4PT1A

Crystal structure of locusta migratoria odorant binding proteins lmigobp1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
129
structure length
129
Chain Sequence
VNMKLTGRIMDAAKEVDHTCRSSTGVPRDMLHRYAEGQTVDDDDFKCYLKCIMVEFNSLSDDGVFVLEEELENVPPEIKEEGHRVVHSCKHINHDEACETAYQIHQCYKQSDPELYSLVVRAFDATIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein 1d
publication title Crystal structure of the Locusta migratoria odorant binding protein.
pubmed doi rcsb
source organism Locusta migratoria
molecule tags Transport protein
total genus 49
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4pt1A00
3D75A 3L4LA 2L2CA 3CABA 2QDIA 3DXLA 3L47A 3D77A 1LS8A 3V2LA 2FJYA 3NGVA 3S0FA 3QMEA 3VB1A 3NHIA 4JD9A 3FE9A 3R1VA 1OW4A 3RZSA 3N7HA 3S0AA 4PT1A 1C3ZA 2QEHA 3BFBA 1T14A 3S0EA 1DQEA 1TUJA 3Q8IA 2KPHA 4INXA 3S0DA 3D73A 2QEVA 2WCKA 3L4AA 1OOHA 2ERBA 2P70A 3K1EA 3DY9A 3CYZA 1ORGA 3B7AA 2JPOA 2WCLA 3CZ1A 3OGNA 2WCHA 2WCJA 3BFHA 1P28A 3R1PA 2H8VA 2WC6A 3PJIA 2QEBA 3R72A 3B88A 3D76A 1OOFA 3BJHA 3CZ2A 3S0GA 2WCMA 2P71A 4FQTA 2WC5A 3B86A 3CZ0A 2QEOA 3NHTA 1OOIX 2GTEA 3S0BA 4OZDA 4INWA 1QWVA 3B87A 4F7FA 3B6XA 1XFRA 3DYEA 3BFAA 1OOGA 1GM0A 3FE8A 1TWOA 3D78A 1C3YA 5EL2A 3CDNA 3R1OA 3DZTA 3FE6A 2PQLA 5DICA 3D74A
chains in the Genus database with same CATH superfamily
3D75A 4NDDA 1KK7Z 1WDCC 1K95A 1SKTA 3A8RA 1J7RA 2PYQA 2L98A 2WCBA 2LAPA 1XA5A 4YGCB 1UURA 4BY5A 2GV5A 4XYNA 1S26D 1SR6C 1SK6D 2WNDA 1SCMB 1BR4B 2QDIA 3PALA 1K9KA 3TZ1A 1PRWA 4N5XA 2EC6C 1F55A 5CSFA 1LA3A 1LS8A 3DF0A 5FI7A 2BCXA 3NGVA 3UO9A 1S5GY 2FCDA 3QMEA 4I5LB 1AK8A 4I5JA 4HRGA 4P5OE 3I5GC 3RZSA 2JT0A 3OX5A 2COLB 2KBIA 3N7HA 1UUSA 2JXCA 2KI4C 5DKRA 1CFFA 2PSRA 3HCMA 3AKAA 4QJ5B 4UPGA 3BUMB 2BL0B 2KYFA 5FI6A 1DJXA 3JVTC 4YGAA 2AUCA 3SG6A 1S36A 1YVLA 3FS7A 1NX2A 3VRNA 2EGDA 3K21A 1OOJA 1UHHA 2AMIA 1S6JA 2KI6D 1RTP1 1D1OA 1A29A 3NSIA 3EG5B 3I5IB 2ZFDA 5DKQA 5AFPA 1PALA 3I5HC 2G2BA 1J55A 2Q4UA 1QTXA 4N1FA 1SW8A 1YUUA 4GNKB 3D73A 2QEVA 3VROA 1DJGA 2LHLA 1QX2A 1QASA 4CPVA 1NP8A 5B8IB 1QIVA 4JKTA 4MZLA 1J7QA 3K1EA 1F4QA 3KO0A 1K8UA 1ORGA 3B7AA 4QJ4B 3RM1A 2WCLA 5FYXA 1A03A 5HLOA 2CNPA 1CFCA 2F3ZA 3OGNA 4HREE 2KAYA 4A4CA 4JQ0D 2LP3A 1KWOB 4YI8A 1F4OA 1ALWA 1YUSA 2WCJA 3SIBA 4WRIA 1P28A 3TUYB 1B7TY 1XVJA 1FW4A 2SCPA 3H4SE 2FJUB 3WXAA 1Y1AA 1OZSA 2Y1MA 3CWGA 4E68A 1DELA 3R72A 3PM2A 1AVSA 1F54A 1N0YA 3BUWB 3O4YA 1MUXA 1NCXA 4MN0A 4YI9A 3ZWHA 1SY9A 2BCAA 2L0PA 2A4JA 2ZRSA 4OCIA 3CZ0A 2JT8A 3TDIA 5I8NA 3EK7A 1CMFA 1MF8B 2ZN9A 2Q91A 3NHTA 2GGMA 2LVIA 1X02A 4MZJA 2KNEA 2NZ0A 2OTGC 5CSIA 4PHJA 1YR5A 1OMDA 2CCMA 1TRFA 1N2DA 4PHKA 4INWA 1HQVA 1N65A 1RK9A 2QPTA 3CR2A 4U8DA 1LXFC 1WRZA 3EKHA 1QWVA 1KFXS 2I2RE 1H4BA 1NPQA 1NCYA 2JTTA 1XFRA 1NIWA 5AANA 1IJ5A 3VRPA 1MXEA 1YTZC 2WC8A 1IRJA 1TWOA 3IF7A 3PN7B 3D78A 2K8MB 3GK2A 1MQ1A 3TDUA 2K7BA 1C3YA 1H8BA 1FF1A 2K7DA 2KI6C 1SL9A 2WCEA 3CLNA 3D10A 4MSPA 5IBWA 2BBNA 2F3YA 3SG3A 1KSMA 3EK4A 3S0EA 2KLEA 4YBHB 1IWQA 1CDNA 3LK0A 1QLSA 2KBMA 2I18A 2L5XB 3L4LA 3SG5A 1LVCD 2JPTA 2TN4A 1OZOA 2MA2A 1BU3A 4ORCB 2EC6B 4ICBA 2K7OA 2NCPA 1JWDA 3O6BA 5I2QA 1U5IB 1EH2A 3C1VA 3JTDC 2LMTA 1R6PA 3OB1B 4MRXA 4IL1A 2JRFA 1BMOA 1XFVO 2G9BA 2JTZA 1JUOA 3V2LA 2ZRTA 1CFPA 3FIAA 3TS5C 1OMVA 4HSZA 1G8IA 1MWNA 3S0AA 3MSEB 4JPZB 4OV2A 1DJZA 1L7ZA 1EG3A 1BR1B 1C3ZA 1UP5A 2KOTA 2QEHA 3BFBA 1Z2CB 1V1FA 1Y6WA 4PE1A 4KYNA 1MR8A 1HT9A 3D0YB 3I5HB 1DQEA 2D8NA 2K60A 4OR9B 1XFYO 2BCBA 2F2OA 3PATA 5JJGA 1Y1UA 2H61A 2KGBC 2LVKA 1LKJA 2KPHA 2O60A 1S6CA 3BOWB 1IQ5A 1XFUO 2MLEC 1KQMC 3EVVA 4I5NB 4C0JA 1ALVA 1NWDA 2MLFC 2LP2A 3GOFA 5CSJA 3WHTB 4D1EA 2CXJA 1FI6A 1RROA 3GK4X 3PM8A 3CYZA 1UHNA 1L2OC 2JPOA 1EL4A 4GPLB 1K90D 1G4YR 1XYDA 1NYAA 1MXLC 2MHHA 3CZ1A 2LE9B 1QJTA 2RGIA 1FBVA 3PN7C 5D69A 1CLMA 2WCHA 1BT6A 1KK8C 1KSOA 2L2EA 5F6TA 1RFJA 1OQPA 3OHMB 4TNCA 3CR4X 4OKHA 2WC6A 3SG7A 4WQ2A 1KQVA 3ICBA 2ZNDA 5KSZA 2K2FA 1DJHA 3B88A 2I7AA 4ETOA 2MBXA 1QX5B 2M97A 4F0ZB 1SL7A 3D76A 3BJHA 2JWWA 1QV0A 3CR5X 1DC1A 1YRTB 2WC5A 4PDZA 3B86A 2KDHA 1LINA 5ER4X 1BOCA 2QEOA 1RJVA 1DTLA 1JC2A 4R1EA 1G33A 1KK7Y 3KHEA 3VRQA 1FPWA 1B8LA 2WORA 2CTNA 1PSRA 1IKUA 2H61C 3VGOA 2PRUA 4N1GA 4WQ3A 4OZDA 1CTRA 3PLFB 2LNKA 2LC5A 1K9UA 1TCOB 4MZKA 2M3WA 2HETA 3EKJA 1XK4A 1SYMA 3DVEA 3KEVA 4F7FA 2FOTA 2L50A 2M7LA 2DOQA 3BFAA 5AERA 1GM0A 1A75B 4MEWA 1YVHA 2JU0A 3FE8A 3OBVA 1VRKA 1LA0A 5CPVA 1SCMC 2BE4A 1AJ4A 1PSBA 2BKIB 4IJ7A 1S3PA 4M2QA 4QJ3B 1AHRA 2E6WA 2VRGA 1TOPA 1WLZA 2NCOA 1JSAA 1QXPA 1SBJA 3SS5A 1F8HA 1SCVA 4L9MA 1MHOA 4MRYA 1ODBA 1XFWO 2FCEA 2M49B 3JTDB 2Y1NA 2L2CA 1F71A 3CABA 1NX3A 1SRAA 3EVUA 3I5FC 1TCFA 2BL0C 4GUKA 3M0WA 1GQMA 1DF0B 4DS7A 2M8UA 3LL8B 1F70A 4ORAB 3TS5B 1B9AA 3L47A 1K2HA 2KLDA 4OVNF 1OE9B 2BECA 1DEKA 1CDMA 1SL8A 1XO5A 4PALA 3LK1A 2CT9A 3DVJA 1DJWA 1NUBA 3I5IC 5D3OA 1QVIZ 1W9ZA 1YX8A 1WDCB 1XFZO 2BKHB 2KGRA 2LMVA 2V53A 3VRRA 4FTGA 4P2YB 5G08A 3R1VA 1CLBA 2NLNA 1DF0A 2LHIA 3ZNIA 1IG5A 4PE7A 1CM1A 1TNQA 3IQOA 4AQIA 2HF5A 1AP4A 1B8CA 2L51A 3KF9A 1JBAA 5GQQC 1C7VA 4PT1A 2F2PA 1SR6B 1T14A 3O2PA 5I94A 4AOMA 2R2IA 4C0LA 1IGVA 1M31A 1W7JB 2KFGA 1S1EA 2O5GA 2ZNEA 2IS9A 1TUJA 1ZUZA 2BBMA 3NSLA 1KFUL 3OB2B 3AAKA 4PCWA 1KWOC 4INXA 2Y4QA 4ZCUA 1EG4A 3BUOB 3SJSA 1DT7B 3I5GB 3TUYC 1NX0A 1GGWA 3GK1A 1S5GZ 1R2UA 5DKNA 3L4AA 2KI4B 1TUZA 1IIOA 1DGUA 3BUXB 2ERBA 2JOJA 2JXLA 4DCKA 1U5IA 3JVTB 1B1GA 1C07A 1SPYA 3O4XA 1TTXA 4DRWA 1UHJA 5K89A 2PASA 2HQ8A 1ZOTB 2QACA 2K61A 3BYAA 3EVRA 1NSHA 3NSKA 3QRXA 3DD4A 5ER5A 2SASA 1DJYA 1DMOA 2PALA 2K2AA 1CM4A 2BAPA 3RLZA 2H8VA 3HX4A 1GGZA 3PJIA 1J1DA 2M1KB 2M9GA 1OSAA 1V1GA 2NXQA 1M45A 1EJ3A 1Z4HA 2LVVA 3S0GA 4CIDA 3D0YA 3S0FA 2WCMA 2P71A 2JQ6A 4FQTA 4Q04A 4XJKB 2LUXA 1BLQA 2HQWA 3OP0A 1CMGA 3O78A 3LLEA 4PE0A 3DF0B 1OOIX 4DIRA 3BOWA 1TNXA 2WCFA 3S0BA 4CLNA 1RECA 1QV1A 2OS8C 5JOLA 5I2OA 3UNWA 4XJKA 4GGNA 2F33A 1B7TZ 1CDLA 3B87A 1M46A 1YX7A 1TIZA 3B6XA 2PMYA 3DYEA 2M1UA 4GGFA 4PE4A 2L4IA 1CKKA 4M2OA 4A4BA 2JNFA 1B4CA 2JT3A 1BODA 3CDNA 2LVJA 3R1OA 3AKBA 4NDBA 3CTNA 2YGUA 2ZKMX 3FE6A 5D7FA 2PQLA 1B47A 3SG2A 5DICA 4GFTA 3D74A 1BG1A 2OTGB 2KHNA 2MJWB 3I5FB 4AQJA 3IQQA 1DVIA 5I2LA 4CFRA 4MVFA 1RWYA 1TNWA 1Y1XA 2H2KA 5HKYA 2ISDA 2LCPA 1QX7A 2K7CA 2LM5A 5PALA 2KAVA 2JULA 2LV7A 3SS3A 1M39A 3OX6A 2LLSA 3DXLA 4JWQA 3D77A 1CFDA 2CBLA 4YGDB 1SNLA 4YGEB 2FJYA 1K9PA 3BXKA 1SMGA 3PSRA 1K94A 1QATA 2HPSA 1B8RA 2KFFA 3KPXA 3NHIA 4JD9A 3FE9A 5TNCA 1AJ5A 5J3XA 3VB1A 2I94A 1FI5A 1OW4A 1CDPA 4YGBB 3NSOA 2LLUA 1W7IB 2Y5IA 4ORBB 2LANA 1A75A 1Y0VH 2KAXA 4PHNA 1WRKA 2EHBA 3AAJA 4GGFC 4DUQA 1BJFA 1EXRA 4C0KA 1AUIB 1UWOA 4GAOA 1KFXL 1Q80A 1E8AA 2WOSA 1DGVA 1XFXO 1K93D 2M0RA 2MRDA 3CZTX 1PVAA 3Q8IA 1BF5A 3E3RA 2P6BB 3S0DA 2K0JA 1WRLA 1JF0A 1YURA 1CLLA 1TNPA 2WCKA 1C7WA 3A4UB 2L4HA 1OOHA 5HKWA 2GGZA 4PHMA 1JF2A 2KYCA 1J1EA 2M7NA 3DVKA 2BE6A 3PFVA 1JFKA 5AEQA 2P70A 2KFHA 2AAOA 2JZIA 5HKZA 3DY9A 1WLMA 3BQ3A 3F45A 4USLA 4ZCVA 4NQGA 3SG4A 1JFJA 1PK0D 1YUTA 1XK4C 2B1UA 1DJIA 2M29A 2OPOA 3DVMA 1A4PA 1UHIA 2LMUA 1YRUB 1ZMZA 3BFHA 4FQOA 4YRUA 3CS1A 1KQMB 3R1PA 4CFQA 1QLKA 5HL1A 2QEBA 3FWCA 1OMRA 2LUCA 4I5KA 1OOFA 1KCYA 3CZ2A 2PVBA 1GJYA 1L2OB 3WNXB 3SIAA 3SS4A 1SSEB 1WY9A 4M2PA 2KSPA 4MLWA 5FI2A 1CB1A 2F8PA 2LLTA 2OS8B 1ZACA 2MAZA 4MBEA 3CGAA 1KK8B 5HLVA 1S6IA 2GTEA 2ZN8A 3FWBA 1J7OA 5KU1A 1ZFSA 4NDCA 3WHUB 1NX1A 1IQ3A 1IJ6A 2E30A 5KTYA 1M63B 1K96A 1IH0A 4GBAA 2KQYA 1TN4A 5BPJA 2JNXA 5AXIA 1PVBA 2BNXA 3NXAA 4HRHA 4BY4A 2L5YA 1KFUS 1OOGA 3TDZA 3EK8A 3BUNB 2JC2A 1QIWA 1CNPA 1J7PA 3LCPC 1A2XA 5EL2A 5HYDA 1PULA 1UHKA 1NCZA 5CSNA 1QVIY 3DZTA 3IVTA 1QS7A 2KQ6A
chains in the Genus database with same CATH topology
3D75A 3L4LA 2L2CA 3CABA 2QDIA 3DXLA 3L47A 3D77A 1LS8A 3V2LA 2FJYA 3NGVA 3S0FA 3QMEA 3VB1A 3NHIA 4JD9A 3FE9A 3R1VA 1OW4A 3RZSA 3N7HA 3S0AA 4PT1A 1C3ZA 2QEHA 3BFBA 1T14A 3S0EA 1DQEA 1TUJA 3Q8IA 2KPHA 4INXA 3S0DA 3D73A 2QEVA 2WCKA 3L4AA 1OOHA 2ERBA 2P70A 3K1EA 3DY9A 3CYZA 1ORGA 3B7AA 2JPOA 2WCLA 3CZ1A 3OGNA 2WCHA 2WCJA 3BFHA 1P28A 3R1PA 2H8VA 2WC6A 3PJIA 2QEBA 3R72A 3B88A 3D76A 1OOFA 3BJHA 3CZ2A 3S0GA 2WCMA 2P71A 4FQTA 2WC5A 3B86A 3CZ0A 2QEOA 3NHTA 1OOIX 2GTEA 3S0BA 4OZDA 4INWA 1QWVA 3B87A 4F7FA 3B6XA 1XFRA 3DYEA 3BFAA 1OOGA 1GM0A 3FE8A 1TWOA 3D78A 1C3YA 5EL2A 3CDNA 3R1OA 3DZTA 3FE6A 2PQLA 5DICA 3D74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D75 A;  3L4L A;  2L2C A;  3CAB A;  2QDI A;  3DXL A;  3L47 A;  3D77 A;  1LS8 A;  3V2L A;  2FJY A;  3NGV A;  3S0F A;  3QME A;  3VB1 A;  3NHI A;  4JD9 A;  3FE9 A;  3R1V A;  1OW4 A;  3RZS A;  3N7H A;  3S0A A;  4PT1 A;  1C3Z A;  2QEH A;  3BFB A;  1T14 A;  3S0E A;  1DQE A;  1TUJ A;  3Q8I A;  2KPH A;  4INX A;  3S0D A;  3D73 A;  2QEV A;  2WCK A;  3L4A A;  1OOH A;  2ERB A;  2P70 A;  3K1E A;  3DY9 A;  3CYZ A;  1ORG A;  3B7A A;  2JPO A;  2WCL A;  3CZ1 A;  3OGN A;  2WCH A;  2WCJ A;  3BFH A;  1P28 A;  3R1P A;  2H8V A;  2WC6 A;  3PJI A;  2QEB A;  3R72 A;  3B88 A;  3D76 A;  1OOF A;  3BJH A;  3CZ2 A;  3S0G A;  2WCM A;  2P71 A;  4FQT A;  2WC5 A;  3B86 A;  3CZ0 A;  2QEO A;  3NHT A;  1OOI X;  2GTE A;  3S0B A;  4OZD A;  4INW A;  1QWV A;  3B87 A;  4F7F A;  3B6X A;  1XFR A;  3DYE A;  3BFA A;  1OOG A;  1GM0 A;  3FE8 A;  1TWO A;  3D78 A;  1C3Y A;  5EL2 A;  3CDN A;  3R1O A;  3DZT A;  3FE6 A;  2PQL A;  5DIC A;  3D74 A; 
#chains in the Genus database with same CATH topology
 3D75 A;  4NDD A;  1KK7 Z;  1WDC C;  1K95 A;  1SKT A;  3A8R A;  1J7R A;  2PYQ A;  2L98 A;  2WCB A;  2LAP A;  1XA5 A;  4YGC B;  1UUR A;  4BY5 A;  2GV5 A;  4XYN A;  1S26 D;  1SR6 C;  1SK6 D;  2WND A;  1SCM B;  1BR4 B;  2QDI A;  3PAL A;  1K9K A;  3TZ1 A;  1PRW A;  4N5X A;  2EC6 C;  1F55 A;  5CSF A;  1LA3 A;  1LS8 A;  3DF0 A;  5FI7 A;  2BCX A;  3NGV A;  3UO9 A;  1S5G Y;  2FCD A;  3QME A;  4I5L B;  1AK8 A;  4I5J A;  4HRG A;  4P5O E;  3I5G C;  3RZS A;  2JT0 A;  3OX5 A;  2COL B;  2KBI A;  3N7H A;  1UUS A;  2JXC A;  2KI4 C;  5DKR A;  1CFF A;  2PSR A;  3HCM A;  3AKA A;  4QJ5 B;  4UPG A;  3BUM B;  2BL0 B;  2KYF A;  5FI6 A;  1DJX A;  3JVT C;  4YGA A;  2AUC A;  3SG6 A;  1S36 A;  1YVL A;  3FS7 A;  1NX2 A;  3VRN A;  2EGD A;  3K21 A;  1OOJ A;  1UHH A;  2AMI A;  1S6J A;  2KI6 D;  1RTP 1;  1D1O A;  1A29 A;  3NSI A;  3EG5 B;  3I5I B;  2ZFD A;  5DKQ A;  5AFP A;  1PAL A;  3I5H C;  2G2B A;  1J55 A;  2Q4U A;  1QTX A;  4N1F A;  1SW8 A;  1YUU A;  4GNK B;  3D73 A;  2QEV A;  3VRO A;  1DJG A;  2LHL A;  1QX2 A;  1QAS A;  4CPV A;  1NP8 A;  5B8I B;  1QIV A;  4JKT A;  4MZL A;  1J7Q A;  3K1E A;  1F4Q A;  3KO0 A;  1K8U A;  1ORG A;  3B7A A;  4QJ4 B;  3RM1 A;  2WCL A;  5FYX A;  1A03 A;  5HLO A;  2CNP A;  1CFC A;  2F3Z A;  3OGN A;  4HRE E;  2KAY A;  4A4C A;  4JQ0 D;  2LP3 A;  1KWO B;  4YI8 A;  1F4O A;  1ALW A;  1YUS A;  2WCJ A;  3SIB A;  4WRI A;  1P28 A;  3TUY B;  1B7T Y;  1XVJ A;  1FW4 A;  2SCP A;  3H4S E;  2FJU B;  3WXA A;  1Y1A A;  1OZS A;  2Y1M A;  3CWG A;  4E68 A;  1DEL A;  3R72 A;  3PM2 A;  1AVS A;  1F54 A;  1N0Y A;  3BUW B;  3O4Y A;  1MUX A;  1NCX A;  4MN0 A;  4YI9 A;  3ZWH A;  1SY9 A;  2BCA A;  2L0P A;  2A4J A;  2ZRS A;  4OCI A;  3CZ0 A;  2JT8 A;  3TDI A;  5I8N A;  3EK7 A;  1CMF A;  1MF8 B;  2ZN9 A;  2Q91 A;  3NHT A;  2GGM A;  2LVI A;  1X02 A;  4MZJ A;  2KNE A;  2NZ0 A;  2OTG C;  5CSI A;  4PHJ A;  1YR5 A;  1OMD A;  2CCM A;  1TRF A;  1N2D A;  4PHK A;  4INW A;  1HQV A;  1N65 A;  1RK9 A;  2QPT A;  3CR2 A;  4U8D A;  1LXF C;  1WRZ A;  3EKH A;  1QWV A;  1KFX S;  2I2R E;  1H4B A;  1NPQ A;  1NCY A;  2JTT A;  1XFR A;  1NIW A;  5AAN A;  1IJ5 A;  3VRP A;  1MXE A;  1YTZ C;  2WC8 A;  1IRJ A;  1TWO A;  3IF7 A;  3PN7 B;  3D78 A;  2K8M B;  3GK2 A;  1MQ1 A;  3TDU A;  2K7B A;  1C3Y A;  1H8B A;  1FF1 A;  2K7D A;  2KI6 C;  1SL9 A;  2WCE A;  3CLN A;  3D10 A;  4MSP A;  5IBW A;  2BBN A;  2F3Y A;  3SG3 A;  1KSM A;  3EK4 A;  3S0E A;  2KLE A;  4YBH B;  1IWQ A;  1CDN A;  3LK0 A;  1QLS A;  2KBM A;  2I18 A;  2L5X B;  3L4L A;  3SG5 A;  1LVC D;  2JPT A;  2TN4 A;  1OZO A;  2MA2 A;  1BU3 A;  4ORC B;  2EC6 B;  4ICB A;  2K7O A;  2NCP A;  1JWD A;  3O6B A;  5I2Q A;  1U5I B;  1EH2 A;  3C1V A;  3JTD C;  2LMT A;  1R6P A;  3OB1 B;  4MRX A;  4IL1 A;  2JRF A;  1BMO A;  1XFV O;  2G9B A;  2JTZ A;  1JUO A;  3V2L A;  2ZRT A;  1CFP A;  3FIA A;  3TS5 C;  1OMV A;  4HSZ A;  1G8I A;  1MWN A;  3S0A A;  3MSE B;  4JPZ B;  4OV2 A;  1DJZ A;  1L7Z A;  1EG3 A;  1BR1 B;  1C3Z A;  1UP5 A;  2KOT A;  2QEH A;  3BFB A;  1Z2C B;  1V1F A;  1Y6W A;  4PE1 A;  4KYN A;  1MR8 A;  1HT9 A;  3D0Y B;  3I5H B;  1DQE A;  2D8N A;  2K60 A;  4OR9 B;  1XFY O;  2BCB A;  2F2O A;  3PAT A;  5JJG A;  1Y1U A;  2H61 A;  2KGB C;  2LVK A;  1LKJ A;  2KPH A;  2O60 A;  1S6C A;  3BOW B;  1IQ5 A;  1XFU O;  2MLE C;  1KQM C;  3EVV A;  4I5N B;  4C0J A;  1ALV A;  1NWD A;  2MLF C;  2LP2 A;  3GOF A;  5CSJ A;  3WHT B;  4D1E A;  2CXJ A;  1FI6 A;  1RRO A;  3GK4 X;  3PM8 A;  3CYZ A;  1UHN A;  1L2O C;  2JPO A;  1EL4 A;  4GPL B;  1K90 D;  1G4Y R;  1XYD A;  1NYA A;  1MXL C;  2MHH A;  3CZ1 A;  2LE9 B;  1QJT A;  2RGI A;  1FBV A;  3PN7 C;  5D69 A;  1CLM A;  2WCH A;  1BT6 A;  1KK8 C;  1KSO A;  2L2E A;  5F6T A;  1RFJ A;  1OQP A;  3OHM B;  4TNC A;  3CR4 X;  4OKH A;  2WC6 A;  3SG7 A;  4WQ2 A;  1KQV A;  3ICB A;  2ZND A;  5KSZ A;  2K2F A;  1DJH A;  3B88 A;  2I7A A;  4ETO A;  2MBX A;  1QX5 B;  2M97 A;  4F0Z B;  1SL7 A;  3D76 A;  3BJH A;  2JWW A;  1QV0 A;  3CR5 X;  1DC1 A;  1YRT B;  2WC5 A;  4PDZ A;  3B86 A;  2KDH A;  1LIN A;  5ER4 X;  1BOC A;  2QEO A;  1RJV A;  1DTL A;  1JC2 A;  4R1E A;  1G33 A;  1KK7 Y;  3KHE A;  3VRQ A;  1FPW A;  1B8L A;  2WOR A;  2CTN A;  1PSR A;  1IKU A;  2H61 C;  3VGO A;  2PRU A;  4N1G A;  4WQ3 A;  4OZD A;  1CTR A;  3PLF B;  2LNK A;  2LC5 A;  1K9U A;  1TCO B;  4MZK A;  2M3W A;  2HET A;  3EKJ A;  1XK4 A;  1SYM A;  3DVE A;  3KEV A;  4F7F A;  2FOT A;  2L50 A;  2M7L A;  2DOQ A;  3BFA A;  5AER A;  1GM0 A;  1A75 B;  4MEW A;  1YVH A;  2JU0 A;  3FE8 A;  3OBV A;  1VRK A;  1LA0 A;  5CPV A;  1SCM C;  2BE4 A;  1AJ4 A;  1PSB A;  2BKI B;  4IJ7 A;  1S3P A;  4M2Q A;  4QJ3 B;  1AHR A;  2E6W A;  2VRG A;  1TOP A;  1WLZ A;  2NCO A;  1JSA A;  1QXP A;  1SBJ A;  3SS5 A;  1F8H A;  1SCV A;  4L9M A;  1MHO A;  4MRY A;  1ODB A;  1XFW O;  2FCE A;  2M49 B;  3JTD B;  2Y1N A;  2L2C A;  1F71 A;  3CAB A;  1NX3 A;  1SRA A;  3EVU A;  3I5F C;  1TCF A;  2BL0 C;  4GUK A;  3M0W A;  1GQM A;  1DF0 B;  4DS7 A;  2M8U A;  3LL8 B;  1F70 A;  4ORA B;  3TS5 B;  1B9A A;  3L47 A;  1K2H A;  2KLD A;  4OVN F;  1OE9 B;  2BEC A;  1DEK A;  1CDM A;  1SL8 A;  1XO5 A;  4PAL A;  3LK1 A;  2CT9 A;  3DVJ A;  1DJW A;  1NUB A;  3I5I C;  5D3O A;  1QVI Z;  1W9Z A;  1YX8 A;  1WDC B;  1XFZ O;  2BKH B;  2KGR A;  2LMV A;  2V53 A;  3VRR A;  4FTG A;  4P2Y B;  5G08 A;  3R1V A;  1CLB A;  2NLN A;  1DF0 A;  2LHI A;  3ZNI A;  1IG5 A;  4PE7 A;  1CM1 A;  1TNQ A;  3IQO A;  4AQI A;  2HF5 A;  1AP4 A;  1B8C A;  2L51 A;  3KF9 A;  1JBA A;  5GQQ C;  1C7V A;  4PT1 A;  2F2P A;  1SR6 B;  1T14 A;  3O2P A;  5I94 A;  4AOM A;  2R2I A;  4C0L A;  1IGV A;  1M31 A;  1W7J B;  2KFG A;  1S1E A;  2O5G A;  2ZNE A;  2IS9 A;  1TUJ A;  1ZUZ A;  2BBM A;  3NSL A;  1KFU L;  3OB2 B;  3AAK A;  4PCW A;  1KWO C;  4INX A;  2Y4Q A;  4ZCU A;  1EG4 A;  3BUO B;  3SJS A;  1DT7 B;  3I5G B;  3TUY C;  1NX0 A;  1GGW A;  3GK1 A;  1S5G Z;  1R2U A;  5DKN A;  3L4A A;  2KI4 B;  1TUZ A;  1IIO A;  1DGU A;  3BUX B;  2ERB A;  2JOJ A;  2JXL A;  4DCK A;  1U5I A;  3JVT B;  1B1G A;  1C07 A;  1SPY A;  3O4X A;  1TTX A;  4DRW A;  1UHJ A;  5K89 A;  2PAS A;  2HQ8 A;  1ZOT B;  2QAC A;  2K61 A;  3BYA A;  3EVR A;  1NSH A;  3NSK A;  3QRX A;  3DD4 A;  5ER5 A;  2SAS A;  1DJY A;  1DMO A;  2PAL A;  2K2A A;  1CM4 A;  2BAP A;  3RLZ A;  2H8V A;  3HX4 A;  1GGZ A;  3PJI A;  1J1D A;  2M1K B;  2M9G A;  1OSA A;  1V1G A;  2NXQ A;  1M45 A;  1EJ3 A;  1Z4H A;  2LVV A;  3S0G A;  4CID A;  3D0Y A;  3S0F A;  2WCM A;  2P71 A;  2JQ6 A;  4FQT A;  4Q04 A;  4XJK B;  2LUX A;  1BLQ A;  2HQW A;  3OP0 A;  1CMG A;  3O78 A;  3LLE A;  4PE0 A;  3DF0 B;  1OOI X;  4DIR A;  3BOW A;  1TNX A;  2WCF A;  3S0B A;  4CLN A;  1REC A;  1QV1 A;  2OS8 C;  5JOL A;  5I2O A;  3UNW A;  4XJK A;  4GGN A;  2F33 A;  1B7T Z;  1CDL A;  3B87 A;  1M46 A;  1YX7 A;  1TIZ A;  3B6X A;  2PMY A;  3DYE A;  2M1U A;  4GGF A;  4PE4 A;  2L4I A;  1CKK A;  4M2O A;  4A4B A;  2JNF A;  1B4C A;  2JT3 A;  1BOD A;  3CDN A;  2LVJ A;  3R1O A;  3AKB A;  4NDB A;  3CTN A;  2YGU A;  2ZKM X;  3FE6 A;  5D7F A;  2PQL A;  1B47 A;  3SG2 A;  5DIC A;  4GFT A;  3D74 A;  1BG1 A;  2OTG B;  2KHN A;  2MJW B;  3I5F B;  4AQJ A;  3IQQ A;  1DVI A;  5I2L A;  4CFR A;  4MVF A;  1RWY A;  1TNW A;  1Y1X A;  2H2K A;  5HKY A;  2ISD A;  2LCP A;  1QX7 A;  2K7C A;  2LM5 A;  5PAL A;  2KAV A;  2JUL A;  2LV7 A;  3SS3 A;  1M39 A;  3OX6 A;  2LLS A;  3DXL A;  4JWQ A;  3D77 A;  1CFD A;  2CBL A;  4YGD B;  1SNL A;  4YGE B;  2FJY A;  1K9P A;  3BXK A;  1SMG A;  3PSR A;  1K94 A;  1QAT A;  2HPS A;  1B8R A;  2KFF A;  3KPX A;  3NHI A;  4JD9 A;  3FE9 A;  5TNC A;  1AJ5 A;  5J3X A;  3VB1 A;  2I94 A;  1FI5 A;  1OW4 A;  1CDP A;  4YGB B;  3NSO A;  2LLU A;  1W7I B;  2Y5I A;  4ORB B;  2LAN A;  1A75 A;  1Y0V H;  2KAX A;  4PHN A;  1WRK A;  2EHB A;  3AAJ A;  4GGF C;  4DUQ A;  1BJF A;  1EXR A;  4C0K A;  1AUI B;  1UWO A;  4GAO A;  1KFX L;  1Q80 A;  1E8A A;  2WOS A;  1DGV A;  1XFX O;  1K93 D;  2M0R A;  2MRD A;  3CZT X;  1PVA A;  3Q8I A;  1BF5 A;  3E3R A;  2P6B B;  3S0D A;  2K0J A;  1WRL A;  1JF0 A;  1YUR A;  1CLL A;  1TNP A;  2WCK A;  1C7W A;  3A4U B;  2L4H A;  1OOH A;  5HKW A;  2GGZ A;  4PHM A;  1JF2 A;  2KYC A;  1J1E A;  2M7N A;  3DVK A;  2BE6 A;  3PFV A;  1JFK A;  5AEQ A;  2P70 A;  2KFH A;  2AAO A;  2JZI A;  5HKZ A;  3DY9 A;  1WLM A;  3BQ3 A;  3F45 A;  4USL A;  4ZCV A;  4NQG A;  3SG4 A;  1JFJ A;  1PK0 D;  1YUT A;  1XK4 C;  2B1U A;  1DJI A;  2M29 A;  2OPO A;  3DVM A;  1A4P A;  1UHI A;  2LMU A;  1YRU B;  1ZMZ A;  3BFH A;  4FQO A;  4YRU A;  3CS1 A;  1KQM B;  3R1P A;  4CFQ A;  1QLK A;  5HL1 A;  2QEB A;  3FWC A;  1OMR A;  2LUC A;  4I5K A;  1OOF A;  1KCY A;  3CZ2 A;  2PVB A;  1GJY A;  1L2O B;  3WNX B;  3SIA A;  3SS4 A;  1SSE B;  1WY9 A;  4M2P A;  2KSP A;  4MLW A;  5FI2 A;  1CB1 A;  2F8P A;  2LLT A;  2OS8 B;  1ZAC A;  2MAZ A;  4MBE A;  3CGA A;  1KK8 B;  5HLV A;  1S6I A;  2GTE A;  2ZN8 A;  3FWB A;  1J7O A;  5KU1 A;  1ZFS A;  4NDC A;  3WHU B;  1NX1 A;  1IQ3 A;  1IJ6 A;  2E30 A;  5KTY A;  1M63 B;  1K96 A;  1IH0 A;  4GBA A;  2KQY A;  1TN4 A;  5BPJ A;  2JNX A;  5AXI A;  1PVB A;  2BNX A;  3NXA A;  4HRH A;  4BY4 A;  2L5Y A;  1KFU S;  1OOG A;  3TDZ A;  3EK8 A;  3BUN B;  2JC2 A;  1QIW A;  1CNP A;  1J7P A;  3LCP C;  1A2X A;  5EL2 A;  5HYD A;  1PUL A;  1UHK A;  1NCZ A;  5CSN A;  1QVI Y;  3DZT A;  3IVT A;  1QS7 A;  2KQ6 A; 
#chains in the Genus database with same CATH homology
 3D75 A;  3L4L A;  2L2C A;  3CAB A;  2QDI A;  3DXL A;  3L47 A;  3D77 A;  1LS8 A;  3V2L A;  2FJY A;  3NGV A;  3S0F A;  3QME A;  3VB1 A;  3NHI A;  4JD9 A;  3FE9 A;  3R1V A;  1OW4 A;  3RZS A;  3N7H A;  3S0A A;  4PT1 A;  1C3Z A;  2QEH A;  3BFB A;  1T14 A;  3S0E A;  1DQE A;  1TUJ A;  3Q8I A;  2KPH A;  4INX A;  3S0D A;  3D73 A;  2QEV A;  2WCK A;  3L4A A;  1OOH A;  2ERB A;  2P70 A;  3K1E A;  3DY9 A;  3CYZ A;  1ORG A;  3B7A A;  2JPO A;  2WCL A;  3CZ1 A;  3OGN A;  2WCH A;  2WCJ A;  3BFH A;  1P28 A;  3R1P A;  2H8V A;  2WC6 A;  3PJI A;  2QEB A;  3R72 A;  3B88 A;  3D76 A;  1OOF A;  3BJH A;  3CZ2 A;  3S0G A;  2WCM A;  2P71 A;  4FQT A;  2WC5 A;  3B86 A;  3CZ0 A;  2QEO A;  3NHT A;  1OOI X;  2GTE A;  3S0B A;  4OZD A;  4INW A;  1QWV A;  3B87 A;  4F7F A;  3B6X A;  1XFR A;  3DYE A;  3BFA A;  1OOG A;  1GM0 A;  3FE8 A;  1TWO A;  3D78 A;  1C3Y A;  5EL2 A;  3CDN A;  3R1O A;  3DZT A;  3FE6 A;  2PQL A;  5DIC A;  3D74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...