2ZN9A

Crystal structure of ca2+-bound form of des3-20alg-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
169
structure length
169
Chain Sequence
b'ALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 61
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zn9A00
4PE7A 2JNFA 2EHBA 2FCDA 3CR4X 2LMVA 4HRHA 1DJIA 2LUCA 2Q4UA 1KFXL 3TZ1A 3AAJA 2R2IA 2TN4A 3JTDC 2FJUB 1B1GA 2KQ6A 1F8HA 1FI6A 2WCFA 2L51A 1RECA 2KBMA 1DJYA 5DKRA 3AKAA 2M49B 4DIRA 1WRKA 2L50A 3SIAA 1EG4A 4M2PA 1S5GY 1DJWA 1IWQA 1CB1A 5HLOA 4E68A 3BYAA 3TUYC 1GJYA 1PVAA 3FS7A 5HYDA 3KO0A 4GGNA 2FCEA 3JTDB 4YGCB 2BECA 1YRUB 1DGVA 2FOTA 2KDHA 1CLBA 2MA2A 4GNKB 1V1FA 1CDMA 4YGEB 2ZN8A 3E3RA 1F71A 3EK4A 1DVIA 1K93D 3KEVA 4OV2A 1R2UA 2L5XB 1K9PA 1R6PA 1YR5A 3I5FC 3I5GC 3BQ3A 1BLQA 2KI6D 4ORBB 1QIWA 1TNQA 2BE6A 1ODBA 2ZRTA 3PLFB 1NX2A 3IF7A 1OQPA 2IS9A 1M39A 3AAKA 2KOTA 1TNXA 1TRFA 3LLEA 2BCXA 1IJ5A 1V1GA 1TCFA 5G08A 1DJZA 3I5GB 3PN7C 1MXEA 4N1GA 1C7VA 3EKJA 1UHJA 2LM5A 2HPSA 4PHNA 1C7WA 1M45A 1KQVA 5CSFA 1XFUO 1CFFA 1KQMC 1TTXA 2PVBA 2JQ6A 1SBJA 2K7DA 4NDCA 1D1OA 1EL4A 5PALA 1CDNA 1NX1A 1YUSA 3GK1A 1WDCC 2HQWA 4WRIA 4YGDB 3NSKA 1QXPA 2KI4C 2LLTA 3EVVA 2KFFA 1ZOTB 1UHIA 2GGZA 1XVJA 2SCPA 4ORCB 1S3PA 1C07A 2HF5A 3ZNIA 2B1UA 1K96A 2JRFA 1KQMB 1RTP1 3NSIA 1S6IA 1Y1AA 2OS8C 3LK1A 3O2PA 3VRQA 4A4CA 2JXCA 2H61C 1WDCB 2JXLA 1XFZO 2OTGB 1IQ5A 1Q80A 4IL1A 1CMFA 3IQQA 2GGMA 4XJKA 1DT7B 1H8BA 1RJVA 1NCZA 1XYDA 1KWOC 5CPVA 1WLZA 1PSRA 2LLSA 2PRUA 2I2RE 3HCMA 1KFUL 4HRGA 4XJKB 2ZFDA 5JJGA 2O60A 3TS5C 4PE1A 3GK4X 1G4YR 2KGRA 2OS8B 4NQGA 1AUIB 1MF8B 2KSPA 4QJ4B 4ZCVA 2M1KB 3BOWA 3O6BA 4FQOA 5CSJA 4AQIA 3BUXB 3WHTB 2K7OA 3BOWB 1LKJA 4WQ2A 2PALA 2JC2A 1JUOA 1SCMC 1JWDA 2MAZA 3D10A 3ICBA 1KK8C 1QS7A 1S5GZ 2KNEA 3DVMA 3PM8A 1X02A 1NX3A 1CLMA 2BL0C 3NSOA 2JZIA 1CFDA 1QASA 1SW8A 3A8RA 4C0JA 5B8IB 1SRAA 1S36A 1LINA 3C1VA 4JQ0D 2WCEA 4GAOA 2JT8A 1IH0A 3D0YA 1NYAA 4ORAB 1TNWA 1SPYA 3H4SE 4HSZA 3NXAA 3D0YB 2COLB 2M9GA 1SMGA 2CBLA 3LCPC 2EC6C 3I5IC 5AEQA 2V53A 3PALA 1XK4C 1CM1A 1DF0A 4MZKA 1J55A 3RM1A 4DRWA 1MR8A 1OMDA 1ZUZA 3VRRA 1NSHA 1XO5A 1JC2A 5KSZA 1DF0B 1LA3A 2NCPA 3CR2A 1YUTA 3EVUA 2LHLA 2LVIA 4QJ3B 3CLNA 4MRYA 3DVKA 1F4QA 3EK8A 1BJFA 1TNPA 3OX6A 1UHKA 5JOLA 1Y1UA 1U5IA 1XFWO 2LNKA 2F3ZA 2F8PA 1B8RA 2EC6B 2MJWB 2ZN9A 1M46A 3I5IB 1NCYA 5HLVA 1ALVA 2ZKMX 1S6CA 1AJ5A 3EVRA 1NIWA 1U5IB 4U8DA 3DD4A 2K8MB 4PHKA 4P2YB 5AERA 1YTZC 2L0PA 1CDPA 1JF0A 3PFVA 3VGOA 3GK2A 3WNXB 4P5OE 2L4HA 2LCPA 4GPLB 4BY4A 2KI6C 4QJ5B 1RROA 4OR9B 4GBAA 4Q04A 2AMIA 2NCOA 3TUYB 4AQJA 2PMYA 1CM4A 1N2DA 2M97A 1YX8A 1TIZA 2K2AA 1JBAA 1TCOB 3BUWB 2K7CA 1RK9A 2CT9A 1IGVA 2HQ8A 1VRKA 2JTZA 2JT3A 1G33A 3LL8B 2LLUA 1CFPA 1Y1XA 1K95A 2LMTA 2WORA 1SKTA 4FTGA 3ZWHA 4PHJA 1PULA 2PSRA 3I5FB 2NZ0A 1N0YA 2K0JA 4M2OA 1BOCA 1QV1A 3EK7A 1B8LA 1K8UA 1UUSA 2BCAA 5DKQA 5F6TA 1H4BA 1PALA 5FYXA 3SG5A 1K9UA 1G8IA 1IRJA 1KFUS 1F4OA 3CGAA 4PE4A 4DUQA 3FWCA 4GUKA 5ER5A 2JTTA 4JPZB 4MVFA 1J7RA 2L2EA 1OZOA 1AVSA 1J7OA 1BR4B 2KFGA 2M8UA 1F54A 1W7IB 4YGAA 2M3WA 2JULA 3PN7B 1AP4A 1J1EA 1QX7A 4PE0A 1QTXA 2LV7A 5AXIA 3DVEA 2M0RA 1AJ4A 1WLMA 1XFYO 1CNPA 4C0LA 2RGIA 1BMOA 1A2XA 3SG4A 3CZTX 4GFTA 3DVJA 3PATA 3SG2A 1ZACA 1OE9B 1KCYA 1KSMA 2K7BA 3JVTC 1F70A 4I5KA 4MBEA 2KI4B 1DJHA 5CSIA 1Y0VH 1YURA 1MHOA 2M29A 2NLNA 1SCVA 1K90D 2M1UA 1UWOA 4YI9A 3KPXA 1FW4A 2LVVA 1NP8A 3QRXA 4CPVA 1J1DA 1UP5A 2H61A 4WQ3A 3SIBA 1SR6C 2QACA 4JWQA 1JF2A 2E6WA 2O5GA 3I5HC 2LP2A 1QLSA 1J7PA 4OCIA 1DGUA 1YX7A 2HETA 3BUNB 5AFPA 1KFXS 4CIDA 3CR5X 1KWOB 2NXQA 1M31A 1BODA 2BKHB 4HREE 1TN4A 1EXRA 2BE4A 3SG3A 1OOJA 1FBVA 2LP3A 2CCMA 3TS5B 1SL7A 1B7TY 2BCBA 2L98A 2ZNEA 3WXAA 1SL9A 2G2BA 4XYNA 4C0KA 1CDLA 1ALWA 3I5HB 5I2OA 1K2HA 2PASA 1MUXA 2K2FA 1UHNA 3OB1B 1S6JA 4DCKA 2KQYA 2A4JA 1QLKA 2KBIA 2KAYA 5IBWA 1SCMB 1EG3A 1QJTA 4GGFC 3VROA 4BY5A 1LA0A 1KK8B 5KU1A 2MRDA 5CSNA 2Q91A 1UHHA 1YVHA 1QX2A 2E30A 2BL0B 3TDUA 5KTYA 2WCBA 2MLFC 3GOFA 1F55A 2JU0A 4MZJA 4TNCA 4DS7A 1BG1A 1OSAA 1ZMZA 2F3YA 2JWWA 3CS1A 1CLLA 4MN0A 1OMRA 1PRWA 1QATA 2CNPA 4USLA 1CTRA 4PCWA 2I7AA 3NSLA 4MRXA 1XK4A 2Y5IA 2Y1NA 1LVCD 1FI5A 1QIVA 3F45A 3CTNA 5D69A 4N1FA 1KSOA 2WNDA 1BU3A 2MHHA 2SASA 1KK7Y 4ICBA 1E8AA 3FWBA 1NX0A 1SK6D 2KGBC 5ER4X 1CKKA 1DMOA 2I18A 1HT9A 5I2LA 1IJ6A 1JFJA 2ZRSA 4NDDA 1B9AA 1W7JB 3A4UB 3FIAA 3K21A 3O78A 4A4BA 3RLZA 2BKIB 2GV5A 4D1EA 4MEWA 4YGBB 1QX5B 3AKBA 4ZCUA 2M7NA 1CMGA 3PSRA 2LVKA 5DKNA 2KAVA 1B8CA 1B4CA 2Y1MA 1QVIY 1S26D 4OVNF 3MSEB 2P6BB 1B47A 1DJGA 1RFJA 3WHUB 4YBHB 4F0ZB 1SNLA 1EJ3A 1SYMA 3OX5A 3EKHA 2KFHA 1A75A 3LK0A 1MWNA 2MBXA 2L4IA 1IQ3A 1BR1B 2F2OA 2KHNA 1CFCA 3OB2B 3TDZA 2QPTA 1A75B 1GGWA 4I5LB 1WRZA 5I8NA 1AHRA 2I94A 1YRTB 4MLWA 2F33A 4OKHA 3BXKA 1RWYA 1XA5A 2JT0A 4N5XA 2EGDA 1NUBA 1PVBA 5J3XA 1JFKA 3BUMB 4YRUA 2KAXA 3VRPA 2BBMA 1UURA 2JPTA 2KYCA 2LHIA 5I2QA 1L7ZA 1YVLA 2LC5A 5AANA 1FPWA 3KF9A 1B7TZ 4R1EA 1ZFSA 1IG5A 4PALA 1XFVO 1A29A 2LANA 1M63B 2VRGA 1HQVA 2OTGC 5HKYA 1A03A 3SG6A 1JSAA 2ISDA 4MSPA 2M7LA 2LAPA 1DTLA 2BBNA 3SG7A 1NPQA 4CFQA 2WOSA 2LMUA 2KYFA 5TNCA 1A4PA 3VRNA 2CXJA 3DF0A 1N65A 3JVTB 2CTNA 1K94A 1BF5A 2MLEC 2D8NA 1WRLA 2OPOA 1NCXA 3DF0B 1FF1A 2WC8A 4I5JA 2LVJA 2LUXA 4L9MA 1GQMA 1L2OC 1XFXO 1MQ1A 4NDBA 1S1EA 5D7FA 1WY9A 3CWGA 1EH2A 1SR6B 5K89A 5HKZA 3O4YA 4CLNA 1KK7Z 1SL8A 3M0WA 1DJXA 2AUCA 1YUUA 2H2KA 4I5NB 1SY9A 5GQQC 1QV0A 1J7QA 1BT6A 1PSBA 4PDZA 3SJSA 3TDIA 1L2OB 2JOJA 2ZNDA 4AOMA 2DOQA 1PK0D 1LXFC 3BUOB 1AK8A 1NWDA 1Y6WA 2Y4QA 1OMVA 4ETOA 5HKWA 1QVIZ 2JNXA 2F2PA 4GGFA 5BPJA 3KHEA 1GGZA 4M2QA 1K9KA 3OHMB 3OP0A 4PHMA 4UPGA 1TOPA 2AAOA 4CFRA 1MXLC 2LE9B 1OZSA 3HX4A 4YI8A 4MZLA 2G9BA 3IQOA 2K61A 1IKUA
chains in the Genus database with same CATH superfamily
4PE7A 2JNFA 2WCKA 1DELA 2EHBA 2FCDA 3CR4X 2LMVA 4HRHA 1DJIA 2LUCA 2Q4UA 1KFXL 3TZ1A 1C3ZA 2R2IA 2TN4A 3AAJA 2FJUB 3JTDC 2KQ6A 1B1GA 2ERBA 1F8HA 1FI6A 2WCFA 2L51A 1RECA 2KBMA 1DJYA 5DKRA 3AKAA 2M49B 4DIRA 1WRKA 2L50A 3SIAA 1EG4A 4M2PA 1S5GY 1DJWA 1IWQA 1CB1A 5HLOA 4E68A 3BYAA 3TUYC 1GJYA 3D76A 1PVAA 2QEHA 3FS7A 5HYDA 3KO0A 4GGNA 1IKUA 2WCLA 2BNXA 2FCEA 3JTDB 3Q8IA 4YGCB 2BECA 1YRUB 1DGVA 1XFRA 2FOTA 2KDHA 1CLBA 2MA2A 4GNKB 1V1FA 1CDMA 4YGEB 2ZN8A 3E3RA 1F71A 3EK4A 2PQLA 2QDIA 1DVIA 1K93D 3KEVA 4OV2A 1R2UA 2L5XB 1K9PA 5DICA 1R6PA 1YR5A 3R72A 3I5FC 3OGNA 3I5GC 3BQ3A 1BLQA 2KI6D 4ORBB 1QIWA 1TNQA 2BE6A 1ODBA 1ORGA 2ZRTA 3PLFB 1NX2A 3IF7A 1OQPA 2IS9A 3FE9A 5EL2A 3S0FA 1M39A 3AAKA 3BFHA 2KOTA 1TNXA 1TRFA 3D74A 3LLEA 2BCXA 3K1EA 4JKTA 1IJ5A 1V1GA 1TCFA 5G08A 1DJZA 3I5GB 1TUJA 1MXEA 3PN7C 4N1GA 1C7VA 3EKJA 1UHJA 2LM5A 2HPSA 4PHNA 1C7WA 1M45A 3S0GA 1KQVA 5CSFA 1XFUO 1CFFA 1KQMC 3PM2A 1TTXA 2PVBA 3L47A 2JQ6A 1SBJA 2K7DA 4NDCA 1D1OA 1EL4A 5PALA 1CDNA 1NX1A 1YUSA 3GK1A 1WDCC 2HQWA 4WRIA 4YGDB 3NSKA 1QXPA 2KI4C 2LLTA 3EVVA 2KFFA 1ZOTB 1UHIA 2GGZA 1XVJA 2SCPA 4ORCB 1S3PA 1Z4HA 1C07A 2HF5A 3ZNIA 2B1UA 1K96A 2JRFA 1KQMB 1RTP1 3NSIA 1S6IA 1Y1AA 2OS8C 2YGUA 3LK1A 3O2PA 1Z2CB 3VRQA 4A4CA 2WC6A 2JXCA 2H61C 1WDCB 2JXLA 1XFZO 2OTGB 1IQ5A 1Q80A 4IL1A 1CMFA 3IQQA 2GGMA 4XJKA 1DT7B 1H8BA 1RJVA 1NCZA 1XYDA 1KWOC 5CPVA 1WLZA 1PSRA 2LLSA 2PRUA 2I2RE 3HCMA 1KFUL 2K60A 4HRGA 4XJKB 2ZFDA 5JJGA 2O60A 3TS5C 4PE1A 5FI2A 3GK4X 1G4YR 2KGRA 2OS8B 5D3OA 1TWOA 4OZDA 4NQGA 1AUIB 5FI7A 1MF8B 2KSPA 4QJ4B 3CABA 4ZCVA 2M1KB 3BOWA 3O6BA 4FQOA 5CSJA 4AQIA 5HL1A 3BUXB 3WHTB 2K7OA 3BOWB 1LKJA 4WQ2A 2PALA 2JC2A 1JUOA 1QWVA 1SCMC 2MAZA 3D10A 1JWDA 3ICBA 1KK8C 1QS7A 1S5GZ 2KNEA 3DVMA 3PM8A 1X02A 1NX3A 3QMEA 1CLMA 2BL0C 3NSOA 2JZIA 1CFDA 3SS5A 1QASA 1SW8A 3A8RA 4C0JA 5B8IB 3DY9A 1SRAA 1S36A 1LINA 2KLDA 3C1VA 4JQ0D 2WCEA 4GAOA 2JT8A 1IH0A 3D0YA 2H8VA 1NYAA 4ORAB 1TNWA 1SPYA 3H4SE 4HSZA 3NXAA 3D0YB 3B88A 2COLB 2M9GA 3NHTA 1SMGA 2CBLA 3LCPC 2EC6C 3I5IC 5AEQA 2V53A 3PALA 1XK4C 1CM1A 1DF0A 4MZKA 1J55A 3RM1A 4DRWA 1MR8A 1OMDA 1ZUZA 4INWA 3VRRA 1NSHA 1XO5A 1JC2A 5KSZA 1DF0B 1LA3A 2NCPA 3CR2A 1YUTA 2L2CA 3EVUA 2LHLA 2LVIA 4QJ3B 3CLNA 3R1PA 4MRYA 3DVKA 1F4QA 3EK8A 1BJFA 1TNPA 3OX6A 3V2LA 1UHKA 2QEOA 5JOLA 1Y1UA 1U5IA 1XFWO 2LNKA 2F3ZA 2F8PA 1B8RA 2EC6B 2KLEA 2MJWB 1M46A 2ZN9A 1NCYA 3I5IB 1DQEA 5HLVA 1ALVA 2ZKMX 1S6CA 1AJ5A 3EVRA 1NIWA 1U5IB 4U8DA 3DD4A 2K8MB 4PHKA 4P2YB 1OOFA 5AERA 1YTZC 2L0PA 1CDPA 1JF0A 3DXLA 3PFVA 3GK2A 3VGOA 4P5OE 2L4HA 2LCPA 4GPLB 3WNXB 4BY4A 2KI6C 4QJ5B 1RROA 4OR9B 4GBAA 4Q04A 2AMIA 2NCOA 3TUYB 4AQJA 2PMYA 1CM4A 1N2DA 2M97A 1YX8A 1TIZA 2K2AA 1JBAA 1TCOB 3BUWB 2K7CA 3NGVA 1RK9A 2CT9A 1IGVA 2HQ8A 1VRKA 2JTZA 2JT3A 1G33A 3LL8B 1DEKA 2LLUA 3D75A 1DC1A 1Y1XA 1OOHA 1K95A 2LMTA 1CFPA 2WORA 1SKTA 4FTGA 3ZWHA 4PHJA 1PULA 2PSRA 3I5FB 2NZ0A 1N0YA 2K0JA 4M2OA 1BOCA 1QV1A 3FE8A 3EK7A 1B8LA 1K8UA 1UUSA 2BCAA 5DKQA 5F6TA 1H4BA 3L4LA 1PALA 5FYXA 3SG5A 1K9UA 1G8IA 1IRJA 1KFUS 1F4OA 3BFBA 3CGAA 4PE4A 3FWCA 4DUQA 1C3YA 2FJYA 4GUKA 5ER5A 2JTTA 3DYEA 4JPZB 4MVFA 1J7RA 2L2EA 1OZOA 1AVSA 1J7OA 1BR4B 2KFGA 2M8UA 1F54A 1W7IB 3D73A 4YGAA 2M3WA 2JULA 3PN7B 1AP4A 1J1EA 1QX7A 4PE0A 1TUZA 1QTXA 2LV7A 5AXIA 3DVEA 2M0RA 1AJ4A 1WLMA 1XFYO 1CNPA 4C0LA 2RGIA 1BMOA 2BAPA 3CDNA 1A2XA 3SG4A 1OOGA 3CZTX 4GFTA 3DVJA 3PATA 4KYNA 1ZACA 3SG2A 1OE9B 1KCYA 1KSMA 2K7BA 3JVTC 1F70A 4I5KA 4MBEA 2KI4B 1DJHA 5CSIA 1Y0VH 1YURA 1MHOA 2M29A 2NLNA 5I94A 2PYQA 1SCVA 1K90D 2M1UA 1UWOA 4YI9A 3KPXA 1FW4A 2LVVA 1NP8A 3QRXA 4CPVA 1J1DA 1UP5A 2H61A 4WQ3A 3SIBA 1SR6C 2QACA 4JWQA 1JF2A 2E6WA 2O5GA 3I5HC 2GTEA 2LP2A 1QLSA 3RZSA 4OCIA 1J7PA 1DGUA 1YX7A 4F7FA 2HETA 3BUNB 3CZ2A 5AFPA 1KFXS 4CIDA 3CR5X 1KWOB 2NXQA 1M31A 1T14A 2BKHB 2QEBA 1TN4A 1EXRA 2BE4A 4HREE 1OW4A 1OOJA 3SG3A 1FBVA 2LP3A 2CCMA 3VB1A 1IIOA 3TS5B 3S0BA 1SL7A 1B7TY 2BCBA 2L98A 2ZNEA 3WXAA 1SL9A 2G2BA 4XYNA 4C0KA 1CDLA 1ALWA 3I5HB 5I2OA 1K2HA 2PASA 3NHIA 1MUXA 2K2FA 3EG5B 1UHNA 3OB1B 2JPOA 1S6JA 4DCKA 2KQYA 2A4JA 1QLKA 2KBIA 2KAYA 3CYZA 5IBWA 4FQTA 1SCMB 1EG3A 1QJTA 4GGFC 3VROA 4BY5A 1LA0A 1KK8B 5KU1A 2MRDA 5CSNA 2Q91A 1UHHA 1YVHA 1QX2A 2E30A 2BL0B 3TDUA 5KTYA 2WCBA 2MLFC 3GOFA 1F55A 2P70A 2JU0A 2WCHA 4MZJA 4TNCA 4DS7A 1BG1A 1OSAA 1ZMZA 2F3YA 2JWWA 3UNWA 4INXA 3CS1A 1CLLA 4MN0A 1OMRA 1PRWA 1QATA 2CNPA 4USLA 1CTRA 4PCWA 2I7AA 3NSLA 1LS8A 4MRXA 1XK4A 2Y5IA 3BJHA 2Y1NA 1LVCD 1FI5A 1QIVA 3F45A 3CTNA 5D69A 4N1FA 1KSOA 2WNDA 1BU3A 3SS4A 2MHHA 3DZTA 2SASA 3N7HA 1KK7Y 4ICBA 1E8AA 3FWBA 1NX0A 1SK6D 2KGBC 5ER4X 1CKKA 1DMOA 2I18A 1HT9A 5I2LA 1IJ6A 1JFJA 2ZRSA 4NDDA 1B9AA 1W7JB 3A4UB 3B7AA 3FIAA 3K21A 3O78A 4A4BA 3RLZA 2BKIB 2GV5A 4D1EA 4MEWA 4YGBB 1QX5B 3AKBA 4ZCUA 2M7NA 1CMGA 3PSRA 2LVKA 5DKNA 2KAVA 1B8CA 1B4CA 2Y1MA 1QVIY 1S26D 4OVNF 3MSEB 2P6BB 1B47A 1DJGA 1RFJA 3WHUB 3BFAA 4YBHB 4F0ZB 1SNLA 1EJ3A 1SYMA 3OX5A 3EKHA 2KFHA 1A75A 3LK0A 1MWNA 2MBXA 2L4IA 1IQ3A 1BR1B 2F2OA 2KHNA 1CFCA 3OB2B 3R1VA 3TDZA 2QPTA 1A75B 1GGWA 4I5LB 4PT1A 1WRZA 5I8NA 1AHRA 2I94A 3R1OA 1YRTB 4MLWA 2F33A 3CZ1A 4OKHA 3BXKA 1RWYA 1XA5A 2KPHA 2JT0A 4N5XA 2WCMA 2EGDA 1NUBA 1PVBA 5J3XA 1JFKA 3S0DA 3BUMB 4YRUA 2KAXA 4IJ7A 3IVTA 3VRPA 3B6XA 2BBMA 1UURA 2JPTA 2KYCA 2LHIA 5I2QA 1L7ZA 1YVLA 2LC5A 5AANA 1BODA 1P28A 1GM0A 1FPWA 3SS3A 3KF9A 1B7TZ 3UO9A 4R1EA 3B87A 1ZFSA 1IG5A 4PALA 1XFVO 1A29A 2LANA 1M63B 2VRGA 1HQVA 2OTGC 5HKYA 1A03A 2L5YA 3SG6A 1JSAA 2ISDA 4MSPA 3O4XA 2M7LA 2LAPA 1DTLA 2BBNA 3B86A 3SG7A 1NPQA 4CFQA 2WOSA 2LMUA 2KYFA 5TNCA 1A4PA 3VRNA 2CXJA 3DF0A 1N65A 3JVTB 2CTNA 1OOIX 3S0EA 1K94A 1BF5A 2MLEC 2D8NA 1WRLA 2OPOA 1NCXA 3DF0B 1FF1A 3D78A 2WC8A 4I5JA 2LVJA 2LUXA 4L9MA 1GQMA 1L2OC 1XFXO 1MQ1A 4NDBA 1S1EA 5D7FA 1WY9A 3CWGA 1EH2A 1SR6B 2WCJA 5K89A 5HKZA 3O4YA 4CLNA 1KK7Z 1SL8A 3M0WA 1DJXA 2AUCA 1YUUA 2H2KA 2P71A 1SY9A 4I5NB 4JD9A 1QV0A 5GQQC 1J7QA 1BT6A 3D77A 3L4AA 1PSBA 3PJIA 4PDZA 3SJSA 3TDIA 1L2OB 2JOJA 2ZNDA 4AOMA 2DOQA 1PK0D 1LXFC 3BUOB 1AK8A 1NWDA 2WC5A 1Y6WA 2Y4QA 1OMVA 3OBVA 4ETOA 1W9ZA 3CZ0A 5HKWA 1QVIZ 2JNXA 2F2PA 4GGFA 5BPJA 3KHEA 5FI6A 1GGZA 4M2QA 1K9KA 3OHMB 1SSEB 3OP0A 4PHMA 4UPGA 3S0AA 1TOPA 2AAOA 4CFRA 1MXLC 2LE9B 1OZSA 3HX4A 4YI8A 4MZLA 2G9BA 3IQOA 2K61A 3FE6A 2QEVA
chains in the Genus database with same CATH topology
4PE7A 2JNFA 2EHBA 2FCDA 3CR4X 2LMVA 4HRHA 1DJIA 2LUCA 2Q4UA 1KFXL 3TZ1A 3AAJA 2R2IA 2TN4A 3JTDC 2FJUB 1B1GA 2KQ6A 1F8HA 1FI6A 2WCFA 2L51A 1RECA 2KBMA 1DJYA 5DKRA 3AKAA 2M49B 4DIRA 1WRKA 2L50A 3SIAA 1EG4A 4M2PA 1S5GY 1DJWA 1IWQA 1CB1A 5HLOA 4E68A 3BYAA 3TUYC 1GJYA 1PVAA 3FS7A 5HYDA 3KO0A 4GGNA 2FCEA 3JTDB 4YGCB 2BECA 1YRUB 1DGVA 2FOTA 2KDHA 1CLBA 2MA2A 4GNKB 1V1FA 1CDMA 4YGEB 2ZN8A 3E3RA 1F71A 3EK4A 1DVIA 1K93D 3KEVA 4OV2A 1R2UA 2L5XB 1K9PA 1R6PA 1YR5A 3I5FC 3I5GC 3BQ3A 1BLQA 2KI6D 4ORBB 1QIWA 1TNQA 2BE6A 1ODBA 2ZRTA 3PLFB 1NX2A 3IF7A 1OQPA 2IS9A 1M39A 3AAKA 2KOTA 1TNXA 1TRFA 3LLEA 2BCXA 1IJ5A 1V1GA 1TCFA 5G08A 1DJZA 3I5GB 3PN7C 1MXEA 4N1GA 1C7VA 3EKJA 1UHJA 2LM5A 2HPSA 4PHNA 1C7WA 1M45A 1KQVA 5CSFA 1XFUO 1CFFA 1KQMC 1TTXA 2PVBA 2JQ6A 1SBJA 2K7DA 4NDCA 1D1OA 1EL4A 5PALA 1CDNA 1NX1A 1YUSA 3GK1A 1WDCC 2HQWA 4WRIA 4YGDB 3NSKA 1QXPA 2KI4C 2LLTA 3EVVA 2KFFA 1ZOTB 1UHIA 2GGZA 1XVJA 2SCPA 4ORCB 1S3PA 1C07A 2HF5A 3ZNIA 2B1UA 1K96A 2JRFA 1KQMB 1RTP1 3NSIA 1S6IA 1Y1AA 2OS8C 3LK1A 3O2PA 3VRQA 4A4CA 2JXCA 2H61C 1WDCB 2JXLA 1XFZO 2OTGB 1IQ5A 1Q80A 4IL1A 1CMFA 3IQQA 2GGMA 4XJKA 1DT7B 1H8BA 1RJVA 1NCZA 1XYDA 1KWOC 5CPVA 1WLZA 1PSRA 2LLSA 2PRUA 2I2RE 3HCMA 1KFUL 4HRGA 4XJKB 2ZFDA 5JJGA 2O60A 3TS5C 4PE1A 3GK4X 1G4YR 2KGRA 2OS8B 4NQGA 1AUIB 1MF8B 2KSPA 4QJ4B 4ZCVA 2M1KB 3BOWA 3O6BA 4FQOA 5CSJA 4AQIA 3BUXB 3WHTB 2K7OA 3BOWB 1LKJA 4WQ2A 2PALA 2JC2A 1JUOA 1SCMC 1JWDA 2MAZA 3D10A 3ICBA 1KK8C 1QS7A 1S5GZ 2KNEA 3DVMA 3PM8A 1X02A 1NX3A 1CLMA 2BL0C 3NSOA 2JZIA 1CFDA 1QASA 1SW8A 3A8RA 4C0JA 5B8IB 1SRAA 1S36A 1LINA 3C1VA 4JQ0D 2WCEA 4GAOA 2JT8A 1IH0A 3D0YA 1NYAA 4ORAB 1TNWA 1SPYA 3H4SE 4HSZA 3NXAA 3D0YB 2COLB 2M9GA 1SMGA 2CBLA 3LCPC 2EC6C 3I5IC 5AEQA 2V53A 3PALA 1XK4C 1CM1A 1DF0A 4MZKA 1J55A 3RM1A 4DRWA 1MR8A 1OMDA 1ZUZA 3VRRA 1NSHA 1XO5A 1JC2A 5KSZA 1DF0B 1LA3A 2NCPA 3CR2A 1YUTA 3EVUA 2LHLA 2LVIA 4QJ3B 3CLNA 4MRYA 3DVKA 1F4QA 3EK8A 1BJFA 1TNPA 3OX6A 1UHKA 5JOLA 1Y1UA 1U5IA 1XFWO 2LNKA 2F3ZA 2F8PA 1B8RA 2EC6B 2MJWB 2ZN9A 1M46A 3I5IB 1NCYA 5HLVA 1ALVA 2ZKMX 1S6CA 1AJ5A 3EVRA 1NIWA 1U5IB 4U8DA 3DD4A 2K8MB 4PHKA 4P2YB 5AERA 1YTZC 2L0PA 1CDPA 1JF0A 3PFVA 3VGOA 3GK2A 3WNXB 4P5OE 2L4HA 2LCPA 4GPLB 4BY4A 2KI6C 4QJ5B 1RROA 4OR9B 4GBAA 4Q04A 2AMIA 2NCOA 3TUYB 4AQJA 2PMYA 1CM4A 1N2DA 2M97A 1YX8A 1TIZA 2K2AA 1JBAA 1TCOB 3BUWB 2K7CA 1RK9A 2CT9A 1IGVA 2HQ8A 1VRKA 2JTZA 2JT3A 1G33A 3LL8B 2LLUA 1CFPA 1Y1XA 1K95A 2LMTA 2WORA 1SKTA 4FTGA 3ZWHA 4PHJA 1PULA 2PSRA 3I5FB 2NZ0A 1N0YA 2K0JA 4M2OA 1BOCA 1QV1A 3EK7A 1B8LA 1K8UA 1UUSA 2BCAA 5DKQA 5F6TA 1H4BA 1PALA 5FYXA 3SG5A 1K9UA 1G8IA 1IRJA 1KFUS 1F4OA 3CGAA 4PE4A 4DUQA 3FWCA 4GUKA 5ER5A 2JTTA 4JPZB 4MVFA 1J7RA 2L2EA 1OZOA 1AVSA 1J7OA 1BR4B 2KFGA 2M8UA 1F54A 1W7IB 4YGAA 2M3WA 2JULA 3PN7B 1AP4A 1J1EA 1QX7A 4PE0A 1QTXA 2LV7A 5AXIA 3DVEA 2M0RA 1AJ4A 1WLMA 1XFYO 1CNPA 4C0LA 2RGIA 1BMOA 1A2XA 3SG4A 3CZTX 4GFTA 3DVJA 3PATA 3SG2A 1ZACA 1OE9B 1KCYA 1KSMA 2K7BA 3JVTC 1F70A 4I5KA 4MBEA 2KI4B 1DJHA 5CSIA 1Y0VH 1YURA 1MHOA 2M29A 2NLNA 1SCVA 1K90D 2M1UA 1UWOA 4YI9A 3KPXA 1FW4A 2LVVA 1NP8A 3QRXA 4CPVA 1J1DA 1UP5A 2H61A 4WQ3A 3SIBA 1SR6C 2QACA 4JWQA 1JF2A 2E6WA 2O5GA 3I5HC 2LP2A 1QLSA 1J7PA 4OCIA 1DGUA 1YX7A 2HETA 3BUNB 5AFPA 1KFXS 4CIDA 3CR5X 1KWOB 2NXQA 1M31A 1BODA 2BKHB 4HREE 1TN4A 1EXRA 2BE4A 3SG3A 1OOJA 1FBVA 2LP3A 2CCMA 3TS5B 1SL7A 1B7TY 2BCBA 2L98A 2ZNEA 3WXAA 1SL9A 2G2BA 4XYNA 4C0KA 1CDLA 1ALWA 3I5HB 5I2OA 1K2HA 2PASA 1MUXA 2K2FA 1UHNA 3OB1B 1S6JA 4DCKA 2KQYA 2A4JA 1QLKA 2KBIA 2KAYA 5IBWA 1SCMB 1EG3A 1QJTA 4GGFC 3VROA 4BY5A 1LA0A 1KK8B 5KU1A 2MRDA 5CSNA 2Q91A 1UHHA 1YVHA 1QX2A 2E30A 2BL0B 3TDUA 5KTYA 2WCBA 2MLFC 3GOFA 1F55A 2JU0A 4MZJA 4TNCA 4DS7A 1BG1A 1OSAA 1ZMZA 2F3YA 2JWWA 3CS1A 1CLLA 4MN0A 1OMRA 1PRWA 1QATA 2CNPA 4USLA 1CTRA 4PCWA 2I7AA 3NSLA 4MRXA 1XK4A 2Y5IA 2Y1NA 1LVCD 1FI5A 1QIVA 3F45A 3CTNA 5D69A 4N1FA 1KSOA 2WNDA 1BU3A 2MHHA 2SASA 1KK7Y 4ICBA 1E8AA 3FWBA 1NX0A 1SK6D 2KGBC 5ER4X 1CKKA 1DMOA 2I18A 1HT9A 5I2LA 1IJ6A 1JFJA 2ZRSA 4NDDA 1B9AA 1W7JB 3A4UB 3FIAA 3K21A 3O78A 4A4BA 3RLZA 2BKIB 2GV5A 4D1EA 4MEWA 4YGBB 1QX5B 3AKBA 4ZCUA 2M7NA 1CMGA 3PSRA 2LVKA 5DKNA 2KAVA 1B8CA 1B4CA 2Y1MA 1QVIY 1S26D 4OVNF 3MSEB 2P6BB 1B47A 1DJGA 1RFJA 3WHUB 4YBHB 4F0ZB 1SNLA 1EJ3A 1SYMA 3OX5A 3EKHA 2KFHA 1A75A 3LK0A 1MWNA 2MBXA 2L4IA 1IQ3A 1BR1B 2F2OA 2KHNA 1CFCA 3OB2B 3TDZA 2QPTA 1A75B 1GGWA 4I5LB 1WRZA 5I8NA 1AHRA 2I94A 1YRTB 4MLWA 2F33A 4OKHA 3BXKA 1RWYA 1XA5A 2JT0A 4N5XA 2EGDA 1NUBA 1PVBA 5J3XA 1JFKA 3BUMB 4YRUA 2KAXA 3VRPA 2BBMA 1UURA 2JPTA 2KYCA 2LHIA 5I2QA 1L7ZA 1YVLA 2LC5A 5AANA 1FPWA 3KF9A 1B7TZ 4R1EA 1ZFSA 1IG5A 4PALA 1XFVO 1A29A 2LANA 1M63B 2VRGA 1HQVA 2OTGC 5HKYA 1A03A 3SG6A 1JSAA 2ISDA 4MSPA 2M7LA 2LAPA 1DTLA 2BBNA 3SG7A 1NPQA 4CFQA 2WOSA 2LMUA 2KYFA 5TNCA 1A4PA 3VRNA 2CXJA 3DF0A 1N65A 3JVTB 2CTNA 1K94A 1BF5A 2MLEC 2D8NA 1WRLA 2OPOA 1NCXA 3DF0B 1FF1A 2WC8A 4I5JA 2LVJA 2LUXA 4L9MA 1GQMA 1L2OC 1XFXO 1MQ1A 4NDBA 1S1EA 5D7FA 1WY9A 3CWGA 1EH2A 1SR6B 5K89A 5HKZA 3O4YA 4CLNA 1KK7Z 1SL8A 3M0WA 1DJXA 2AUCA 1YUUA 2H2KA 4I5NB 1SY9A 5GQQC 1QV0A 1J7QA 1BT6A 1PSBA 4PDZA 3SJSA 3TDIA 1L2OB 2JOJA 2ZNDA 4AOMA 2DOQA 1PK0D 1LXFC 3BUOB 1AK8A 1NWDA 1Y6WA 2Y4QA 1OMVA 4ETOA 5HKWA 1QVIZ 2JNXA 2F2PA 4GGFA 5BPJA 3KHEA 1GGZA 4M2QA 1K9KA 3OHMB 3OP0A 4PHMA 4UPGA 1TOPA 2AAOA 4CFRA 1MXLC 2LE9B 1OZSA 3HX4A 4YI8A 4MZLA 2G9BA 3IQOA 2K61A 1IKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE7 A;  2JNF A;  2EHB A;  2FCD A;  3CR4 X;  2LMV A;  4HRH A;  1DJI A;  2LUC A;  2Q4U A;  1KFX L;  3TZ1 A;  3AAJ A;  2R2I A;  2TN4 A;  3JTD C;  2FJU B;  1B1G A;  2KQ6 A;  1F8H A;  1FI6 A;  2WCF A;  2L51 A;  1REC A;  2KBM A;  1DJY A;  5DKR A;  3AKA A;  2M49 B;  4DIR A;  1WRK A;  2L50 A;  3SIA A;  1EG4 A;  4M2P A;  1S5G Y;  1DJW A;  1IWQ A;  1CB1 A;  5HLO A;  4E68 A;  3BYA A;  3TUY C;  1GJY A;  1PVA A;  3FS7 A;  5HYD A;  3KO0 A;  4GGN A;  2FCE A;  3JTD B;  4YGC B;  2BEC A;  1YRU B;  1DGV A;  2FOT A;  2KDH A;  1CLB A;  2MA2 A;  4GNK B;  1V1F A;  1CDM A;  4YGE B;  2ZN8 A;  3E3R A;  1F71 A;  3EK4 A;  1DVI A;  1K93 D;  3KEV A;  4OV2 A;  1R2U A;  2L5X B;  1K9P A;  1R6P A;  1YR5 A;  3I5F C;  3I5G C;  3BQ3 A;  1BLQ A;  2KI6 D;  4ORB B;  1QIW A;  1TNQ A;  2BE6 A;  1ODB A;  2ZRT A;  3PLF B;  1NX2 A;  3IF7 A;  1OQP A;  2IS9 A;  1M39 A;  3AAK A;  2KOT A;  1TNX A;  1TRF A;  3LLE A;  2BCX A;  1IJ5 A;  1V1G A;  1TCF A;  5G08 A;  1DJZ A;  3I5G B;  3PN7 C;  1MXE A;  4N1G A;  1C7V A;  3EKJ A;  1UHJ A;  2LM5 A;  2HPS A;  4PHN A;  1C7W A;  1M45 A;  1KQV A;  5CSF A;  1XFU O;  1CFF A;  1KQM C;  1TTX A;  2PVB A;  2JQ6 A;  1SBJ A;  2K7D A;  4NDC A;  1D1O A;  1EL4 A;  5PAL A;  1CDN A;  1NX1 A;  1YUS A;  3GK1 A;  1WDC C;  2HQW A;  4WRI A;  4YGD B;  3NSK A;  1QXP A;  2KI4 C;  2LLT A;  3EVV A;  2KFF A;  1ZOT B;  1UHI A;  2GGZ A;  1XVJ A;  2SCP A;  4ORC B;  1S3P A;  1C07 A;  2HF5 A;  3ZNI A;  2B1U A;  1K96 A;  2JRF A;  1KQM B;  1RTP 1;  3NSI A;  1S6I A;  1Y1A A;  2OS8 C;  3LK1 A;  3O2P A;  3VRQ A;  4A4C A;  2JXC A;  2H61 C;  1WDC B;  2JXL A;  1XFZ O;  2OTG B;  1IQ5 A;  1Q80 A;  4IL1 A;  1CMF A;  3IQQ A;  2GGM A;  4XJK A;  1DT7 B;  1H8B A;  1RJV A;  1NCZ A;  1XYD A;  1KWO C;  5CPV A;  1WLZ A;  1PSR A;  2LLS A;  2PRU A;  2I2R E;  3HCM A;  1KFU L;  4HRG A;  4XJK B;  2ZFD A;  5JJG A;  2O60 A;  3TS5 C;  4PE1 A;  3GK4 X;  1G4Y R;  2KGR A;  2OS8 B;  4NQG A;  1AUI B;  1MF8 B;  2KSP A;  4QJ4 B;  4ZCV A;  2M1K B;  3BOW A;  3O6B A;  4FQO A;  5CSJ A;  4AQI A;  3BUX B;  3WHT B;  2K7O A;  3BOW B;  1LKJ A;  4WQ2 A;  2PAL A;  2JC2 A;  1JUO A;  1SCM C;  1JWD A;  2MAZ A;  3D10 A;  3ICB A;  1KK8 C;  1QS7 A;  1S5G Z;  2KNE A;  3DVM A;  3PM8 A;  1X02 A;  1NX3 A;  1CLM A;  2BL0 C;  3NSO A;  2JZI A;  1CFD A;  1QAS A;  1SW8 A;  3A8R A;  4C0J A;  5B8I B;  1SRA A;  1S36 A;  1LIN A;  3C1V A;  4JQ0 D;  2WCE A;  4GAO A;  2JT8 A;  1IH0 A;  3D0Y A;  1NYA A;  4ORA B;  1TNW A;  1SPY A;  3H4S E;  4HSZ A;  3NXA A;  3D0Y B;  2COL B;  2M9G A;  1SMG A;  2CBL A;  3LCP C;  2EC6 C;  3I5I C;  5AEQ A;  2V53 A;  3PAL A;  1XK4 C;  1CM1 A;  1DF0 A;  4MZK A;  1J55 A;  3RM1 A;  4DRW A;  1MR8 A;  1OMD A;  1ZUZ A;  3VRR A;  1NSH A;  1XO5 A;  1JC2 A;  5KSZ A;  1DF0 B;  1LA3 A;  2NCP A;  3CR2 A;  1YUT A;  3EVU A;  2LHL A;  2LVI A;  4QJ3 B;  3CLN A;  4MRY A;  3DVK A;  1F4Q A;  3EK8 A;  1BJF A;  1TNP A;  3OX6 A;  1UHK A;  5JOL A;  1Y1U A;  1U5I A;  1XFW O;  2LNK A;  2F3Z A;  2F8P A;  1B8R A;  2EC6 B;  2MJW B;  2ZN9 A;  1M46 A;  3I5I B;  1NCY A;  5HLV A;  1ALV A;  2ZKM X;  1S6C A;  1AJ5 A;  3EVR A;  1NIW A;  1U5I B;  4U8D A;  3DD4 A;  2K8M B;  4PHK A;  4P2Y B;  5AER A;  1YTZ C;  2L0P A;  1CDP A;  1JF0 A;  3PFV A;  3VGO A;  3GK2 A;  3WNX B;  4P5O E;  2L4H A;  2LCP A;  4GPL B;  4BY4 A;  2KI6 C;  4QJ5 B;  1RRO A;  4OR9 B;  4GBA A;  4Q04 A;  2AMI A;  2NCO A;  3TUY B;  4AQJ A;  2PMY A;  1CM4 A;  1N2D A;  2M97 A;  1YX8 A;  1TIZ A;  2K2A A;  1JBA A;  1TCO B;  3BUW B;  2K7C A;  1RK9 A;  2CT9 A;  1IGV A;  2HQ8 A;  1VRK A;  2JTZ A;  2JT3 A;  1G33 A;  3LL8 B;  2LLU A;  1CFP A;  1Y1X A;  1K95 A;  2LMT A;  2WOR A;  1SKT A;  4FTG A;  3ZWH A;  4PHJ A;  1PUL A;  2PSR A;  3I5F B;  2NZ0 A;  1N0Y A;  2K0J A;  4M2O A;  1BOC A;  1QV1 A;  3EK7 A;  1B8L A;  1K8U A;  1UUS A;  2BCA A;  5DKQ A;  5F6T A;  1H4B A;  1PAL A;  5FYX A;  3SG5 A;  1K9U A;  1G8I A;  1IRJ A;  1KFU S;  1F4O A;  3CGA A;  4PE4 A;  4DUQ A;  3FWC A;  4GUK A;  5ER5 A;  2JTT A;  4JPZ B;  4MVF A;  1J7R A;  2L2E A;  1OZO A;  1AVS A;  1J7O A;  1BR4 B;  2KFG A;  2M8U A;  1F54 A;  1W7I B;  4YGA A;  2M3W A;  2JUL A;  3PN7 B;  1AP4 A;  1J1E A;  1QX7 A;  4PE0 A;  1QTX A;  2LV7 A;  5AXI A;  3DVE A;  2M0R A;  1AJ4 A;  1WLM A;  1XFY O;  1CNP A;  4C0L A;  2RGI A;  1BMO A;  1A2X A;  3SG4 A;  3CZT X;  4GFT A;  3DVJ A;  3PAT A;  3SG2 A;  1ZAC A;  1OE9 B;  1KCY A;  1KSM A;  2K7B A;  3JVT C;  1F70 A;  4I5K A;  4MBE A;  2KI4 B;  1DJH A;  5CSI A;  1Y0V H;  1YUR A;  1MHO A;  2M29 A;  2NLN A;  1SCV A;  1K90 D;  2M1U A;  1UWO A;  4YI9 A;  3KPX A;  1FW4 A;  2LVV A;  1NP8 A;  3QRX A;  4CPV A;  1J1D A;  1UP5 A;  2H61 A;  4WQ3 A;  3SIB A;  1SR6 C;  2QAC A;  4JWQ A;  1JF2 A;  2E6W A;  2O5G A;  3I5H C;  2LP2 A;  1QLS A;  1J7P A;  4OCI A;  1DGU A;  1YX7 A;  2HET A;  3BUN B;  5AFP A;  1KFX S;  4CID A;  3CR5 X;  1KWO B;  2NXQ A;  1M31 A;  1BOD A;  2BKH B;  4HRE E;  1TN4 A;  1EXR A;  2BE4 A;  3SG3 A;  1OOJ A;  1FBV A;  2LP3 A;  2CCM A;  3TS5 B;  1SL7 A;  1B7T Y;  2BCB A;  2L98 A;  2ZNE A;  3WXA A;  1SL9 A;  2G2B A;  4XYN A;  4C0K A;  1CDL A;  1ALW A;  3I5H B;  5I2O A;  1K2H A;  2PAS A;  1MUX A;  2K2F A;  1UHN A;  3OB1 B;  1S6J A;  4DCK A;  2KQY A;  2A4J A;  1QLK A;  2KBI A;  2KAY A;  5IBW A;  1SCM B;  1EG3 A;  1QJT A;  4GGF C;  3VRO A;  4BY5 A;  1LA0 A;  1KK8 B;  5KU1 A;  2MRD A;  5CSN A;  2Q91 A;  1UHH A;  1YVH A;  1QX2 A;  2E30 A;  2BL0 B;  3TDU A;  5KTY A;  2WCB A;  2MLF C;  3GOF A;  1F55 A;  2JU0 A;  4MZJ A;  4TNC A;  4DS7 A;  1BG1 A;  1OSA A;  1ZMZ A;  2F3Y A;  2JWW A;  3CS1 A;  1CLL A;  4MN0 A;  1OMR A;  1PRW A;  1QAT A;  2CNP A;  4USL A;  1CTR A;  4PCW A;  2I7A A;  3NSL A;  4MRX A;  1XK4 A;  2Y5I A;  2Y1N A;  1LVC D;  1FI5 A;  1QIV A;  3F45 A;  3CTN A;  5D69 A;  4N1F A;  1KSO A;  2WND A;  1BU3 A;  2MHH A;  2SAS A;  1KK7 Y;  4ICB A;  1E8A A;  3FWB A;  1NX0 A;  1SK6 D;  2KGB C;  5ER4 X;  1CKK A;  1DMO A;  2I18 A;  1HT9 A;  5I2L A;  1IJ6 A;  1JFJ A;  2ZRS A;  4NDD A;  1B9A A;  1W7J B;  3A4U B;  3FIA A;  3K21 A;  3O78 A;  4A4B A;  3RLZ A;  2BKI B;  2GV5 A;  4D1E A;  4MEW A;  4YGB B;  1QX5 B;  3AKB A;  4ZCU A;  2M7N A;  1CMG A;  3PSR A;  2LVK A;  5DKN A;  2KAV A;  1B8C A;  1B4C A;  2Y1M A;  1QVI Y;  1S26 D;  4OVN F;  3MSE B;  2P6B B;  1B47 A;  1DJG A;  1RFJ A;  3WHU B;  4YBH B;  4F0Z B;  1SNL A;  1EJ3 A;  1SYM A;  3OX5 A;  3EKH A;  2KFH A;  1A75 A;  3LK0 A;  1MWN A;  2MBX A;  2L4I A;  1IQ3 A;  1BR1 B;  2F2O A;  2KHN A;  1CFC A;  3OB2 B;  3TDZ A;  2QPT A;  1A75 B;  1GGW A;  4I5L B;  1WRZ A;  5I8N A;  1AHR A;  2I94 A;  1YRT B;  4MLW A;  2F33 A;  4OKH A;  3BXK A;  1RWY A;  1XA5 A;  2JT0 A;  4N5X A;  2EGD A;  1NUB A;  1PVB A;  5J3X A;  1JFK A;  3BUM B;  4YRU A;  2KAX A;  3VRP A;  2BBM A;  1UUR A;  2JPT A;  2KYC A;  2LHI A;  5I2Q A;  1L7Z A;  1YVL A;  2LC5 A;  5AAN A;  1FPW A;  3KF9 A;  1B7T Z;  4R1E A;  1ZFS A;  1IG5 A;  4PAL A;  1XFV O;  1A29 A;  2LAN A;  1M63 B;  2VRG A;  1HQV A;  2OTG C;  5HKY A;  1A03 A;  3SG6 A;  1JSA A;  2ISD A;  4MSP A;  2M7L A;  2LAP A;  1DTL A;  2BBN A;  3SG7 A;  1NPQ A;  4CFQ A;  2WOS A;  2LMU A;  2KYF A;  5TNC A;  1A4P A;  3VRN A;  2CXJ A;  3DF0 A;  1N65 A;  3JVT B;  2CTN A;  1K94 A;  1BF5 A;  2MLE C;  2D8N A;  1WRL A;  2OPO A;  1NCX A;  3DF0 B;  1FF1 A;  2WC8 A;  4I5J A;  2LVJ A;  2LUX A;  4L9M A;  1GQM A;  1L2O C;  1XFX O;  1MQ1 A;  4NDB A;  1S1E A;  5D7F A;  1WY9 A;  3CWG A;  1EH2 A;  1SR6 B;  5K89 A;  5HKZ A;  3O4Y A;  4CLN A;  1KK7 Z;  1SL8 A;  3M0W A;  1DJX A;  2AUC A;  1YUU A;  2H2K A;  4I5N B;  1SY9 A;  5GQQ C;  1QV0 A;  1J7Q A;  1BT6 A;  1PSB A;  4PDZ A;  3SJS A;  3TDI A;  1L2O B;  2JOJ A;  2ZND A;  4AOM A;  2DOQ A;  1PK0 D;  1LXF C;  3BUO B;  1AK8 A;  1NWD A;  1Y6W A;  2Y4Q A;  1OMV A;  4ETO A;  5HKW A;  1QVI Z;  2JNX A;  2F2P A;  4GGF A;  5BPJ A;  3KHE A;  1GGZ A;  4M2Q A;  1K9K A;  3OHM B;  3OP0 A;  4PHM A;  4UPG A;  1TOP A;  2AAO A;  4CFR A;  1MXL C;  2LE9 B;  1OZS A;  3HX4 A;  4YI8 A;  4MZL A;  2G9B A;  3IQO A;  2K61 A;  1IKU A; 
#chains in the Genus database with same CATH topology
 4PE7 A;  2JNF A;  2WCK A;  1DEL A;  2EHB A;  2FCD A;  3CR4 X;  2LMV A;  4HRH A;  1DJI A;  2LUC A;  2Q4U A;  1KFX L;  3TZ1 A;  1C3Z A;  2R2I A;  2TN4 A;  3AAJ A;  2FJU B;  3JTD C;  2KQ6 A;  1B1G A;  2ERB A;  1F8H A;  1FI6 A;  2WCF A;  2L51 A;  1REC A;  2KBM A;  1DJY A;  5DKR A;  3AKA A;  2M49 B;  4DIR A;  1WRK A;  2L50 A;  3SIA A;  1EG4 A;  4M2P A;  1S5G Y;  1DJW A;  1IWQ A;  1CB1 A;  5HLO A;  4E68 A;  3BYA A;  3TUY C;  1GJY A;  3D76 A;  1PVA A;  2QEH A;  3FS7 A;  5HYD A;  3KO0 A;  4GGN A;  1IKU A;  2WCL A;  2BNX A;  2FCE A;  3JTD B;  3Q8I A;  4YGC B;  2BEC A;  1YRU B;  1DGV A;  1XFR A;  2FOT A;  2KDH A;  1CLB A;  2MA2 A;  4GNK B;  1V1F A;  1CDM A;  4YGE B;  2ZN8 A;  3E3R A;  1F71 A;  3EK4 A;  2PQL A;  2QDI A;  1DVI A;  1K93 D;  3KEV A;  4OV2 A;  1R2U A;  2L5X B;  1K9P A;  5DIC A;  1R6P A;  1YR5 A;  3R72 A;  3I5F C;  3OGN A;  3I5G C;  3BQ3 A;  1BLQ A;  2KI6 D;  4ORB B;  1QIW A;  1TNQ A;  2BE6 A;  1ODB A;  1ORG A;  2ZRT A;  3PLF B;  1NX2 A;  3IF7 A;  1OQP A;  2IS9 A;  3FE9 A;  5EL2 A;  3S0F A;  1M39 A;  3AAK A;  3BFH A;  2KOT A;  1TNX A;  1TRF A;  3D74 A;  3LLE A;  2BCX A;  3K1E A;  4JKT A;  1IJ5 A;  1V1G A;  1TCF A;  5G08 A;  1DJZ A;  3I5G B;  1TUJ A;  1MXE A;  3PN7 C;  4N1G A;  1C7V A;  3EKJ A;  1UHJ A;  2LM5 A;  2HPS A;  4PHN A;  1C7W A;  1M45 A;  3S0G A;  1KQV A;  5CSF A;  1XFU O;  1CFF A;  1KQM C;  3PM2 A;  1TTX A;  2PVB A;  3L47 A;  2JQ6 A;  1SBJ A;  2K7D A;  4NDC A;  1D1O A;  1EL4 A;  5PAL A;  1CDN A;  1NX1 A;  1YUS A;  3GK1 A;  1WDC C;  2HQW A;  4WRI A;  4YGD B;  3NSK A;  1QXP A;  2KI4 C;  2LLT A;  3EVV A;  2KFF A;  1ZOT B;  1UHI A;  2GGZ A;  1XVJ A;  2SCP A;  4ORC B;  1S3P A;  1Z4H A;  1C07 A;  2HF5 A;  3ZNI A;  2B1U A;  1K96 A;  2JRF A;  1KQM B;  1RTP 1;  3NSI A;  1S6I A;  1Y1A A;  2OS8 C;  2YGU A;  3LK1 A;  3O2P A;  1Z2C B;  3VRQ A;  4A4C A;  2WC6 A;  2JXC A;  2H61 C;  1WDC B;  2JXL A;  1XFZ O;  2OTG B;  1IQ5 A;  1Q80 A;  4IL1 A;  1CMF A;  3IQQ A;  2GGM A;  4XJK A;  1DT7 B;  1H8B A;  1RJV A;  1NCZ A;  1XYD A;  1KWO C;  5CPV A;  1WLZ A;  1PSR A;  2LLS A;  2PRU A;  2I2R E;  3HCM A;  1KFU L;  2K60 A;  4HRG A;  4XJK B;  2ZFD A;  5JJG A;  2O60 A;  3TS5 C;  4PE1 A;  5FI2 A;  3GK4 X;  1G4Y R;  2KGR A;  2OS8 B;  5D3O A;  1TWO A;  4OZD A;  4NQG A;  1AUI B;  5FI7 A;  1MF8 B;  2KSP A;  4QJ4 B;  3CAB A;  4ZCV A;  2M1K B;  3BOW A;  3O6B A;  4FQO A;  5CSJ A;  4AQI A;  5HL1 A;  3BUX B;  3WHT B;  2K7O A;  3BOW B;  1LKJ A;  4WQ2 A;  2PAL A;  2JC2 A;  1JUO A;  1QWV A;  1SCM C;  2MAZ A;  3D10 A;  1JWD A;  3ICB A;  1KK8 C;  1QS7 A;  1S5G Z;  2KNE A;  3DVM A;  3PM8 A;  1X02 A;  1NX3 A;  3QME A;  1CLM A;  2BL0 C;  3NSO A;  2JZI A;  1CFD A;  3SS5 A;  1QAS A;  1SW8 A;  3A8R A;  4C0J A;  5B8I B;  3DY9 A;  1SRA A;  1S36 A;  1LIN A;  2KLD A;  3C1V A;  4JQ0 D;  2WCE A;  4GAO A;  2JT8 A;  1IH0 A;  3D0Y A;  2H8V A;  1NYA A;  4ORA B;  1TNW A;  1SPY A;  3H4S E;  4HSZ A;  3NXA A;  3D0Y B;  3B88 A;  2COL B;  2M9G A;  3NHT A;  1SMG A;  2CBL A;  3LCP C;  2EC6 C;  3I5I C;  5AEQ A;  2V53 A;  3PAL A;  1XK4 C;  1CM1 A;  1DF0 A;  4MZK A;  1J55 A;  3RM1 A;  4DRW A;  1MR8 A;  1OMD A;  1ZUZ A;  4INW A;  3VRR A;  1NSH A;  1XO5 A;  1JC2 A;  5KSZ A;  1DF0 B;  1LA3 A;  2NCP A;  3CR2 A;  1YUT A;  2L2C A;  3EVU A;  2LHL A;  2LVI A;  4QJ3 B;  3CLN A;  3R1P A;  4MRY A;  3DVK A;  1F4Q A;  3EK8 A;  1BJF A;  1TNP A;  3OX6 A;  3V2L A;  1UHK A;  2QEO A;  5JOL A;  1Y1U A;  1U5I A;  1XFW O;  2LNK A;  2F3Z A;  2F8P A;  1B8R A;  2EC6 B;  2KLE A;  2MJW B;  1M46 A;  2ZN9 A;  1NCY A;  3I5I B;  1DQE A;  5HLV A;  1ALV A;  2ZKM X;  1S6C A;  1AJ5 A;  3EVR A;  1NIW A;  1U5I B;  4U8D A;  3DD4 A;  2K8M B;  4PHK A;  4P2Y B;  1OOF A;  5AER A;  1YTZ C;  2L0P A;  1CDP A;  1JF0 A;  3DXL A;  3PFV A;  3GK2 A;  3VGO A;  4P5O E;  2L4H A;  2LCP A;  4GPL B;  3WNX B;  4BY4 A;  2KI6 C;  4QJ5 B;  1RRO A;  4OR9 B;  4GBA A;  4Q04 A;  2AMI A;  2NCO A;  3TUY B;  4AQJ A;  2PMY A;  1CM4 A;  1N2D A;  2M97 A;  1YX8 A;  1TIZ A;  2K2A A;  1JBA A;  1TCO B;  3BUW B;  2K7C A;  3NGV A;  1RK9 A;  2CT9 A;  1IGV A;  2HQ8 A;  1VRK A;  2JTZ A;  2JT3 A;  1G33 A;  3LL8 B;  1DEK A;  2LLU A;  3D75 A;  1DC1 A;  1Y1X A;  1OOH A;  1K95 A;  2LMT A;  1CFP A;  2WOR A;  1SKT A;  4FTG A;  3ZWH A;  4PHJ A;  1PUL A;  2PSR A;  3I5F B;  2NZ0 A;  1N0Y A;  2K0J A;  4M2O A;  1BOC A;  1QV1 A;  3FE8 A;  3EK7 A;  1B8L A;  1K8U A;  1UUS A;  2BCA A;  5DKQ A;  5F6T A;  1H4B A;  3L4L A;  1PAL A;  5FYX A;  3SG5 A;  1K9U A;  1G8I A;  1IRJ A;  1KFU S;  1F4O A;  3BFB A;  3CGA A;  4PE4 A;  3FWC A;  4DUQ A;  1C3Y A;  2FJY A;  4GUK A;  5ER5 A;  2JTT A;  3DYE A;  4JPZ B;  4MVF A;  1J7R A;  2L2E A;  1OZO A;  1AVS A;  1J7O A;  1BR4 B;  2KFG A;  2M8U A;  1F54 A;  1W7I B;  3D73 A;  4YGA A;  2M3W A;  2JUL A;  3PN7 B;  1AP4 A;  1J1E A;  1QX7 A;  4PE0 A;  1TUZ A;  1QTX A;  2LV7 A;  5AXI A;  3DVE A;  2M0R A;  1AJ4 A;  1WLM A;  1XFY O;  1CNP A;  4C0L A;  2RGI A;  1BMO A;  2BAP A;  3CDN A;  1A2X A;  3SG4 A;  1OOG A;  3CZT X;  4GFT A;  3DVJ A;  3PAT A;  4KYN A;  1ZAC A;  3SG2 A;  1OE9 B;  1KCY A;  1KSM A;  2K7B A;  3JVT C;  1F70 A;  4I5K A;  4MBE A;  2KI4 B;  1DJH A;  5CSI A;  1Y0V H;  1YUR A;  1MHO A;  2M29 A;  2NLN A;  5I94 A;  2PYQ A;  1SCV A;  1K90 D;  2M1U A;  1UWO A;  4YI9 A;  3KPX A;  1FW4 A;  2LVV A;  1NP8 A;  3QRX A;  4CPV A;  1J1D A;  1UP5 A;  2H61 A;  4WQ3 A;  3SIB A;  1SR6 C;  2QAC A;  4JWQ A;  1JF2 A;  2E6W A;  2O5G A;  3I5H C;  2GTE A;  2LP2 A;  1QLS A;  3RZS A;  4OCI A;  1J7P A;  1DGU A;  1YX7 A;  4F7F A;  2HET A;  3BUN B;  3CZ2 A;  5AFP A;  1KFX S;  4CID A;  3CR5 X;  1KWO B;  2NXQ A;  1M31 A;  1T14 A;  2BKH B;  2QEB A;  1TN4 A;  1EXR A;  2BE4 A;  4HRE E;  1OW4 A;  1OOJ A;  3SG3 A;  1FBV A;  2LP3 A;  2CCM A;  3VB1 A;  1IIO A;  3TS5 B;  3S0B A;  1SL7 A;  1B7T Y;  2BCB A;  2L98 A;  2ZNE A;  3WXA A;  1SL9 A;  2G2B A;  4XYN A;  4C0K A;  1CDL A;  1ALW A;  3I5H B;  5I2O A;  1K2H A;  2PAS A;  3NHI A;  1MUX A;  2K2F A;  3EG5 B;  1UHN A;  3OB1 B;  2JPO A;  1S6J A;  4DCK A;  2KQY A;  2A4J A;  1QLK A;  2KBI A;  2KAY A;  3CYZ A;  5IBW A;  4FQT A;  1SCM B;  1EG3 A;  1QJT A;  4GGF C;  3VRO A;  4BY5 A;  1LA0 A;  1KK8 B;  5KU1 A;  2MRD A;  5CSN A;  2Q91 A;  1UHH A;  1YVH A;  1QX2 A;  2E30 A;  2BL0 B;  3TDU A;  5KTY A;  2WCB A;  2MLF C;  3GOF A;  1F55 A;  2P70 A;  2JU0 A;  2WCH A;  4MZJ A;  4TNC A;  4DS7 A;  1BG1 A;  1OSA A;  1ZMZ A;  2F3Y A;  2JWW A;  3UNW A;  4INX A;  3CS1 A;  1CLL A;  4MN0 A;  1OMR A;  1PRW A;  1QAT A;  2CNP A;  4USL A;  1CTR A;  4PCW A;  2I7A A;  3NSL A;  1LS8 A;  4MRX A;  1XK4 A;  2Y5I A;  3BJH A;  2Y1N A;  1LVC D;  1FI5 A;  1QIV A;  3F45 A;  3CTN A;  5D69 A;  4N1F A;  1KSO A;  2WND A;  1BU3 A;  3SS4 A;  2MHH A;  3DZT A;  2SAS A;  3N7H A;  1KK7 Y;  4ICB A;  1E8A A;  3FWB A;  1NX0 A;  1SK6 D;  2KGB C;  5ER4 X;  1CKK A;  1DMO A;  2I18 A;  1HT9 A;  5I2L A;  1IJ6 A;  1JFJ A;  2ZRS A;  4NDD A;  1B9A A;  1W7J B;  3A4U B;  3B7A A;  3FIA A;  3K21 A;  3O78 A;  4A4B A;  3RLZ A;  2BKI B;  2GV5 A;  4D1E A;  4MEW A;  4YGB B;  1QX5 B;  3AKB A;  4ZCU A;  2M7N A;  1CMG A;  3PSR A;  2LVK A;  5DKN A;  2KAV A;  1B8C A;  1B4C A;  2Y1M A;  1QVI Y;  1S26 D;  4OVN F;  3MSE B;  2P6B B;  1B47 A;  1DJG A;  1RFJ A;  3WHU B;  3BFA A;  4YBH B;  4F0Z B;  1SNL A;  1EJ3 A;  1SYM A;  3OX5 A;  3EKH A;  2KFH A;  1A75 A;  3LK0 A;  1MWN A;  2MBX A;  2L4I A;  1IQ3 A;  1BR1 B;  2F2O A;  2KHN A;  1CFC A;  3OB2 B;  3R1V A;  3TDZ A;  2QPT A;  1A75 B;  1GGW A;  4I5L B;  4PT1 A;  1WRZ A;  5I8N A;  1AHR A;  2I94 A;  3R1O A;  1YRT B;  4MLW A;  2F33 A;  3CZ1 A;  4OKH A;  3BXK A;  1RWY A;  1XA5 A;  2KPH A;  2JT0 A;  4N5X A;  2WCM A;  2EGD A;  1NUB A;  1PVB A;  5J3X A;  1JFK A;  3S0D A;  3BUM B;  4YRU A;  2KAX A;  4IJ7 A;  3IVT A;  3VRP A;  3B6X A;  2BBM A;  1UUR A;  2JPT A;  2KYC A;  2LHI A;  5I2Q A;  1L7Z A;  1YVL A;  2LC5 A;  5AAN A;  1BOD A;  1P28 A;  1GM0 A;  1FPW A;  3SS3 A;  3KF9 A;  1B7T Z;  3UO9 A;  4R1E A;  3B87 A;  1ZFS A;  1IG5 A;  4PAL A;  1XFV O;  1A29 A;  2LAN A;  1M63 B;  2VRG A;  1HQV A;  2OTG C;  5HKY A;  1A03 A;  2L5Y A;  3SG6 A;  1JSA A;  2ISD A;  4MSP A;  3O4X A;  2M7L A;  2LAP A;  1DTL A;  2BBN A;  3B86 A;  3SG7 A;  1NPQ A;  4CFQ A;  2WOS A;  2LMU A;  2KYF A;  5TNC A;  1A4P A;  3VRN A;  2CXJ A;  3DF0 A;  1N65 A;  3JVT B;  2CTN A;  1OOI X;  3S0E A;  1K94 A;  1BF5 A;  2MLE C;  2D8N A;  1WRL A;  2OPO A;  1NCX A;  3DF0 B;  1FF1 A;  3D78 A;  2WC8 A;  4I5J A;  2LVJ A;  2LUX A;  4L9M A;  1GQM A;  1L2O C;  1XFX O;  1MQ1 A;  4NDB A;  1S1E A;  5D7F A;  1WY9 A;  3CWG A;  1EH2 A;  1SR6 B;  2WCJ A;  5K89 A;  5HKZ A;  3O4Y A;  4CLN A;  1KK7 Z;  1SL8 A;  3M0W A;  1DJX A;  2AUC A;  1YUU A;  2H2K A;  2P71 A;  1SY9 A;  4I5N B;  4JD9 A;  1QV0 A;  5GQQ C;  1J7Q A;  1BT6 A;  3D77 A;  3L4A A;  1PSB A;  3PJI A;  4PDZ A;  3SJS A;  3TDI A;  1L2O B;  2JOJ A;  2ZND A;  4AOM A;  2DOQ A;  1PK0 D;  1LXF C;  3BUO B;  1AK8 A;  1NWD A;  2WC5 A;  1Y6W A;  2Y4Q A;  1OMV A;  3OBV A;  4ETO A;  1W9Z A;  3CZ0 A;  5HKW A;  1QVI Z;  2JNX A;  2F2P A;  4GGF A;  5BPJ A;  3KHE A;  5FI6 A;  1GGZ A;  4M2Q A;  1K9K A;  3OHM B;  1SSE B;  3OP0 A;  4PHM A;  4UPG A;  3S0A A;  1TOP A;  2AAO A;  4CFR A;  1MXL C;  2LE9 B;  1OZS A;  3HX4 A;  4YI8 A;  4MZL A;  2G9B A;  3IQO A;  2K61 A;  3FE6 A;  2QEV A; 
#chains in the Genus database with same CATH homology
 4PE7 A;  2JNF A;  2EHB A;  2FCD A;  3CR4 X;  2LMV A;  4HRH A;  1DJI A;  2LUC A;  2Q4U A;  1KFX L;  3TZ1 A;  3AAJ A;  2R2I A;  2TN4 A;  3JTD C;  2FJU B;  1B1G A;  2KQ6 A;  1F8H A;  1FI6 A;  2WCF A;  2L51 A;  1REC A;  2KBM A;  1DJY A;  5DKR A;  3AKA A;  2M49 B;  4DIR A;  1WRK A;  2L50 A;  3SIA A;  1EG4 A;  4M2P A;  1S5G Y;  1DJW A;  1IWQ A;  1CB1 A;  5HLO A;  4E68 A;  3BYA A;  3TUY C;  1GJY A;  1PVA A;  3FS7 A;  5HYD A;  3KO0 A;  4GGN A;  2FCE A;  3JTD B;  4YGC B;  2BEC A;  1YRU B;  1DGV A;  2FOT A;  2KDH A;  1CLB A;  2MA2 A;  4GNK B;  1V1F A;  1CDM A;  4YGE B;  2ZN8 A;  3E3R A;  1F71 A;  3EK4 A;  1DVI A;  1K93 D;  3KEV A;  4OV2 A;  1R2U A;  2L5X B;  1K9P A;  1R6P A;  1YR5 A;  3I5F C;  3I5G C;  3BQ3 A;  1BLQ A;  2KI6 D;  4ORB B;  1QIW A;  1TNQ A;  2BE6 A;  1ODB A;  2ZRT A;  3PLF B;  1NX2 A;  3IF7 A;  1OQP A;  2IS9 A;  1M39 A;  3AAK A;  2KOT A;  1TNX A;  1TRF A;  3LLE A;  2BCX A;  1IJ5 A;  1V1G A;  1TCF A;  5G08 A;  1DJZ A;  3I5G B;  3PN7 C;  1MXE A;  4N1G A;  1C7V A;  3EKJ A;  1UHJ A;  2LM5 A;  2HPS A;  4PHN A;  1C7W A;  1M45 A;  1KQV A;  5CSF A;  1XFU O;  1CFF A;  1KQM C;  1TTX A;  2PVB A;  2JQ6 A;  1SBJ A;  2K7D A;  4NDC A;  1D1O A;  1EL4 A;  5PAL A;  1CDN A;  1NX1 A;  1YUS A;  3GK1 A;  1WDC C;  2HQW A;  4WRI A;  4YGD B;  3NSK A;  1QXP A;  2KI4 C;  2LLT A;  3EVV A;  2KFF A;  1ZOT B;  1UHI A;  2GGZ A;  1XVJ A;  2SCP A;  4ORC B;  1S3P A;  1C07 A;  2HF5 A;  3ZNI A;  2B1U A;  1K96 A;  2JRF A;  1KQM B;  1RTP 1;  3NSI A;  1S6I A;  1Y1A A;  2OS8 C;  3LK1 A;  3O2P A;  3VRQ A;  4A4C A;  2JXC A;  2H61 C;  1WDC B;  2JXL A;  1XFZ O;  2OTG B;  1IQ5 A;  1Q80 A;  4IL1 A;  1CMF A;  3IQQ A;  2GGM A;  4XJK A;  1DT7 B;  1H8B A;  1RJV A;  1NCZ A;  1XYD A;  1KWO C;  5CPV A;  1WLZ A;  1PSR A;  2LLS A;  2PRU A;  2I2R E;  3HCM A;  1KFU L;  4HRG A;  4XJK B;  2ZFD A;  5JJG A;  2O60 A;  3TS5 C;  4PE1 A;  3GK4 X;  1G4Y R;  2KGR A;  2OS8 B;  4NQG A;  1AUI B;  1MF8 B;  2KSP A;  4QJ4 B;  4ZCV A;  2M1K B;  3BOW A;  3O6B A;  4FQO A;  5CSJ A;  4AQI A;  3BUX B;  3WHT B;  2K7O A;  3BOW B;  1LKJ A;  4WQ2 A;  2PAL A;  2JC2 A;  1JUO A;  1SCM C;  1JWD A;  2MAZ A;  3D10 A;  3ICB A;  1KK8 C;  1QS7 A;  1S5G Z;  2KNE A;  3DVM A;  3PM8 A;  1X02 A;  1NX3 A;  1CLM A;  2BL0 C;  3NSO A;  2JZI A;  1CFD A;  1QAS A;  1SW8 A;  3A8R A;  4C0J A;  5B8I B;  1SRA A;  1S36 A;  1LIN A;  3C1V A;  4JQ0 D;  2WCE A;  4GAO A;  2JT8 A;  1IH0 A;  3D0Y A;  1NYA A;  4ORA B;  1TNW A;  1SPY A;  3H4S E;  4HSZ A;  3NXA A;  3D0Y B;  2COL B;  2M9G A;  1SMG A;  2CBL A;  3LCP C;  2EC6 C;  3I5I C;  5AEQ A;  2V53 A;  3PAL A;  1XK4 C;  1CM1 A;  1DF0 A;  4MZK A;  1J55 A;  3RM1 A;  4DRW A;  1MR8 A;  1OMD A;  1ZUZ A;  3VRR A;  1NSH A;  1XO5 A;  1JC2 A;  5KSZ A;  1DF0 B;  1LA3 A;  2NCP A;  3CR2 A;  1YUT A;  3EVU A;  2LHL A;  2LVI A;  4QJ3 B;  3CLN A;  4MRY A;  3DVK A;  1F4Q A;  3EK8 A;  1BJF A;  1TNP A;  3OX6 A;  1UHK A;  5JOL A;  1Y1U A;  1U5I A;  1XFW O;  2LNK A;  2F3Z A;  2F8P A;  1B8R A;  2EC6 B;  2MJW B;  2ZN9 A;  1M46 A;  3I5I B;  1NCY A;  5HLV A;  1ALV A;  2ZKM X;  1S6C A;  1AJ5 A;  3EVR A;  1NIW A;  1U5I B;  4U8D A;  3DD4 A;  2K8M B;  4PHK A;  4P2Y B;  5AER A;  1YTZ C;  2L0P A;  1CDP A;  1JF0 A;  3PFV A;  3VGO A;  3GK2 A;  3WNX B;  4P5O E;  2L4H A;  2LCP A;  4GPL B;  4BY4 A;  2KI6 C;  4QJ5 B;  1RRO A;  4OR9 B;  4GBA A;  4Q04 A;  2AMI A;  2NCO A;  3TUY B;  4AQJ A;  2PMY A;  1CM4 A;  1N2D A;  2M97 A;  1YX8 A;  1TIZ A;  2K2A A;  1JBA A;  1TCO B;  3BUW B;  2K7C A;  1RK9 A;  2CT9 A;  1IGV A;  2HQ8 A;  1VRK A;  2JTZ A;  2JT3 A;  1G33 A;  3LL8 B;  2LLU A;  1CFP A;  1Y1X A;  1K95 A;  2LMT A;  2WOR A;  1SKT A;  4FTG A;  3ZWH A;  4PHJ A;  1PUL A;  2PSR A;  3I5F B;  2NZ0 A;  1N0Y A;  2K0J A;  4M2O A;  1BOC A;  1QV1 A;  3EK7 A;  1B8L A;  1K8U A;  1UUS A;  2BCA A;  5DKQ A;  5F6T A;  1H4B A;  1PAL A;  5FYX A;  3SG5 A;  1K9U A;  1G8I A;  1IRJ A;  1KFU S;  1F4O A;  3CGA A;  4PE4 A;  4DUQ A;  3FWC A;  4GUK A;  5ER5 A;  2JTT A;  4JPZ B;  4MVF A;  1J7R A;  2L2E A;  1OZO A;  1AVS A;  1J7O A;  1BR4 B;  2KFG A;  2M8U A;  1F54 A;  1W7I B;  4YGA A;  2M3W A;  2JUL A;  3PN7 B;  1AP4 A;  1J1E A;  1QX7 A;  4PE0 A;  1QTX A;  2LV7 A;  5AXI A;  3DVE A;  2M0R A;  1AJ4 A;  1WLM A;  1XFY O;  1CNP A;  4C0L A;  2RGI A;  1BMO A;  1A2X A;  3SG4 A;  3CZT X;  4GFT A;  3DVJ A;  3PAT A;  3SG2 A;  1ZAC A;  1OE9 B;  1KCY A;  1KSM A;  2K7B A;  3JVT C;  1F70 A;  4I5K A;  4MBE A;  2KI4 B;  1DJH A;  5CSI A;  1Y0V H;  1YUR A;  1MHO A;  2M29 A;  2NLN A;  1SCV A;  1K90 D;  2M1U A;  1UWO A;  4YI9 A;  3KPX A;  1FW4 A;  2LVV A;  1NP8 A;  3QRX A;  4CPV A;  1J1D A;  1UP5 A;  2H61 A;  4WQ3 A;  3SIB A;  1SR6 C;  2QAC A;  4JWQ A;  1JF2 A;  2E6W A;  2O5G A;  3I5H C;  2LP2 A;  1QLS A;  1J7P A;  4OCI A;  1DGU A;  1YX7 A;  2HET A;  3BUN B;  5AFP A;  1KFX S;  4CID A;  3CR5 X;  1KWO B;  2NXQ A;  1M31 A;  1BOD A;  2BKH B;  4HRE E;  1TN4 A;  1EXR A;  2BE4 A;  3SG3 A;  1OOJ A;  1FBV A;  2LP3 A;  2CCM A;  3TS5 B;  1SL7 A;  1B7T Y;  2BCB A;  2L98 A;  2ZNE A;  3WXA A;  1SL9 A;  2G2B A;  4XYN A;  4C0K A;  1CDL A;  1ALW A;  3I5H B;  5I2O A;  1K2H A;  2PAS A;  1MUX A;  2K2F A;  1UHN A;  3OB1 B;  1S6J A;  4DCK A;  2KQY A;  2A4J A;  1QLK A;  2KBI A;  2KAY A;  5IBW A;  1SCM B;  1EG3 A;  1QJT A;  4GGF C;  3VRO A;  4BY5 A;  1LA0 A;  1KK8 B;  5KU1 A;  2MRD A;  5CSN A;  2Q91 A;  1UHH A;  1YVH A;  1QX2 A;  2E30 A;  2BL0 B;  3TDU A;  5KTY A;  2WCB A;  2MLF C;  3GOF A;  1F55 A;  2JU0 A;  4MZJ A;  4TNC A;  4DS7 A;  1BG1 A;  1OSA A;  1ZMZ A;  2F3Y A;  2JWW A;  3CS1 A;  1CLL A;  4MN0 A;  1OMR A;  1PRW A;  1QAT A;  2CNP A;  4USL A;  1CTR A;  4PCW A;  2I7A A;  3NSL A;  4MRX A;  1XK4 A;  2Y5I A;  2Y1N A;  1LVC D;  1FI5 A;  1QIV A;  3F45 A;  3CTN A;  5D69 A;  4N1F A;  1KSO A;  2WND A;  1BU3 A;  2MHH A;  2SAS A;  1KK7 Y;  4ICB A;  1E8A A;  3FWB A;  1NX0 A;  1SK6 D;  2KGB C;  5ER4 X;  1CKK A;  1DMO A;  2I18 A;  1HT9 A;  5I2L A;  1IJ6 A;  1JFJ A;  2ZRS A;  4NDD A;  1B9A A;  1W7J B;  3A4U B;  3FIA A;  3K21 A;  3O78 A;  4A4B A;  3RLZ A;  2BKI B;  2GV5 A;  4D1E A;  4MEW A;  4YGB B;  1QX5 B;  3AKB A;  4ZCU A;  2M7N A;  1CMG A;  3PSR A;  2LVK A;  5DKN A;  2KAV A;  1B8C A;  1B4C A;  2Y1M A;  1QVI Y;  1S26 D;  4OVN F;  3MSE B;  2P6B B;  1B47 A;  1DJG A;  1RFJ A;  3WHU B;  4YBH B;  4F0Z B;  1SNL A;  1EJ3 A;  1SYM A;  3OX5 A;  3EKH A;  2KFH A;  1A75 A;  3LK0 A;  1MWN A;  2MBX A;  2L4I A;  1IQ3 A;  1BR1 B;  2F2O A;  2KHN A;  1CFC A;  3OB2 B;  3TDZ A;  2QPT A;  1A75 B;  1GGW A;  4I5L B;  1WRZ A;  5I8N A;  1AHR A;  2I94 A;  1YRT B;  4MLW A;  2F33 A;  4OKH A;  3BXK A;  1RWY A;  1XA5 A;  2JT0 A;  4N5X A;  2EGD A;  1NUB A;  1PVB A;  5J3X A;  1JFK A;  3BUM B;  4YRU A;  2KAX A;  3VRP A;  2BBM A;  1UUR A;  2JPT A;  2KYC A;  2LHI A;  5I2Q A;  1L7Z A;  1YVL A;  2LC5 A;  5AAN A;  1FPW A;  3KF9 A;  1B7T Z;  4R1E A;  1ZFS A;  1IG5 A;  4PAL A;  1XFV O;  1A29 A;  2LAN A;  1M63 B;  2VRG A;  1HQV A;  2OTG C;  5HKY A;  1A03 A;  3SG6 A;  1JSA A;  2ISD A;  4MSP A;  2M7L A;  2LAP A;  1DTL A;  2BBN A;  3SG7 A;  1NPQ A;  4CFQ A;  2WOS A;  2LMU A;  2KYF A;  5TNC A;  1A4P A;  3VRN A;  2CXJ A;  3DF0 A;  1N65 A;  3JVT B;  2CTN A;  1K94 A;  1BF5 A;  2MLE C;  2D8N A;  1WRL A;  2OPO A;  1NCX A;  3DF0 B;  1FF1 A;  2WC8 A;  4I5J A;  2LVJ A;  2LUX A;  4L9M A;  1GQM A;  1L2O C;  1XFX O;  1MQ1 A;  4NDB A;  1S1E A;  5D7F A;  1WY9 A;  3CWG A;  1EH2 A;  1SR6 B;  5K89 A;  5HKZ A;  3O4Y A;  4CLN A;  1KK7 Z;  1SL8 A;  3M0W A;  1DJX A;  2AUC A;  1YUU A;  2H2K A;  4I5N B;  1SY9 A;  5GQQ C;  1QV0 A;  1J7Q A;  1BT6 A;  1PSB A;  4PDZ A;  3SJS A;  3TDI A;  1L2O B;  2JOJ A;  2ZND A;  4AOM A;  2DOQ A;  1PK0 D;  1LXF C;  3BUO B;  1AK8 A;  1NWD A;  1Y6W A;  2Y4Q A;  1OMV A;  4ETO A;  5HKW A;  1QVI Z;  2JNX A;  2F2P A;  4GGF A;  5BPJ A;  3KHE A;  1GGZ A;  4M2Q A;  1K9K A;  3OHM B;  3OP0 A;  4PHM A;  4UPG A;  1TOP A;  2AAO A;  4CFR A;  1MXL C;  2LE9 B;  1OZS A;  3HX4 A;  4YI8 A;  4MZL A;  2G9B A;  3IQO A;  2K61 A;  1IKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...