LM5A 4MLWA 1B4CA 1XFVO 1AJ5A 2JC2A 1PSRA 1ZOTB 2BNXA 2JTTA 2I7AA 2L50A 4QJ3B 3WNXB 1OMRA 3K1EA 2WCBA 2EC6C 5CPVA 2BE4A 4NDBA 2P70A 1UP5A 1DJGA 1XFXO 1M45A 2AAOA 4GUKA 3DY9A 4MZKA 2LLTA 2LVVA 4JWQA 1C3ZA 1DEKA 1C7WA 1FI6A 2H8VA 4GBAA 1GGZA 1IIOA 4ZCVA 3PATA 2WOSA 2KGBC 1NSHA 2NLNA 4GPLB 1M31A 3A4UB 5HL1A 1SK6D 2Q91A 2QPTA 1SY9A 1N65A 2E6WA 2JQ6A 1EH2A 1B7TZ 1UUSA 4PHJA 1YUSA 2L4IA 1SW8A 1W7JB 1WDCB 2NXQA 2OTGB 3CZTX 5DKNA 3RM1A 1OZOA 2M3WA 4I5LB 4ORBB 4PE4A 3UO9A 1G4YR 1KWOC 2WNDA 1A29A 1K9PA 1S1EA 4JD9A 1SBJA 2G2BA 1KQMC 2GGMA 3GK2A 1YURA 2CXJA 1YTZC 3CZ1A 4PE7A 3TDZA 1H8BA 4MSPA 3NSKA 4Q04A 1UURA 4FQTA 5B8IB 1Z4HA 3N7HA 1JBAA 1KQVA 1GJYA 2YGUA 1K96A 1P28A 1D1OA 2BL0B 3IVTA 1SNLA 2KQ6A 1KK7Y 1CDMA 2LVIA 1KFUS 1K2HA 2HF5A 4NDCA 2Y5IA 5HKWA 1CDNA 3BFAA 2BCAA 4AOMA 1BMOA 1YR5A 2L0PA 3I5GB 1DC1A 3LK1A 2NCPA 1YRUB 5KTYA 2LP3A 2GV5A 3DVMA 1LA3A 1CLBA 3SG4A 4GGNA 4MBEA 1CLMA 3JVTB 3SIBA 1J1EA 1SCMC 1TRFA 1F4QA 3BUOB 1J7RA 1K90D 1EXRA 1Y6WA 5K89A 1TUJA 3S0DA 5D7FA 1HT9A 3NSLA 3BXKA 1A03A 2KSPA 5TNCA 1AVSA 2IS9A 4D1EA 3AAKA 3DF0A 3LK0A 4P2YB 3I5HB 1QLSA 4PDZA 1BOCA 2KI4B 3BJHA 5HKYA 1Y1UA 1DJHA 2KAVA 3D75A 1B8CA 2MLEC 5PALA 3C1VA 3EVRA 1BLQA 2LAPA 1S6JA 2H2KA 4A4CA 1NX3A 1EL4A 3FIAA 1F54A 2JT3A 1NX2A 1DF0A 1IQ3A 2MAZA 2WC6A 2KI4C 2ZN9A 3VRPA 1ZMZA 5DICA 1QIVA 3JTDB 3WHUB 4XJKB 4C0LA 1BU3A 2BBNA 4ORAB 1A75B 3B86A 1XFRA 2E30A 2P71A 1KK7Z 3BUWB 1YVHA 2QEHA 3EKJA 1IWQA 2KBMA 4OR9B 4A4BA 1A2XA 1VRKA 1OOGA 3IQOA 4ETOA 1CM4A 4CIDA 3EG5B 3SG2A 4YGDB 1RK9A 4R1EA 1KFXS 5F6TA 2CBLA 3F45A 4DCKA 3CABA 1XFUO 3FE9A 3BOWA 1J1DA 2JWWA 4CLNA 3S0AA 1U5IB 1QXPA 3B87A 1CDPA 1ORGA 1JFJA 3I5FB 5D3OA 5FYXA 3PFVA 5GQQC 2K2FA 3D0YB 3DZTA 1LINA 1IH0A 1IJ5A 1J55A 2OS8C 4AQJA 3MSEB 4F7FA 1EG4A 2QEOA 2BCXA 2QACA 3OX5A 4CFRA 1B1GA 1WRKA 2CTNA 2JNXA 1OQPA 3DXLA 1NCYA 3KEVA 4N5XA 1CTRA 2BE6A 3H4SE 3WHTB 1F71A 4YGCB 1TN4A 1XK4C 4ICBA 2LMTA 1SMGA 1LKJA 3DD4A 1XO5A 2DOQA 4FTGA 1RWYA 3S0GA 2LV7A 3SG5A 1BODA 1BG1A 5I2OA 3I5IB 5AEQA 1TWOA 1QV0A 2KBIA 2JPTA 1DTLA 2RGIA 1DJWA 2ZKMX 1NCXA 2FJYA 4USLA 1OOJA 3TUYB 2ZNEA 4ORCB 4OZDA 5AANA 1UWOA 1TNWA 1LS8A 1NX1A 1SL7A 3PM8A 2A4JA 3SG6A 2CCMA 5JOLA 2Y1NA 3CDNA 2F33A 4GGFA 3UNWA 1CNPA 3VRNA 1K93D 1Y0VH 4I5NB 1CFPA 1NP8A 1NUBA 5FI2A 1QLKA 4YGBB 1OSAA 4GAOA 5EL2A 5HKZA 1JF0A 2WCFA 2MRDA 3PN7B 2JULA 1TUZA 2WCHA 3VRRA 4YRUA 1QIWA 1QX5B 3OB1B 1IQ5A 5ER5A 1DJZA 1OW4A 2PSRA 2GGZA 2HETA 1DT7B 1NIWA 1JC2A 3TS5B 2PQLA 2WCKA 2WCEA 4OV2A 2JXLA 1LVCD 2K7OA 1PRWA 3ZWHA 1AJ4A 2HPSA 1LXFC 1KK8B 4YI8A 2K7BA 1YX7A 2D8NA 2KPHA 2M1UA 2LUXA 3CWGA 1E8AA 2WCLA 1SPYA 1RECA 2NCOA 1NPQA 1H4BA 3L47A 1WRZA 3BUXB 1WDCC 1F70A 5HYDA 2L98A 2OTGC 4E68A 1S5GY 1KSMA 1FBVA 2F8PA 4F0ZB 1C07A 1KK8C 1QX2A 1FW4A 2JT8A 4PT1A 1QVIZ 3ICBA 1RJVA 3KPXA 4YBHB 2V53A 1B47A 3HX4A 2K8MB 3CZ0A 2M0RA 3BFBA 3CS1A 2FCEA 2PVBA 3TDIA 1XFWO 3CR5X 4OKHA 4JKTA 3EVVA 1ZACA 2LCPA 4C0KA 2BL0C 1TNQA 1WRLA 4GNKB 1L2OB 1MHOA 1WLZA 1CMGA 2KGRA 1OOHA 1PVBA 2K60A 1C7VA 3AAJA 2COLB 1FI5A 2QEBA 3D78A 3OX6A 5BPJA 4DIRA 1RROA 3I5GC 3BUNB 2K7CA 1YX8A 2M29A 4WQ3A 1AK8A 1MXEA 3JVTC 3GK1A 3CYZA 1AP4A 1KSOA 1OOIX 1QX7A 4M2PA 3FWCA 5FI6A 2Y1MA 1JF2A 1S3PA 2JXCA 5G08A 1Y1XA 2HQ8A 2WC5A 1TCOB 4IL1A 3VB1A 3PLFB 3EK4A 2TN4A 4C0JA 1CM1A 4JQ0D 1YUUA 1Z2CB 1QJTA 2LHIA 3RZSA 3O4YA 4MEWA 2LC5A 3I5HC 1KFUL 1DJXA
chains in the Genus database with same CATH topology
1EJ3A 4WQ2A 4AQIA 1LA0A 4ZCUA 1G8IA 3TDUA 4CFQA 1R2UA 2I2RE 1ALVA 1IGVA 1G33A 1SL9A 1YUTA 2JT0A 3IQQA 4TNCA 1SRAA 1S6CA 3RLZA 1S6IA 4YGAA 2KAYA 1M46A 4M2QA 1PVAA 1AUIB 1WY9A 3EK7A 2Q4UA 3NSOA 3JTDC 1IJ6A 1K95A 2LHLA 1Q80A 2L5XB 1IG5A 2ISDA 2M8UA 5KSZA 1J7PA 3DVKA 1YVLA 2M7LA 3O78A 2MBXA 1QATA 3PALA 4N1FA 1BF5A 4I5JA 3BYAA 2K7DA 3SG7A 2HQWA 3HCMA 2MLFC 2F3ZA 5CSNA 4BY4A 3NXAA 1FPWA 2L51A 1MXLC 1A4PA 4PALA 5HLOA 5I2LA 3I5FC 1B9AA 1OZSA 1A75A 1RTP1 1K9KA 2KI6D 2FOTA 1XA5A 2Y4QA 1PULA 1UHIA 3EK8A 4P5OE 2CNPA 1EG3A 1KCYA 4QJ4B 2LLSA 2O5GA 1K9UA 4MVFA 5KU1A 1DMOA 3KF9A 1B7TY 2LLUA 3SJSA 1N0YA 4PE0A 2ZFDA 4YI9A 3SIAA 2R2IA 4MZLA 1W7IB 1TIZA 3D0YA 2FCDA 2ZRSA 3A8RA 1IKUA 1OMVA 1XK4A 3I5IC 1ZUZA 1WLMA 2BBMA 1OMDA 5D69A 4DRWA 2H61C 2KAXA 2LMUA 3WXAA 3TUYC 4YGEB 3EVUA 1Y1AA 5AERA 5AFPA 2LANA 1XVJA 2EC6B 2F2OA 1CB1A 1DJYA 3IF7A 1F55A 1JSAA 5ER4X 2L2EA 4U8DA 1DGVA 2JOJA 1B8RA 4BY5A 2LVJA 2LUCA 2CT9A 3PN7C 3SG3A 2LVKA 5JJGA 1MUXA 1S36A 1UHHA 2H61A 3FS7A 2KFFA 3LCPC 2JRFA 2BCBA 1BJFA 2PMYA 4MN0A 3AKBA 5AXIA 4MRXA 3TS5C 1DVIA 1M39A 1BR1B 4OCIA 2M97A 2EGDA 1PALA 1KWOB 2MJWB 3OB2B 1TCFA 1X02A 2BKHB 5I8NA 1KQMB 1F4OA 2AUCA 3ZNIA 4HRGA 1CLLA 4UPGA 1FF1A 2SASA 1NYAA 1JUOA 3EKHA 3VRQA 1UHJA 2WC8A 3GOFA 3KHEA 1BT6A 3K21A 1K94A 2SCPA 3D10A 5HLVA 2VRGA 1NCZA 2M1KB 5DKRA 1UHKA 4FQOA 2EHBA 3OHMB 2ZN8A 4NQGA 3NSIA 3O2PA 3O6BA 1CFFA 3DF0B 1S26D 5J3XA 1J7QA 4HREE 1JFKA 2LNKA 2M7NA 1QV1A 5CSFA 1L2OC 1YRTB 1SKTA 2PALA 3CLNA 3LLEA 4MZJA 1SCMB 3DVJA 2P6BB 2WORA 5IBWA 3CGAA 3KO0A 1V1GA 1DF0B 1SCVA 2KYCA 2L4HA 2M49B 2JNFA 1CKKA 1RFJA 1N2DA 5DKQA 1PK0D 3CR4X 2MA2A 1XFZO 1GGWA 3VROA 1HQVA 2KFHA 4DUQA 2JZIA 1ODBA 1CMFA 1S5GZ 1JWDA 4HSZA 1NX0A 2LMVA 3DVEA 2OPOA 5CSJA 1PSBA 2F2PA 4PCWA 1K8UA 1DGUA 3BQ3A 1TOPA 1CFCA 4PHKA 2ZRTA 3VGOA 1QS7A 3BOWB 4QJ5B 1M63B 3GK4X 3PSRA 1MF8B 2JU0A 1F8HA 4MRYA 1GQMA 2KI6C 1XFYO 2FJUB 1R6PA 1MWNA 3AKAA 3LL8B 3TZ1A 1SL8A 2K0JA 2KQYA 1NWDA 1V1FA 1L7ZA 4OVNF 3BUMB 2KNEA 3E3RA 1AHRA 4XJKA 2ZNDA 2I18A 2PRUA 2G9BA 2K61A 2LP2A 2BKIB 3CTNA 4M2OA 5I2QA 1MQ1A 2I94A 2OS8B 2KFGA 1IRJA 1MR8A 4N1GA 1CFDA 1QTXA 2JTZA 1BR4B 2KDHA 4PE1A 1OE9B 4PHNA 1XYDA 2NZ0A 3QRXA 1TNXA 5CSIA 2B1UA 1SR6B 4JPZB 3CR2A 1U5IA 2KYFA 4NDDA 1TTXA 2AMIA 2MHHA 3FWBA 1ALWA 1CDLA 1J7OA 4L9MA 2PASA 3OP0A 4GFTA 2K2AA 4CPVA 1KFXL 1QASA 2KOTA 4PHMA 4DS7A 4I5KA 4WRIA 4XYNA 1UHNA 1SR6C 2M9GA 4GGFC 1TNPA 3M0WA 1SYMA 1ZFSA 2LE9B 2BECA 2KHNA 2F3YA 1QVIY 4HRHA 1DJIA 2O60A 1B8LA 2LM5A 4MLWA 1B4CA 1XFVO 1AJ5A 2JC2A 1PSRA 1ZOTB 2JTTA 2L50A 2I7AA 3WNXB 4QJ3B 1OMRA 2WCBA 2EC6C 5CPVA 2BE4A 4NDBA 1UP5A 1DJGA 1XFXO 1M45A 2AAOA 4GUKA 4MZKA 2LLTA 2LVVA 4JWQA 1C7WA 1FI6A 4GBAA 1GGZA 4ZCVA 3PATA 2WOSA 2KGBC 1NSHA 2NLNA 4GPLB 1M31A 3A4UB 1SK6D 2Q91A 2QPTA 1SY9A 1N65A 2E6WA 2JQ6A 1EH2A 1B7TZ 1UUSA 4PHJA 1YUSA 2L4IA 1SW8A 1W7JB 1WDCB 2NXQA 2OTGB 3CZTX 5DKNA 3RM1A 1OZOA 2M3WA 4I5LB 4ORBB 4PE4A 1G4YR 1KWOC 2WNDA 1A29A 1K9PA 1S1EA 1SBJA 2G2BA 1KQMC 2GGMA 3GK2A 1YURA 2CXJA 1YTZC 4PE7A 1H8BA 3TDZA 4MSPA 3NSKA 4Q04A 1UURA 5B8IB 1JBAA 1KQVA 1GJYA 1K96A 1D1OA 2BL0B 1SNLA 2KQ6A 1KK7Y 1CDMA 2LVIA 1KFUS 1K2HA 2HF5A 4NDCA 2Y5IA 5HKWA 1CDNA 2BCAA 4AOMA 1BMOA 1YR5A 2L0PA 3I5GB 3LK1A 2NCPA 1YRUB 5KTYA 2LP3A 2GV5A 3DVMA 1LA3A 1CLBA 3SG4A 4GGNA 4MBEA 1CLMA 3JVTB 3SIBA 1J1EA 1SCMC 1TRFA 1F4QA 3BUOB 1J7RA 1K90D 1EXRA 1Y6WA 5K89A 5D7FA 1HT9A 3NSLA 3BXKA 1A03A 2KSPA 5TNCA 1AVSA 2IS9A 4D1EA 3AAKA 3DF0A 3LK0A 4P2YB 3I5HB 1QLSA 4PDZA 1BOCA 2KI4B 5HKYA 1Y1UA 1DJHA 2KAVA 1B8CA 2MLEC 5PALA 3C1VA 3EVRA 1BLQA 2LAPA 1S6JA 2H2KA 4A4CA 1NX3A 1EL4A 3FIAA 1F54A 2JT3A 1NX2A 1DF0A 1IQ3A 2MAZA 2KI4C 2ZN9A 3VRPA 1ZMZA 3WHUB 1QIVA 3JTDB 4XJKB 4C0LA 1BU3A 2BBNA 4ORAB 1A75B 2E30A 1KK7Z 3BUWB 1YVHA 3EKJA 4OR9B 1IWQA 2KBMA 4A4BA 1A2XA 1VRKA 3IQOA 4ETOA 1CM4A 4CIDA 3SG2A 4YGDB 1RK9A 4R1EA 1KFXS 5F6TA 2CBLA 3F45A 4DCKA 1XFUO 3BOWA 1J1DA 2JWWA 4CLNA 1U5IB 1QXPA 1CDPA 1JFJA 3I5FB 5FYXA 3PFVA 5GQQC 2K2FA 3D0YB 1LINA 1IH0A 1IJ5A 1J55A 2OS8C 4AQJA 3MSEB 1EG4A 2BCXA 2QACA 3OX5A 4CFRA 1B1GA 1WRKA 2CTNA 2JNXA 1OQPA 1NCYA 3KEVA 4N5XA 1CTRA 2BE6A 3H4SE 3WHTB 1F71A 4YGCB 1TN4A 1XK4C 4ICBA 2LMTA 1SMGA 1LKJA 3DD4A 1XO5A 2DOQA 4FTGA 1RWYA 2LV7A 3SG5A 1BODA 1BG1A 5I2OA 3I5IB 5AEQA 1QV0A 2KBIA 2JPTA 1DTLA 2RGIA 1DJWA 2ZKMX 1NCXA 4USLA 1OOJA 3TUYB 2ZNEA 4ORCB 5AANA 1UWOA 1TNWA 1NX1A 1SL7A 3PM8A 2A4JA 3SG6A 2CCMA 5JOLA 2Y1NA 2F33A 4GGFA 1CNPA 3VRNA 1K93D 1Y0VH 4I5NB 1CFPA 1NP8A 1NUBA 1QLKA 4YGBB 1OSAA 4GAOA 5HKZA 1JF0A 2WCFA 2MRDA 3PN7B 2JULA 3VRRA 4YRUA 1QIWA 1QX5B 3OB1B 1IQ5A 5ER5A 1DJZA 2PSRA 2GGZA 2HETA 1DT7B 1NIWA 1JC2A 3TS5B 4OV2A 2WCEA 2JXLA 1LVCD 2K7OA 1PRWA 3ZWHA 1AJ4A 2HPSA 1LXFC 1KK8B 4YI8A 2K7BA 1YX7A 2D8NA 2M1UA 2LUXA 3CWGA 1E8AA 1SPYA 1RECA 2NCOA 1NPQA 1H4BA 1WRZA 3BUXB 1WDCC 1F70A 5HYDA 2L98A 2OTGC 4E68A 1S5GY 1KSMA 1FBVA 2F8PA 4F0ZB 1C07A 1KK8C 1QX2A 1FW4A 2JT8A 1QVIZ 3ICBA 1RJVA 3KPXA 4YBHB 2V53A 1B47A 3HX4A 2K8MB 2M0RA 3CS1A 2FCEA 2PVBA 3TDIA 1XFWO 3CR5X 4OKHA 3EVVA 1ZACA 2LCPA 4C0KA 2BL0C 1TNQA 1WRLA 4GNKB 1L2OB 1MHOA 1WLZA 1CMGA 2KGRA 1PVBA 1C7VA 3AAJA 2COLB 1FI5A 3OX6A 5BPJA 4DIRA 1RROA 3I5GC 3BUNB 2K7CA 1YX8A 2M29A 4WQ3A 1AK8A 1MXEA 3JVTC 3GK1A 1AP4A 1KSOA 1QX7A 4M2PA 3FWCA 2Y1MA 1JF2A 1S3PA 2JXCA 5G08A 1Y1XA 2HQ8A 4IL1A 1TCOB 3PLFB 3EK4A 2TN4A 4C0JA 1CM1A 4JQ0D 1YUUA 1QJTA 2LHIA 3O4YA 4MEWA 2LC5A 3I5HC 1KFUL 1DJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EJ3 A;  4WQ2 A;  4AQI A;  1LA0 A;  4ZCU A;  1G8I A;  3TDU A;  4CFQ A;  1R2U A;  2I2R E;  1ALV A;  1IGV A;  1G33 A;  1SL9 A;  1YUT A;  2JT0 A;  3IQQ A;  4TNC A;  1SRA A;  1S6C A;  3RLZ A;  1S6I A;  4YGA A;  2KAY A;  1M46 A;  4M2Q A;  1PVA A;  1AUI B;  1WY9 A;  3EK7 A;  2Q4U A;  3NSO A;  3JTD C;  1IJ6 A;  1K95 A;  2LHL A;  1Q80 A;  2L5X B;  1IG5 A;  2ISD A;  2M8U A;  5KSZ A;  1J7P A;  3DVK A;  1YVL A;  2M7L A;  3O78 A;  2MBX A;  1QAT A;  3PAL A;  4N1F A;  1BF5 A;  4I5J A;  3BYA A;  2K7D A;  3SG7 A;  2HQW A;  3HCM A;  2MLF C;  2F3Z A;  5CSN A;  4BY4 A;  3NXA A;  1FPW A;  2L51 A;  1MXL C;  1A4P A;  4PAL A;  5HLO A;  5I2L A;  3I5F C;  1B9A A;  1OZS A;  1A75 A;  1RTP 1;  1K9K A;  2KI6 D;  2FOT A;  1XA5 A;  2Y4Q A;  1PUL A;  1UHI A;  3EK8 A;  4P5O E;  2CNP A;  1EG3 A;  1KCY A;  4QJ4 B;  2LLS A;  2O5G A;  1K9U A;  4MVF A;  5KU1 A;  1DMO A;  3KF9 A;  1B7T Y;  2LLU A;  3SJS A;  1N0Y A;  4PE0 A;  2ZFD A;  4YI9 A;  3SIA A;  2R2I A;  4MZL A;  1W7I B;  1TIZ A;  3D0Y A;  2FCD A;  2ZRS A;  3A8R A;  1IKU A;  1OMV A;  1XK4 A;  3I5I C;  1ZUZ A;  1WLM A;  2BBM A;  1OMD A;  5D69 A;  4DRW A;  2H61 C;  2KAX A;  2LMU A;  3WXA A;  3TUY C;  4YGE B;  3EVU A;  1Y1A A;  5AER A;  5AFP A;  2LAN A;  1XVJ A;  2EC6 B;  2F2O A;  1CB1 A;  1DJY A;  3IF7 A;  1F55 A;  1JSA A;  5ER4 X;  2L2E A;  4U8D A;  1DGV A;  2JOJ A;  1B8R A;  4BY5 A;  2LVJ A;  2LUC A;  2CT9 A;  3PN7 C;  3SG3 A;  2LVK A;  5JJG A;  1MUX A;  1S36 A;  1UHH A;  2H61 A;  3FS7 A;  2KFF A;  3LCP C;  2JRF A;  2BCB A;  1BJF A;  2PMY A;  4MN0 A;  3AKB A;  5AXI A;  4MRX A;  3TS5 C;  1DVI A;  1M39 A;  1BR1 B;  4OCI A;  2M97 A;  2EGD A;  1PAL A;  1KWO B;  2MJW B;  3OB2 B;  1TCF A;  1X02 A;  2BKH B;  5I8N A;  1KQM B;  1F4O A;  2AUC A;  3ZNI A;  4HRG A;  1CLL A;  4UPG A;  1FF1 A;  2SAS A;  1NYA A;  1JUO A;  3EKH A;  3VRQ A;  1UHJ A;  2WC8 A;  3GOF A;  3KHE A;  1BT6 A;  3K21 A;  1K94 A;  2SCP A;  3D10 A;  5HLV A;  2VRG A;  1NCZ A;  2M1K B;  5DKR A;  1UHK A;  4FQO A;  2EHB A;  3OHM B;  2ZN8 A;  4NQG A;  3NSI A;  3O2P A;  3O6B A;  1CFF A;  3DF0 B;  1S26 D;  5J3X A;  1J7Q A;  4HRE E;  1JFK A;  2LNK A;  2M7N A;  1QV1 A;  5CSF A;  1L2O C;  1YRT B;  1SKT A;  2PAL A;  3CLN A;  3LLE A;  4MZJ A;  1SCM B;  3DVJ A;  2P6B B;  2WOR A;  5IBW A;  3CGA A;  3KO0 A;  1V1G A;  1DF0 B;  1SCV A;  2KYC A;  2L4H A;  2M49 B;  2JNF A;  1CKK A;  1RFJ A;  1N2D A;  5DKQ A;  1PK0 D;  3CR4 X;  2MA2 A;  1XFZ O;  1GGW A;  3VRO A;  1HQV A;  2KFH A;  4DUQ A;  2JZI A;  1ODB A;  1CMF A;  1S5G Z;  1JWD A;  4HSZ A;  1NX0 A;  2LMV A;  3DVE A;  2OPO A;  5CSJ A;  1PSB A;  2F2P A;  4PCW A;  1K8U A;  1DGU A;  3BQ3 A;  1TOP A;  1CFC A;  4PHK A;  2ZRT A;  3VGO A;  1QS7 A;  3BOW B;  4QJ5 B;  1M63 B;  3GK4 X;  3PSR A;  1MF8 B;  2JU0 A;  1F8H A;  4MRY A;  1GQM A;  2KI6 C;  1XFY O;  2FJU B;  1R6P A;  1MWN A;  3AKA A;  3LL8 B;  3TZ1 A;  1SL8 A;  2K0J A;  2KQY A;  1NWD A;  1V1F A;  1L7Z A;  4OVN F;  3BUM B;  2KNE A;  3E3R A;  1AHR A;  4XJK A;  2ZND A;  2I18 A;  2PRU A;  2G9B A;  2K61 A;  2LP2 A;  2BKI B;  3CTN A;  4M2O A;  5I2Q A;  1MQ1 A;  2I94 A;  2OS8 B;  2KFG A;  1IRJ A;  1MR8 A;  4N1G A;  1CFD A;  1QTX A;  2JTZ A;  1BR4 B;  2KDH A;  4PE1 A;  1OE9 B;  4PHN A;  1XYD A;  2NZ0 A;  3QRX A;  1TNX A;  5CSI A;  2B1U A;  1SR6 B;  4JPZ B;  3CR2 A;  1U5I A;  2KYF A;  4NDD A;  1TTX A;  2AMI A;  2MHH A;  3FWB A;  1ALW A;  1CDL A;  1J7O A;  4L9M A;  2PAS A;  3OP0 A;  4GFT A;  2K2A A;  4CPV A;  1KFX L;  1QAS A;  2KOT A;  4PHM A;  4DS7 A;  4I5K A;  4WRI A;  4XYN A;  1UHN A;  1SR6 C;  2M9G A;  4GGF C;  1TNP A;  3M0W A;  1SYM A;  1ZFS A;  2LE9 B;  2BEC A;  2KHN A;  2F3Y A;  1QVI Y;  4HRH A;  1DJI A;  2O60 A;  1B8L A;  2LM5 A;  4MLW A;  1B4C A;  1XFV O;  1AJ5 A;  2JC2 A;  1PSR A;  1ZOT B;  2JTT A;  2L50 A;  2I7A A;  3WNX B;  4QJ3 B;  1OMR A;  2WCB A;  2EC6 C;  5CPV A;  2BE4 A;  4NDB A;  1UP5 A;  1DJG A;  1XFX O;  1M45 A;  2AAO A;  4GUK A;  4MZK A;  2LLT A;  2LVV A;  4JWQ A;  1C7W A;  1FI6 A;  4GBA A;  1GGZ A;  4ZCV A;  3PAT A;  2WOS A;  2KGB C;  1NSH A;  2NLN A;  4GPL B;  1M31 A;  3A4U B;  1SK6 D;  2Q91 A;  2QPT A;  1SY9 A;  1N65 A;  2E6W A;  2JQ6 A;  1EH2 A;  1B7T Z;  1UUS A;  4PHJ A;  1YUS A;  2L4I A;  1SW8 A;  1W7J B;  1WDC B;  2NXQ A;  2OTG B;  3CZT X;  5DKN A;  3RM1 A;  1OZO A;  2M3W A;  4I5L B;  4ORB B;  4PE4 A;  1G4Y R;  1KWO C;  2WND A;  1A29 A;  1K9P A;  1S1E A;  1SBJ A;  2G2B A;  1KQM C;  2GGM A;  3GK2 A;  1YUR A;  2CXJ A;  1YTZ C;  4PE7 A;  1H8B A;  3TDZ A;  4MSP A;  3NSK A;  4Q04 A;  1UUR A;  5B8I B;  1JBA A;  1KQV A;  1GJY A;  1K96 A;  1D1O A;  2BL0 B;  1SNL A;  2KQ6 A;  1KK7 Y;  1CDM A;  2LVI A;  1KFU S;  1K2H A;  2HF5 A;  4NDC A;  2Y5I A;  5HKW A;  1CDN A;  2BCA A;  4AOM A;  1BMO A;  1YR5 A;  2L0P A;  3I5G B;  3LK1 A;  2NCP A;  1YRU B;  5KTY A;  2LP3 A;  2GV5 A;  3DVM A;  1LA3 A;  1CLB A;  3SG4 A;  4GGN A;  4MBE A;  1CLM A;  3JVT B;  3SIB A;  1J1E A;  1SCM C;  1TRF A;  1F4Q A;  3BUO B;  1J7R A;  1K90 D;  1EXR A;  1Y6W A;  5K89 A;  5D7F A;  1HT9 A;  3NSL A;  3BXK A;  1A03 A;  2KSP A;  5TNC A;  1AVS A;  2IS9 A;  4D1E A;  3AAK A;  3DF0 A;  3LK0 A;  4P2Y B;  3I5H B;  1QLS A;  4PDZ A;  1BOC A;  2KI4 B;  5HKY A;  1Y1U A;  1DJH A;  2KAV A;  1B8C A;  2MLE C;  5PAL A;  3C1V A;  3EVR A;  1BLQ A;  2LAP A;  1S6J A;  2H2K A;  4A4C A;  1NX3 A;  1EL4 A;  3FIA A;  1F54 A;  2JT3 A;  1NX2 A;  1DF0 A;  1IQ3 A;  2MAZ A;  2KI4 C;  2ZN9 A;  3VRP A;  1ZMZ A;  3WHU B;  1QIV A;  3JTD B;  4XJK B;  4C0L A;  1BU3 A;  2BBN A;  4ORA B;  1A75 B;  2E30 A;  1KK7 Z;  3BUW B;  1YVH A;  3EKJ A;  4OR9 B;  1IWQ A;  2KBM A;  4A4B A;  1A2X A;  1VRK A;  3IQO A;  4ETO A;  1CM4 A;  4CID A;  3SG2 A;  4YGD B;  1RK9 A;  4R1E A;  1KFX S;  5F6T A;  2CBL A;  3F45 A;  4DCK A;  1XFU O;  3BOW A;  1J1D A;  2JWW A;  4CLN A;  1U5I B;  1QXP A;  1CDP A;  1JFJ A;  3I5F B;  5FYX A;  3PFV A;  5GQQ C;  2K2F A;  3D0Y B;  1LIN A;  1IH0 A;  1IJ5 A;  1J55 A;  2OS8 C;  4AQJ A;  3MSE B;  1EG4 A;  2BCX A;  2QAC A;  3OX5 A;  4CFR A;  1B1G A;  1WRK A;  2CTN A;  2JNX A;  1OQP A;  1NCY A;  3KEV A;  4N5X A;  1CTR A;  2BE6 A;  3H4S E;  3WHT B;  1F71 A;  4YGC B;  1TN4 A;  1XK4 C;  4ICB A;  2LMT A;  1SMG A;  1LKJ A;  3DD4 A;  1XO5 A;  2DOQ A;  4FTG A;  1RWY A;  2LV7 A;  3SG5 A;  1BOD A;  1BG1 A;  5I2O A;  3I5I B;  5AEQ A;  1QV0 A;  2KBI A;  2JPT A;  1DTL A;  2RGI A;  1DJW A;  2ZKM X;  1NCX A;  4USL A;  1OOJ A;  3TUY B;  2ZNE A;  4ORC B;  5AAN A;  1UWO A;  1TNW A;  1NX1 A;  1SL7 A;  3PM8 A;  2A4J A;  3SG6 A;  2CCM A;  5JOL A;  2Y1N A;  2F33 A;  4GGF A;  1CNP A;  3VRN A;  1K93 D;  1Y0V H;  4I5N B;  1CFP A;  1NP8 A;  1NUB A;  1QLK A;  4YGB B;  1OSA A;  4GAO A;  5HKZ A;  1JF0 A;  2WCF A;  2MRD A;  3PN7 B;  2JUL A;  3VRR A;  4YRU A;  1QIW A;  1QX5 B;  3OB1 B;  1IQ5 A;  5ER5 A;  1DJZ A;  2PSR A;  2GGZ A;  2HET A;  1DT7 B;  1NIW A;  1JC2 A;  3TS5 B;  4OV2 A;  2WCE A;  2JXL A;  1LVC D;  2K7O A;  1PRW A;  3ZWH A;  1AJ4 A;  2HPS A;  1LXF C;  1KK8 B;  4YI8 A;  2K7B A;  1YX7 A;  2D8N A;  2M1U A;  2LUX A;  3CWG A;  1E8A A;  1SPY A;  1REC A;  2NCO A;  1NPQ A;  1H4B A;  1WRZ A;  3BUX B;  1WDC C;  1F70 A;  5HYD A;  2L98 A;  2OTG C;  4E68 A;  1S5G Y;  1KSM A;  1FBV A;  2F8P A;  4F0Z B;  1C07 A;  1KK8 C;  1QX2 A;  1FW4 A;  2JT8 A;  1QVI Z;  3ICB A;  1RJV A;  3KPX A;  4YBH B;  2V53 A;  1B47 A;  3HX4 A;  2K8M B;  2M0R A;  3CS1 A;  2FCE A;  2PVB A;  3TDI A;  1XFW O;  3CR5 X;  4OKH A;  3EVV A;  1ZAC A;  2LCP A;  4C0K A;  2BL0 C;  1TNQ A;  1WRL A;  4GNK B;  1L2O B;  1MHO A;  1WLZ A;  1CMG A;  2KGR A;  1PVB A;  1C7V A;  3AAJ A;  2COL B;  1FI5 A;  3OX6 A;  5BPJ A;  4DIR A;  1RRO A;  3I5G C;  3BUN B;  2K7C A;  1YX8 A;  2M29 A;  4WQ3 A;  1AK8 A;  1MXE A;  3JVT C;  3GK1 A;  1AP4 A;  1KSO A;  1QX7 A;  4M2P A;  3FWC A;  2Y1M A;  1JF2 A;  1S3P A;  2JXC A;  5G08 A;  1Y1X A;  2HQ8 A;  4IL1 A;  1TCO B;  3PLF B;  3EK4 A;  2TN4 A;  4C0J A;  1CM1 A;  4JQ0 D;  1YUU A;  1QJT A;  2LHI A;  3O4Y A;  4MEW A;  2LC5 A;  3I5H C;  1KFU L;  1DJX A; 
#chains in the Genus database with same CATH topology
 3R1P A;  3DYE A;  1EJ3 A;  4WQ2 A;  4AQI A;  1LA0 A;  4ZCU A;  1G8I A;  3TDU A;  4CFQ A;  1R2U A;  2I2R E;  1ALV A;  1IGV A;  1G33 A;  1SL9 A;  1YUT A;  2GTE A;  2JT0 A;  3IQQ A;  4TNC A;  4INX A;  1SRA A;  1S6C A;  3RLZ A;  1S6I A;  4YGA A;  2KAY A;  1M46 A;  4M2Q A;  1PVA A;  1AUI B;  1WY9 A;  3EK7 A;  2Q4U A;  3NSO A;  3JTD C;  1IJ6 A;  1K95 A;  2LHL A;  1Q80 A;  2L5X B;  1IG5 A;  2ISD A;  3SS5 A;  2M8U A;  5KSZ A;  1J7P A;  3DVK A;  1YVL A;  2M7L A;  3O78 A;  2MBX A;  1QAT A;  3PAL A;  4N1F A;  1BF5 A;  4I5J A;  3BYA A;  2K7D A;  3SG7 A;  4INW A;  2HQW A;  3HCM A;  2MLF C;  2F3Z A;  5CSN A;  3R1O A;  3FE8 A;  3NXA A;  4BY4 A;  2L51 A;  1FPW A;  1MXL C;  1A4P A;  4PAL A;  5HLO A;  5I2L A;  3L4L A;  3I5F C;  1B9A A;  1OZS A;  1A75 A;  1C3Y A;  1RTP 1;  1K9K A;  2KI6 D;  2FOT A;  3SS4 A;  1XA5 A;  2Y4Q A;  1PUL A;  1UHI A;  3EK8 A;  4P5O E;  2CNP A;  1EG3 A;  1KCY A;  4QJ4 B;  2LLS A;  2O5G A;  1K9U A;  4MVF A;  5KU1 A;  1DMO A;  3KF9 A;  1B7T Y;  2LLU A;  3SJS A;  1N0Y A;  4PE0 A;  1W9Z A;  2ZFD A;  4YI9 A;  3SIA A;  2R2I A;  4MZL A;  1W7I B;  1TIZ A;  3D0Y A;  2FCD A;  2ZRS A;  3A8R A;  1IKU A;  1OMV A;  1XK4 A;  3I5I C;  1ZUZ A;  1WLM A;  2BBM A;  3QME A;  1OMD A;  5D69 A;  4DRW A;  2H61 C;  2KAX A;  2LMU A;  3WXA A;  3TUY C;  3Q8I A;  4YGE B;  3EVU A;  1Y1A A;  5AER A;  3S0E A;  5AFP A;  2LAN A;  1XVJ A;  2EC6 B;  2KLD A;  1SSE B;  2F2O A;  1DJY A;  3IF7 A;  1CB1 A;  1F55 A;  3D76 A;  1JSA A;  5ER4 X;  2L2E A;  4U8D A;  1DGV A;  2JOJ A;  3PM2 A;  1B8R A;  4BY5 A;  2LVJ A;  2LUC A;  2CT9 A;  3PN7 C;  3R72 A;  3SG3 A;  2LVK A;  5JJG A;  1MUX A;  1S36 A;  1UHH A;  2H61 A;  3FS7 A;  2KFF A;  3LCP C;  2JRF A;  2BCB A;  1BJF A;  2PMY A;  4MN0 A;  3AKB A;  5AXI A;  4MRX A;  3TS5 C;  1DVI A;  1M39 A;  3FE6 A;  1BR1 B;  4OCI A;  2L5Y A;  2M97 A;  3OBV A;  2EGD A;  1PAL A;  1KWO B;  2MJW B;  3B6X A;  3OB2 B;  1TCF A;  1X02 A;  2BKH B;  5I8N A;  1KQM B;  1F4O A;  2AUC A;  3ZNI A;  4HRG A;  1CLL A;  4UPG A;  1FF1 A;  2SAS A;  1NYA A;  1JUO A;  3EKH A;  1GM0 A;  3VRQ A;  1UHJ A;  2WC8 A;  3GOF A;  3KHE A;  1BT6 A;  3K21 A;  1K94 A;  3OGN A;  2SCP A;  3D10 A;  5HLV A;  2VRG A;  1NCZ A;  2M1K B;  5DKR A;  1UHK A;  2KLE A;  4FQO A;  2EHB A;  3OHM B;  2ZN8 A;  4NQG A;  3NSI A;  3O2P A;  3O6B A;  1CFF A;  3DF0 B;  1S26 D;  5J3X A;  5I94 A;  4HRE E;  1J7Q A;  1JFK A;  2LNK A;  2M7N A;  1QV1 A;  5CSF A;  1L2O C;  1YRT B;  1SKT A;  2PAL A;  3CLN A;  3D73 A;  3LLE A;  4MZJ A;  1SCM B;  3DVJ A;  2P6B B;  2WOR A;  5IBW A;  3CGA A;  3KO0 A;  1V1G A;  3L4A A;  1DF0 B;  1SCV A;  2KYC A;  2L4H A;  2M49 B;  5FI7 A;  2JNF A;  1CKK A;  1RFJ A;  1N2D A;  5DKQ A;  1PK0 D;  3CR4 X;  2MA2 A;  1XFZ O;  1GGW A;  3VRO A;  1HQV A;  2KFH A;  4DUQ A;  2JZI A;  1ODB A;  1CMF A;  1S5G Z;  1JWD A;  1DQE A;  4HSZ A;  3S0F A;  1NX0 A;  2LMV A;  3DVE A;  2OPO A;  1T14 A;  5CSJ A;  1PSB A;  2F2P A;  4PCW A;  1K8U A;  1DGU A;  3BQ3 A;  1TOP A;  4KYN A;  1CFC A;  4PHK A;  2ZRT A;  3VGO A;  1QS7 A;  3BOW B;  4QJ5 B;  1M63 B;  3GK4 X;  3PSR A;  1MF8 B;  2JU0 A;  1F8H A;  4MRY A;  3S0B A;  2QEV A;  1GQM A;  2KI6 C;  3O4X A;  1QWV A;  1XFY O;  2FJU B;  1R6P A;  1MWN A;  2BAP A;  3AKA A;  3LL8 B;  3B7A A;  2WCM A;  2L2C A;  3TZ1 A;  3BFH A;  3CZ2 A;  3NHT A;  1SL8 A;  2K0J A;  2KQY A;  1NWD A;  1V1F A;  1L7Z A;  4OVN F;  3BUM B;  2KNE A;  3E3R A;  1AHR A;  3NGV A;  4XJK A;  2ZND A;  2I18 A;  3PJI A;  2PRU A;  2G9B A;  3D74 A;  2JPO A;  2K61 A;  2LP2 A;  2BKI B;  3CTN A;  4M2O A;  5I2Q A;  1MQ1 A;  2I94 A;  2QDI A;  2OS8 B;  2KFG A;  1IRJ A;  1MR8 A;  3NHI A;  4N1G A;  3V2L A;  1CFD A;  3R1V A;  1QTX A;  2JTZ A;  1BR4 B;  2KDH A;  4PE1 A;  1OE9 B;  4PHN A;  1XYD A;  2NZ0 A;  3QRX A;  1TNX A;  3D77 A;  5CSI A;  2B1U A;  1OOF A;  1SR6 B;  4JPZ B;  3CR2 A;  1U5I A;  2KYF A;  4NDD A;  1TTX A;  2AMI A;  2MHH A;  3FWB A;  1ALW A;  1CDL A;  1J7O A;  4L9M A;  2PAS A;  3OP0 A;  4GFT A;  1DEL A;  2K2A A;  4CPV A;  1KFX L;  1QAS A;  2KOT A;  4PHM A;  4DS7 A;  4I5K A;  2WCJ A;  4WRI A;  4XYN A;  3B88 A;  2PYQ A;  1UHN A;  1SR6 C;  2M9G A;  4GGF C;  3SS3 A;  4IJ7 A;  1TNP A;  3M0W A;  1SYM A;  1ZFS A;  2LE9 B;  2BEC A;  2KHN A;  2F3Y A;  1QVI Y;  4HRH A;  1DJI A;  2O60 A;  1B8L A;  2ERB A;  2LM5 A;  4MLW A;  1B4C A;  1XFV O;  1AJ5 A;  2JC2 A;  1PSR A;  1ZOT B;  2BNX A;  2JTT A;  2I7A A;  2L50 A;  4QJ3 B;  3WNX B;  1OMR A;  3K1E A;  2WCB A;  2EC6 C;  5CPV A;  2BE4 A;  4NDB A;  2P70 A;  1UP5 A;  1DJG A;  1XFX O;  1M45 A;  2AAO A;  4GUK A;  3DY9 A;  4MZK A;  2LLT A;  2LVV A;  4JWQ A;  1C3Z A;  1DEK A;  1C7W A;  1FI6 A;  2H8V A;  4GBA A;  1GGZ A;  1IIO A;  4ZCV A;  3PAT A;  2WOS A;  2KGB C;  1NSH A;  2NLN A;  4GPL B;  1M31 A;  3A4U B;  5HL1 A;  1SK6 D;  2Q91 A;  2QPT A;  1SY9 A;  1N65 A;  2E6W A;  2JQ6 A;  1EH2 A;  1B7T Z;  1UUS A;  4PHJ A;  1YUS A;  2L4I A;  1SW8 A;  1W7J B;  1WDC B;  2NXQ A;  2OTG B;  3CZT X;  5DKN A;  3RM1 A;  1OZO A;  2M3W A;  4I5L B;  4ORB B;  4PE4 A;  3UO9 A;  1G4Y R;  1KWO C;  2WND A;  1A29 A;  1K9P A;  1S1E A;  4JD9 A;  1SBJ A;  2G2B A;  1KQM C;  2GGM A;  3GK2 A;  1YUR A;  2CXJ A;  1YTZ C;  3CZ1 A;  4PE7 A;  3TDZ A;  1H8B A;  4MSP A;  3NSK A;  4Q04 A;  1UUR A;  4FQT A;  5B8I B;  1Z4H A;  3N7H A;  1JBA A;  1KQV A;  1GJY A;  2YGU A;  1K96 A;  1P28 A;  1D1O A;  2BL0 B;  3IVT A;  1SNL A;  2KQ6 A;  1KK7 Y;  1CDM A;  2LVI A;  1KFU S;  1K2H A;  2HF5 A;  4NDC A;  2Y5I A;  5HKW A;  1CDN A;  3BFA A;  2BCA A;  4AOM A;  1BMO A;  1YR5 A;  2L0P A;  3I5G B;  1DC1 A;  3LK1 A;  2NCP A;  1YRU B;  5KTY A;  2LP3 A;  2GV5 A;  3DVM A;  1LA3 A;  1CLB A;  3SG4 A;  4GGN A;  4MBE A;  1CLM A;  3JVT B;  3SIB A;  1J1E A;  1SCM C;  1TRF A;  1F4Q A;  3BUO B;  1J7R A;  1K90 D;  1EXR A;  1Y6W A;  5K89 A;  1TUJ A;  3S0D A;  5D7F A;  1HT9 A;  3NSL A;  3BXK A;  1A03 A;  2KSP A;  5TNC A;  1AVS A;  2IS9 A;  4D1E A;  3AAK A;  3DF0 A;  3LK0 A;  4P2Y B;  3I5H B;  1QLS A;  4PDZ A;  1BOC A;  2KI4 B;  3BJH A;  5HKY A;  1Y1U A;  1DJH A;  2KAV A;  3D75 A;  1B8C A;  2MLE C;  5PAL A;  3C1V A;  3EVR A;  1BLQ A;  2LAP A;  1S6J A;  2H2K A;  4A4C A;  1NX3 A;  1EL4 A;  3FIA A;  1F54 A;  2JT3 A;  1NX2 A;  1DF0 A;  1IQ3 A;  2MAZ A;  2WC6 A;  2KI4 C;  2ZN9 A;  3VRP A;  1ZMZ A;  5DIC A;  1QIV A;  3JTD B;  3WHU B;  4XJK B;  4C0L A;  1BU3 A;  2BBN A;  4ORA B;  1A75 B;  3B86 A;  1XFR A;  2E30 A;  2P71 A;  1KK7 Z;  3BUW B;  1YVH A;  2QEH A;  3EKJ A;  1IWQ A;  2KBM A;  4OR9 B;  4A4B A;  1A2X A;  1VRK A;  1OOG A;  3IQO A;  4ETO A;  1CM4 A;  4CID A;  3EG5 B;  3SG2 A;  4YGD B;  1RK9 A;  4R1E A;  1KFX S;  5F6T A;  2CBL A;  3F45 A;  4DCK A;  3CAB A;  1XFU O;  3FE9 A;  3BOW A;  1J1D A;  2JWW A;  4CLN A;  3S0A A;  1U5I B;  1QXP A;  3B87 A;  1CDP A;  1ORG A;  1JFJ A;  3I5F B;  5D3O A;  5FYX A;  3PFV A;  5GQQ C;  2K2F A;  3D0Y B;  3DZT A;  1LIN A;  1IH0 A;  1IJ5 A;  1J55 A;  2OS8 C;  4AQJ A;  3MSE B;  4F7F A;  1EG4 A;  2QEO A;  2BCX A;  2QAC A;  3OX5 A;  4CFR A;  1B1G A;  1WRK A;  2CTN A;  2JNX A;  1OQP A;  3DXL A;  1NCY A;  3KEV A;  4N5X A;  1CTR A;  2BE6 A;  3H4S E;  3WHT B;  1F71 A;  4YGC B;  1TN4 A;  1XK4 C;  4ICB A;  2LMT A;  1SMG A;  1LKJ A;  3DD4 A;  1XO5 A;  2DOQ A;  4FTG A;  1RWY A;  3S0G A;  2LV7 A;  3SG5 A;  1BOD A;  1BG1 A;  5I2O A;  3I5I B;  5AEQ A;  1TWO A;  1QV0 A;  2KBI A;  2JPT A;  1DTL A;  2RGI A;  1DJW A;  2ZKM X;  1NCX A;  2FJY A;  4USL A;  1OOJ A;  3TUY B;  2ZNE A;  4ORC B;  4OZD A;  5AAN A;  1UWO A;  1TNW A;  1LS8 A;  1NX1 A;  1SL7 A;  3PM8 A;  2A4J A;  3SG6 A;  2CCM A;  5JOL A;  2Y1N A;  3CDN A;  2F33 A;  4GGF A;  3UNW A;  1CNP A;  3VRN A;  1K93 D;  1Y0V H;  4I5N B;  1CFP A;  1NP8 A;  1NUB A;  5FI2 A;  1QLK A;  4YGB B;  1OSA A;  4GAO A;  5EL2 A;  5HKZ A;  1JF0 A;  2WCF A;  2MRD A;  3PN7 B;  2JUL A;  1TUZ A;  2WCH A;  3VRR A;  4YRU A;  1QIW A;  1QX5 B;  3OB1 B;  1IQ5 A;  5ER5 A;  1DJZ A;  1OW4 A;  2PSR A;  2GGZ A;  2HET A;  1DT7 B;  1NIW A;  1JC2 A;  3TS5 B;  2PQL A;  2WCK A;  2WCE A;  4OV2 A;  2JXL A;  1LVC D;  2K7O A;  1PRW A;  3ZWH A;  1AJ4 A;  2HPS A;  1LXF C;  1KK8 B;  4YI8 A;  2K7B A;  1YX7 A;  2D8N A;  2KPH A;  2M1U A;  2LUX A;  3CWG A;  1E8A A;  2WCL A;  1SPY A;  1REC A;  2NCO A;  1NPQ A;  1H4B A;  3L47 A;  1WRZ A;  3BUX B;  1WDC C;  1F70 A;  5HYD A;  2L98 A;  2OTG C;  4E68 A;  1S5G Y;  1KSM A;  1FBV A;  2F8P A;  4F0Z B;  1C07 A;  1KK8 C;  1QX2 A;  1FW4 A;  2JT8 A;  4PT1 A;  1QVI Z;  3ICB A;  1RJV A;  3KPX A;  4YBH B;  2V53 A;  1B47 A;  3HX4 A;  2K8M B;  3CZ0 A;  2M0R A;  3BFB A;  3CS1 A;  2FCE A;  2PVB A;  3TDI A;  1XFW O;  3CR5 X;  4OKH A;  4JKT A;  3EVV A;  1ZAC A;  2LCP A;  4C0K A;  2BL0 C;  1TNQ A;  1WRL A;  4GNK B;  1L2O B;  1MHO A;  1WLZ A;  1CMG A;  2KGR A;  1OOH A;  1PVB A;  2K60 A;  1C7V A;  3AAJ A;  2COL B;  1FI5 A;  2QEB A;  3D78 A;  3OX6 A;  5BPJ A;  4DIR A;  1RRO A;  3I5G C;  3BUN B;  2K7C A;  1YX8 A;  2M29 A;  4WQ3 A;  1AK8 A;  1MXE A;  3JVT C;  3GK1 A;  3CYZ A;  1AP4 A;  1KSO A;  1OOI X;  1QX7 A;  4M2P A;  3FWC A;  5FI6 A;  2Y1M A;  1JF2 A;  1S3P A;  2JXC A;  5G08 A;  1Y1X A;  2HQ8 A;  2WC5 A;  1TCO B;  4IL1 A;  3VB1 A;  3PLF B;  3EK4 A;  2TN4 A;  4C0J A;  1CM1 A;  4JQ0 D;  1YUU A;  1Z2C B;  1QJT A;  2LHI A;  3RZS A;  3O4Y A;  4MEW A;  2LC5 A;  3I5H C;  1KFU L;  1DJX A; 
#chains in the Genus database with same CATH homology
 1EJ3 A;  4WQ2 A;  4AQI A;  1LA0 A;  4ZCU A;  1G8I A;  3TDU A;  4CFQ A;  1R2U A;  2I2R E;  1ALV A;  1IGV A;  1G33 A;  1SL9 A;  1YUT A;  2JT0 A;  3IQQ A;  4TNC A;  1SRA A;  1S6C A;  3RLZ A;  1S6I A;  4YGA A;  2KAY A;  1M46 A;  4M2Q A;  1PVA A;  1AUI B;  1WY9 A;  3EK7 A;  2Q4U A;  3NSO A;  3JTD C;  1IJ6 A;  1K95 A;  2LHL A;  1Q80 A;  2L5X B;  1IG5 A;  2ISD A;  2M8U A;  5KSZ A;  1J7P A;  3DVK A;  1YVL A;  2M7L A;  3O78 A;  2MBX A;  1QAT A;  3PAL A;  4N1F A;  1BF5 A;  4I5J A;  3BYA A;  2K7D A;  3SG7 A;  2HQW A;  3HCM A;  2MLF C;  2F3Z A;  5CSN A;  4BY4 A;  3NXA A;  1FPW A;  2L51 A;  1MXL C;  1A4P A;  4PAL A;  5HLO A;  5I2L A;  3I5F C;  1B9A A;  1OZS A;  1A75 A;  1RTP 1;  1K9K A;  2KI6 D;  2FOT A;  1XA5 A;  2Y4Q A;  1PUL A;  1UHI A;  3EK8 A;  4P5O E;  2CNP A;  1EG3 A;  1KCY A;  4QJ4 B;  2LLS A;  2O5G A;  1K9U A;  4MVF A;  5KU1 A;  1DMO A;  3KF9 A;  1B7T Y;  2LLU A;  3SJS A;  1N0Y A;  4PE0 A;  2ZFD A;  4YI9 A;  3SIA A;  2R2I A;  4MZL A;  1W7I B;  1TIZ A;  3D0Y A;  2FCD A;  2ZRS A;  3A8R A;  1IKU A;  1OMV A;  1XK4 A;  3I5I C;  1ZUZ A;  1WLM A;  2BBM A;  1OMD A;  5D69 A;  4DRW A;  2H61 C;  2KAX A;  2LMU A;  3WXA A;  3TUY C;  4YGE B;  3EVU A;  1Y1A A;  5AER A;  5AFP A;  2LAN A;  1XVJ A;  2EC6 B;  2F2O A;  1CB1 A;  1DJY A;  3IF7 A;  1F55 A;  1JSA A;  5ER4 X;  2L2E A;  4U8D A;  1DGV A;  2JOJ A;  1B8R A;  4BY5 A;  2LVJ A;  2LUC A;  2CT9 A;  3PN7 C;  3SG3 A;  2LVK A;  5JJG A;  1MUX A;  1S36 A;  1UHH A;  2H61 A;  3FS7 A;  2KFF A;  3LCP C;  2JRF A;  2BCB A;  1BJF A;  2PMY A;  4MN0 A;  3AKB A;  5AXI A;  4MRX A;  3TS5 C;  1DVI A;  1M39 A;  1BR1 B;  4OCI A;  2M97 A;  2EGD A;  1PAL A;  1KWO B;  2MJW B;  3OB2 B;  1TCF A;  1X02 A;  2BKH B;  5I8N A;  1KQM B;  1F4O A;  2AUC A;  3ZNI A;  4HRG A;  1CLL A;  4UPG A;  1FF1 A;  2SAS A;  1NYA A;  1JUO A;  3EKH A;  3VRQ A;  1UHJ A;  2WC8 A;  3GOF A;  3KHE A;  1BT6 A;  3K21 A;  1K94 A;  2SCP A;  3D10 A;  5HLV A;  2VRG A;  1NCZ A;  2M1K B;  5DKR A;  1UHK A;  4FQO A;  2EHB A;  3OHM B;  2ZN8 A;  4NQG A;  3NSI A;  3O2P A;  3O6B A;  1CFF A;  3DF0 B;  1S26 D;  5J3X A;  1J7Q A;  4HRE E;  1JFK A;  2LNK A;  2M7N A;  1QV1 A;  5CSF A;  1L2O C;  1YRT B;  1SKT A;  2PAL A;  3CLN A;  3LLE A;  4MZJ A;  1SCM B;  3DVJ A;  2P6B B;  2WOR A;  5IBW A;  3CGA A;  3KO0 A;  1V1G A;  1DF0 B;  1SCV A;  2KYC A;  2L4H A;  2M49 B;  2JNF A;  1CKK A;  1RFJ A;  1N2D A;  5DKQ A;  1PK0 D;  3CR4 X;  2MA2 A;  1XFZ O;  1GGW A;  3VRO A;  1HQV A;  2KFH A;  4DUQ A;  2JZI A;  1ODB A;  1CMF A;  1S5G Z;  1JWD A;  4HSZ A;  1NX0 A;  2LMV A;  3DVE A;  2OPO A;  5CSJ A;  1PSB A;  2F2P A;  4PCW A;  1K8U A;  1DGU A;  3BQ3 A;  1TOP A;  1CFC A;  4PHK A;  2ZRT A;  3VGO A;  1QS7 A;  3BOW B;  4QJ5 B;  1M63 B;  3GK4 X;  3PSR A;  1MF8 B;  2JU0 A;  1F8H A;  4MRY A;  1GQM A;  2KI6 C;  1XFY O;  2FJU B;  1R6P A;  1MWN A;  3AKA A;  3LL8 B;  3TZ1 A;  1SL8 A;  2K0J A;  2KQY A;  1NWD A;  1V1F A;  1L7Z A;  4OVN F;  3BUM B;  2KNE A;  3E3R A;  1AHR A;  4XJK A;  2ZND A;  2I18 A;  2PRU A;  2G9B A;  2K61 A;  2LP2 A;  2BKI B;  3CTN A;  4M2O A;  5I2Q A;  1MQ1 A;  2I94 A;  2OS8 B;  2KFG A;  1IRJ A;  1MR8 A;  4N1G A;  1CFD A;  1QTX A;  2JTZ A;  1BR4 B;  2KDH A;  4PE1 A;  1OE9 B;  4PHN A;  1XYD A;  2NZ0 A;  3QRX A;  1TNX A;  5CSI A;  2B1U A;  1SR6 B;  4JPZ B;  3CR2 A;  1U5I A;  2KYF A;  4NDD A;  1TTX A;  2AMI A;  2MHH A;  3FWB A;  1ALW A;  1CDL A;  1J7O A;  4L9M A;  2PAS A;  3OP0 A;  4GFT A;  2K2A A;  4CPV A;  1KFX L;  1QAS A;  2KOT A;  4PHM A;  4DS7 A;  4I5K A;  4WRI A;  4XYN A;  1UHN A;  1SR6 C;  2M9G A;  4GGF C;  1TNP A;  3M0W A;  1SYM A;  1ZFS A;  2LE9 B;  2BEC A;  2KHN A;  2F3Y A;  1QVI Y;  4HRH A;  1DJI A;  2O60 A;  1B8L A;  2LM5 A;  4MLW A;  1B4C A;  1XFV O;  1AJ5 A;  2JC2 A;  1PSR A;  1ZOT B;  2JTT A;  2L50 A;  2I7A A;  3WNX B;  4QJ3 B;  1OMR A;  2WCB A;  2EC6 C;  5CPV A;  2BE4 A;  4NDB A;  1UP5 A;  1DJG A;  1XFX O;  1M45 A;  2AAO A;  4GUK A;  4MZK A;  2LLT A;  2LVV A;  4JWQ A;  1C7W A;  1FI6 A;  4GBA A;  1GGZ A;  4ZCV A;  3PAT A;  2WOS A;  2KGB C;  1NSH A;  2NLN A;  4GPL B;  1M31 A;  3A4U B;  1SK6 D;  2Q91 A;  2QPT A;  1SY9 A;  1N65 A;  2E6W A;  2JQ6 A;  1EH2 A;  1B7T Z;  1UUS A;  4PHJ A;  1YUS A;  2L4I A;  1SW8 A;  1W7J B;  1WDC B;  2NXQ A;  2OTG B;  3CZT X;  5DKN A;  3RM1 A;  1OZO A;  2M3W A;  4I5L B;  4ORB B;  4PE4 A;  1G4Y R;  1KWO C;  2WND A;  1A29 A;  1K9P A;  1S1E A;  1SBJ A;  2G2B A;  1KQM C;  2GGM A;  3GK2 A;  1YUR A;  2CXJ A;  1YTZ C;  4PE7 A;  1H8B A;  3TDZ A;  4MSP A;  3NSK A;  4Q04 A;  1UUR A;  5B8I B;  1JBA A;  1KQV A;  1GJY A;  1K96 A;  1D1O A;  2BL0 B;  1SNL A;  2KQ6 A;  1KK7 Y;  1CDM A;  2LVI A;  1KFU S;  1K2H A;  2HF5 A;  4NDC A;  2Y5I A;  5HKW A;  1CDN A;  2BCA A;  4AOM A;  1BMO A;  1YR5 A;  2L0P A;  3I5G B;  3LK1 A;  2NCP A;  1YRU B;  5KTY A;  2LP3 A;  2GV5 A;  3DVM A;  1LA3 A;  1CLB A;  3SG4 A;  4GGN A;  4MBE A;  1CLM A;  3JVT B;  3SIB A;  1J1E A;  1SCM C;  1TRF A;  1F4Q A;  3BUO B;  1J7R A;  1K90 D;  1EXR A;  1Y6W A;  5K89 A;  5D7F A;  1HT9 A;  3NSL A;  3BXK A;  1A03 A;  2KSP A;  5TNC A;  1AVS A;  2IS9 A;  4D1E A;  3AAK A;  3DF0 A;  3LK0 A;  4P2Y B;  3I5H B;  1QLS A;  4PDZ A;  1BOC A;  2KI4 B;  5HKY A;  1Y1U A;  1DJH A;  2KAV A;  1B8C A;  2MLE C;  5PAL A;  3C1V A;  3EVR A;  1BLQ A;  2LAP A;  1S6J A;  2H2K A;  4A4C A;  1NX3 A;  1EL4 A;  3FIA A;  1F54 A;  2JT3 A;  1NX2 A;  1DF0 A;  1IQ3 A;  2MAZ A;  2KI4 C;  2ZN9 A;  3VRP A;  1ZMZ A;  3WHU B;  1QIV A;  3JTD B;  4XJK B;  4C0L A;  1BU3 A;  2BBN A;  4ORA B;  1A75 B;  2E30 A;  1KK7 Z;  3BUW B;  1YVH A;  3EKJ A;  4OR9 B;  1IWQ A;  2KBM A;  4A4B A;  1A2X A;  1VRK A;  3IQO A;  4ETO A;  1CM4 A;  4CID A;  3SG2 A;  4YGD B;  1RK9 A;  4R1E A;  1KFX S;  5F6T A;  2CBL A;  3F45 A;  4DCK A;  1XFU O;  3BOW A;  1J1D A;  2JWW A;  4CLN A;  1U5I B;  1QXP A;  1CDP A;  1JFJ A;  3I5F B;  5FYX A;  3PFV A;  5GQQ C;  2K2F A;  3D0Y B;  1LIN A;  1IH0 A;  1IJ5 A;  1J55 A;  2OS8 C;  4AQJ A;  3MSE B;  1EG4 A;  2BCX A;  2QAC A;  3OX5 A;  4CFR A;  1B1G A;  1WRK A;  2CTN A;  2JNX A;  1OQP A;  1NCY A;  3KEV A;  4N5X A;  1CTR A;  2BE6 A;  3H4S E;  3WHT B;  1F71 A;  4YGC B;  1TN4 A;  1XK4 C;  4ICB A;  2LMT A;  1SMG A;  1LKJ A;  3DD4 A;  1XO5 A;  2DOQ A;  4FTG A;  1RWY A;  2LV7 A;  3SG5 A;  1BOD A;  1BG1 A;  5I2O A;  3I5I B;  5AEQ A;  1QV0 A;  2KBI A;  2JPT A;  1DTL A;  2RGI A;  1DJW A;  2ZKM X;  1NCX A;  4USL A;  1OOJ A;  3TUY B;  2ZNE A;  4ORC B;  5AAN A;  1UWO A;  1TNW A;  1NX1 A;  1SL7 A;  3PM8 A;  2A4J A;  3SG6 A;  2CCM A;  5JOL A;  2Y1N A;  2F33 A;  4GGF A;  1CNP A;  3VRN A;  1K93 D;  1Y0V H;  4I5N B;  1CFP A;  1NP8 A;  1NUB A;  1QLK A;  4YGB B;  1OSA A;  4GAO A;  5HKZ A;  1JF0 A;  2WCF A;  2MRD A;  3PN7 B;  2JUL A;  3VRR A;  4YRU A;  1QIW A;  1QX5 B;  3OB1 B;  1IQ5 A;  5ER5 A;  1DJZ A;  2PSR A;  2GGZ A;  2HET A;  1DT7 B;  1NIW A;  1JC2 A;  3TS5 B;  4OV2 A;  2WCE A;  2JXL A;  1LVC D;  2K7O A;  1PRW A;  3ZWH A;  1AJ4 A;  2HPS A;  1LXF C;  1KK8 B;  4YI8 A;  2K7B A;  1YX7 A;  2D8N A;  2M1U A;  2LUX A;  3CWG A;  1E8A A;  1SPY A;  1REC A;  2NCO A;  1NPQ A;  1H4B A;  1WRZ A;  3BUX B;  1WDC C;  1F70 A;  5HYD A;  2L98 A;  2OTG C;  4E68 A;  1S5G Y;  1KSM A;  1FBV A;  2F8P A;  4F0Z B;  1C07 A;  1KK8 C;  1QX2 A;  1FW4 A;  2JT8 A;  1QVI Z;  3ICB A;  1RJV A;  3KPX A;  4YBH B;  2V53 A;  1B47 A;  3HX4 A;  2K8M B;  2M0R A;  3CS1 A;  2FCE A;  2PVB A;  3TDI A;  1XFW O;  3CR5 X;  4OKH A;  3EVV A;  1ZAC A;  2LCP A;  4C0K A;  2BL0 C;  1TNQ A;  1WRL A;  4GNK B;  1L2O B;  1MHO A;  1WLZ A;  1CMG A;  2KGR A;  1PVB A;  1C7V A;  3AAJ A;  2COL B;  1FI5 A;  3OX6 A;  5BPJ A;  4DIR A;  1RRO A;  3I5G C;  3BUN B;  2K7C A;  1YX8 A;  2M29 A;  4WQ3 A;  1AK8 A;  1MXE A;  3JVT C;  3GK1 A;  1AP4 A;  1KSO A;  1QX7 A;  4M2P A;  3FWC A;  2Y1M A;  1JF2 A;  1S3P A;  2JXC A;  5G08 A;  1Y1X A;  2HQ8 A;  4IL1 A;  1TCO B;  3PLF B;  3EK4 A;  2TN4 A;  4C0J A;  1CM1 A;  4JQ0 D;  1YUU A;  1QJT A;  2LHI A;  3O4Y A;  4MEW A;  2LC5 A;  3I5H C;  1KFU L;  1DJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...