4PT1A

Crystal structure of locusta migratoria odorant binding proteins lmigobp1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
129
structure length
129
Chain Sequence
VNMKLTGRIMDAAKEVDHTCRSSTGVPRDMLHRYAEGQTVDDDDFKCYLKCIMVEFNSLSDDGVFVLEEELENVPPEIKEEGHRVVHSCKHINHDEACETAYQIHQCYKQSDPELYSLVVRAFDATIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein 1d
publication title Crystal structure of the Locusta migratoria odorant binding protein.
pubmed doi rcsb
source organism Locusta migratoria
molecule tags Transport protein
total genus 49
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4pt1A00
3V2LA 3NHTA 2QEOA 3B7AA 3DXLA 4INWA 2JPOA 3S0EA 3FE9A 2WCJA 4JD9A 2PQLA 4FQTA 3R1PA 3B86A 1GM0A 3B6XA 3D77A 3BFHA 3N7HA 2WCKA 3S0GA 3S0AA 1TWOA 2H8VA 3CZ1A 1OOFA 3VB1A 2WC5A 3S0BA 3R1VA 4PT1A 3DY9A 3QMEA 3D75A 3L47A 2QEBA 4OZDA 3B88A 3D76A 3CYZA 2P70A 3PJIA 1T14A 1P28A 3NHIA 3R1OA 2P71A 1OOIX 3OGNA 1LS8A 2WCMA 4F7FA 3FE6A 3NGVA 3K1EA 3DYEA 1XFRA 2ERBA 2KPHA 3CZ2A 3D74A 1QWVA 3FE8A 1OOHA 1TUJA 2QEHA 2GTEA 3BFBA 3Q8IA 2WC6A 3BJHA 3D73A 5DICA 3RZSA 1DQEA 4INXA 1OOGA 2QDIA 3B87A 3D78A 3L4LA 2WCHA 3S0DA 2QEVA 1C3YA 3CABA 1OW4A 2FJYA 1ORGA 3CZ0A 3CDNA 3S0FA 2WCLA 3BFAA 3L4AA 2L2CA 5EL2A 1C3ZA 3DZTA 3R72A
chains in the Genus database with same CATH superfamily
3FWCA 3O78A 3V2LA 1K9PA 1KFUL 2QEOA 4MZLA 3DXLA 2H61C 2B1UA 2JPOA 4INWA 4P2YB 5FI2A 3S0EA 2P6BB 1OE9B 1PVBA 2WCJA 1N2DA 4QJ4B 1NUBA 1K9UA 4NDCA 1TCOB 1JUOA 1NWDA 3B86A 1GM0A 3I5FC 3I5GB 4WQ3A 4WQ2A 1MQ1A 5I2LA 1B7TY 1WLMA 1YUTA 2JULA 2EHBA 4GBAA 5J3XA 3TDZA 1SSEB 3BUNB 3TDUA 2KDHA 2G9BA 5HKYA 1R2UA 3D10A 1JFJA 1QATA 2BE4A 2M1UA 1KWOC 1NP8A 1PK0D 4CPVA 1FI5A 2JT3A 1XFWO 1S5GZ 4QJ3B 1EJ3A 2KAYA 2WC5A 4MN0A 5AEQA 2FOTA 3IQQA 1K93D 3FS7A 2O5GA 1KFXS 1TN4A 1UHNA 2DOQA 4MRXA 3TS5C 3D75A 5FI7A 1IKUA 2ISDA 1ZUZA 1C07A 3VGOA 1WRKA 1QX5B 1ZFSA 2BNXA 2JNFA 1KQMC 1XFZO 1YVHA 2LM5A 1KK7Z 3SG3A 1SCVA 1Z4HA 2KI6D 3CYZA 4YI8A 1Y1AA 2P70A 1DJYA 3OB2B 2K8MB 1OMVA 2JT0A 5BPJA 2LVVA 2CBLA 1RJVA 2P71A 1OOIX 2JOJA 1IJ6A 4ORBB 1DT7B 2JTZA 2WCMA 2Q4UA 2WC8A 1JF2A 4YGEB 4D1EA 3EVRA 2V53A 4BY4A 5TNCA 4F7FA 1FW4A 1AUIB 1B8LA 1DTLA 3I5FB 3NGVA 1KK8C 3KF9A 1OMDA 1FPWA 2JZIA 1OQPA 4A4BA 2LMVA 1XK4C 1PVAA 4ORCB 2WCFA 1LKJA 1QASA 2JXLA 2K7DA 1SYMA 3OX5A 1B1GA 1IWQA 4PHJA 3NSIA 2MLFC 4I5LB 3FE8A 1KWOB 1QV0A 4L9MA 1JF0A 1IH0A 1QX2A 2QEHA 3PM8A 4MSPA 2FCEA 2HETA 3D0YB 2LMUA 2ZN9A 2HF5A 2I18A 1XFVO 3D73A 1L2OC 4MEWA 5DICA 1MF8B 4IJ7A 1UUSA 1NIWA 4INXA 4OR9B 1OOGA 3TS5B 1Y6WA 1JWDA 2KHNA 3D78A 4CIDA 1UHJA 3BXKA 3AAKA 5GQQC 2ZRTA 1OSAA 1RTP1 2L0PA 2MA2A 2KFGA 1CMGA 2JWWA 5FI6A 3NSLA 1BOCA 4OV2A 1AJ5A 2L4HA 1OW4A 3DVJA 4NQGA 1ORGA 2AUCA 2IS9A 1X02A 3CDNA 5ER4X 3EKJA 4I5KA 1H8BA 2VRGA 1HQVA 1A2XA 1XA5A 4DIRA 2L2CA 3SG7A 1CTRA 2LAPA 4CLNA 4DS7A 4QJ5B 4UPGA 1S3PA 1QXPA 3OHMB 1M39A 2L5XB 3R72A 2BKHB 1NPQA 3TUYC 2A4JA 3PALA 1J7RA 1BMOA 3B7AA 3MSEB 3GK1A 2NCOA 2WCBA 1FBVA 1KK8B 1Z2CB 2PMYA 3FE9A 5AANA 1SCMC 1EG3A 4JD9A 4WRIA 1QLSA 1DJZA 2PQLA 1BU3A 5HKWA 1KCYA 1K94A 1SL7A 2RGIA 3R1PA 2Q91A 3AKBA 1WRZA 2ZN8A 1D1OA 4C0KA 1SY9A 2K61A 2HQWA 2G2BA 1ALVA 1YVLA 3PN7C 4PDZA 4I5NB 2JNXA 3D77A 1G8IA 1M45A 5CSJA 3BFHA 3N7HA 1DJGA 1L2OB 1QIVA 1QTXA 3GK4X 5AXIA 1JC2A 1WLZA 1DF0B 1ZMZA 2PALA 3S0GA 3SG6A 2M3WA 3HCMA 1CLMA 2BCXA 4YBHB 2MHHA 4GGNA 3TDIA 2ZRSA 2ZNDA 4YGBB 3VB1A 1DJHA 2WOSA 5JJGA 4PT1A 3DY9A 1DGUA 2MAZA 1B7TZ 2M0RA 1CB1A 2BBMA 1IJ5A 5D7FA 1DF0A 4NDBA 5KTYA 3I5IC 2K2AA 1RECA 1IQ3A 4DCKA 3KPXA 3CR5X 1FF1A 3TUYB 3CR2A 3E3RA 2QACA 1S1EA 1YTZC 4A4CA 4MZJA 1P28A 2JQ6A 1TNXA 3SS5A 1OMRA 2OTGC 2KAVA 1N65A 1QIWA 3KHEA 1SL8A 1S26D 1CLBA 1SCMB 2PVBA 1XVJA 2KFHA 2BCAA 1GGZA 1NCXA 1IQ5A 1J55A 2KYCA 1J7OA 2KQ6A 2FJUB 5I94A 1J1EA 1F4QA 3PN7B 4Q04A 2LP3A 4JWQA 1QS7A 2ERBA 4DRWA 1UHIA 3CLNA 3JVTC 2H2KA 2M7NA 1BJFA 2M8UA 2O60A 1M63B 2LUXA 2PRUA 3OBVA 4PCWA 3UO9A 4YGAA 1CM1A 1WDCC 2GTEA 1S36A 1LVCD 2YGUA 3BFBA 3Q8IA 4R1EA 1K9KA 2KSPA 3TZ1A 5I8NA 1QVIY 3OX6A 4AQIA 1S6IA 1CNPA 2K7CA 4PE7A 2QDIA 3NXAA 4I5JA 3VRRA 3B87A 4JPZB 2LCPA 1CDMA 3SS3A 3UNWA 3JTDC 4MBEA 1YR5A 2JT8A 1MUXA 1NSHA 1UP5A 2L5YA 2WCHA 3I5IB 2M29A 4CFRA 2F8PA 2MBXA 3CABA 4XYNA 3VRPA 1U5IA 2PASA 4F0ZB 4C0JA 1EL4A 1IGVA 5AERA 4YGDB 2E6WA 2MJWB 1DJIA 2OTGB 2WORA 3RLZA 1S6CA 1YRUB 3OP0A 2SCPA 1C3ZA 3VRNA 3M0WA 2F33A 2K60A 1CKKA 2JTTA 3BUOB 4ZCUA 1L7ZA 5ER5A 1KFUS 4N1GA 4M2QA 2D8NA 1UURA 1K96A 1MR8A 1F4OA 1RK9A 1SBJA 1YRTB 3JVTB 1LA0A 1SNLA 3SG5A 3O4XA 1KQMB 2E30A 1XFYO 4NDDA 5HYDA 1CDLA 1PRWA 2NCPA 1WDCB 3RM1A 1NCZA 1PALA 1CMFA 1F71A 4FTGA 1CDPA 3DF0B 4GFTA 2WCKA 3S0AA 4ICBA 5CSNA 5I2OA 1TWOA 2JXCA 3JTDB 2H8VA 2ZFDA 1F55A 2CTNA 4JQ0D 2F3ZA 1RFJA 3CR4X 1OOFA 5FYXA 5CPVA 3BQ3A 3S0BA 3SJSA 2M49B 1CFCA 1KFXL 3DF0A 4U8DA 3QMEA 1EG4A 1OZOA 2AMIA 3L47A 2F2OA 2QEBA 1JSAA 4OZDA 1TUZA 3B88A 3EK4A 3AKAA 1KQVA 4MZKA 1XFXO 1TCFA 2LLUA 3CWGA 3IVTA 3PFVA 3PJIA 1T14A 3EK8A 4USLA 1NX3A 4MRYA 1K95A 1B8RA 1CFPA 3NHIA 3LK0A 1C7VA 1B8CA 5HKZA 2GV5A 1KSMA 2QPTA 3DVEA 3OGNA 3SG2A 1LS8A 5K89A 2CXJA 4XJKA 1BG1A 1BLQA 1DELA 2M7LA 2WNDA 3PATA 2BAPA 2R2IA 3EKHA 2LVKA 1GQMA 1UHHA 1OOJA 1Y1XA 2BECA 2KGBC 5I2QA 1F54A 3H4SE 3KO0A 2BKIB 1V1FA 3ICBA 1J1DA 3FE6A 3QRXA 5DKQA 1S6JA 2L98A 1LINA 1DVIA 2K7OA 3NSOA 1XFRA 4M2OA 1IRJA 3LCPC 1AVSA 1MXEA 2KOTA 2Y1MA 1IIOA 5KU1A 1E8AA 2NZ0A 2PYQA 2EC6C 1NX1A 1ODBA 1SR6C 1KSOA 3CZ2A 4PHKA 1LA3A 3D74A 3FIAA 4HREE 1WRLA 1A75B 3VROA 1SMGA 1FI6A 1EH2A 2MLEC 1K8UA 1TNQA 1AJ4A 1TUJA 4PE4A 2OS8C 4PALA 4AQJA 4DUQA 2JC2A 1NYAA 2AAOA 1M46A 2F2PA 2I7AA 2L2EA 3BJHA 5CSFA 5DKNA 1MWNA 4ZCVA 1HT9A 1QX7A 1BF5A 1W9ZA 3RZSA 1DGVA 1MHOA 5F6TA 3WHTB 3PSRA 1H4BA 1W7JB 3DVMA 3K21A 4YI9A 4GGFA 1SL9A 1XFUO 3L4LA 1WY9A 1CFDA 5D3OA 1XO5A 1UHKA 1A75A 1C3YA 1CM4A 2F3YA 2BL0C 1QJTA 1UWOA 4PHNA 5B8IB 1K2HA 4JKTA 1A03A 2FJYA 3A4UB 3CZ0A 2NLNA 1QVIZ 3S0FA 2KBIA 1QV1A 2BE6A 2WCLA 2KQYA 1V1GA 5DKRA 1R6PA 1F8HA 1A29A 1IG5A 1GGWA 2LMTA 3AAJA 5KSZA 4N5XA 1K90D 3DZTA 1MXLC 2CT9A 3NSKA 1U5IB 2K2FA 1RWYA 3NHTA 2ZKMX 3EK7A 1YURA 4GUKA 1TRFA 1AK8A 2HQ8A 1YX8A 3PM2A 3WXAA 5CSIA 1ZOTB 2EGDA 2GGMA 2JU0A 2SASA 3O4YA 4FQTA 2EC6B 3SIBA 3HX4A 1SR6B 3O6BA 4YRUA 1S5GY 1Y1UA 1PULA 2KAXA 1JFKA 4MLWA 4BY5A 1BR1B 1GJYA 2OS8B 3I5HC 3GK2A 1C7WA 3B6XA 4FQOA 1NX0A 2KLEA 3CGAA 2L51A 2LNKA 2L4IA 2LP2A 2KGRA 2OPOA 1BT6A 1RROA 2K7BA 1YUUA 2LV7A 1QLKA 1PSBA 4GAOA 4OVNF 4TNCA 1NCYA 2JPTA 1SRAA 3LLEA 3ZWHA 1KK7Y 1YUSA 1DEKA 2BCBA 2FCDA 4OCIA 2HPSA 3CZ1A 1SK6D 3VRQA 2KLDA 3FWBA 3KEVA 2PSRA 4PE0A 3R1VA 3DD4A 2BL0B 2I2RE 2LC5A 3BOWB 4IL1A 3F45A 2LVIA 1BR4B 5D69A 1N0YA 2KI4C 2H61A 4PE1A 3CZTX 1B4CA 3A8RA 4M2PA 1EXRA 2LHLA 2M1KB 2KI6C 3D76A 3IF7A 1M31A 1DJWA 4HRGA 2Y5IA 1OZSA 2I94A 2LHIA 3SIAA 1YX7A 3BUXB 1LXFC 2NXQA 3BOWA 5G08A 4GGFC 4HSZA 2BBNA 1ZACA 1Q80A 2JRFA 3R1OA 1PSRA 1TNWA 4MVFA 4ORAB 3EVUA 2M9GA 2K0JA 3LK1A 1SW8A 2KBMA 1B9AA 1AHRA 3CTNA 4E68A 3EG5B 5IBWA 3OB1B 4P5OE 1VRKA 2ZNEA 3CS1A 5HLVA 1F70A 1AP4A 3O2PA 3K1EA 3DYEA 3I5HB 2CCMA 3D0YA 1Y0VH 2KPHA 5AFPA 1ALWA 1B47A 2KYFA 1NX2A 2Y4QA 4XJKB 3BUMB 1G4YR 2LLSA 2KFFA 3ZNIA 1DC1A 2MRDA 1DJXA 2LVJA 1QWVA 1G33A 1CLLA 1W7IB 1TNPA 2KNEA 2M97A 1OOHA 3I5GC 3SG4A 4CFQA 4AOMA 3GOFA 4YGCB 1SKTA 4ETOA 5PALA 2WC6A 5HLOA 3BYAA 4HRHA 1J7PA 2GGZA 2CNPA 3SS4A 1DQEA 2LE9B 3WNXB 2KI4B 1CDNA 2WCEA 4PHMA 3BUWB 1TIZA 1TOPA 3PLFB 3S0DA 2QEVA 2LANA 2L50A 2LUCA 3C1VA 5JOLA 5HL1A 1JBAA 4GPLB 1CFFA 1SPYA 1TTXA 3IQOA 4N1FA 3EVVA 4OKHA 3WHUB 4C0LA 1J7QA 2COLB 2LLTA 3BFAA 3DVKA 1BODA 1DMOA 3L4AA 4GNKB 1XK4A 2TN4A 3LL8B 5EL2A 1A4PA 2Y1NA 4KYNA 1XYDA
chains in the Genus database with same CATH topology
3V2LA 3NHTA 2QEOA 3B7AA 3DXLA 4INWA 2JPOA 3S0EA 3FE9A 2WCJA 4JD9A 2PQLA 4FQTA 3R1PA 3B86A 1GM0A 3B6XA 3D77A 3BFHA 3N7HA 2WCKA 3S0GA 3S0AA 1TWOA 2H8VA 3CZ1A 1OOFA 3VB1A 2WC5A 3S0BA 3R1VA 4PT1A 3DY9A 3QMEA 3D75A 3L47A 2QEBA 4OZDA 3B88A 3D76A 3CYZA 2P70A 3PJIA 1T14A 1P28A 3NHIA 3R1OA 2P71A 1OOIX 3OGNA 1LS8A 2WCMA 4F7FA 3FE6A 3NGVA 3K1EA 3DYEA 1XFRA 2ERBA 2KPHA 3CZ2A 3D74A 1QWVA 3FE8A 1OOHA 1TUJA 2QEHA 2GTEA 3BFBA 3Q8IA 2WC6A 3BJHA 3D73A 5DICA 3RZSA 1DQEA 4INXA 1OOGA 2QDIA 3B87A 3D78A 3L4LA 2WCHA 3S0DA 2QEVA 1C3YA 3CABA 1OW4A 2FJYA 1ORGA 3CZ0A 3CDNA 3S0FA 2WCLA 3BFAA 3L4AA 2L2CA 5EL2A 1C3ZA 3DZTA 3R72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2L A;  3NHT A;  2QEO A;  3B7A A;  3DXL A;  4INW A;  2JPO A;  3S0E A;  3FE9 A;  2WCJ A;  4JD9 A;  2PQL A;  4FQT A;  3R1P A;  3B86 A;  1GM0 A;  3B6X A;  3D77 A;  3BFH A;  3N7H A;  2WCK A;  3S0G A;  3S0A A;  1TWO A;  2H8V A;  3CZ1 A;  1OOF A;  3VB1 A;  2WC5 A;  3S0B A;  3R1V A;  4PT1 A;  3DY9 A;  3QME A;  3D75 A;  3L47 A;  2QEB A;  4OZD A;  3B88 A;  3D76 A;  3CYZ A;  2P70 A;  3PJI A;  1T14 A;  1P28 A;  3NHI A;  3R1O A;  2P71 A;  1OOI X;  3OGN A;  1LS8 A;  2WCM A;  4F7F A;  3FE6 A;  3NGV A;  3K1E A;  3DYE A;  1XFR A;  2ERB A;  2KPH A;  3CZ2 A;  3D74 A;  1QWV A;  3FE8 A;  1OOH A;  1TUJ A;  2QEH A;  2GTE A;  3BFB A;  3Q8I A;  2WC6 A;  3BJH A;  3D73 A;  5DIC A;  3RZS A;  1DQE A;  4INX A;  1OOG A;  2QDI A;  3B87 A;  3D78 A;  3L4L A;  2WCH A;  3S0D A;  2QEV A;  1C3Y A;  3CAB A;  1OW4 A;  2FJY A;  1ORG A;  3CZ0 A;  3CDN A;  3S0F A;  2WCL A;  3BFA A;  3L4A A;  2L2C A;  5EL2 A;  1C3Z A;  3DZT A;  3R72 A; 
#chains in the Genus database with same CATH topology
 3FWC A;  3O78 A;  3V2L A;  1K9P A;  1KFU L;  2QEO A;  4MZL A;  3DXL A;  2H61 C;  2B1U A;  2JPO A;  4INW A;  4P2Y B;  5FI2 A;  3S0E A;  2P6B B;  1OE9 B;  1PVB A;  2WCJ A;  1N2D A;  4QJ4 B;  1NUB A;  1K9U A;  4NDC A;  1TCO B;  1JUO A;  1NWD A;  3B86 A;  1GM0 A;  3I5F C;  3I5G B;  4WQ3 A;  4WQ2 A;  1MQ1 A;  5I2L A;  1B7T Y;  1WLM A;  1YUT A;  2JUL A;  2EHB A;  4GBA A;  5J3X A;  3TDZ A;  1SSE B;  3BUN B;  3TDU A;  2KDH A;  2G9B A;  5HKY A;  1R2U A;  3D10 A;  1JFJ A;  1QAT A;  2BE4 A;  2M1U A;  1KWO C;  1NP8 A;  1PK0 D;  4CPV A;  1FI5 A;  2JT3 A;  1XFW O;  1S5G Z;  4QJ3 B;  1EJ3 A;  2KAY A;  2WC5 A;  4MN0 A;  5AEQ A;  2FOT A;  3IQQ A;  1K93 D;  3FS7 A;  2O5G A;  1KFX S;  1TN4 A;  1UHN A;  2DOQ A;  4MRX A;  3TS5 C;  3D75 A;  5FI7 A;  1IKU A;  2ISD A;  1ZUZ A;  1C07 A;  3VGO A;  1WRK A;  1QX5 B;  1ZFS A;  2BNX A;  2JNF A;  1KQM C;  1XFZ O;  1YVH A;  2LM5 A;  1KK7 Z;  3SG3 A;  1SCV A;  1Z4H A;  2KI6 D;  3CYZ A;  4YI8 A;  1Y1A A;  2P70 A;  1DJY A;  3OB2 B;  2K8M B;  1OMV A;  2JT0 A;  5BPJ A;  2LVV A;  2CBL A;  1RJV A;  2P71 A;  1OOI X;  2JOJ A;  1IJ6 A;  4ORB B;  1DT7 B;  2JTZ A;  2WCM A;  2Q4U A;  2WC8 A;  1JF2 A;  4YGE B;  4D1E A;  3EVR A;  2V53 A;  4BY4 A;  5TNC A;  4F7F A;  1FW4 A;  1AUI B;  1B8L A;  1DTL A;  3I5F B;  3NGV A;  1KK8 C;  3KF9 A;  1OMD A;  1FPW A;  2JZI A;  1OQP A;  4A4B A;  2LMV A;  1XK4 C;  1PVA A;  4ORC B;  2WCF A;  1LKJ A;  1QAS A;  2JXL A;  2K7D A;  1SYM A;  3OX5 A;  1B1G A;  1IWQ A;  4PHJ A;  3NSI A;  2MLF C;  4I5L B;  3FE8 A;  1KWO B;  1QV0 A;  4L9M A;  1JF0 A;  1IH0 A;  1QX2 A;  2QEH A;  3PM8 A;  4MSP A;  2FCE A;  2HET A;  3D0Y B;  2LMU A;  2ZN9 A;  2HF5 A;  2I18 A;  1XFV O;  3D73 A;  1L2O C;  4MEW A;  5DIC A;  1MF8 B;  4IJ7 A;  1UUS A;  1NIW A;  4INX A;  4OR9 B;  1OOG A;  3TS5 B;  1Y6W A;  1JWD A;  2KHN A;  3D78 A;  4CID A;  1UHJ A;  3BXK A;  3AAK A;  5GQQ C;  2ZRT A;  1OSA A;  1RTP 1;  2L0P A;  2MA2 A;  2KFG A;  1CMG A;  2JWW A;  5FI6 A;  3NSL A;  1BOC A;  4OV2 A;  1AJ5 A;  2L4H A;  1OW4 A;  3DVJ A;  4NQG A;  1ORG A;  2AUC A;  2IS9 A;  1X02 A;  3CDN A;  5ER4 X;  3EKJ A;  4I5K A;  1H8B A;  2VRG A;  1HQV A;  1A2X A;  1XA5 A;  4DIR A;  2L2C A;  3SG7 A;  1CTR A;  2LAP A;  4CLN A;  4DS7 A;  4QJ5 B;  4UPG A;  1S3P A;  1QXP A;  3OHM B;  1M39 A;  2L5X B;  3R72 A;  2BKH B;  1NPQ A;  3TUY C;  2A4J A;  3PAL A;  1J7R A;  1BMO A;  3B7A A;  3MSE B;  3GK1 A;  2NCO A;  2WCB A;  1FBV A;  1KK8 B;  1Z2C B;  2PMY A;  3FE9 A;  5AAN A;  1SCM C;  1EG3 A;  4JD9 A;  4WRI A;  1QLS A;  1DJZ A;  2PQL A;  1BU3 A;  5HKW A;  1KCY A;  1K94 A;  1SL7 A;  2RGI A;  3R1P A;  2Q91 A;  3AKB A;  1WRZ A;  2ZN8 A;  1D1O A;  4C0K A;  1SY9 A;  2K61 A;  2HQW A;  2G2B A;  1ALV A;  1YVL A;  3PN7 C;  4PDZ A;  4I5N B;  2JNX A;  3D77 A;  1G8I A;  1M45 A;  5CSJ A;  3BFH A;  3N7H A;  1DJG A;  1L2O B;  1QIV A;  1QTX A;  3GK4 X;  5AXI A;  1JC2 A;  1WLZ A;  1DF0 B;  1ZMZ A;  2PAL A;  3S0G A;  3SG6 A;  2M3W A;  3HCM A;  1CLM A;  2BCX A;  4YBH B;  2MHH A;  4GGN A;  3TDI A;  2ZRS A;  2ZND A;  4YGB B;  3VB1 A;  1DJH A;  2WOS A;  5JJG A;  4PT1 A;  3DY9 A;  1DGU A;  2MAZ A;  1B7T Z;  2M0R A;  1CB1 A;  2BBM A;  1IJ5 A;  5D7F A;  1DF0 A;  4NDB A;  5KTY A;  3I5I C;  2K2A A;  1REC A;  1IQ3 A;  4DCK A;  3KPX A;  3CR5 X;  1FF1 A;  3TUY B;  3CR2 A;  3E3R A;  2QAC A;  1S1E A;  1YTZ C;  4A4C A;  4MZJ A;  1P28 A;  2JQ6 A;  1TNX A;  3SS5 A;  1OMR A;  2OTG C;  2KAV A;  1N65 A;  1QIW A;  3KHE A;  1SL8 A;  1S26 D;  1CLB A;  1SCM B;  2PVB A;  1XVJ A;  2KFH A;  2BCA A;  1GGZ A;  1NCX A;  1IQ5 A;  1J55 A;  2KYC A;  1J7O A;  2KQ6 A;  2FJU B;  5I94 A;  1J1E A;  1F4Q A;  3PN7 B;  4Q04 A;  2LP3 A;  4JWQ A;  1QS7 A;  2ERB A;  4DRW A;  1UHI A;  3CLN A;  3JVT C;  2H2K A;  2M7N A;  1BJF A;  2M8U A;  2O60 A;  1M63 B;  2LUX A;  2PRU A;  3OBV A;  4PCW A;  3UO9 A;  4YGA A;  1CM1 A;  1WDC C;  2GTE A;  1S36 A;  1LVC D;  2YGU A;  3BFB A;  3Q8I A;  4R1E A;  1K9K A;  2KSP A;  3TZ1 A;  5I8N A;  1QVI Y;  3OX6 A;  4AQI A;  1S6I A;  1CNP A;  2K7C A;  4PE7 A;  2QDI A;  3NXA A;  4I5J A;  3VRR A;  3B87 A;  4JPZ B;  2LCP A;  1CDM A;  3SS3 A;  3UNW A;  3JTD C;  4MBE A;  1YR5 A;  2JT8 A;  1MUX A;  1NSH A;  1UP5 A;  2L5Y A;  2WCH A;  3I5I B;  2M29 A;  4CFR A;  2F8P A;  2MBX A;  3CAB A;  4XYN A;  3VRP A;  1U5I A;  2PAS A;  4F0Z B;  4C0J A;  1EL4 A;  1IGV A;  5AER A;  4YGD B;  2E6W A;  2MJW B;  1DJI A;  2OTG B;  2WOR A;  3RLZ A;  1S6C A;  1YRU B;  3OP0 A;  2SCP A;  1C3Z A;  3VRN A;  3M0W A;  2F33 A;  2K60 A;  1CKK A;  2JTT A;  3BUO B;  4ZCU A;  1L7Z A;  5ER5 A;  1KFU S;  4N1G A;  4M2Q A;  2D8N A;  1UUR A;  1K96 A;  1MR8 A;  1F4O A;  1RK9 A;  1SBJ A;  1YRT B;  3JVT B;  1LA0 A;  1SNL A;  3SG5 A;  3O4X A;  1KQM B;  2E30 A;  1XFY O;  4NDD A;  5HYD A;  1CDL A;  1PRW A;  2NCP A;  1WDC B;  3RM1 A;  1NCZ A;  1PAL A;  1CMF A;  1F71 A;  4FTG A;  1CDP A;  3DF0 B;  4GFT A;  2WCK A;  3S0A A;  4ICB A;  5CSN A;  5I2O A;  1TWO A;  2JXC A;  3JTD B;  2H8V A;  2ZFD A;  1F55 A;  2CTN A;  4JQ0 D;  2F3Z A;  1RFJ A;  3CR4 X;  1OOF A;  5FYX A;  5CPV A;  3BQ3 A;  3S0B A;  3SJS A;  2M49 B;  1CFC A;  1KFX L;  3DF0 A;  4U8D A;  3QME A;  1EG4 A;  1OZO A;  2AMI A;  3L47 A;  2F2O A;  2QEB A;  1JSA A;  4OZD A;  1TUZ A;  3B88 A;  3EK4 A;  3AKA A;  1KQV A;  4MZK A;  1XFX O;  1TCF A;  2LLU A;  3CWG A;  3IVT A;  3PFV A;  3PJI A;  1T14 A;  3EK8 A;  4USL A;  1NX3 A;  4MRY A;  1K95 A;  1B8R A;  1CFP A;  3NHI A;  3LK0 A;  1C7V A;  1B8C A;  5HKZ A;  2GV5 A;  1KSM A;  2QPT A;  3DVE A;  3OGN A;  3SG2 A;  1LS8 A;  5K89 A;  2CXJ A;  4XJK A;  1BG1 A;  1BLQ A;  1DEL A;  2M7L A;  2WND A;  3PAT A;  2BAP A;  2R2I A;  3EKH A;  2LVK A;  1GQM A;  1UHH A;  1OOJ A;  1Y1X A;  2BEC A;  2KGB C;  5I2Q A;  1F54 A;  3H4S E;  3KO0 A;  2BKI B;  1V1F A;  3ICB A;  1J1D A;  3FE6 A;  3QRX A;  5DKQ A;  1S6J A;  2L98 A;  1LIN A;  1DVI A;  2K7O A;  3NSO A;  1XFR A;  4M2O A;  1IRJ A;  3LCP C;  1AVS A;  1MXE A;  2KOT A;  2Y1M A;  1IIO A;  5KU1 A;  1E8A A;  2NZ0 A;  2PYQ A;  2EC6 C;  1NX1 A;  1ODB A;  1SR6 C;  1KSO A;  3CZ2 A;  4PHK A;  1LA3 A;  3D74 A;  3FIA A;  4HRE E;  1WRL A;  1A75 B;  3VRO A;  1SMG A;  1FI6 A;  1EH2 A;  2MLE C;  1K8U A;  1TNQ A;  1AJ4 A;  1TUJ A;  4PE4 A;  2OS8 C;  4PAL A;  4AQJ A;  4DUQ A;  2JC2 A;  1NYA A;  2AAO A;  1M46 A;  2F2P A;  2I7A A;  2L2E A;  3BJH A;  5CSF A;  5DKN A;  1MWN A;  4ZCV A;  1HT9 A;  1QX7 A;  1BF5 A;  1W9Z A;  3RZS A;  1DGV A;  1MHO A;  5F6T A;  3WHT B;  3PSR A;  1H4B A;  1W7J B;  3DVM A;  3K21 A;  4YI9 A;  4GGF A;  1SL9 A;  1XFU O;  3L4L A;  1WY9 A;  1CFD A;  5D3O A;  1XO5 A;  1UHK A;  1A75 A;  1C3Y A;  1CM4 A;  2F3Y A;  2BL0 C;  1QJT A;  1UWO A;  4PHN A;  5B8I B;  1K2H A;  4JKT A;  1A03 A;  2FJY A;  3A4U B;  3CZ0 A;  2NLN A;  1QVI Z;  3S0F A;  2KBI A;  1QV1 A;  2BE6 A;  2WCL A;  2KQY A;  1V1G A;  5DKR A;  1R6P A;  1F8H A;  1A29 A;  1IG5 A;  1GGW A;  2LMT A;  3AAJ A;  5KSZ A;  4N5X A;  1K90 D;  3DZT A;  1MXL C;  2CT9 A;  3NSK A;  1U5I B;  2K2F A;  1RWY A;  3NHT A;  2ZKM X;  3EK7 A;  1YUR A;  4GUK A;  1TRF A;  1AK8 A;  2HQ8 A;  1YX8 A;  3PM2 A;  3WXA A;  5CSI A;  1ZOT B;  2EGD A;  2GGM A;  2JU0 A;  2SAS A;  3O4Y A;  4FQT A;  2EC6 B;  3SIB A;  3HX4 A;  1SR6 B;  3O6B A;  4YRU A;  1S5G Y;  1Y1U A;  1PUL A;  2KAX A;  1JFK A;  4MLW A;  4BY5 A;  1BR1 B;  1GJY A;  2OS8 B;  3I5H C;  3GK2 A;  1C7W A;  3B6X A;  4FQO A;  1NX0 A;  2KLE A;  3CGA A;  2L51 A;  2LNK A;  2L4I A;  2LP2 A;  2KGR A;  2OPO A;  1BT6 A;  1RRO A;  2K7B A;  1YUU A;  2LV7 A;  1QLK A;  1PSB A;  4GAO A;  4OVN F;  4TNC A;  1NCY A;  2JPT A;  1SRA A;  3LLE A;  3ZWH A;  1KK7 Y;  1YUS A;  1DEK A;  2BCB A;  2FCD A;  4OCI A;  2HPS A;  3CZ1 A;  1SK6 D;  3VRQ A;  2KLD A;  3FWB A;  3KEV A;  2PSR A;  4PE0 A;  3R1V A;  3DD4 A;  2BL0 B;  2I2R E;  2LC5 A;  3BOW B;  4IL1 A;  3F45 A;  2LVI A;  1BR4 B;  5D69 A;  1N0Y A;  2KI4 C;  2H61 A;  4PE1 A;  3CZT X;  1B4C A;  3A8R A;  4M2P A;  1EXR A;  2LHL A;  2M1K B;  2KI6 C;  3D76 A;  3IF7 A;  1M31 A;  1DJW A;  4HRG A;  2Y5I A;  1OZS A;  2I94 A;  2LHI A;  3SIA A;  1YX7 A;  3BUX B;  1LXF C;  2NXQ A;  3BOW A;  5G08 A;  4GGF C;  4HSZ A;  2BBN A;  1ZAC A;  1Q80 A;  2JRF A;  3R1O A;  1PSR A;  1TNW A;  4MVF A;  4ORA B;  3EVU A;  2M9G A;  2K0J A;  3LK1 A;  1SW8 A;  2KBM A;  1B9A A;  1AHR A;  3CTN A;  4E68 A;  3EG5 B;  5IBW A;  3OB1 B;  4P5O E;  1VRK A;  2ZNE A;  3CS1 A;  5HLV A;  1F70 A;  1AP4 A;  3O2P A;  3K1E A;  3DYE A;  3I5H B;  2CCM A;  3D0Y A;  1Y0V H;  2KPH A;  5AFP A;  1ALW A;  1B47 A;  2KYF A;  1NX2 A;  2Y4Q A;  4XJK B;  3BUM B;  1G4Y R;  2LLS A;  2KFF A;  3ZNI A;  1DC1 A;  2MRD A;  1DJX A;  2LVJ A;  1QWV A;  1G33 A;  1CLL A;  1W7I B;  1TNP A;  2KNE A;  2M97 A;  1OOH A;  3I5G C;  3SG4 A;  4CFQ A;  4AOM A;  3GOF A;  4YGC B;  1SKT A;  4ETO A;  5PAL A;  2WC6 A;  5HLO A;  3BYA A;  4HRH A;  1J7P A;  2GGZ A;  2CNP A;  3SS4 A;  1DQE A;  2LE9 B;  3WNX B;  2KI4 B;  1CDN A;  2WCE A;  4PHM A;  3BUW B;  1TIZ A;  1TOP A;  3PLF B;  3S0D A;  2QEV A;  2LAN A;  2L50 A;  2LUC A;  3C1V A;  5JOL A;  5HL1 A;  1JBA A;  4GPL B;  1CFF A;  1SPY A;  1TTX A;  3IQO A;  4N1F A;  3EVV A;  4OKH A;  3WHU B;  4C0L A;  1J7Q A;  2COL B;  2LLT A;  3BFA A;  3DVK A;  1BOD A;  1DMO A;  3L4A A;  4GNK B;  1XK4 A;  2TN4 A;  3LL8 B;  5EL2 A;  1A4P A;  2Y1N A;  4KYN A;  1XYD A; 
#chains in the Genus database with same CATH homology
 3V2L A;  3NHT A;  2QEO A;  3B7A A;  3DXL A;  4INW A;  2JPO A;  3S0E A;  3FE9 A;  2WCJ A;  4JD9 A;  2PQL A;  4FQT A;  3R1P A;  3B86 A;  1GM0 A;  3B6X A;  3D77 A;  3BFH A;  3N7H A;  2WCK A;  3S0G A;  3S0A A;  1TWO A;  2H8V A;  3CZ1 A;  1OOF A;  3VB1 A;  2WC5 A;  3S0B A;  3R1V A;  4PT1 A;  3DY9 A;  3QME A;  3D75 A;  3L47 A;  2QEB A;  4OZD A;  3B88 A;  3D76 A;  3CYZ A;  2P70 A;  3PJI A;  1T14 A;  1P28 A;  3NHI A;  3R1O A;  2P71 A;  1OOI X;  3OGN A;  1LS8 A;  2WCM A;  4F7F A;  3FE6 A;  3NGV A;  3K1E A;  3DYE A;  1XFR A;  2ERB A;  2KPH A;  3CZ2 A;  3D74 A;  1QWV A;  3FE8 A;  1OOH A;  1TUJ A;  2QEH A;  2GTE A;  3BFB A;  3Q8I A;  2WC6 A;  3BJH A;  3D73 A;  5DIC A;  3RZS A;  1DQE A;  4INX A;  1OOG A;  2QDI A;  3B87 A;  3D78 A;  3L4L A;  2WCH A;  3S0D A;  2QEV A;  1C3Y A;  3CAB A;  1OW4 A;  2FJY A;  1ORG A;  3CZ0 A;  3CDN A;  3S0F A;  2WCL A;  3BFA A;  3L4A A;  2L2C A;  5EL2 A;  1C3Z A;  3DZT A;  3R72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...