2ZN9A

Crystal structure of ca2+-bound form of des3-20alg-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
169
structure length
169
Chain Sequence
ALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zn9A00
1KFXL 5KSZA 2BL0B 1B9AA 2JTZA 3TDUA 4TNCA 1WLMA 1MXEA 1B4CA 2ZN9A 1TIZA 1CTRA 2PRUA 1SR6C 1JFKA 2L4IA 1EG4A 1QIWA 1YRTB 2BCXA 2KYCA 1QVIZ 3OHMB 2NLNA 4PE4A 1MQ1A 1MHOA 5JJGA 1IKUA 1F55A 2ZNDA 3EVRA 2LP3A 2LHLA 1VRKA 1YUSA 2JT0A 1F8HA 3PSRA 3OP0A 3PN7C 2MA2A 2ZFDA 1S6IA 2G2BA 1OZOA 3AAJA 3RM1A 1BOCA 1ZOTB 2KFHA 1XFZO 1S5GZ 3VRQA 4YI9A 1RK9A 3CTNA 4GBAA 3BUXB 1JSAA 2IS9A 2KI4B 1CDLA 1H8BA 1GQMA 1J7RA 2BECA 1U5IA 3O78A 1XFWO 3LL8B 1KSMA 1NCYA 3EKJA 4UPGA 3PATA 3SG4A 4NQGA 2K0JA 3EVVA 1Y1XA 1ZMZA 2HPSA 1ZACA 1N2DA 1UHHA 3TDZA 1F4QA 2AUCA 1JFJA 1KK8B 3NSLA 2VRGA 3I5FB 1DJGA 1KFXS 4GUKA 1KQVA 2L2EA 1YUTA 1PSBA 2EC6B 1M46A 2DOQA 2O5GA 2OTGC 1ODBA 1PK0D 1SYMA 1UURA 4MLWA 5I2LA 1LKJA 1CDMA 1SW8A 3I5IC 4GPLB 1YX7A 2K61A 2HQWA 2KDHA 4MN0A 1QX5B 3KHEA 2LE9B 1SL7A 1CMFA 2KBIA 2MAZA 3GK4X 5CSFA 4PDZA 2KNEA 5J3XA 1UUSA 3D10A 1B7TY 1LXFC 1OMVA 2LC5A 1J1DA 1YR5A 3WHTB 5ER4X 1HQVA 1MXLC 3QRXA 2F2PA 2LUXA 4OCIA 1QTXA 4YRUA 1EH2A 4ORCB 3HCMA 3DF0A 3BOWA 4AQIA 3PALA 1SR6B 1SBJA 2BKIB 4PE1A 3OX6A 1HT9A 1K94A 1SCVA 4OR9B 1KSOA 1B8CA 4M2PA 3NXAA 3DF0B 3JVTC 3BOWB 4USLA 1LA0A 3PN7B 1XK4C 3JTDC 2CTNA 1IG5A 1NX0A 3KPXA 1K9PA 1QIVA 4GGFC 3OB2B 2QACA 1UHIA 1FF1A 1M63B 2I94A 4PHMA 2ZRSA 2D8NA 2KGRA 1TTXA 1V1FA 5AXIA 1QASA 3SG7A 3BUOB 1C7VA 1XFVO 1XA5A 1PVBA 1S36A 1Y1UA 1LA3A 4JQ0D 4ORAB 2KSPA 2ZN8A 2JTTA 3CLNA 2L5XB 4ICBA 1F71A 2KBMA 2CNPA 1QATA 1TCFA 1IQ3A 1W7JB 4P2YB 4MZLA 1PRWA 1CM4A 1K96A 4PE7A 2A4JA 3BUWB 1C07A 1YVLA 4E68A 1DMOA 5K89A 1BU3A 3FS7A 3MSEB 2M97A 1KQMC 2GGMA 5TNCA 1MF8B 4FQOA 1CFPA 4F0ZB 2OTGB 1MUXA 2MLEC 2JOJA 2LVIA 2WNDA 3I5IB 1Q80A 1J7OA 3E3RA 1QXPA 1A75B 1PALA 1AJ4A 3VRNA 3I5HC 3KF9A 1NPQA 2BE6A 4GFTA 3K21A 2BKHB 1M45A 4YGBB 1WRLA 1TN4A 2F2OA 3KEVA 3A8RA 2KAYA 2V53A 4MRXA 1TOPA 4XJKB 5AANA 1OMDA 3VRRA 5DKQA 2E6WA 3TUYC 2JU0A 1BF5A 2KHNA 2LAPA 1N0YA 1GJYA 3IF7A 2WCFA 1KK7Z 4A4CA 1G33A 1AK8A 4YBHB 2E30A 2LLSA 1SCMC 1F4OA 1FI5A 3SJSA 1G8IA 4PHNA 2BCAA 1NUBA 1TNWA 3O6BA 2KAVA 1S1EA 1J7PA 5AEQA 2M9GA 1PULA 2B1UA 5KTYA 2MRDA 1JBAA 2Y1NA 1V1GA 1AVSA 4MZJA 3NSIA 3SG2A 2K7BA 4GGFA 4GGNA 1YURA 5HKYA 3JVTB 5AFPA 1CKKA 5CPVA 1CLBA 1IRJA 2M29A 3JTDB 5ER5A 2H61A 2M7NA 2NCOA 2L50A 3HX4A 3M0WA 1OMRA 3EK7A 3O4YA 1YRUB 3D0YB 1X02A 3VGOA 4PHJA 3AAKA 1DJIA 1QS7A 5BPJA 4HRGA 2K7OA 4CPVA 1WRKA 4MBEA 4DRWA 3TS5C 2KFFA 1B8LA 4L9MA 4M2OA 4OVNF 5HKZA 2I7AA 4QJ5B 1Y1AA 2JT3A 3TZ1A 1NCXA 1LVCD 1K2HA 1A03A 2LUCA 1EXRA 2JWWA 1BODA 2LVKA 1AUIB 1QX7A 3PFVA 1R6PA 1A2XA 1NIWA 1KQMB 2FCDA 2KAXA 3I5GC 1H4BA 1XFUO 4MZKA 1KWOC 4PALA 4MRYA 1B1GA 1EJ3A 4D1EA 2Y1MA 3F45A 1JF2A 1DT7B 2WCBA 1GGWA 1RWYA 1OZSA 4U8DA 2M8UA 1YVHA 2JQ6A 4BY5A 3WXAA 2LCPA 1IWQA 2BCBA 4MVFA 3ZWHA 3I5HB 5CSNA 1SY9A 2LHIA 4I5KA 5KU1A 5PALA 4HSZA 4QJ3B 1CFCA 1DVIA 4ORBB 2PALA 1IJ6A 4N5XA 2JNFA 2LVJA 1BJFA 1XO5A 4YI8A 1NSHA 2K7CA 2WC8A 1N65A 2ISDA 2LLTA 2LNKA 3TUYB 1XFYO 4HREE 3O2PA 4YGEB 2KQ6A 1UHNA 1ZFSA 1ALWA 2KGBC 1A4PA 1S3PA 1SCMB 1JC2A 3GK1A 5D7FA 2Y4QA 1W7IB 3TDIA 4NDBA 1DTLA 4N1GA 5I2OA 3GOFA 2MJWB 1QVIY 1CB1A 4DUQA 2M3WA 1IQ5A 2HETA 1JWDA 3BQ3A 1C7WA 3SG5A 3CR4X 3CS1A 4YGCB 2JPTA 2OS8C 2F3YA 3VROA 1QV1A 2L0PA 2L98A 1M31A 4I5LB 1R2UA 2KQYA 1S5GY 2KI6C 3AKAA 4ZCUA 2LMVA 3NSKA 4ETOA 4WQ3A 5DKRA 4YGDB 2SASA 1A75A 1J55A 2M7LA 1IGVA 1PSRA 2PSRA 2I2RE 2NXQA 1UHJA 2JZIA 3ICBA 5HLVA 1DJYA 1DJWA 1B7TZ 3H4SE 1BG1A 1NWDA 5HKWA 3TS5B 2F33A 3A4UB 2WCEA 3AKBA 4XJKA 1XVJA 1DGUA 2LVVA 1WRZA 4XYNA 1K95A 3DVJA 1UHKA 1DGVA 1QLSA 4GNKB 2LLUA 1BT6A 3C1VA 3I5GB 1TRFA 3IQOA 1SK6D 3CZTX 5G08A 1KWOB 1DJXA 2M1UA 2NZ0A 4I5NB 1SRAA 1WLZA 1NX1A 2CXJA 1CM1A 3WHUB 2NCPA 5AERA 4Q04A 2BBMA 2LANA 3SG3A 1QLKA 5HLOA 1BR4B 2SCPA 1WDCC 3GK2A 5IBWA 2JXCA 2K2FA 3LK1A 1CNPA 1SMGA 4OV2A 1XK4A 2PASA 2PVBA 1DJZA 3PLFB 2L4HA 2K7DA 1L7ZA 2FJUB 1L2OC 1AHRA 4PE0A 3SG6A 1CMGA 2AAOA 1YTZC 2F8PA 2K8MB 1YX8A 1DJHA 3D0YA 1BMOA 1ALVA 2F3ZA 3FIAA 1RJVA 2ZRTA 4ZCVA 1FI6A 4BY4A 5CSIA 3BUMB 4AOMA 2KYFA 1Y0VH 1TNPA 1RECA 4N1FA 1MR8A 4DIRA 3OB1B 3KO0A 1K9UA 2CBLA 2L51A 5FYXA 5I2QA 4DCKA 1F70A 1PVAA 3CR5X 2JC2A 2RGIA 4FTGA 4CFQA 2PMYA 1NYAA 3LCPC 3CWGA 4CFRA 4GAOA 1OOJA 1S6JA 3DVMA 3EVUA 2G9BA 4CIDA 1IJ5A 4JPZB 2OS8B 1J1EA 1M39A 1B8RA 3CR2A 4AQJA 3LLEA 4MSPA 1FBVA 1CLMA 1CDNA 5DKNA 1U5IB 1NX2A 1QJTA 3FWBA 1CDPA 3VRPA 3BYAA 3EK4A 2FOTA 1UWOA 1NP8A 1SPYA 2P6BB 3DVEA 5I8NA 2KI6D 2MHHA 4QJ4B 4PCWA 3ZNIA 1WY9A 2QPTA 1ZUZA 4OKHA 1QV0A 1XYDA 3DD4A 2I18A 2HQ8A 2BL0C 4IL1A 2JT8A 2K2AA 1F54A 3BUNB 2EGDA 1JUOA 5D69A 2GV5A 2BBNA 1FPWA 1OQPA 1J7QA 4JWQA 1SKTA 4NDDA 1TCOB 4R1EA 1KFUL 3CGAA 1S26D 1XFXO 2HF5A 1TNQA 1QX2A 1RTP1 1OE9B 2ZKMX 2MBXA 2Y5IA 1WDCB 4CLNA 1CFFA 2KOTA 2LV7A 2O60A 4WQ2A 1K9KA 1K90D 4YGAA 3EKHA 3FWCA 1MWNA 3EK8A 4A4BA 2KI4C 2R2IA 2WOSA 5HYDA 1L2OB 4C0LA 2JULA 2BE4A 2COLB 3SIBA 1B47A 1K8UA 2CCMA 1Y6WA 2JNXA 2OPOA 1KK7Y 1SNLA 4DS7A 2JRFA 2Q91A 1NCZA 3WNXB 2WORA 1AP4A 2H2KA 1YUUA 1KK8C 4MEWA 3I5FC 3LK0A 1SL9A 1K93D 3BXKA 1FW4A 2TN4A 4NDCA 1D1OA 2LMUA 2EC6C 2EHBA 2ZNEA 1CLLA 4I5JA 4C0KA 1TNXA 2H61C 1RROA 1G4YR 2GGZA 3IQQA 2AMIA 1BLQA 1A29A 1KCYA 1OSAA 2JXLA 1E8AA 2M0RA 4HRHA 1RFJA 1KFUS 2CT9A 2MLFC 2LMTA 1SL8A 2M49B 4PHKA 3SIAA 1AJ5A 1EG3A 1S6CA 2LP2A 1JF0A 5B8IB 1DF0A 2KFGA 1LINA 4C0JA 2M1KB 3OX5A 4P5OE 2LM5A 3PM8A 1NX3A 5CSJA 1IH0A 4M2QA 5JOLA 5F6TA 5GQQC 4WRIA 1UP5A 3RLZA 2FCEA 3DVKA 3NSOA 2Q4UA 1BR1B 1DF0B 1EL4A 1CFDA 1GGZA
chains in the Genus database with same CATH superfamily
1KFXL 5KSZA 2BL0B 1B9AA 2JTZA 3TDUA 2KLEA 4TNCA 1WLMA 1MXEA 2L2CA 1B4CA 2ZN9A 1TIZA 1CTRA 2PRUA 1SR6C 1JFKA 2L4IA 1EG4A 1QIWA 1YRTB 2BCXA 2KYCA 1QVIZ 3OHMB 3N7HA 2NLNA 4PE4A 1MQ1A 1MHOA 5JJGA 1IKUA 1F55A 2ZNDA 3EVRA 2LP3A 2LHLA 3BFAA 3CDNA 1VRKA 1YUSA 2JT0A 1F8HA 3PSRA 3OP0A 3PN7C 3S0AA 1P28A 2MA2A 2ZFDA 1S6IA 2G2BA 1OZOA 3AAJA 3RM1A 1BOCA 1ZOTB 2KFHA 1XFZO 1S5GZ 3D75A 3VRQA 4YI9A 1RK9A 3CTNA 4GBAA 3BUXB 1JSAA 3FE9A 2IS9A 2WCJA 3CZ1A 2KI4B 1CDLA 4IJ7A 1GQMA 1J7RA 2BECA 1OOIX 3EG5B 1H8BA 1U5IA 3O78A 1XFWO 3LL8B 1KSMA 1NCYA 3EKJA 4UPGA 3PATA 3SG4A 4NQGA 2K0JA 3EVVA 1Y1XA 1ZMZA 2HPSA 1ZACA 1N2DA 1UHHA 3TDZA 1F4QA 2AUCA 1JFJA 1KK8B 3NSLA 2VRGA 3I5FB 1DJGA 1KFXS 4GUKA 3SS4A 5HL1A 1KQVA 2L2EA 1YUTA 1PSBA 2EC6B 1M46A 2DOQA 2O5GA 2OTGC 1ODBA 1PK0D 1SYMA 1UURA 4MLWA 5I2LA 1LKJA 1CDMA 1SW8A 3I5IC 4GPLB 1YX7A 2WCKA 2K61A 2HQWA 2KDHA 4MN0A 1QX5B 3L47A 3KHEA 3Q8IA 2LE9B 1SL7A 1CMFA 2KBIA 2MAZA 3S0BA 2QEBA 3GK4X 5CSFA 4PDZA 2KNEA 5J3XA 2QEOA 1LS8A 1UUSA 3D10A 3IVTA 3FE6A 1B7TY 1LXFC 1OMVA 2LC5A 1J1DA 1YR5A 3WHTB 5ER4X 1HQVA 1MXLC 3QMEA 2F2PA 2LUXA 1ORGA 1QTXA 3CABA 3QRXA 4OCIA 4YRUA 1EH2A 4ORCB 2WCMA 3HCMA 3DF0A 3BOWA 4AQIA 3VB1A 3PALA 1SR6B 1SBJA 1IIOA 2BKIB 4PE1A 3OX6A 1GM0A 1HT9A 1K94A 1SCVA 3R72A 1KSOA 4OR9B 1B8CA 4M2PA 3NXAA 3DF0B 3JVTC 1Z4HA 3BOWB 2PYQA 4USLA 1DC1A 1LA0A 3PN7B 1XK4C 1W9ZA 3JTDC 2CTNA 1IG5A 1NX0A 3KPXA 1K9PA 1QIVA 4GGFC 3OB2B 2QACA 1UHIA 1FF1A 1M63B 2I94A 4PHMA 2ZRSA 2D8NA 3D78A 2KGRA 1TTXA 1V1FA 5AXIA 1QASA 3SG7A 3BUOB 1C7VA 1XFVO 1XA5A 1PVBA 1S36A 1Y1UA 1LA3A 4JQ0D 4ORAB 2KSPA 2ZN8A 2JTTA 3CLNA 2L5XB 4ICBA 1F71A 2KBMA 2CNPA 1QATA 1TCFA 1IQ3A 1W7JB 4P2YB 4MZLA 1PRWA 1CM4A 1K96A 4PE7A 2A4JA 3BUWB 1C07A 1YVLA 4E68A 1DMOA 5K89A 1BU3A 3FS7A 3MSEB 3V2LA 4JKTA 2M97A 2YGUA 1KQMC 2GGMA 5TNCA 1MF8B 4FQOA 4INXA 1CFPA 4F0ZB 2OTGB 1MUXA 2MLEC 2JOJA 2LVIA 2WNDA 3I5IB 1Q80A 1J7OA 3D77A 3E3RA 1QXPA 1A75B 1PALA 1AJ4A 3VRNA 3I5HC 3KF9A 1NPQA 2BE6A 4GFTA 3K21A 2BKHB 1M45A 4YGBB 1WRLA 1TN4A 4OZDA 2F2OA 3KEVA 3A8RA 2KAYA 2V53A 4MRXA 1TOPA 4XJKB 5AANA 1OMDA 3VRRA 3PJIA 5DKQA 2E6WA 3TUYC 2JU0A 1BF5A 2KHNA 2LAPA 1N0YA 5DICA 1GJYA 3IF7A 2WCFA 1KK7Z 4A4CA 1G33A 1AK8A 4YBHB 2E30A 1OOFA 1SCMC 1F4OA 2LLSA 5FI6A 1OOHA 1FI5A 3SJSA 3L4AA 1G8IA 4PHNA 2BCAA 3NHTA 1NUBA 1TNWA 3O6BA 1CFCA 1DQEA 2KAVA 1S1EA 1J7PA 5AEQA 2M9GA 1PULA 2B1UA 5KTYA 2MRDA 1JBAA 2Y1NA 1V1GA 1AVSA 4MZJA 3NSIA 3SG2A 2K7BA 4GGFA 4GGNA 1YURA 5HKYA 3BFHA 3JVTB 5AFPA 1CKKA 5CPVA 1CLBA 1IRJA 2M29A 3JTDB 5ER5A 2H61A 2M7NA 2JPOA 2NCOA 2L50A 3HX4A 3M0WA 1OMRA 3EK7A 3O4YA 1YRUB 3D0YB 1X02A 3VGOA 4PHJA 3AAKA 1DJIA 3D74A 5FI7A 1QS7A 3SS3A 4HRGA 5BPJA 2K7OA 4CPVA 1WRKA 4MBEA 4DRWA 3TS5C 2KFFA 1B8LA 3B87A 4L9MA 4M2OA 4OVNF 5HKZA 2I7AA 4QJ5B 1Y1AA 2JT3A 3TZ1A 1NCXA 1LVCD 1K2HA 1A03A 2LUCA 1EXRA 2JWWA 1BODA 2LVKA 1AUIB 1QX7A 3PFVA 1R6PA 1A2XA 1NIWA 1KQMB 2FCDA 2KAXA 3I5GC 1H4BA 1XFUO 4MZKA 3OGNA 1KWOC 4PALA 4MRYA 1B1GA 1EJ3A 4D1EA 2Y1MA 3F45A 1JF2A 1DT7B 4JD9A 2WCBA 1GGWA 1RWYA 1OZSA 4U8DA 2M8UA 3S0GA 1YVHA 2JQ6A 4BY5A 3WXAA 2LCPA 1IWQA 2BCBA 3D73A 4MVFA 3ZWHA 3I5HB 5CSNA 1SY9A 2LHIA 4I5KA 5KU1A 5PALA 4HSZA 1Z2CB 3DXLA 1DVIA 4ORBB 4QJ3B 2PALA 3CZ0A 1IJ6A 3NHIA 4N5XA 2H8VA 2JNFA 2LVJA 4FQTA 1BJFA 1XO5A 1DEKA 4YI8A 1NSHA 2K7CA 2WC8A 1N65A 2ISDA 2LLTA 2LNKA 3TUYB 1XFYO 2WC5A 4HREE 3O2PA 4YGEB 2KQ6A 1UHNA 1ZFSA 1ALWA 2KGBC 1A4PA 1S3PA 1SCMB 1JC2A 3GK1A 2WCHA 5D7FA 4F7FA 2Y4QA 1W7IB 1TUJA 3TDIA 4NDBA 1DTLA 4N1GA 5I2OA 3GOFA 3CZ2A 2MJWB 3L4LA 1QVIY 1CB1A 4DUQA 2M3WA 1IQ5A 2HETA 1JWDA 3BQ3A 4KYNA 1C7WA 3SG5A 3CR4X 3CS1A 3S0DA 4YGCB 5I94A 3RZSA 2JPTA 2OS8C 2F3YA 3VROA 1QV1A 2L0PA 2L98A 1M31A 3BJHA 4I5LB 1R2UA 2P71A 5EL2A 2KQYA 1S5GY 2KI6C 3AKAA 4ZCUA 2FJYA 2LMVA 3NSKA 4ETOA 4WQ3A 2KLDA 5DKRA 4YGDB 2SASA 1A75A 1J55A 2M7LA 1IGVA 1PSRA 2PSRA 2I2RE 2NXQA 2K60A 1UHJA 2JZIA 3ICBA 5HLVA 1DJYA 1DJWA 1B7TZ 1QWVA 3H4SE 3K1EA 1BG1A 1NWDA 3SS5A 5HKWA 3TS5B 2F33A 3A4UB 2WCEA 3AKBA 3CYZA 4XJKA 1XVJA 1DGUA 2WC6A 2KPHA 2LVVA 1WRZA 4XYNA 1K95A 3DVJA 1UHKA 1DGVA 1QLSA 4GNKB 2LLUA 1BT6A 3C1VA 3I5GB 1TRFA 3IQOA 1SK6D 3CZTX 5G08A 1KWOB 1DJXA 2M1UA 2NZ0A 4I5NB 1SRAA 1WLZA 1NX1A 2CXJA 1CM1A 3WHUB 2NCPA 5AERA 4Q04A 1XFRA 2BBMA 2LANA 3SG3A 1QLKA 5HLOA 1BR4B 2SCPA 1WDCC 1C3ZA 3GK2A 5IBWA 2JXCA 2K2FA 3LK1A 3R1VA 1CNPA 1SMGA 3FE8A 4OV2A 1XK4A 2PASA 2PVBA 3DZTA 1DJZA 3PLFB 2L4HA 2K7DA 1L7ZA 2FJUB 1L2OC 1AHRA 4PE0A 3SG6A 1CMGA 2AAOA 2P70A 2BNXA 1YTZC 3DYEA 2F8PA 2K8MB 1YX8A 1DJHA 3D0YA 1BMOA 1ALVA 2F3ZA 3FIAA 1RJVA 2ZRTA 4ZCVA 1FI6A 4BY4A 5CSIA 3BUMB 4AOMA 2KYFA 1Y0VH 1TNPA 1RECA 4N1FA 1MR8A 2GTEA 4DIRA 3OB1B 3KO0A 1K9UA 2CBLA 3UO9A 2L51A 5FYXA 5I2QA 4DCKA 1F70A 1PVAA 3CR5X 2JC2A 2RGIA 4FTGA 4CFQA 2PMYA 1NYAA 3LCPC 3CWGA 4CFRA 4GAOA 3B7AA 1OOJA 1S6JA 3DVMA 3EVUA 2G9BA 3B88A 1IJ5A 4JPZB 2OS8B 4CIDA 3UNWA 5FI2A 1J1EA 1M39A 2QEVA 3R1PA 1B8RA 3CR2A 4AQJA 1TUZA 3LLEA 4MSPA 1FBVA 1CLMA 1CDNA 5DKNA 1U5IB 1NX2A 1QJTA 3FWBA 1CDPA 2PQLA 3VRPA 2BAPA 1TWOA 3BYAA 2FOTA 1UWOA 1NP8A 1SPYA 2P6BB 3DVEA 3EK4A 2KI6D 5I8NA 2MHHA 4QJ4B 4PCWA 3ZNIA 1SSEB 1WY9A 2QPTA 1ZUZA 3S0FA 4OKHA 1QV0A 1XYDA 3DD4A 2I18A 2HQ8A 2BL0C 4IL1A 4PT1A 2JT8A 2K2AA 1F54A 3BUNB 2EGDA 3D76A 1DELA 1JUOA 5D69A 2GV5A 2BBNA 1FPWA 1OQPA 1J7QA 4JWQA 2QDIA 1SKTA 4NDDA 1TCOB 4R1EA 1KFUL 3CGAA 3PM2A 1S26D 1XFXO 2HF5A 3BFBA 1TNQA 1QX2A 1RTP1 1OE9B 2ZKMX 2MBXA 2Y5IA 1WDCB 4CLNA 1CFFA 2KOTA 2LV7A 2O60A 4WQ2A 1K9KA 1K90D 4YGAA 3EKHA 3FWCA 1MWNA 3EK8A 4A4BA 3NGVA 3OBVA 2KI4C 5D3OA 2R2IA 2WOSA 5HYDA 1L2OB 4C0LA 2JULA 2BE4A 2COLB 3SIBA 1B47A 1K8UA 2CCMA 1Y6WA 2JNXA 2OPOA 1KK7Y 1SNLA 4DS7A 2JRFA 2Q91A 1NCZA 3WNXB 2WORA 1AP4A 1OOGA 2H2KA 1YUUA 1KK8C 4MEWA 3I5FC 3LK0A 1SL9A 1K93D 4INWA 3BXKA 1FW4A 2TN4A 4NDCA 1D1OA 2LMUA 2EC6C 2EHBA 2ZNEA 1CLLA 4I5JA 4C0KA 1TNXA 2H61C 1RROA 1G4YR 2GGZA 3IQQA 2AMIA 3S0EA 1A29A 1BLQA 1OSAA 2JXLA 1KCYA 1E8AA 3B86A 3O4XA 2M0RA 4HRHA 1RFJA 1KFUS 2CT9A 2MLFC 2ERBA 2LMTA 1SL8A 2M49B 3DY9A 4PHKA 3SIAA 1AJ5A 3B6XA 1EG3A 1S6CA 2LP2A 1JF0A 5B8IB 1DF0A 2KFGA 1T14A 1LINA 1OW4A 2M1KB 3OX5A 4C0JA 4P5OE 2WCLA 2LM5A 3PM8A 1NX3A 5CSJA 1IH0A 4M2QA 5JOLA 5F6TA 2L5YA 4WRIA 1UP5A 5GQQC 3RLZA 2FCEA 3DVKA 2QEHA 3R1OA 3NSOA 2Q4UA 1BR1B 1DF0B 1EL4A 1C3YA 1CFDA 1GGZA
chains in the Genus database with same CATH topology
1KFXL 5KSZA 2BL0B 1B9AA 2JTZA 3TDUA 4TNCA 1WLMA 1MXEA 1B4CA 2ZN9A 1TIZA 1CTRA 2PRUA 1SR6C 1JFKA 2L4IA 1EG4A 1QIWA 1YRTB 2BCXA 2KYCA 1QVIZ 3OHMB 2NLNA 4PE4A 1MQ1A 1MHOA 5JJGA 1IKUA 1F55A 2ZNDA 3EVRA 2LP3A 2LHLA 1VRKA 1YUSA 2JT0A 1F8HA 3PSRA 3OP0A 3PN7C 2MA2A 2ZFDA 1S6IA 2G2BA 1OZOA 3AAJA 3RM1A 1BOCA 1ZOTB 2KFHA 1XFZO 1S5GZ 3VRQA 4YI9A 1RK9A 3CTNA 4GBAA 3BUXB 1JSAA 2IS9A 2KI4B 1CDLA 1H8BA 1GQMA 1J7RA 2BECA 1U5IA 3O78A 1XFWO 3LL8B 1KSMA 1NCYA 3EKJA 4UPGA 3PATA 3SG4A 4NQGA 2K0JA 3EVVA 1Y1XA 1ZMZA 2HPSA 1ZACA 1N2DA 1UHHA 3TDZA 1F4QA 2AUCA 1JFJA 1KK8B 3NSLA 2VRGA 3I5FB 1DJGA 1KFXS 4GUKA 1KQVA 2L2EA 1YUTA 1PSBA 2EC6B 1M46A 2DOQA 2O5GA 2OTGC 1ODBA 1PK0D 1SYMA 1UURA 4MLWA 5I2LA 1LKJA 1CDMA 1SW8A 3I5IC 4GPLB 1YX7A 2K61A 2HQWA 2KDHA 4MN0A 1QX5B 3KHEA 2LE9B 1SL7A 1CMFA 2KBIA 2MAZA 3GK4X 5CSFA 4PDZA 2KNEA 5J3XA 1UUSA 3D10A 1B7TY 1LXFC 1OMVA 2LC5A 1J1DA 1YR5A 3WHTB 5ER4X 1HQVA 1MXLC 3QRXA 2F2PA 2LUXA 4OCIA 1QTXA 4YRUA 1EH2A 4ORCB 3HCMA 3DF0A 3BOWA 4AQIA 3PALA 1SR6B 1SBJA 2BKIB 4PE1A 3OX6A 1HT9A 1K94A 1SCVA 4OR9B 1KSOA 1B8CA 4M2PA 3NXAA 3DF0B 3JVTC 3BOWB 4USLA 1LA0A 3PN7B 1XK4C 3JTDC 2CTNA 1IG5A 1NX0A 3KPXA 1K9PA 1QIVA 4GGFC 3OB2B 2QACA 1UHIA 1FF1A 1M63B 2I94A 4PHMA 2ZRSA 2D8NA 2KGRA 1TTXA 1V1FA 5AXIA 1QASA 3SG7A 3BUOB 1C7VA 1XFVO 1XA5A 1PVBA 1S36A 1Y1UA 1LA3A 4JQ0D 4ORAB 2KSPA 2ZN8A 2JTTA 3CLNA 2L5XB 4ICBA 1F71A 2KBMA 2CNPA 1QATA 1TCFA 1IQ3A 1W7JB 4P2YB 4MZLA 1PRWA 1CM4A 1K96A 4PE7A 2A4JA 3BUWB 1C07A 1YVLA 4E68A 1DMOA 5K89A 1BU3A 3FS7A 3MSEB 2M97A 1KQMC 2GGMA 5TNCA 1MF8B 4FQOA 1CFPA 4F0ZB 2OTGB 1MUXA 2MLEC 2JOJA 2LVIA 2WNDA 3I5IB 1Q80A 1J7OA 3E3RA 1QXPA 1A75B 1PALA 1AJ4A 3VRNA 3I5HC 3KF9A 1NPQA 2BE6A 4GFTA 3K21A 2BKHB 1M45A 4YGBB 1WRLA 1TN4A 2F2OA 3KEVA 3A8RA 2KAYA 2V53A 4MRXA 1TOPA 4XJKB 5AANA 1OMDA 3VRRA 5DKQA 2E6WA 3TUYC 2JU0A 1BF5A 2KHNA 2LAPA 1N0YA 1GJYA 3IF7A 2WCFA 1KK7Z 4A4CA 1G33A 1AK8A 4YBHB 2E30A 2LLSA 1SCMC 1F4OA 1FI5A 3SJSA 1G8IA 4PHNA 2BCAA 1NUBA 1TNWA 3O6BA 2KAVA 1S1EA 1J7PA 5AEQA 2M9GA 1PULA 2B1UA 5KTYA 2MRDA 1JBAA 2Y1NA 1V1GA 1AVSA 4MZJA 3NSIA 3SG2A 2K7BA 4GGFA 4GGNA 1YURA 5HKYA 3JVTB 5AFPA 1CKKA 5CPVA 1CLBA 1IRJA 2M29A 3JTDB 5ER5A 2H61A 2M7NA 2NCOA 2L50A 3HX4A 3M0WA 1OMRA 3EK7A 3O4YA 1YRUB 3D0YB 1X02A 3VGOA 4PHJA 3AAKA 1DJIA 1QS7A 5BPJA 4HRGA 2K7OA 4CPVA 1WRKA 4MBEA 4DRWA 3TS5C 2KFFA 1B8LA 4L9MA 4M2OA 4OVNF 5HKZA 2I7AA 4QJ5B 1Y1AA 2JT3A 3TZ1A 1NCXA 1LVCD 1K2HA 1A03A 2LUCA 1EXRA 2JWWA 1BODA 2LVKA 1AUIB 1QX7A 3PFVA 1R6PA 1A2XA 1NIWA 1KQMB 2FCDA 2KAXA 3I5GC 1H4BA 1XFUO 4MZKA 1KWOC 4PALA 4MRYA 1B1GA 1EJ3A 4D1EA 2Y1MA 3F45A 1JF2A 1DT7B 2WCBA 1GGWA 1RWYA 1OZSA 4U8DA 2M8UA 1YVHA 2JQ6A 4BY5A 3WXAA 2LCPA 1IWQA 2BCBA 4MVFA 3ZWHA 3I5HB 5CSNA 1SY9A 2LHIA 4I5KA 5KU1A 5PALA 4HSZA 4QJ3B 1CFCA 1DVIA 4ORBB 2PALA 1IJ6A 4N5XA 2JNFA 2LVJA 1BJFA 1XO5A 4YI8A 1NSHA 2K7CA 2WC8A 1N65A 2ISDA 2LLTA 2LNKA 3TUYB 1XFYO 4HREE 3O2PA 4YGEB 2KQ6A 1UHNA 1ZFSA 1ALWA 2KGBC 1A4PA 1S3PA 1SCMB 1JC2A 3GK1A 5D7FA 2Y4QA 1W7IB 3TDIA 4NDBA 1DTLA 4N1GA 5I2OA 3GOFA 2MJWB 1QVIY 1CB1A 4DUQA 2M3WA 1IQ5A 2HETA 1JWDA 3BQ3A 1C7WA 3SG5A 3CR4X 3CS1A 4YGCB 2JPTA 2OS8C 2F3YA 3VROA 1QV1A 2L0PA 2L98A 1M31A 4I5LB 1R2UA 2KQYA 1S5GY 2KI6C 3AKAA 4ZCUA 2LMVA 3NSKA 4ETOA 4WQ3A 5DKRA 4YGDB 2SASA 1A75A 1J55A 2M7LA 1IGVA 1PSRA 2PSRA 2I2RE 2NXQA 1UHJA 2JZIA 3ICBA 5HLVA 1DJYA 1DJWA 1B7TZ 3H4SE 1BG1A 1NWDA 5HKWA 3TS5B 2F33A 3A4UB 2WCEA 3AKBA 4XJKA 1XVJA 1DGUA 2LVVA 1WRZA 4XYNA 1K95A 3DVJA 1UHKA 1DGVA 1QLSA 4GNKB 2LLUA 1BT6A 3C1VA 3I5GB 1TRFA 3IQOA 1SK6D 3CZTX 5G08A 1KWOB 1DJXA 2M1UA 2NZ0A 4I5NB 1SRAA 1WLZA 1NX1A 2CXJA 1CM1A 3WHUB 2NCPA 5AERA 4Q04A 2BBMA 2LANA 3SG3A 1QLKA 5HLOA 1BR4B 2SCPA 1WDCC 3GK2A 5IBWA 2JXCA 2K2FA 3LK1A 1CNPA 1SMGA 4OV2A 1XK4A 2PASA 2PVBA 1DJZA 3PLFB 2L4HA 2K7DA 1L7ZA 2FJUB 1L2OC 1AHRA 4PE0A 3SG6A 1CMGA 2AAOA 1YTZC 2F8PA 2K8MB 1YX8A 1DJHA 3D0YA 1BMOA 1ALVA 2F3ZA 3FIAA 1RJVA 2ZRTA 4ZCVA 1FI6A 4BY4A 5CSIA 3BUMB 4AOMA 2KYFA 1Y0VH 1TNPA 1RECA 4N1FA 1MR8A 4DIRA 3OB1B 3KO0A 1K9UA 2CBLA 2L51A 5FYXA 5I2QA 4DCKA 1F70A 1PVAA 3CR5X 2JC2A 2RGIA 4FTGA 4CFQA 2PMYA 1NYAA 3LCPC 3CWGA 4CFRA 4GAOA 1OOJA 1S6JA 3DVMA 3EVUA 2G9BA 4CIDA 1IJ5A 4JPZB 2OS8B 1J1EA 1M39A 1B8RA 3CR2A 4AQJA 3LLEA 4MSPA 1FBVA 1CLMA 1CDNA 5DKNA 1U5IB 1NX2A 1QJTA 3FWBA 1CDPA 3VRPA 3BYAA 3EK4A 2FOTA 1UWOA 1NP8A 1SPYA 2P6BB 3DVEA 5I8NA 2KI6D 2MHHA 4QJ4B 4PCWA 3ZNIA 1WY9A 2QPTA 1ZUZA 4OKHA 1QV0A 1XYDA 3DD4A 2I18A 2HQ8A 2BL0C 4IL1A 2JT8A 2K2AA 1F54A 3BUNB 2EGDA 1JUOA 5D69A 2GV5A 2BBNA 1FPWA 1OQPA 1J7QA 4JWQA 1SKTA 4NDDA 1TCOB 4R1EA 1KFUL 3CGAA 1S26D 1XFXO 2HF5A 1TNQA 1QX2A 1RTP1 1OE9B 2ZKMX 2MBXA 2Y5IA 1WDCB 4CLNA 1CFFA 2KOTA 2LV7A 2O60A 4WQ2A 1K9KA 1K90D 4YGAA 3EKHA 3FWCA 1MWNA 3EK8A 4A4BA 2KI4C 2R2IA 2WOSA 5HYDA 1L2OB 4C0LA 2JULA 2BE4A 2COLB 3SIBA 1B47A 1K8UA 2CCMA 1Y6WA 2JNXA 2OPOA 1KK7Y 1SNLA 4DS7A 2JRFA 2Q91A 1NCZA 3WNXB 2WORA 1AP4A 2H2KA 1YUUA 1KK8C 4MEWA 3I5FC 3LK0A 1SL9A 1K93D 3BXKA 1FW4A 2TN4A 4NDCA 1D1OA 2LMUA 2EC6C 2EHBA 2ZNEA 1CLLA 4I5JA 4C0KA 1TNXA 2H61C 1RROA 1G4YR 2GGZA 3IQQA 2AMIA 1BLQA 1A29A 1KCYA 1OSAA 2JXLA 1E8AA 2M0RA 4HRHA 1RFJA 1KFUS 2CT9A 2MLFC 2LMTA 1SL8A 2M49B 4PHKA 3SIAA 1AJ5A 1EG3A 1S6CA 2LP2A 1JF0A 5B8IB 1DF0A 2KFGA 1LINA 4C0JA 2M1KB 3OX5A 4P5OE 2LM5A 3PM8A 1NX3A 5CSJA 1IH0A 4M2QA 5JOLA 5F6TA 5GQQC 4WRIA 1UP5A 3RLZA 2FCEA 3DVKA 3NSOA 2Q4UA 1BR1B 1DF0B 1EL4A 1CFDA 1GGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  5KSZ A;  2BL0 B;  1B9A A;  2JTZ A;  3TDU A;  4TNC A;  1WLM A;  1MXE A;  1B4C A;  2ZN9 A;  1TIZ A;  1CTR A;  2PRU A;  1SR6 C;  1JFK A;  2L4I A;  1EG4 A;  1QIW A;  1YRT B;  2BCX A;  2KYC A;  1QVI Z;  3OHM B;  2NLN A;  4PE4 A;  1MQ1 A;  1MHO A;  5JJG A;  1IKU A;  1F55 A;  2ZND A;  3EVR A;  2LP3 A;  2LHL A;  1VRK A;  1YUS A;  2JT0 A;  1F8H A;  3PSR A;  3OP0 A;  3PN7 C;  2MA2 A;  2ZFD A;  1S6I A;  2G2B A;  1OZO A;  3AAJ A;  3RM1 A;  1BOC A;  1ZOT B;  2KFH A;  1XFZ O;  1S5G Z;  3VRQ A;  4YI9 A;  1RK9 A;  3CTN A;  4GBA A;  3BUX B;  1JSA A;  2IS9 A;  2KI4 B;  1CDL A;  1H8B A;  1GQM A;  1J7R A;  2BEC A;  1U5I A;  3O78 A;  1XFW O;  3LL8 B;  1KSM A;  1NCY A;  3EKJ A;  4UPG A;  3PAT A;  3SG4 A;  4NQG A;  2K0J A;  3EVV A;  1Y1X A;  1ZMZ A;  2HPS A;  1ZAC A;  1N2D A;  1UHH A;  3TDZ A;  1F4Q A;  2AUC A;  1JFJ A;  1KK8 B;  3NSL A;  2VRG A;  3I5F B;  1DJG A;  1KFX S;  4GUK A;  1KQV A;  2L2E A;  1YUT A;  1PSB A;  2EC6 B;  1M46 A;  2DOQ A;  2O5G A;  2OTG C;  1ODB A;  1PK0 D;  1SYM A;  1UUR A;  4MLW A;  5I2L A;  1LKJ A;  1CDM A;  1SW8 A;  3I5I C;  4GPL B;  1YX7 A;  2K61 A;  2HQW A;  2KDH A;  4MN0 A;  1QX5 B;  3KHE A;  2LE9 B;  1SL7 A;  1CMF A;  2KBI A;  2MAZ A;  3GK4 X;  5CSF A;  4PDZ A;  2KNE A;  5J3X A;  1UUS A;  3D10 A;  1B7T Y;  1LXF C;  1OMV A;  2LC5 A;  1J1D A;  1YR5 A;  3WHT B;  5ER4 X;  1HQV A;  1MXL C;  3QRX A;  2F2P A;  2LUX A;  4OCI A;  1QTX A;  4YRU A;  1EH2 A;  4ORC B;  3HCM A;  3DF0 A;  3BOW A;  4AQI A;  3PAL A;  1SR6 B;  1SBJ A;  2BKI B;  4PE1 A;  3OX6 A;  1HT9 A;  1K94 A;  1SCV A;  4OR9 B;  1KSO A;  1B8C A;  4M2P A;  3NXA A;  3DF0 B;  3JVT C;  3BOW B;  4USL A;  1LA0 A;  3PN7 B;  1XK4 C;  3JTD C;  2CTN A;  1IG5 A;  1NX0 A;  3KPX A;  1K9P A;  1QIV A;  4GGF C;  3OB2 B;  2QAC A;  1UHI A;  1FF1 A;  1M63 B;  2I94 A;  4PHM A;  2ZRS A;  2D8N A;  2KGR A;  1TTX A;  1V1F A;  5AXI A;  1QAS A;  3SG7 A;  3BUO B;  1C7V A;  1XFV O;  1XA5 A;  1PVB A;  1S36 A;  1Y1U A;  1LA3 A;  4JQ0 D;  4ORA B;  2KSP A;  2ZN8 A;  2JTT A;  3CLN A;  2L5X B;  4ICB A;  1F71 A;  2KBM A;  2CNP A;  1QAT A;  1TCF A;  1IQ3 A;  1W7J B;  4P2Y B;  4MZL A;  1PRW A;  1CM4 A;  1K96 A;  4PE7 A;  2A4J A;  3BUW B;  1C07 A;  1YVL A;  4E68 A;  1DMO A;  5K89 A;  1BU3 A;  3FS7 A;  3MSE B;  2M97 A;  1KQM C;  2GGM A;  5TNC A;  1MF8 B;  4FQO A;  1CFP A;  4F0Z B;  2OTG B;  1MUX A;  2MLE C;  2JOJ A;  2LVI A;  2WND A;  3I5I B;  1Q80 A;  1J7O A;  3E3R A;  1QXP A;  1A75 B;  1PAL A;  1AJ4 A;  3VRN A;  3I5H C;  3KF9 A;  1NPQ A;  2BE6 A;  4GFT A;  3K21 A;  2BKH B;  1M45 A;  4YGB B;  1WRL A;  1TN4 A;  2F2O A;  3KEV A;  3A8R A;  2KAY A;  2V53 A;  4MRX A;  1TOP A;  4XJK B;  5AAN A;  1OMD A;  3VRR A;  5DKQ A;  2E6W A;  3TUY C;  2JU0 A;  1BF5 A;  2KHN A;  2LAP A;  1N0Y A;  1GJY A;  3IF7 A;  2WCF A;  1KK7 Z;  4A4C A;  1G33 A;  1AK8 A;  4YBH B;  2E30 A;  2LLS A;  1SCM C;  1F4O A;  1FI5 A;  3SJS A;  1G8I A;  4PHN A;  2BCA A;  1NUB A;  1TNW A;  3O6B A;  2KAV A;  1S1E A;  1J7P A;  5AEQ A;  2M9G A;  1PUL A;  2B1U A;  5KTY A;  2MRD A;  1JBA A;  2Y1N A;  1V1G A;  1AVS A;  4MZJ A;  3NSI A;  3SG2 A;  2K7B A;  4GGF A;  4GGN A;  1YUR A;  5HKY A;  3JVT B;  5AFP A;  1CKK A;  5CPV A;  1CLB A;  1IRJ A;  2M29 A;  3JTD B;  5ER5 A;  2H61 A;  2M7N A;  2NCO A;  2L50 A;  3HX4 A;  3M0W A;  1OMR A;  3EK7 A;  3O4Y A;  1YRU B;  3D0Y B;  1X02 A;  3VGO A;  4PHJ A;  3AAK A;  1DJI A;  1QS7 A;  5BPJ A;  4HRG A;  2K7O A;  4CPV A;  1WRK A;  4MBE A;  4DRW A;  3TS5 C;  2KFF A;  1B8L A;  4L9M A;  4M2O A;  4OVN F;  5HKZ A;  2I7A A;  4QJ5 B;  1Y1A A;  2JT3 A;  3TZ1 A;  1NCX A;  1LVC D;  1K2H A;  1A03 A;  2LUC A;  1EXR A;  2JWW A;  1BOD A;  2LVK A;  1AUI B;  1QX7 A;  3PFV A;  1R6P A;  1A2X A;  1NIW A;  1KQM B;  2FCD A;  2KAX A;  3I5G C;  1H4B A;  1XFU O;  4MZK A;  1KWO C;  4PAL A;  4MRY A;  1B1G A;  1EJ3 A;  4D1E A;  2Y1M A;  3F45 A;  1JF2 A;  1DT7 B;  2WCB A;  1GGW A;  1RWY A;  1OZS A;  4U8D A;  2M8U A;  1YVH A;  2JQ6 A;  4BY5 A;  3WXA A;  2LCP A;  1IWQ A;  2BCB A;  4MVF A;  3ZWH A;  3I5H B;  5CSN A;  1SY9 A;  2LHI A;  4I5K A;  5KU1 A;  5PAL A;  4HSZ A;  4QJ3 B;  1CFC A;  1DVI A;  4ORB B;  2PAL A;  1IJ6 A;  4N5X A;  2JNF A;  2LVJ A;  1BJF A;  1XO5 A;  4YI8 A;  1NSH A;  2K7C A;  2WC8 A;  1N65 A;  2ISD A;  2LLT A;  2LNK A;  3TUY B;  1XFY O;  4HRE E;  3O2P A;  4YGE B;  2KQ6 A;  1UHN A;  1ZFS A;  1ALW A;  2KGB C;  1A4P A;  1S3P A;  1SCM B;  1JC2 A;  3GK1 A;  5D7F A;  2Y4Q A;  1W7I B;  3TDI A;  4NDB A;  1DTL A;  4N1G A;  5I2O A;  3GOF A;  2MJW B;  1QVI Y;  1CB1 A;  4DUQ A;  2M3W A;  1IQ5 A;  2HET A;  1JWD A;  3BQ3 A;  1C7W A;  3SG5 A;  3CR4 X;  3CS1 A;  4YGC B;  2JPT A;  2OS8 C;  2F3Y A;  3VRO A;  1QV1 A;  2L0P A;  2L98 A;  1M31 A;  4I5L B;  1R2U A;  2KQY A;  1S5G Y;  2KI6 C;  3AKA A;  4ZCU A;  2LMV A;  3NSK A;  4ETO A;  4WQ3 A;  5DKR A;  4YGD B;  2SAS A;  1A75 A;  1J55 A;  2M7L A;  1IGV A;  1PSR A;  2PSR A;  2I2R E;  2NXQ A;  1UHJ A;  2JZI A;  3ICB A;  5HLV A;  1DJY A;  1DJW A;  1B7T Z;  3H4S E;  1BG1 A;  1NWD A;  5HKW A;  3TS5 B;  2F33 A;  3A4U B;  2WCE A;  3AKB A;  4XJK A;  1XVJ A;  1DGU A;  2LVV A;  1WRZ A;  4XYN A;  1K95 A;  3DVJ A;  1UHK A;  1DGV A;  1QLS A;  4GNK B;  2LLU A;  1BT6 A;  3C1V A;  3I5G B;  1TRF A;  3IQO A;  1SK6 D;  3CZT X;  5G08 A;  1KWO B;  1DJX A;  2M1U A;  2NZ0 A;  4I5N B;  1SRA A;  1WLZ A;  1NX1 A;  2CXJ A;  1CM1 A;  3WHU B;  2NCP A;  5AER A;  4Q04 A;  2BBM A;  2LAN A;  3SG3 A;  1QLK A;  5HLO A;  1BR4 B;  2SCP A;  1WDC C;  3GK2 A;  5IBW A;  2JXC A;  2K2F A;  3LK1 A;  1CNP A;  1SMG A;  4OV2 A;  1XK4 A;  2PAS A;  2PVB A;  1DJZ A;  3PLF B;  2L4H A;  2K7D A;  1L7Z A;  2FJU B;  1L2O C;  1AHR A;  4PE0 A;  3SG6 A;  1CMG A;  2AAO A;  1YTZ C;  2F8P A;  2K8M B;  1YX8 A;  1DJH A;  3D0Y A;  1BMO A;  1ALV A;  2F3Z A;  3FIA A;  1RJV A;  2ZRT A;  4ZCV A;  1FI6 A;  4BY4 A;  5CSI A;  3BUM B;  4AOM A;  2KYF A;  1Y0V H;  1TNP A;  1REC A;  4N1F A;  1MR8 A;  4DIR A;  3OB1 B;  3KO0 A;  1K9U A;  2CBL A;  2L51 A;  5FYX A;  5I2Q A;  4DCK A;  1F70 A;  1PVA A;  3CR5 X;  2JC2 A;  2RGI A;  4FTG A;  4CFQ A;  2PMY A;  1NYA A;  3LCP C;  3CWG A;  4CFR A;  4GAO A;  1OOJ A;  1S6J A;  3DVM A;  3EVU A;  2G9B A;  4CID A;  1IJ5 A;  4JPZ B;  2OS8 B;  1J1E A;  1M39 A;  1B8R A;  3CR2 A;  4AQJ A;  3LLE A;  4MSP A;  1FBV A;  1CLM A;  1CDN A;  5DKN A;  1U5I B;  1NX2 A;  1QJT A;  3FWB A;  1CDP A;  3VRP A;  3BYA A;  3EK4 A;  2FOT A;  1UWO A;  1NP8 A;  1SPY A;  2P6B B;  3DVE A;  5I8N A;  2KI6 D;  2MHH A;  4QJ4 B;  4PCW A;  3ZNI A;  1WY9 A;  2QPT A;  1ZUZ A;  4OKH A;  1QV0 A;  1XYD A;  3DD4 A;  2I18 A;  2HQ8 A;  2BL0 C;  4IL1 A;  2JT8 A;  2K2A A;  1F54 A;  3BUN B;  2EGD A;  1JUO A;  5D69 A;  2GV5 A;  2BBN A;  1FPW A;  1OQP A;  1J7Q A;  4JWQ A;  1SKT A;  4NDD A;  1TCO B;  4R1E A;  1KFU L;  3CGA A;  1S26 D;  1XFX O;  2HF5 A;  1TNQ A;  1QX2 A;  1RTP 1;  1OE9 B;  2ZKM X;  2MBX A;  2Y5I A;  1WDC B;  4CLN A;  1CFF A;  2KOT A;  2LV7 A;  2O60 A;  4WQ2 A;  1K9K A;  1K90 D;  4YGA A;  3EKH A;  3FWC A;  1MWN A;  3EK8 A;  4A4B A;  2KI4 C;  2R2I A;  2WOS A;  5HYD A;  1L2O B;  4C0L A;  2JUL A;  2BE4 A;  2COL B;  3SIB A;  1B47 A;  1K8U A;  2CCM A;  1Y6W A;  2JNX A;  2OPO A;  1KK7 Y;  1SNL A;  4DS7 A;  2JRF A;  2Q91 A;  1NCZ A;  3WNX B;  2WOR A;  1AP4 A;  2H2K A;  1YUU A;  1KK8 C;  4MEW A;  3I5F C;  3LK0 A;  1SL9 A;  1K93 D;  3BXK A;  1FW4 A;  2TN4 A;  4NDC A;  1D1O A;  2LMU A;  2EC6 C;  2EHB A;  2ZNE A;  1CLL A;  4I5J A;  4C0K A;  1TNX A;  2H61 C;  1RRO A;  1G4Y R;  2GGZ A;  3IQQ A;  2AMI A;  1BLQ A;  1A29 A;  1KCY A;  1OSA A;  2JXL A;  1E8A A;  2M0R A;  4HRH A;  1RFJ A;  1KFU S;  2CT9 A;  2MLF C;  2LMT A;  1SL8 A;  2M49 B;  4PHK A;  3SIA A;  1AJ5 A;  1EG3 A;  1S6C A;  2LP2 A;  1JF0 A;  5B8I B;  1DF0 A;  2KFG A;  1LIN A;  4C0J A;  2M1K B;  3OX5 A;  4P5O E;  2LM5 A;  3PM8 A;  1NX3 A;  5CSJ A;  1IH0 A;  4M2Q A;  5JOL A;  5F6T A;  5GQQ C;  4WRI A;  1UP5 A;  3RLZ A;  2FCE A;  3DVK A;  3NSO A;  2Q4U A;  1BR1 B;  1DF0 B;  1EL4 A;  1CFD A;  1GGZ A; 
#chains in the Genus database with same CATH topology
 1KFX L;  5KSZ A;  2BL0 B;  1B9A A;  2JTZ A;  3TDU A;  2KLE A;  4TNC A;  1WLM A;  1MXE A;  2L2C A;  1B4C A;  2ZN9 A;  1TIZ A;  1CTR A;  2PRU A;  1SR6 C;  1JFK A;  2L4I A;  1EG4 A;  1QIW A;  1YRT B;  2BCX A;  2KYC A;  1QVI Z;  3OHM B;  3N7H A;  2NLN A;  4PE4 A;  1MQ1 A;  1MHO A;  5JJG A;  1IKU A;  1F55 A;  2ZND A;  3EVR A;  2LP3 A;  2LHL A;  3BFA A;  3CDN A;  1VRK A;  1YUS A;  2JT0 A;  1F8H A;  3PSR A;  3OP0 A;  3PN7 C;  3S0A A;  1P28 A;  2MA2 A;  2ZFD A;  1S6I A;  2G2B A;  1OZO A;  3AAJ A;  3RM1 A;  1BOC A;  1ZOT B;  2KFH A;  1XFZ O;  1S5G Z;  3D75 A;  3VRQ A;  4YI9 A;  1RK9 A;  3CTN A;  4GBA A;  3BUX B;  1JSA A;  3FE9 A;  2IS9 A;  2WCJ A;  3CZ1 A;  2KI4 B;  1CDL A;  4IJ7 A;  1GQM A;  1J7R A;  2BEC A;  1OOI X;  3EG5 B;  1H8B A;  1U5I A;  3O78 A;  1XFW O;  3LL8 B;  1KSM A;  1NCY A;  3EKJ A;  4UPG A;  3PAT A;  3SG4 A;  4NQG A;  2K0J A;  3EVV A;  1Y1X A;  1ZMZ A;  2HPS A;  1ZAC A;  1N2D A;  1UHH A;  3TDZ A;  1F4Q A;  2AUC A;  1JFJ A;  1KK8 B;  3NSL A;  2VRG A;  3I5F B;  1DJG A;  1KFX S;  4GUK A;  3SS4 A;  5HL1 A;  1KQV A;  2L2E A;  1YUT A;  1PSB A;  2EC6 B;  1M46 A;  2DOQ A;  2O5G A;  2OTG C;  1ODB A;  1PK0 D;  1SYM A;  1UUR A;  4MLW A;  5I2L A;  1LKJ A;  1CDM A;  1SW8 A;  3I5I C;  4GPL B;  1YX7 A;  2WCK A;  2K61 A;  2HQW A;  2KDH A;  4MN0 A;  1QX5 B;  3L47 A;  3KHE A;  3Q8I A;  2LE9 B;  1SL7 A;  1CMF A;  2KBI A;  2MAZ A;  3S0B A;  2QEB A;  3GK4 X;  5CSF A;  4PDZ A;  2KNE A;  5J3X A;  2QEO A;  1LS8 A;  1UUS A;  3D10 A;  3IVT A;  3FE6 A;  1B7T Y;  1LXF C;  1OMV A;  2LC5 A;  1J1D A;  1YR5 A;  3WHT B;  5ER4 X;  1HQV A;  1MXL C;  3QME A;  2F2P A;  2LUX A;  1ORG A;  1QTX A;  3CAB A;  3QRX A;  4OCI A;  4YRU A;  1EH2 A;  4ORC B;  2WCM A;  3HCM A;  3DF0 A;  3BOW A;  4AQI A;  3VB1 A;  3PAL A;  1SR6 B;  1SBJ A;  1IIO A;  2BKI B;  4PE1 A;  3OX6 A;  1GM0 A;  1HT9 A;  1K94 A;  1SCV A;  3R72 A;  1KSO A;  4OR9 B;  1B8C A;  4M2P A;  3NXA A;  3DF0 B;  3JVT C;  1Z4H A;  3BOW B;  2PYQ A;  4USL A;  1DC1 A;  1LA0 A;  3PN7 B;  1XK4 C;  1W9Z A;  3JTD C;  2CTN A;  1IG5 A;  1NX0 A;  3KPX A;  1K9P A;  1QIV A;  4GGF C;  3OB2 B;  2QAC A;  1UHI A;  1FF1 A;  1M63 B;  2I94 A;  4PHM A;  2ZRS A;  2D8N A;  3D78 A;  2KGR A;  1TTX A;  1V1F A;  5AXI A;  1QAS A;  3SG7 A;  3BUO B;  1C7V A;  1XFV O;  1XA5 A;  1PVB A;  1S36 A;  1Y1U A;  1LA3 A;  4JQ0 D;  4ORA B;  2KSP A;  2ZN8 A;  2JTT A;  3CLN A;  2L5X B;  4ICB A;  1F71 A;  2KBM A;  2CNP A;  1QAT A;  1TCF A;  1IQ3 A;  1W7J B;  4P2Y B;  4MZL A;  1PRW A;  1CM4 A;  1K96 A;  4PE7 A;  2A4J A;  3BUW B;  1C07 A;  1YVL A;  4E68 A;  1DMO A;  5K89 A;  1BU3 A;  3FS7 A;  3MSE B;  3V2L A;  4JKT A;  2M97 A;  2YGU A;  1KQM C;  2GGM A;  5TNC A;  1MF8 B;  4FQO A;  4INX A;  1CFP A;  4F0Z B;  2OTG B;  1MUX A;  2MLE C;  2JOJ A;  2LVI A;  2WND A;  3I5I B;  1Q80 A;  1J7O A;  3D77 A;  3E3R A;  1QXP A;  1A75 B;  1PAL A;  1AJ4 A;  3VRN A;  3I5H C;  3KF9 A;  1NPQ A;  2BE6 A;  4GFT A;  3K21 A;  2BKH B;  1M45 A;  4YGB B;  1WRL A;  1TN4 A;  4OZD A;  2F2O A;  3KEV A;  3A8R A;  2KAY A;  2V53 A;  4MRX A;  1TOP A;  4XJK B;  5AAN A;  1OMD A;  3VRR A;  3PJI A;  5DKQ A;  2E6W A;  3TUY C;  2JU0 A;  1BF5 A;  2KHN A;  2LAP A;  1N0Y A;  5DIC A;  1GJY A;  3IF7 A;  2WCF A;  1KK7 Z;  4A4C A;  1G33 A;  1AK8 A;  4YBH B;  2E30 A;  1OOF A;  1SCM C;  1F4O A;  2LLS A;  5FI6 A;  1OOH A;  1FI5 A;  3SJS A;  3L4A A;  1G8I A;  4PHN A;  2BCA A;  3NHT A;  1NUB A;  1TNW A;  3O6B A;  1CFC A;  1DQE A;  2KAV A;  1S1E A;  1J7P A;  5AEQ A;  2M9G A;  1PUL A;  2B1U A;  5KTY A;  2MRD A;  1JBA A;  2Y1N A;  1V1G A;  1AVS A;  4MZJ A;  3NSI A;  3SG2 A;  2K7B A;  4GGF A;  4GGN A;  1YUR A;  5HKY A;  3BFH A;  3JVT B;  5AFP A;  1CKK A;  5CPV A;  1CLB A;  1IRJ A;  2M29 A;  3JTD B;  5ER5 A;  2H61 A;  2M7N A;  2JPO A;  2NCO A;  2L50 A;  3HX4 A;  3M0W A;  1OMR A;  3EK7 A;  3O4Y A;  1YRU B;  3D0Y B;  1X02 A;  3VGO A;  4PHJ A;  3AAK A;  1DJI A;  3D74 A;  5FI7 A;  1QS7 A;  3SS3 A;  4HRG A;  5BPJ A;  2K7O A;  4CPV A;  1WRK A;  4MBE A;  4DRW A;  3TS5 C;  2KFF A;  1B8L A;  3B87 A;  4L9M A;  4M2O A;  4OVN F;  5HKZ A;  2I7A A;  4QJ5 B;  1Y1A A;  2JT3 A;  3TZ1 A;  1NCX A;  1LVC D;  1K2H A;  1A03 A;  2LUC A;  1EXR A;  2JWW A;  1BOD A;  2LVK A;  1AUI B;  1QX7 A;  3PFV A;  1R6P A;  1A2X A;  1NIW A;  1KQM B;  2FCD A;  2KAX A;  3I5G C;  1H4B A;  1XFU O;  4MZK A;  3OGN A;  1KWO C;  4PAL A;  4MRY A;  1B1G A;  1EJ3 A;  4D1E A;  2Y1M A;  3F45 A;  1JF2 A;  1DT7 B;  4JD9 A;  2WCB A;  1GGW A;  1RWY A;  1OZS A;  4U8D A;  2M8U A;  3S0G A;  1YVH A;  2JQ6 A;  4BY5 A;  3WXA A;  2LCP A;  1IWQ A;  2BCB A;  3D73 A;  4MVF A;  3ZWH A;  3I5H B;  5CSN A;  1SY9 A;  2LHI A;  4I5K A;  5KU1 A;  5PAL A;  4HSZ A;  1Z2C B;  3DXL A;  1DVI A;  4ORB B;  4QJ3 B;  2PAL A;  3CZ0 A;  1IJ6 A;  3NHI A;  4N5X A;  2H8V A;  2JNF A;  2LVJ A;  4FQT A;  1BJF A;  1XO5 A;  1DEK A;  4YI8 A;  1NSH A;  2K7C A;  2WC8 A;  1N65 A;  2ISD A;  2LLT A;  2LNK A;  3TUY B;  1XFY O;  2WC5 A;  4HRE E;  3O2P A;  4YGE B;  2KQ6 A;  1UHN A;  1ZFS A;  1ALW A;  2KGB C;  1A4P A;  1S3P A;  1SCM B;  1JC2 A;  3GK1 A;  2WCH A;  5D7F A;  4F7F A;  2Y4Q A;  1W7I B;  1TUJ A;  3TDI A;  4NDB A;  1DTL A;  4N1G A;  5I2O A;  3GOF A;  3CZ2 A;  2MJW B;  3L4L A;  1QVI Y;  1CB1 A;  4DUQ A;  2M3W A;  1IQ5 A;  2HET A;  1JWD A;  3BQ3 A;  4KYN A;  1C7W A;  3SG5 A;  3CR4 X;  3CS1 A;  3S0D A;  4YGC B;  5I94 A;  3RZS A;  2JPT A;  2OS8 C;  2F3Y A;  3VRO A;  1QV1 A;  2L0P A;  2L98 A;  1M31 A;  3BJH A;  4I5L B;  1R2U A;  2P71 A;  5EL2 A;  2KQY A;  1S5G Y;  2KI6 C;  3AKA A;  4ZCU A;  2FJY A;  2LMV A;  3NSK A;  4ETO A;  4WQ3 A;  2KLD A;  5DKR A;  4YGD B;  2SAS A;  1A75 A;  1J55 A;  2M7L A;  1IGV A;  1PSR A;  2PSR A;  2I2R E;  2NXQ A;  2K60 A;  1UHJ A;  2JZI A;  3ICB A;  5HLV A;  1DJY A;  1DJW A;  1B7T Z;  1QWV A;  3H4S E;  3K1E A;  1BG1 A;  1NWD A;  3SS5 A;  5HKW A;  3TS5 B;  2F33 A;  3A4U B;  2WCE A;  3AKB A;  3CYZ A;  4XJK A;  1XVJ A;  1DGU A;  2WC6 A;  2KPH A;  2LVV A;  1WRZ A;  4XYN A;  1K95 A;  3DVJ A;  1UHK A;  1DGV A;  1QLS A;  4GNK B;  2LLU A;  1BT6 A;  3C1V A;  3I5G B;  1TRF A;  3IQO A;  1SK6 D;  3CZT X;  5G08 A;  1KWO B;  1DJX A;  2M1U A;  2NZ0 A;  4I5N B;  1SRA A;  1WLZ A;  1NX1 A;  2CXJ A;  1CM1 A;  3WHU B;  2NCP A;  5AER A;  4Q04 A;  1XFR A;  2BBM A;  2LAN A;  3SG3 A;  1QLK A;  5HLO A;  1BR4 B;  2SCP A;  1WDC C;  1C3Z A;  3GK2 A;  5IBW A;  2JXC A;  2K2F A;  3LK1 A;  3R1V A;  1CNP A;  1SMG A;  3FE8 A;  4OV2 A;  1XK4 A;  2PAS A;  2PVB A;  3DZT A;  1DJZ A;  3PLF B;  2L4H A;  2K7D A;  1L7Z A;  2FJU B;  1L2O C;  1AHR A;  4PE0 A;  3SG6 A;  1CMG A;  2AAO A;  2P70 A;  2BNX A;  1YTZ C;  3DYE A;  2F8P A;  2K8M B;  1YX8 A;  1DJH A;  3D0Y A;  1BMO A;  1ALV A;  2F3Z A;  3FIA A;  1RJV A;  2ZRT A;  4ZCV A;  1FI6 A;  4BY4 A;  5CSI A;  3BUM B;  4AOM A;  2KYF A;  1Y0V H;  1TNP A;  1REC A;  4N1F A;  1MR8 A;  2GTE A;  4DIR A;  3OB1 B;  3KO0 A;  1K9U A;  2CBL A;  3UO9 A;  2L51 A;  5FYX A;  5I2Q A;  4DCK A;  1F70 A;  1PVA A;  3CR5 X;  2JC2 A;  2RGI A;  4FTG A;  4CFQ A;  2PMY A;  1NYA A;  3LCP C;  3CWG A;  4CFR A;  4GAO A;  3B7A A;  1OOJ A;  1S6J A;  3DVM A;  3EVU A;  2G9B A;  3B88 A;  1IJ5 A;  4JPZ B;  2OS8 B;  4CID A;  3UNW A;  5FI2 A;  1J1E A;  1M39 A;  2QEV A;  3R1P A;  1B8R A;  3CR2 A;  4AQJ A;  1TUZ A;  3LLE A;  4MSP A;  1FBV A;  1CLM A;  1CDN A;  5DKN A;  1U5I B;  1NX2 A;  1QJT A;  3FWB A;  1CDP A;  2PQL A;  3VRP A;  2BAP A;  1TWO A;  3BYA A;  2FOT A;  1UWO A;  1NP8 A;  1SPY A;  2P6B B;  3DVE A;  3EK4 A;  2KI6 D;  5I8N A;  2MHH A;  4QJ4 B;  4PCW A;  3ZNI A;  1SSE B;  1WY9 A;  2QPT A;  1ZUZ A;  3S0F A;  4OKH A;  1QV0 A;  1XYD A;  3DD4 A;  2I18 A;  2HQ8 A;  2BL0 C;  4IL1 A;  4PT1 A;  2JT8 A;  2K2A A;  1F54 A;  3BUN B;  2EGD A;  3D76 A;  1DEL A;  1JUO A;  5D69 A;  2GV5 A;  2BBN A;  1FPW A;  1OQP A;  1J7Q A;  4JWQ A;  2QDI A;  1SKT A;  4NDD A;  1TCO B;  4R1E A;  1KFU L;  3CGA A;  3PM2 A;  1S26 D;  1XFX O;  2HF5 A;  3BFB A;  1TNQ A;  1QX2 A;  1RTP 1;  1OE9 B;  2ZKM X;  2MBX A;  2Y5I A;  1WDC B;  4CLN A;  1CFF A;  2KOT A;  2LV7 A;  2O60 A;  4WQ2 A;  1K9K A;  1K90 D;  4YGA A;  3EKH A;  3FWC A;  1MWN A;  3EK8 A;  4A4B A;  3NGV A;  3OBV A;  2KI4 C;  5D3O A;  2R2I A;  2WOS A;  5HYD A;  1L2O B;  4C0L A;  2JUL A;  2BE4 A;  2COL B;  3SIB A;  1B47 A;  1K8U A;  2CCM A;  1Y6W A;  2JNX A;  2OPO A;  1KK7 Y;  1SNL A;  4DS7 A;  2JRF A;  2Q91 A;  1NCZ A;  3WNX B;  2WOR A;  1AP4 A;  1OOG A;  2H2K A;  1YUU A;  1KK8 C;  4MEW A;  3I5F C;  3LK0 A;  1SL9 A;  1K93 D;  4INW A;  3BXK A;  1FW4 A;  2TN4 A;  4NDC A;  1D1O A;  2LMU A;  2EC6 C;  2EHB A;  2ZNE A;  1CLL A;  4I5J A;  4C0K A;  1TNX A;  2H61 C;  1RRO A;  1G4Y R;  2GGZ A;  3IQQ A;  2AMI A;  3S0E A;  1A29 A;  1BLQ A;  1OSA A;  2JXL A;  1KCY A;  1E8A A;  3B86 A;  3O4X A;  2M0R A;  4HRH A;  1RFJ A;  1KFU S;  2CT9 A;  2MLF C;  2ERB A;  2LMT A;  1SL8 A;  2M49 B;  3DY9 A;  4PHK A;  3SIA A;  1AJ5 A;  3B6X A;  1EG3 A;  1S6C A;  2LP2 A;  1JF0 A;  5B8I B;  1DF0 A;  2KFG A;  1T14 A;  1LIN A;  1OW4 A;  2M1K B;  3OX5 A;  4C0J A;  4P5O E;  2WCL A;  2LM5 A;  3PM8 A;  1NX3 A;  5CSJ A;  1IH0 A;  4M2Q A;  5JOL A;  5F6T A;  2L5Y A;  4WRI A;  1UP5 A;  5GQQ C;  3RLZ A;  2FCE A;  3DVK A;  2QEH A;  3R1O A;  3NSO A;  2Q4U A;  1BR1 B;  1DF0 B;  1EL4 A;  1C3Y A;  1CFD A;  1GGZ A; 
#chains in the Genus database with same CATH homology
 1KFX L;  5KSZ A;  2BL0 B;  1B9A A;  2JTZ A;  3TDU A;  4TNC A;  1WLM A;  1MXE A;  1B4C A;  2ZN9 A;  1TIZ A;  1CTR A;  2PRU A;  1SR6 C;  1JFK A;  2L4I A;  1EG4 A;  1QIW A;  1YRT B;  2BCX A;  2KYC A;  1QVI Z;  3OHM B;  2NLN A;  4PE4 A;  1MQ1 A;  1MHO A;  5JJG A;  1IKU A;  1F55 A;  2ZND A;  3EVR A;  2LP3 A;  2LHL A;  1VRK A;  1YUS A;  2JT0 A;  1F8H A;  3PSR A;  3OP0 A;  3PN7 C;  2MA2 A;  2ZFD A;  1S6I A;  2G2B A;  1OZO A;  3AAJ A;  3RM1 A;  1BOC A;  1ZOT B;  2KFH A;  1XFZ O;  1S5G Z;  3VRQ A;  4YI9 A;  1RK9 A;  3CTN A;  4GBA A;  3BUX B;  1JSA A;  2IS9 A;  2KI4 B;  1CDL A;  1H8B A;  1GQM A;  1J7R A;  2BEC A;  1U5I A;  3O78 A;  1XFW O;  3LL8 B;  1KSM A;  1NCY A;  3EKJ A;  4UPG A;  3PAT A;  3SG4 A;  4NQG A;  2K0J A;  3EVV A;  1Y1X A;  1ZMZ A;  2HPS A;  1ZAC A;  1N2D A;  1UHH A;  3TDZ A;  1F4Q A;  2AUC A;  1JFJ A;  1KK8 B;  3NSL A;  2VRG A;  3I5F B;  1DJG A;  1KFX S;  4GUK A;  1KQV A;  2L2E A;  1YUT A;  1PSB A;  2EC6 B;  1M46 A;  2DOQ A;  2O5G A;  2OTG C;  1ODB A;  1PK0 D;  1SYM A;  1UUR A;  4MLW A;  5I2L A;  1LKJ A;  1CDM A;  1SW8 A;  3I5I C;  4GPL B;  1YX7 A;  2K61 A;  2HQW A;  2KDH A;  4MN0 A;  1QX5 B;  3KHE A;  2LE9 B;  1SL7 A;  1CMF A;  2KBI A;  2MAZ A;  3GK4 X;  5CSF A;  4PDZ A;  2KNE A;  5J3X A;  1UUS A;  3D10 A;  1B7T Y;  1LXF C;  1OMV A;  2LC5 A;  1J1D A;  1YR5 A;  3WHT B;  5ER4 X;  1HQV A;  1MXL C;  3QRX A;  2F2P A;  2LUX A;  4OCI A;  1QTX A;  4YRU A;  1EH2 A;  4ORC B;  3HCM A;  3DF0 A;  3BOW A;  4AQI A;  3PAL A;  1SR6 B;  1SBJ A;  2BKI B;  4PE1 A;  3OX6 A;  1HT9 A;  1K94 A;  1SCV A;  4OR9 B;  1KSO A;  1B8C A;  4M2P A;  3NXA A;  3DF0 B;  3JVT C;  3BOW B;  4USL A;  1LA0 A;  3PN7 B;  1XK4 C;  3JTD C;  2CTN A;  1IG5 A;  1NX0 A;  3KPX A;  1K9P A;  1QIV A;  4GGF C;  3OB2 B;  2QAC A;  1UHI A;  1FF1 A;  1M63 B;  2I94 A;  4PHM A;  2ZRS A;  2D8N A;  2KGR A;  1TTX A;  1V1F A;  5AXI A;  1QAS A;  3SG7 A;  3BUO B;  1C7V A;  1XFV O;  1XA5 A;  1PVB A;  1S36 A;  1Y1U A;  1LA3 A;  4JQ0 D;  4ORA B;  2KSP A;  2ZN8 A;  2JTT A;  3CLN A;  2L5X B;  4ICB A;  1F71 A;  2KBM A;  2CNP A;  1QAT A;  1TCF A;  1IQ3 A;  1W7J B;  4P2Y B;  4MZL A;  1PRW A;  1CM4 A;  1K96 A;  4PE7 A;  2A4J A;  3BUW B;  1C07 A;  1YVL A;  4E68 A;  1DMO A;  5K89 A;  1BU3 A;  3FS7 A;  3MSE B;  2M97 A;  1KQM C;  2GGM A;  5TNC A;  1MF8 B;  4FQO A;  1CFP A;  4F0Z B;  2OTG B;  1MUX A;  2MLE C;  2JOJ A;  2LVI A;  2WND A;  3I5I B;  1Q80 A;  1J7O A;  3E3R A;  1QXP A;  1A75 B;  1PAL A;  1AJ4 A;  3VRN A;  3I5H C;  3KF9 A;  1NPQ A;  2BE6 A;  4GFT A;  3K21 A;  2BKH B;  1M45 A;  4YGB B;  1WRL A;  1TN4 A;  2F2O A;  3KEV A;  3A8R A;  2KAY A;  2V53 A;  4MRX A;  1TOP A;  4XJK B;  5AAN A;  1OMD A;  3VRR A;  5DKQ A;  2E6W A;  3TUY C;  2JU0 A;  1BF5 A;  2KHN A;  2LAP A;  1N0Y A;  1GJY A;  3IF7 A;  2WCF A;  1KK7 Z;  4A4C A;  1G33 A;  1AK8 A;  4YBH B;  2E30 A;  2LLS A;  1SCM C;  1F4O A;  1FI5 A;  3SJS A;  1G8I A;  4PHN A;  2BCA A;  1NUB A;  1TNW A;  3O6B A;  2KAV A;  1S1E A;  1J7P A;  5AEQ A;  2M9G A;  1PUL A;  2B1U A;  5KTY A;  2MRD A;  1JBA A;  2Y1N A;  1V1G A;  1AVS A;  4MZJ A;  3NSI A;  3SG2 A;  2K7B A;  4GGF A;  4GGN A;  1YUR A;  5HKY A;  3JVT B;  5AFP A;  1CKK A;  5CPV A;  1CLB A;  1IRJ A;  2M29 A;  3JTD B;  5ER5 A;  2H61 A;  2M7N A;  2NCO A;  2L50 A;  3HX4 A;  3M0W A;  1OMR A;  3EK7 A;  3O4Y A;  1YRU B;  3D0Y B;  1X02 A;  3VGO A;  4PHJ A;  3AAK A;  1DJI A;  1QS7 A;  5BPJ A;  4HRG A;  2K7O A;  4CPV A;  1WRK A;  4MBE A;  4DRW A;  3TS5 C;  2KFF A;  1B8L A;  4L9M A;  4M2O A;  4OVN F;  5HKZ A;  2I7A A;  4QJ5 B;  1Y1A A;  2JT3 A;  3TZ1 A;  1NCX A;  1LVC D;  1K2H A;  1A03 A;  2LUC A;  1EXR A;  2JWW A;  1BOD A;  2LVK A;  1AUI B;  1QX7 A;  3PFV A;  1R6P A;  1A2X A;  1NIW A;  1KQM B;  2FCD A;  2KAX A;  3I5G C;  1H4B A;  1XFU O;  4MZK A;  1KWO C;  4PAL A;  4MRY A;  1B1G A;  1EJ3 A;  4D1E A;  2Y1M A;  3F45 A;  1JF2 A;  1DT7 B;  2WCB A;  1GGW A;  1RWY A;  1OZS A;  4U8D A;  2M8U A;  1YVH A;  2JQ6 A;  4BY5 A;  3WXA A;  2LCP A;  1IWQ A;  2BCB A;  4MVF A;  3ZWH A;  3I5H B;  5CSN A;  1SY9 A;  2LHI A;  4I5K A;  5KU1 A;  5PAL A;  4HSZ A;  4QJ3 B;  1CFC A;  1DVI A;  4ORB B;  2PAL A;  1IJ6 A;  4N5X A;  2JNF A;  2LVJ A;  1BJF A;  1XO5 A;  4YI8 A;  1NSH A;  2K7C A;  2WC8 A;  1N65 A;  2ISD A;  2LLT A;  2LNK A;  3TUY B;  1XFY O;  4HRE E;  3O2P A;  4YGE B;  2KQ6 A;  1UHN A;  1ZFS A;  1ALW A;  2KGB C;  1A4P A;  1S3P A;  1SCM B;  1JC2 A;  3GK1 A;  5D7F A;  2Y4Q A;  1W7I B;  3TDI A;  4NDB A;  1DTL A;  4N1G A;  5I2O A;  3GOF A;  2MJW B;  1QVI Y;  1CB1 A;  4DUQ A;  2M3W A;  1IQ5 A;  2HET A;  1JWD A;  3BQ3 A;  1C7W A;  3SG5 A;  3CR4 X;  3CS1 A;  4YGC B;  2JPT A;  2OS8 C;  2F3Y A;  3VRO A;  1QV1 A;  2L0P A;  2L98 A;  1M31 A;  4I5L B;  1R2U A;  2KQY A;  1S5G Y;  2KI6 C;  3AKA A;  4ZCU A;  2LMV A;  3NSK A;  4ETO A;  4WQ3 A;  5DKR A;  4YGD B;  2SAS A;  1A75 A;  1J55 A;  2M7L A;  1IGV A;  1PSR A;  2PSR A;  2I2R E;  2NXQ A;  1UHJ A;  2JZI A;  3ICB A;  5HLV A;  1DJY A;  1DJW A;  1B7T Z;  3H4S E;  1BG1 A;  1NWD A;  5HKW A;  3TS5 B;  2F33 A;  3A4U B;  2WCE A;  3AKB A;  4XJK A;  1XVJ A;  1DGU A;  2LVV A;  1WRZ A;  4XYN A;  1K95 A;  3DVJ A;  1UHK A;  1DGV A;  1QLS A;  4GNK B;  2LLU A;  1BT6 A;  3C1V A;  3I5G B;  1TRF A;  3IQO A;  1SK6 D;  3CZT X;  5G08 A;  1KWO B;  1DJX A;  2M1U A;  2NZ0 A;  4I5N B;  1SRA A;  1WLZ A;  1NX1 A;  2CXJ A;  1CM1 A;  3WHU B;  2NCP A;  5AER A;  4Q04 A;  2BBM A;  2LAN A;  3SG3 A;  1QLK A;  5HLO A;  1BR4 B;  2SCP A;  1WDC C;  3GK2 A;  5IBW A;  2JXC A;  2K2F A;  3LK1 A;  1CNP A;  1SMG A;  4OV2 A;  1XK4 A;  2PAS A;  2PVB A;  1DJZ A;  3PLF B;  2L4H A;  2K7D A;  1L7Z A;  2FJU B;  1L2O C;  1AHR A;  4PE0 A;  3SG6 A;  1CMG A;  2AAO A;  1YTZ C;  2F8P A;  2K8M B;  1YX8 A;  1DJH A;  3D0Y A;  1BMO A;  1ALV A;  2F3Z A;  3FIA A;  1RJV A;  2ZRT A;  4ZCV A;  1FI6 A;  4BY4 A;  5CSI A;  3BUM B;  4AOM A;  2KYF A;  1Y0V H;  1TNP A;  1REC A;  4N1F A;  1MR8 A;  4DIR A;  3OB1 B;  3KO0 A;  1K9U A;  2CBL A;  2L51 A;  5FYX A;  5I2Q A;  4DCK A;  1F70 A;  1PVA A;  3CR5 X;  2JC2 A;  2RGI A;  4FTG A;  4CFQ A;  2PMY A;  1NYA A;  3LCP C;  3CWG A;  4CFR A;  4GAO A;  1OOJ A;  1S6J A;  3DVM A;  3EVU A;  2G9B A;  4CID A;  1IJ5 A;  4JPZ B;  2OS8 B;  1J1E A;  1M39 A;  1B8R A;  3CR2 A;  4AQJ A;  3LLE A;  4MSP A;  1FBV A;  1CLM A;  1CDN A;  5DKN A;  1U5I B;  1NX2 A;  1QJT A;  3FWB A;  1CDP A;  3VRP A;  3BYA A;  3EK4 A;  2FOT A;  1UWO A;  1NP8 A;  1SPY A;  2P6B B;  3DVE A;  5I8N A;  2KI6 D;  2MHH A;  4QJ4 B;  4PCW A;  3ZNI A;  1WY9 A;  2QPT A;  1ZUZ A;  4OKH A;  1QV0 A;  1XYD A;  3DD4 A;  2I18 A;  2HQ8 A;  2BL0 C;  4IL1 A;  2JT8 A;  2K2A A;  1F54 A;  3BUN B;  2EGD A;  1JUO A;  5D69 A;  2GV5 A;  2BBN A;  1FPW A;  1OQP A;  1J7Q A;  4JWQ A;  1SKT A;  4NDD A;  1TCO B;  4R1E A;  1KFU L;  3CGA A;  1S26 D;  1XFX O;  2HF5 A;  1TNQ A;  1QX2 A;  1RTP 1;  1OE9 B;  2ZKM X;  2MBX A;  2Y5I A;  1WDC B;  4CLN A;  1CFF A;  2KOT A;  2LV7 A;  2O60 A;  4WQ2 A;  1K9K A;  1K90 D;  4YGA A;  3EKH A;  3FWC A;  1MWN A;  3EK8 A;  4A4B A;  2KI4 C;  2R2I A;  2WOS A;  5HYD A;  1L2O B;  4C0L A;  2JUL A;  2BE4 A;  2COL B;  3SIB A;  1B47 A;  1K8U A;  2CCM A;  1Y6W A;  2JNX A;  2OPO A;  1KK7 Y;  1SNL A;  4DS7 A;  2JRF A;  2Q91 A;  1NCZ A;  3WNX B;  2WOR A;  1AP4 A;  2H2K A;  1YUU A;  1KK8 C;  4MEW A;  3I5F C;  3LK0 A;  1SL9 A;  1K93 D;  3BXK A;  1FW4 A;  2TN4 A;  4NDC A;  1D1O A;  2LMU A;  2EC6 C;  2EHB A;  2ZNE A;  1CLL A;  4I5J A;  4C0K A;  1TNX A;  2H61 C;  1RRO A;  1G4Y R;  2GGZ A;  3IQQ A;  2AMI A;  1BLQ A;  1A29 A;  1KCY A;  1OSA A;  2JXL A;  1E8A A;  2M0R A;  4HRH A;  1RFJ A;  1KFU S;  2CT9 A;  2MLF C;  2LMT A;  1SL8 A;  2M49 B;  4PHK A;  3SIA A;  1AJ5 A;  1EG3 A;  1S6C A;  2LP2 A;  1JF0 A;  5B8I B;  1DF0 A;  2KFG A;  1LIN A;  4C0J A;  2M1K B;  3OX5 A;  4P5O E;  2LM5 A;  3PM8 A;  1NX3 A;  5CSJ A;  1IH0 A;  4M2Q A;  5JOL A;  5F6T A;  5GQQ C;  4WRI A;  1UP5 A;  3RLZ A;  2FCE A;  3DVK A;  3NSO A;  2Q4U A;  1BR1 B;  1DF0 B;  1EL4 A;  1CFD A;  1GGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...