4PT1A

Crystal structure of locusta migratoria odorant binding proteins lmigobp1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
129
structure length
129
Chain Sequence
VNMKLTGRIMDAAKEVDHTCRSSTGVPRDMLHRYAEGQTVDDDDFKCYLKCIMVEFNSLSDDGVFVLEEELENVPPEIKEEGHRVVHSCKHINHDEACETAYQIHQCYKQSDPELYSLVVRAFDATIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant-binding protein 1d
publication title Crystal structure of the Locusta migratoria odorant binding protein.
pubmed doi rcsb
source organism Locusta migratoria
total genus 49
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4pt1A00
2QEHA 3NHTA 2WCMA 3K1EA 3RZSA 3CDNA 3DYEA 2WCLA 3B7AA 2WCHA 3CZ1A 5DICA 3CZ0A 3R1VA 3D75A 1XFRA 1TWOA 3BFBA 1C3ZA 3DZTA 1ORGA 2H8VA 3S0GA 2L2CA 3CZ2A 4INXA 2WCKA 3R72A 1OOGA 2FJYA 3DXLA 4OZDA 3S0EA 2JPOA 3QMEA 2QEVA 1OOIX 2WC6A 4PT1A 2WCJA 2QEOA 4JD9A 3D77A 1QWVA 2WC5A 3R1PA 1OOFA 4INWA 3CABA 3NHIA 1P28A 3D73A 2QDIA 1T14A 5EL2A 2PQLA 1LS8A 3N7HA 3VB1A 3L47A 1GM0A 3BFAA 1OOHA 2P70A 3L4LA 2KPHA 1DQEA 3Q8IA 1TUJA 3OGNA 3R1OA 3B87A 1OW4A 3NGVA 3FE8A 3D76A 3B6XA 3S0BA 2GTEA 3B88A 3L4AA 3BJHA 3D74A 3D78A 3FE6A 2QEBA 2P71A 3S0DA 3DY9A 1C3YA 4F7FA 3FE9A 3S0AA 3B86A 3V2LA 3PJIA 4FQTA 3S0FA 3BFHA 2ERBA 3CYZA
chains in the Genus database with same CATH superfamily
2KI6C 2Y5IA 1JFJA 4FTGA 2HQWA 3D0YB 1UP5A 1OMRA 2LMTA 3DYEA 1EJ3A 2K60A 1NIWA 2KFFA 3KHEA 1WLZA 4ETOA 1DVIA 2LUXA 2BBNA 2BECA 2BCXA 3JTDB 1F54A 1NYAA 1IQ3A 2LHIA 1YRUB 2F2OA 5FI7A 1Y1UA 1KCYA 1G8IA 4QJ4B 1SSEB 2IS9A 2KBIA 3R1VA 4PE0A 1H4BA 1BODA 3JTDC 1QXPA 1Y0VH 1SY9A 3H4SE 3UO9A 3DZTA 4E68A 2GV5A 3S0GA 2FJUB 1UURA 3SG3A 4UPGA 5ER4X 2H2KA 1NCXA 2HF5A 1B9AA 2AUCA 3I5IC 2ISDA 4DCKA 5FYXA 1CM4A 3SIBA 2M1UA 4NDBA 4MN0A 4XJKA 4INXA 2ZNEA 4OVNF 3VGOA 5KSZA 2LHLA 1DJXA 3R72A 1TRFA 2NCOA 4NQGA 3O4XA 2JTZA 5PALA 1NWDA 2GGMA 1BJFA 4AQIA 1KFUS 2LVIA 1F70A 4GAOA 4GGNA 4C0JA 3BXKA 2JT3A 1JFKA 2K7OA 1QV0A 2K7CA 4PT1A 5I2LA 2WCJA 5CSIA 1PVBA 1SL7A 2KI6D 4GPLB 3D77A 1WY9A 1A75A 1MXEA 1CM1A 2BAPA 1SNLA 5HKZA 3TZ1A 1KSMA 2EC6B 4CPVA 3LL8B 1ZOTB 3R1PA 4YGEB 3CZTX 1E8AA 2E30A 5HLOA 3CABA 1EH2A 2KDHA 2R2IA 5GQQC 1RWYA 2KYCA 3OB1B 1IJ6A 1YRTB 2WNDA 2CT9A 2BKHB 1J1EA 2EC6C 3O78A 1XFXO 3LK1A 3BFAA 5I94A 2P70A 2ZRSA 1NCZA 3L4LA 3PSRA 5F6TA 1TNWA 1CLLA 4D1EA 3WHUB 3KPXA 2MHHA 5FI6A 3C1VA 1S5GY 3B87A 1OZOA 3GK2A 1F4QA 2D8NA 2LVVA 3FS7A 2KQYA 1FBVA 2JWWA 2WOSA 2KFGA 3VRPA 3RLZA 2ZFDA 3CS1A 1JSAA 2LMVA 4TNCA 1NX1A 3SG6A 1CB1A 3A8RA 3FWBA 3EK4A 1J7RA 4ORAB 2OS8B 3EK7A 1K9UA 2JZIA 1EL4A 1V1FA 1MUXA 2JNXA 3BJHA 3D78A 2P71A 4HREE 2M97A 2KLDA 2M29A 2WORA 3DY9A 1ZUZA 1RFJA 1IRJA 4NDCA 5AEQA 2LCPA 2PMYA 1R2UA 2OS8C 1PSRA 2MA2A 1B1GA 1K93D 3V2LA 2H61C 3PJIA 1A4PA 1TCFA 1C7VA 4GBAA 4QJ5B 1YTZC 1CDMA 1N2DA 2MLEC 3BOWA 1B47A 4I5JA 1CMFA 3CYZA 1CLBA 1J7QA 3K1EA 1OQPA 3CDNA 1GQMA 2WCLA 1HT9A 4JWQA 1DF0B 4ICBA 4C0LA 2BBMA 1N0YA 1CFCA 1RJVA 2WCHA 2M8UA 3FIAA 1RTP1 1TOPA 1ZACA 3CZ1A 5I2QA 4OCIA 5DICA 2HETA 1K2HA 1SL9A 3CZ0A 1BG1A 5CSFA 1GJYA 1JF2A 1RROA 4IL1A 2P6BB 1F71A 1XFRA 3EVVA 3SIAA 5KTYA 4YI9A 1CLMA 1WLMA 1K94A 2LUCA 1LA0A 1ORGA 1PSBA 3KEVA 4M2QA 3SG7A 1IKUA 2H8VA 1IJ5A 3KO0A 3CWGA 4PALA 4CFQA 1V1GA 2I7AA 1YX7A 2BL0B 2LMUA 1Z4HA 2KNEA 1XFYO 4BY4A 2CBLA 2JXLA 5TNCA 2G9BA 1EG4A 2DOQA 4N5XA 2JT8A 2L2CA 1SBJA 3VRNA 1FF1A 3BUMB 3HCMA 1QATA 1DJWA 2KQ6A 1QJTA 2LP3A 1KWOB 1GGZA 2MLFC 1ODBA 2WCKA 3PLFB 4AOMA 1NSHA 1KK7Z 1OOGA 3A4UB 3DXLA 1QASA 2BL0C 5DKQA 1BF5A 3DF0A 1B7TY 4OZDA 1CDNA 2KFHA 2KGBC 4PE1A 2AMIA 1KQVA 1UWOA 1KFUL 1B8LA 2FCEA 3QMEA 4XJKB 3PN7B 1KWOC 3SG4A 1DMOA 1MXLC 3PFVA 1BU3A 2CXJA 2JT0A 2VRGA 3I5IB 3UNWA 1IWQA 3VROA 4CIDA 1L2OB 2RGIA 4CLNA 1WRKA 1M39A 1QTXA 1NX2A 2K2FA 4FQOA 2KYFA 1S6IA 4HSZA 2PYQA 1TNQA 3PN7C 3BFHA 1S6JA 4I5KA 1IG5A 1U5IA 4INWA 4C0KA 1DJHA 3NHIA 3LCPC 1P28A 1IIOA 1L2OC 1A75B 2L4HA 1MWNA 2QDIA 1W7JB 3BUNB 1GGWA 1QIVA 1YUUA 1MF8B 2KAXA 1S3PA 1A03A 1A29A 2EHBA 3PATA 1GM0A 1YUTA 5HL1A 1OOHA 4ZCVA 3OB2B 1PK0D 2KPHA 2BCAA 5I2OA 5HKYA 2M1KB 1M45A 1QVIZ 1Q80A 3IQOA 3OGNA 1LXFC 3CTNA 2QPTA 3IVTA 1OW4A 4ORCB 1J55A 1EG3A 3FE8A 1CFFA 2HQ8A 1OMVA 1DC1A 1JWDA 1XVJA 1XO5A 1PVAA 2JULA 3B6XA 1F55A 1BOCA 2JNFA 4KYNA 4YRUA 3B88A 4PE7A 1YX8A 3O6BA 1XFVO 4IJ7A 2KLEA 1NX3A 2FCDA 3BUXB 1M31A 2G2BA 1DJYA 3D74A 2F8PA 4P2YB 3WNXB 1N65A 1R6PA 1RECA 2QEBA 1G33A 2KGRA 4YGCB 4ZCUA 3S0DA 2BCBA 1K90D 2K61A 1QLKA 1LKJA 2PASA 3JVTC 3PM8A 4F7FA 1SCVA 1J7PA 3I5HB 1SK6D 4MZJA 5CSJA 1SCMB 3EG5B 1SL8A 1SPYA 1SW8A 4FQTA 5JJGA 2ZN8A 4DRWA 2JRFA 4DS7A 1AJ5A 3FWCA 4PHKA 1TIZA 2ERBA 1DT7B 2QEHA 3NHTA 3DD4A 1DJGA 1UHNA 2WCMA 3K21A 4MSPA 3RZSA 2NCPA 3I5HC 2OPOA 3EKJA 2K7BA 2F33A 1QIWA 3OX5A 1SCMC 1DJIA 2LM5A 4ORBB 2V53A 5JOLA 2YGUA 3NSKA 3BOWB 1QX5B 1PULA 2COLB 2L51A 2Y1NA 1YR5A 1YVLA 1HQVA 3QRXA 1EXRA 2JTTA 3LK0A 4GNKB 1TNPA 3IF7A 4PHMA 2PRUA 3D75A 4BY5A 2BE4A 2CTNA 2MRDA 1B8RA 2KI4B 5D69A 1FPWA 1K8UA 1AUIB 1C3ZA 1KQMB 1WDCB 1BT6A 4I5LB 5AANA 1CTRA 2O60A 1XK4A 3TDUA 1QX7A 2LLSA 2HPSA 3O4YA 1FI5A 5BPJA 1MQ1A 3TS5B 1LA3A 1KK8B 3TUYB 1G4YR 3EVRA 5FI2A 1UHHA 2I2RE 1B8CA 2L5YA 2KI4C 4USLA 5AXIA 3HX4A 1KQMC 1WDCC 2QACA 4I5NB 5AERA 3BQ3A 3CGAA 5I8NA 1CDLA 1DTLA 2NXQA 3NSIA 2WCEA 1YURA 5HKWA 3CZ2A 3TS5C 1KK8C 1NPQA 3PALA 3TUYC 2SASA 1S5GZ 3OP0A 2FJYA 2I18A 2JXCA 2LV7A 1JC2A 3NXAA 2WCFA 3DVJA 2L5XB 1CNPA 3S0EA 1M63B 2L50A 4OR9B 2JPOA 2LAPA 3BYAA 3M0WA 2LNKA 2QEVA 3SS4A 1TTXA 1OOIX 2WC6A 4XYNA 3ZWHA 4PDZA 2KOTA 4OV2A 1F4OA 2L2EA 3OBVA 2M9GA 1KFXS 3DF0B 4MLWA 4JKTA 4HRHA 1QWVA 2WC5A 2BKIB 1UHKA 2PALA 1WRZA 2KBMA 3I5FB 3CR5X 3DVEA 4DIRA 4M2PA 1CFPA 2LLUA 1OOFA 1DGUA 1BR1B 1TN4A 2Q4UA 2M7NA 4YBHB 5KU1A 1BMOA 1QS7A 1S1EA 1MR8A 4PHNA 1X02A 5ER5A 3F45A 2LC5A 2KHNA 2PQLA 2B1UA 3I5FC 1BLQA 3VB1A 1WRLA 3L47A 2M7LA 3NSLA 2AAOA 2ZKMX 4P5OE 3GK4X 1DQEA 3Q8IA 1AHRA 1TUJA 3AAKA 1Z2CB 5K89A 2JQ6A 3NGVA 4GGFA 2NZ0A 2L98A 3CR2A 5D7FA 1QLSA 2Y4QA 3KF9A 2GGZA 1C07A 1QVIY 2GTEA 3I5GB 2K2AA 4MZKA 3ZNIA 1TUZA 2JU0A 2M3WA 1H8BA 1CMGA 5B8IB 1MHOA 1RK9A 4F0ZB 1C3YA 4PHJA 2WCBA 1LINA 1DJZA 2ZN9A 3FE9A 3OX6A 3VRRA 2LVJA 1C7WA 2ZRTA 3B86A 3D0YA 3I5GC 3S0AA 5J3XA 4PCWA 4MEWA 1M46A 3OHMB 5DKNA 1FW4A 1B7TZ 2CNPA 2KAYA 3VRQA 2KSPA 1KSOA 3GOFA 3SG2A 3B7AA 1FI6A 3JVTB 4WQ2A 2K8MB 2LE9B 1S26D 1YVHA 1ALVA 3DVKA 2MAZA 4MRYA 1SMGA 2SCPA 1L7ZA 1BR4B 4N1GA 3BUOB 2FOTA 1UHJA 4YGDB 1DEKA 1TWOA 2MJWB 3MSEB 5HYDA 1NCYA 3BFBA 2M49B 2M0RA 1CKKA 2K0JA 2JC2A 1AJ4A 1S6CA 2L4IA 4GFTA 4L9MA 3AKAA 3EVUA 1K96A 1SKTA 3NSOA 3E3RA 3RM1A 4M2OA 2LVKA 1Y1AA 2PSRA 2BNXA 2I94A 2L0PA 3SS3A 1PRWA 5HLVA 2LANA 1K9KA 1ZFSA 1QV1A 2Q91A 1K95A 4YGAA 1JBAA 1S36A 2MBXA 2ZNDA 1YUSA 1UUSA 1XA5A 2F3ZA 2Y1MA 2F3YA 3AAJA 2PVBA 1XK4C 4AQJA 5G08A 3WXAA 1CFDA 1F8HA 3TDIA 4MVFA 3BUWB 1QX2A 4WQ3A 3SJSA 1TNXA 1ALWA 3O2PA 2QEOA 1CDPA 3PM2A 1ZMZA 4JD9A 1OOJA 1SR6B 2LLTA 4QJ3B 4U8DA 4DUQA 2NLNA 3EK8A 1KFXL 3D10A 3TDZA 3ICBA 2CCMA 1AK8A 1NUBA 1OMDA 1OSAA 1IQ5A 1XFWO 2BE6A 4JQ0D 4WRIA 5AFPA 3GK1A 4N1FA 3LLEA 2LP2A 2A4JA 5CPVA 1XFUO 4GUKA 4JPZB 1SR6C 5CSNA 3D73A 1SRAA 2F2PA 4MBEA 4CFRA 1SYMA 1J1DA 1T14A 5EL2A 4A4BA 1LS8A 3N7HA 1A2XA 4HRGA 2E6WA 3CLNA 2O5GA 1OE9B 1Y1XA 1XYDA 4PE4A 4YGBB 1J7OA 4OKHA 5D3OA 1B4CA 3IQQA 3SS5A 3R1OA 4MZLA 4Q04A 4MRXA 1KK7Y 1K9PA 2WC8A 2JPTA 1NP8A 3CR4X 1AP4A 2H61A 1W9ZA 1D1OA 1W7IB 3D76A 3WHTB 3DVMA 2JOJA 3S0BA 1JF0A 1OZSA 2K7DA 5DKRA 1DGVA 1Y6WA 3SG5A 1UHIA 1NX0A 3L4AA 2KAVA 1TCOB 2OTGB 3AKBA 4A4CA 3FE6A 4R1EA 2EGDA 1JUOA 5IBWA 1U5IB 1DELA 1LVCD 3EKHA 4YI8A 1IH0A 1VRKA 2OTGC 1DF0A 4GGFC 2TN4A 1PALA 3S0FA 1IGVA 4NDDA 1XFZO 1AVSA
chains in the Genus database with same CATH topology
2QEHA 3NHTA 2WCMA 3K1EA 3RZSA 3CDNA 3DYEA 2WCLA 3B7AA 2WCHA 3CZ1A 5DICA 3CZ0A 3R1VA 3D75A 1XFRA 1TWOA 3BFBA 1C3ZA 3DZTA 1ORGA 2H8VA 3S0GA 2L2CA 3CZ2A 4INXA 2WCKA 3R72A 1OOGA 2FJYA 3DXLA 4OZDA 3S0EA 2JPOA 3QMEA 2QEVA 1OOIX 2WC6A 4PT1A 2WCJA 2QEOA 4JD9A 3D77A 1QWVA 2WC5A 3R1PA 1OOFA 4INWA 3CABA 3NHIA 1P28A 3D73A 2QDIA 1T14A 5EL2A 2PQLA 1LS8A 3N7HA 3VB1A 3L47A 1GM0A 3BFAA 1OOHA 2P70A 3L4LA 2KPHA 1DQEA 3Q8IA 1TUJA 3OGNA 3R1OA 3B87A 1OW4A 3NGVA 3FE8A 3D76A 3B6XA 3S0BA 2GTEA 3B88A 3L4AA 3BJHA 3D74A 3D78A 3FE6A 2QEBA 2P71A 3S0DA 3DY9A 1C3YA 4F7FA 3FE9A 3S0AA 3B86A 3V2LA 3PJIA 4FQTA 3S0FA 3BFHA 2ERBA 3CYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEH A;  3NHT A;  2WCM A;  3K1E A;  3RZS A;  3CDN A;  3DYE A;  2WCL A;  3B7A A;  2WCH A;  3CZ1 A;  5DIC A;  3CZ0 A;  3R1V A;  3D75 A;  1XFR A;  1TWO A;  3BFB A;  1C3Z A;  3DZT A;  1ORG A;  2H8V A;  3S0G A;  2L2C A;  3CZ2 A;  4INX A;  2WCK A;  3R72 A;  1OOG A;  2FJY A;  3DXL A;  4OZD A;  3S0E A;  2JPO A;  3QME A;  2QEV A;  1OOI X;  2WC6 A;  4PT1 A;  2WCJ A;  2QEO A;  4JD9 A;  3D77 A;  1QWV A;  2WC5 A;  3R1P A;  1OOF A;  4INW A;  3CAB A;  3NHI A;  1P28 A;  3D73 A;  2QDI A;  1T14 A;  5EL2 A;  2PQL A;  1LS8 A;  3N7H A;  3VB1 A;  3L47 A;  1GM0 A;  3BFA A;  1OOH A;  2P70 A;  3L4L A;  2KPH A;  1DQE A;  3Q8I A;  1TUJ A;  3OGN A;  3R1O A;  3B87 A;  1OW4 A;  3NGV A;  3FE8 A;  3D76 A;  3B6X A;  3S0B A;  2GTE A;  3B88 A;  3L4A A;  3BJH A;  3D74 A;  3D78 A;  3FE6 A;  2QEB A;  2P71 A;  3S0D A;  3DY9 A;  1C3Y A;  4F7F A;  3FE9 A;  3S0A A;  3B86 A;  3V2L A;  3PJI A;  4FQT A;  3S0F A;  3BFH A;  2ERB A;  3CYZ A; 
#chains in the Genus database with same CATH topology
 2KI6 C;  2Y5I A;  1JFJ A;  4FTG A;  2HQW A;  3D0Y B;  1UP5 A;  1OMR A;  2LMT A;  3DYE A;  1EJ3 A;  2K60 A;  1NIW A;  2KFF A;  3KHE A;  1WLZ A;  4ETO A;  1DVI A;  2LUX A;  2BBN A;  2BEC A;  2BCX A;  3JTD B;  1F54 A;  1NYA A;  1IQ3 A;  2LHI A;  1YRU B;  2F2O A;  5FI7 A;  1Y1U A;  1KCY A;  1G8I A;  4QJ4 B;  1SSE B;  2IS9 A;  2KBI A;  3R1V A;  4PE0 A;  1H4B A;  1BOD A;  3JTD C;  1QXP A;  1Y0V H;  1SY9 A;  3H4S E;  3UO9 A;  3DZT A;  4E68 A;  2GV5 A;  3S0G A;  2FJU B;  1UUR A;  3SG3 A;  4UPG A;  5ER4 X;  2H2K A;  1NCX A;  2HF5 A;  1B9A A;  2AUC A;  3I5I C;  2ISD A;  4DCK A;  5FYX A;  1CM4 A;  3SIB A;  2M1U A;  4NDB A;  4MN0 A;  4XJK A;  4INX A;  2ZNE A;  4OVN F;  3VGO A;  5KSZ A;  2LHL A;  1DJX A;  3R72 A;  1TRF A;  2NCO A;  4NQG A;  3O4X A;  2JTZ A;  5PAL A;  1NWD A;  2GGM A;  1BJF A;  4AQI A;  1KFU S;  2LVI A;  1F70 A;  4GAO A;  4GGN A;  4C0J A;  3BXK A;  2JT3 A;  1JFK A;  2K7O A;  1QV0 A;  2K7C A;  4PT1 A;  5I2L A;  2WCJ A;  5CSI A;  1PVB A;  1SL7 A;  2KI6 D;  4GPL B;  3D77 A;  1WY9 A;  1A75 A;  1MXE A;  1CM1 A;  2BAP A;  1SNL A;  5HKZ A;  3TZ1 A;  1KSM A;  2EC6 B;  4CPV A;  3LL8 B;  1ZOT B;  3R1P A;  4YGE B;  3CZT X;  1E8A A;  2E30 A;  5HLO A;  3CAB A;  1EH2 A;  2KDH A;  2R2I A;  5GQQ C;  1RWY A;  2KYC A;  3OB1 B;  1IJ6 A;  1YRT B;  2WND A;  2CT9 A;  2BKH B;  1J1E A;  2EC6 C;  3O78 A;  1XFX O;  3LK1 A;  3BFA A;  5I94 A;  2P70 A;  2ZRS A;  1NCZ A;  3L4L A;  3PSR A;  5F6T A;  1TNW A;  1CLL A;  4D1E A;  3WHU B;  3KPX A;  2MHH A;  5FI6 A;  3C1V A;  1S5G Y;  3B87 A;  1OZO A;  3GK2 A;  1F4Q A;  2D8N A;  2LVV A;  3FS7 A;  2KQY A;  1FBV A;  2JWW A;  2WOS A;  2KFG A;  3VRP A;  3RLZ A;  2ZFD A;  3CS1 A;  1JSA A;  2LMV A;  4TNC A;  1NX1 A;  3SG6 A;  1CB1 A;  3A8R A;  3FWB A;  3EK4 A;  1J7R A;  4ORA B;  2OS8 B;  3EK7 A;  1K9U A;  2JZI A;  1EL4 A;  1V1F A;  1MUX A;  2JNX A;  3BJH A;  3D78 A;  2P71 A;  4HRE E;  2M97 A;  2KLD A;  2M29 A;  2WOR A;  3DY9 A;  1ZUZ A;  1RFJ A;  1IRJ A;  4NDC A;  5AEQ A;  2LCP A;  2PMY A;  1R2U A;  2OS8 C;  1PSR A;  2MA2 A;  1B1G A;  1K93 D;  3V2L A;  2H61 C;  3PJI A;  1A4P A;  1TCF A;  1C7V A;  4GBA A;  4QJ5 B;  1YTZ C;  1CDM A;  1N2D A;  2MLE C;  3BOW A;  1B47 A;  4I5J A;  1CMF A;  3CYZ A;  1CLB A;  1J7Q A;  3K1E A;  1OQP A;  3CDN A;  1GQM A;  2WCL A;  1HT9 A;  4JWQ A;  1DF0 B;  4ICB A;  4C0L A;  2BBM A;  1N0Y A;  1CFC A;  1RJV A;  2WCH A;  2M8U A;  3FIA A;  1RTP 1;  1TOP A;  1ZAC A;  3CZ1 A;  5I2Q A;  4OCI A;  5DIC A;  2HET A;  1K2H A;  1SL9 A;  3CZ0 A;  1BG1 A;  5CSF A;  1GJY A;  1JF2 A;  1RRO A;  4IL1 A;  2P6B B;  1F71 A;  1XFR A;  3EVV A;  3SIA A;  5KTY A;  4YI9 A;  1CLM A;  1WLM A;  1K94 A;  2LUC A;  1LA0 A;  1ORG A;  1PSB A;  3KEV A;  4M2Q A;  3SG7 A;  1IKU A;  2H8V A;  1IJ5 A;  3KO0 A;  3CWG A;  4PAL A;  4CFQ A;  1V1G A;  2I7A A;  1YX7 A;  2BL0 B;  2LMU A;  1Z4H A;  2KNE A;  1XFY O;  4BY4 A;  2CBL A;  2JXL A;  5TNC A;  2G9B A;  1EG4 A;  2DOQ A;  4N5X A;  2JT8 A;  2L2C A;  1SBJ A;  3VRN A;  1FF1 A;  3BUM B;  3HCM A;  1QAT A;  1DJW A;  2KQ6 A;  1QJT A;  2LP3 A;  1KWO B;  1GGZ A;  2MLF C;  1ODB A;  2WCK A;  3PLF B;  4AOM A;  1NSH A;  1KK7 Z;  1OOG A;  3A4U B;  3DXL A;  1QAS A;  2BL0 C;  5DKQ A;  1BF5 A;  3DF0 A;  1B7T Y;  4OZD A;  1CDN A;  2KFH A;  2KGB C;  4PE1 A;  2AMI A;  1KQV A;  1UWO A;  1KFU L;  1B8L A;  2FCE A;  3QME A;  4XJK B;  3PN7 B;  1KWO C;  3SG4 A;  1DMO A;  1MXL C;  3PFV A;  1BU3 A;  2CXJ A;  2JT0 A;  2VRG A;  3I5I B;  3UNW A;  1IWQ A;  3VRO A;  4CID A;  1L2O B;  2RGI A;  4CLN A;  1WRK A;  1M39 A;  1QTX A;  1NX2 A;  2K2F A;  4FQO A;  2KYF A;  1S6I A;  4HSZ A;  2PYQ A;  1TNQ A;  3PN7 C;  3BFH A;  1S6J A;  4I5K A;  1IG5 A;  1U5I A;  4INW A;  4C0K A;  1DJH A;  3NHI A;  3LCP C;  1P28 A;  1IIO A;  1L2O C;  1A75 B;  2L4H A;  1MWN A;  2QDI A;  1W7J B;  3BUN B;  1GGW A;  1QIV A;  1YUU A;  1MF8 B;  2KAX A;  1S3P A;  1A03 A;  1A29 A;  2EHB A;  3PAT A;  1GM0 A;  1YUT A;  5HL1 A;  1OOH A;  4ZCV A;  3OB2 B;  1PK0 D;  2KPH A;  2BCA A;  5I2O A;  5HKY A;  2M1K B;  1M45 A;  1QVI Z;  1Q80 A;  3IQO A;  3OGN A;  1LXF C;  3CTN A;  2QPT A;  3IVT A;  1OW4 A;  4ORC B;  1J55 A;  1EG3 A;  3FE8 A;  1CFF A;  2HQ8 A;  1OMV A;  1DC1 A;  1JWD A;  1XVJ A;  1XO5 A;  1PVA A;  2JUL A;  3B6X A;  1F55 A;  1BOC A;  2JNF A;  4KYN A;  4YRU A;  3B88 A;  4PE7 A;  1YX8 A;  3O6B A;  1XFV O;  4IJ7 A;  2KLE A;  1NX3 A;  2FCD A;  3BUX B;  1M31 A;  2G2B A;  1DJY A;  3D74 A;  2F8P A;  4P2Y B;  3WNX B;  1N65 A;  1R6P A;  1REC A;  2QEB A;  1G33 A;  2KGR A;  4YGC B;  4ZCU A;  3S0D A;  2BCB A;  1K90 D;  2K61 A;  1QLK A;  1LKJ A;  2PAS A;  3JVT C;  3PM8 A;  4F7F A;  1SCV A;  1J7P A;  3I5H B;  1SK6 D;  4MZJ A;  5CSJ A;  1SCM B;  3EG5 B;  1SL8 A;  1SPY A;  1SW8 A;  4FQT A;  5JJG A;  2ZN8 A;  4DRW A;  2JRF A;  4DS7 A;  1AJ5 A;  3FWC A;  4PHK A;  1TIZ A;  2ERB A;  1DT7 B;  2QEH A;  3NHT A;  3DD4 A;  1DJG A;  1UHN A;  2WCM A;  3K21 A;  4MSP A;  3RZS A;  2NCP A;  3I5H C;  2OPO A;  3EKJ A;  2K7B A;  2F33 A;  1QIW A;  3OX5 A;  1SCM C;  1DJI A;  2LM5 A;  4ORB B;  2V53 A;  5JOL A;  2YGU A;  3NSK A;  3BOW B;  1QX5 B;  1PUL A;  2COL B;  2L51 A;  2Y1N A;  1YR5 A;  1YVL A;  1HQV A;  3QRX A;  1EXR A;  2JTT A;  3LK0 A;  4GNK B;  1TNP A;  3IF7 A;  4PHM A;  2PRU A;  3D75 A;  4BY5 A;  2BE4 A;  2CTN A;  2MRD A;  1B8R A;  2KI4 B;  5D69 A;  1FPW A;  1K8U A;  1AUI B;  1C3Z A;  1KQM B;  1WDC B;  1BT6 A;  4I5L B;  5AAN A;  1CTR A;  2O60 A;  1XK4 A;  3TDU A;  1QX7 A;  2LLS A;  2HPS A;  3O4Y A;  1FI5 A;  5BPJ A;  1MQ1 A;  3TS5 B;  1LA3 A;  1KK8 B;  3TUY B;  1G4Y R;  3EVR A;  5FI2 A;  1UHH A;  2I2R E;  1B8C A;  2L5Y A;  2KI4 C;  4USL A;  5AXI A;  3HX4 A;  1KQM C;  1WDC C;  2QAC A;  4I5N B;  5AER A;  3BQ3 A;  3CGA A;  5I8N A;  1CDL A;  1DTL A;  2NXQ A;  3NSI A;  2WCE A;  1YUR A;  5HKW A;  3CZ2 A;  3TS5 C;  1KK8 C;  1NPQ A;  3PAL A;  3TUY C;  2SAS A;  1S5G Z;  3OP0 A;  2FJY A;  2I18 A;  2JXC A;  2LV7 A;  1JC2 A;  3NXA A;  2WCF A;  3DVJ A;  2L5X B;  1CNP A;  3S0E A;  1M63 B;  2L50 A;  4OR9 B;  2JPO A;  2LAP A;  3BYA A;  3M0W A;  2LNK A;  2QEV A;  3SS4 A;  1TTX A;  1OOI X;  2WC6 A;  4XYN A;  3ZWH A;  4PDZ A;  2KOT A;  4OV2 A;  1F4O A;  2L2E A;  3OBV A;  2M9G A;  1KFX S;  3DF0 B;  4MLW A;  4JKT A;  4HRH A;  1QWV A;  2WC5 A;  2BKI B;  1UHK A;  2PAL A;  1WRZ A;  2KBM A;  3I5F B;  3CR5 X;  3DVE A;  4DIR A;  4M2P A;  1CFP A;  2LLU A;  1OOF A;  1DGU A;  1BR1 B;  1TN4 A;  2Q4U A;  2M7N A;  4YBH B;  5KU1 A;  1BMO A;  1QS7 A;  1S1E A;  1MR8 A;  4PHN A;  1X02 A;  5ER5 A;  3F45 A;  2LC5 A;  2KHN A;  2PQL A;  2B1U A;  3I5F C;  1BLQ A;  3VB1 A;  1WRL A;  3L47 A;  2M7L A;  3NSL A;  2AAO A;  2ZKM X;  4P5O E;  3GK4 X;  1DQE A;  3Q8I A;  1AHR A;  1TUJ A;  3AAK A;  1Z2C B;  5K89 A;  2JQ6 A;  3NGV A;  4GGF A;  2NZ0 A;  2L98 A;  3CR2 A;  5D7F A;  1QLS A;  2Y4Q A;  3KF9 A;  2GGZ A;  1C07 A;  1QVI Y;  2GTE A;  3I5G B;  2K2A A;  4MZK A;  3ZNI A;  1TUZ A;  2JU0 A;  2M3W A;  1H8B A;  1CMG A;  5B8I B;  1MHO A;  1RK9 A;  4F0Z B;  1C3Y A;  4PHJ A;  2WCB A;  1LIN A;  1DJZ A;  2ZN9 A;  3FE9 A;  3OX6 A;  3VRR A;  2LVJ A;  1C7W A;  2ZRT A;  3B86 A;  3D0Y A;  3I5G C;  3S0A A;  5J3X A;  4PCW A;  4MEW A;  1M46 A;  3OHM B;  5DKN A;  1FW4 A;  1B7T Z;  2CNP A;  2KAY A;  3VRQ A;  2KSP A;  1KSO A;  3GOF A;  3SG2 A;  3B7A A;  1FI6 A;  3JVT B;  4WQ2 A;  2K8M B;  2LE9 B;  1S26 D;  1YVH A;  1ALV A;  3DVK A;  2MAZ A;  4MRY A;  1SMG A;  2SCP A;  1L7Z A;  1BR4 B;  4N1G A;  3BUO B;  2FOT A;  1UHJ A;  4YGD B;  1DEK A;  1TWO A;  2MJW B;  3MSE B;  5HYD A;  1NCY A;  3BFB A;  2M49 B;  2M0R A;  1CKK A;  2K0J A;  2JC2 A;  1AJ4 A;  1S6C A;  2L4I A;  4GFT A;  4L9M A;  3AKA A;  3EVU A;  1K96 A;  1SKT A;  3NSO A;  3E3R A;  3RM1 A;  4M2O A;  2LVK A;  1Y1A A;  2PSR A;  2BNX A;  2I94 A;  2L0P A;  3SS3 A;  1PRW A;  5HLV A;  2LAN A;  1K9K A;  1ZFS A;  1QV1 A;  2Q91 A;  1K95 A;  4YGA A;  1JBA A;  1S36 A;  2MBX A;  2ZND A;  1YUS A;  1UUS A;  1XA5 A;  2F3Z A;  2Y1M A;  2F3Y A;  3AAJ A;  2PVB A;  1XK4 C;  4AQJ A;  5G08 A;  3WXA A;  1CFD A;  1F8H A;  3TDI A;  4MVF A;  3BUW B;  1QX2 A;  4WQ3 A;  3SJS A;  1TNX A;  1ALW A;  3O2P A;  2QEO A;  1CDP A;  3PM2 A;  1ZMZ A;  4JD9 A;  1OOJ A;  1SR6 B;  2LLT A;  4QJ3 B;  4U8D A;  4DUQ A;  2NLN A;  3EK8 A;  1KFX L;  3D10 A;  3TDZ A;  3ICB A;  2CCM A;  1AK8 A;  1NUB A;  1OMD A;  1OSA A;  1IQ5 A;  1XFW O;  2BE6 A;  4JQ0 D;  4WRI A;  5AFP A;  3GK1 A;  4N1F A;  3LLE A;  2LP2 A;  2A4J A;  5CPV A;  1XFU O;  4GUK A;  4JPZ B;  1SR6 C;  5CSN A;  3D73 A;  1SRA A;  2F2P A;  4MBE A;  4CFR A;  1SYM A;  1J1D A;  1T14 A;  5EL2 A;  4A4B A;  1LS8 A;  3N7H A;  1A2X A;  4HRG A;  2E6W A;  3CLN A;  2O5G A;  1OE9 B;  1Y1X A;  1XYD A;  4PE4 A;  4YGB B;  1J7O A;  4OKH A;  5D3O A;  1B4C A;  3IQQ A;  3SS5 A;  3R1O A;  4MZL A;  4Q04 A;  4MRX A;  1KK7 Y;  1K9P A;  2WC8 A;  2JPT A;  1NP8 A;  3CR4 X;  1AP4 A;  2H61 A;  1W9Z A;  1D1O A;  1W7I B;  3D76 A;  3WHT B;  3DVM A;  2JOJ A;  3S0B A;  1JF0 A;  1OZS A;  2K7D A;  5DKR A;  1DGV A;  1Y6W A;  3SG5 A;  1UHI A;  1NX0 A;  3L4A A;  2KAV A;  1TCO B;  2OTG B;  3AKB A;  4A4C A;  3FE6 A;  4R1E A;  2EGD A;  1JUO A;  5IBW A;  1U5I B;  1DEL A;  1LVC D;  3EKH A;  4YI8 A;  1IH0 A;  1VRK A;  2OTG C;  1DF0 A;  4GGF C;  2TN4 A;  1PAL A;  3S0F A;  1IGV A;  4NDD A;  1XFZ O;  1AVS A; 
#chains in the Genus database with same CATH homology
 2QEH A;  3NHT A;  2WCM A;  3K1E A;  3RZS A;  3CDN A;  3DYE A;  2WCL A;  3B7A A;  2WCH A;  3CZ1 A;  5DIC A;  3CZ0 A;  3R1V A;  3D75 A;  1XFR A;  1TWO A;  3BFB A;  1C3Z A;  3DZT A;  1ORG A;  2H8V A;  3S0G A;  2L2C A;  3CZ2 A;  4INX A;  2WCK A;  3R72 A;  1OOG A;  2FJY A;  3DXL A;  4OZD A;  3S0E A;  2JPO A;  3QME A;  2QEV A;  1OOI X;  2WC6 A;  4PT1 A;  2WCJ A;  2QEO A;  4JD9 A;  3D77 A;  1QWV A;  2WC5 A;  3R1P A;  1OOF A;  4INW A;  3CAB A;  3NHI A;  1P28 A;  3D73 A;  2QDI A;  1T14 A;  5EL2 A;  2PQL A;  1LS8 A;  3N7H A;  3VB1 A;  3L47 A;  1GM0 A;  3BFA A;  1OOH A;  2P70 A;  3L4L A;  2KPH A;  1DQE A;  3Q8I A;  1TUJ A;  3OGN A;  3R1O A;  3B87 A;  1OW4 A;  3NGV A;  3FE8 A;  3D76 A;  3B6X A;  3S0B A;  2GTE A;  3B88 A;  3L4A A;  3BJH A;  3D74 A;  3D78 A;  3FE6 A;  2QEB A;  2P71 A;  3S0D A;  3DY9 A;  1C3Y A;  4F7F A;  3FE9 A;  3S0A A;  3B86 A;  3V2L A;  3PJI A;  4FQT A;  3S0F A;  3BFH A;  2ERB A;  3CYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...