3Q8IA

Crystal structure of anopheles gambiae odorant binding protein 4 in complex with indole
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
TMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMTKKGEISFSKTMAQIEAMLPPEMKTMAKEALTHCKDTQTSYKDPCDKAYFSAKCAADFTPDTFMFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant binding protein
molecule keywords Odorant binding protein
publication title Conformational ordering plays a key role in regulating heterodimeric interactions between odorant binding proteins from Anopheles gambiae
rcsb
source organism Anopheles gambiae
total genus 44
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3q8iA00
1ORGA 3K1EA 3D73A 1OOIX 2WCKA 2WCLA 3D76A 3PJIA 3DY9A 3N7HA 3VB1A 3R1OA 3B88A 2P70A 3FE9A 3DZTA 2QEHA 1OOGA 3NGVA 3BFBA 4INWA 1LS8A 4OZDA 2H8VA 2ERBA 2WCMA 3S0BA 3CZ1A 2WC6A 3S0DA 2FJYA 3BFAA 2PQLA 3D78A 3S0AA 3B87A 3CDNA 3S0EA 1XFRA 3NHTA 3BFHA 3Q8IA 3L47A 2L2CA 2WC5A 5DICA 3B86A 3L4AA 3S0FA 3CZ2A 3D77A 1OOFA 2P71A 4F7FA 3L4LA 1DQEA 1C3YA 3OGNA 1OOHA 5EL2A 3B6XA 4FQTA 3CZ0A 3NHIA 4PT1A 2WCHA 1QWVA 1GM0A 3D74A 3V2LA 1TWOA 3R1PA 3CYZA 3R72A 3BJHA 3B7AA 3FE6A 1C3ZA 3RZSA 1TUJA 2QEBA 3DXLA 3DYEA 2WCJA 3R1VA 2GTEA 3CABA 2JPOA 1T14A 3QMEA 2QEVA 4INXA 1P28A 3D75A 4JD9A 1OW4A 3S0GA 2QDIA 2QEOA 3FE8A 2KPHA
chains in the Genus database with same CATH superfamily
3UNWA 4OCIA 1AJ5A 1OMVA 1XFVO 3O2PA 5TNCA 2K2AA 2WCKA 4FQOA 1IIOA 1RFJA 1QLSA 2TN4A 3NSKA 1KSMA 1BU3A 2AUCA 2GGMA 4FTGA 3CZTX 1PSRA 4PHJA 4N5XA 4P2YB 3F45A 5KSZA 4NDDA 1YR5A 2OTGC 1WDCC 2GGZA 1A4PA 2BECA 4MZJA 1B47A 3OP0A 4UPGA 1C07A 2ZRSA 3BUMB 1YRTB 2LVVA 5JJGA 1J7OA 3IF7A 4YGEB 1UHNA 4GAOA 1L2OC 1NIWA 1FI6A 2O60A 1BODA 1H4BA 1B7TY 1BR1B 2KFHA 1XFWO 2ERBA 3BUNB 5I2OA 1NWDA 1YTZC 2G9BA 1YX8A 3BQ3A 1YVHA 5DKQA 4Q04A 3CLNA 3S0DA 2LC5A 2MA2A 4CFQA 1AJ4A 1TNXA 3BFAA 2KGRA 3BYAA 2K0JA 2PQLA 3DF0B 1XYDA 1XFXO 3CR5X 1DF0A 1SW8A 1YUTA 2JPTA 1XFRA 3LK0A 1SCVA 2K7DA 1PVAA 4R1EA 3TUYB 4DUQA 1TNQA 1Y1UA 2OS8C 2MAZA 3HX4A 1QVIZ 1SY9A 1WRLA 2L2CA 3EK4A 2L50A 2WC5A 4DS7A 1A75B 4GGFC 5DICA 5J3XA 5BPJA 3S0FA 1NX1A 1KQMC 2R2IA 3JVTB 1DVIA 2L4HA 2JTTA 2BE6A 1BR4B 1DT7B 2JTZA 4JWQA 1A75A 3I5GC 2V53A 1UHHA 3DVEA 3KPXA 3OGNA 1Y1AA 1OOHA 4MVFA 4YGDB 2JQ6A 4YGAA 3B6XA 1LKJA 1S6JA 4IL1A 1S5GY 2OPOA 1RJVA 3LLEA 1BF5A 1ODBA 3EKJA 1CM1A 3NXAA 4PT1A 5I94A 1A03A 2JNXA 2WCHA 1J7QA 1DMOA 3EG5B 3SG6A 2PALA 3EKHA 1GM0A 2FCEA 4NQGA 1AP4A 4OVNF 4CFRA 1C7VA 1BOCA 2KOTA 3R1PA 1J7PA 1XO5A 1K94A 2LLSA 1D1OA 2JULA 3SIBA 1SCMC 1ALVA 2AMIA 2LP3A 3A8RA 3FE6A 3PATA 4OKHA 1RROA 4GNKB 4QJ4B 1EL4A 1TUJA 1YVLA 2KDHA 4XJKB 1JFJA 3DXLA 3NSIA 1SYMA 1BJFA 3D10A 3OBVA 4E68A 1NYAA 3BOWB 4QJ5B 2WCJA 4ZCVA 2WCEA 2A4JA 5CSNA 1XVJA 4D1EA 2LLUA 1JSAA 1B8CA 2COLB 3FIAA 1SSEB 1T14A 5FYXA 1VRKA 3DVKA 3TS5B 2L5XB 3SS5A 3TUYC 5D69A 3BOWA 1B4CA 2BKHB 1B8RA 1KK8B 3CTNA 1TCOB 3E3RA 1LVCD 1AHRA 1YURA 4JD9A 5FI2A 1OW4A 2ISDA 1WLZA 2K8MB 1S6CA 2QDIA 4YI8A 3FE8A 2KPHA 5F6TA 4AQIA 1E8AA 3PN7B 1QTXA 2KAXA 2GV5A 1OOIX 1SBJA 2F2PA 2WCLA 3D76A 2LVJA 3HCMA 1JF2A 2LCPA 3DY9A 5B8IB 1FW4A 1ZOTB 3N7HA 1F70A 3VROA 3GK4X 2L5YA 1XK4C 4M2OA 3KHEA 1CFPA 3DZTA 1V1GA 1WLMA 3LK1A 2I94A 1OOGA 3KEVA 1EH2A 2Q4UA 2LAPA 2IS9A 5PALA 3SG5A 4TNCA 2QPTA 3RLZA 1PALA 1K90D 3AKBA 1RK9A 4DRWA 1DJXA 3PM2A 2L51A 5CSIA 2G2BA 3O4XA 2WCMA 2KFFA 5CPVA 2PMYA 2JWWA 2Y1MA 4PCWA 1MQ1A 1KK7Z 5AEQA 3SJSA 2BL0B 2MBXA 3UO9A 1XFYO 3EK7A 1S26D 1YUUA 1QASA 4PHKA 2JRFA 2LHLA 3B87A 1YUSA 2M49B 2Y4QA 3S0EA 4PHNA 2Q91A 3O6BA 3PALA 2Y5IA 1A2XA 3QRXA 1CLMA 1QJTA 4BY5A 2O5GA 3OHMB 1IQ5A 2MRDA 2JOJA 1WRKA 1CB1A 1HQVA 1L7ZA 1QLKA 1CDPA 1W7IB 2BBMA 2NCPA 1CLLA 3GK1A 3L4AA 1AK8A 2CTNA 2CCMA 4MRXA 1SL8A 3PFVA 1KK8C 2WCBA 2K2FA 4ETOA 3KF9A 3AKAA 2HQ8A 1DF0B 3SG7A 1C3YA 1FPWA 1FI5A 1JC2A 3I5IB 1V1FA 1NCXA 5HL1A 2LANA 1UHKA 1KSOA 3PN7C 4MLWA 3OB1B 2QACA 5D7FA 1CFFA 2M0RA 1ZACA 1IG5A 2ZN8A 1K96A 1SRAA 4GBAA 4P5OE 2ZNEA 1B7TZ 4PDZA 2EHBA 2KHNA 2LNKA 5HYDA 1QWVA 1MXEA 3O4YA 1K8UA 1XA5A 2Y1NA 1DGUA 1CFDA 1K9KA 2LV7A 1DJZA 2NLNA 4GFTA 3WHUB 1S36A 3TZ1A 3I5HC 5AERA 1NUBA 3JTDB 1QVIY 1TRFA 3FS7A 4I5LB 4AOMA 4C0JA 1CMGA 2KLDA 5HKWA 1PULA 1K9PA 4PE1A 4I5NB 1N65A 2D8NA 2E6WA 2KBIA 3DYEA 3CR2A 3VRPA 2CXJA 2BNXA 2WNDA 1TTXA 1IJ6A 4A4CA 1CKKA 2F3YA 2JU0A 4M2QA 1B8LA 2GTEA 1UP5A 1TCFA 5HKYA 4F0ZB 4DCKA 4NDCA 1M63B 1OOJA 4INXA 1SNLA 1IH0A 1P28A 3H4SE 1M46A 4JKTA 4U8DA 2HETA 2KQYA 2WCFA 1OE9B 1DTLA 3S0GA 2BCXA 2BE4A 1C7WA 3K1EA 1CTRA 3D73A 3FWBA 1OZSA 3A4UB 4ORCB 3WXAA 4AQJA 4C0LA 4YRUA 3AAKA 4GUKA 3PSRA 2L2EA 1TN4A 2HPSA 1IQ3A 1KQVA 2KFGA 1GGWA 2BBNA 3R1OA 1BG1A 2PSRA 1KFXL 3OX5A 5KU1A 2P70A 2NCOA 3FE9A 1KWOB 4MSPA 3SG3A 3VRNA 1MXLC 4NDBA 1DGVA 2K60A 3ICBA 2ZNDA 4MRYA 1LINA 3C1VA 1PSBA 2H61A 4HREE 4YBHB 1F71A 2K7OA 2M97A 2LMUA 4PALA 2FJUB 2VRGA 1GJYA 2JT3A 2M1UA 1W9ZA 1AUIB 2KNEA 4ORAB 1NPQA 4YGCB 1F54A 2ZN9A 3KO0A 2KAYA 3GOFA 3S0BA 1DJIA 3CZ1A 3JVTC 2WC6A 3DVMA 3JTDC 3TDZA 2WC8A 4BY4A 2WORA 1SL9A 1ZFSA 1WDCB 1RWYA 3AAJA 1MHOA 4PE7A 1NCZA 4DIRA 1KFXS 1TNWA 2BCAA 5GQQC 3BFHA 3NSOA 4OR9B 2KI4B 1L2OB 3Q8IA 2SASA 1UWOA 2KI6C 3NSLA 1KFUL 1Y6WA 3OX6A 1IGVA 1JBAA 1B1GA 5HKZA 2KSPA 1ALWA 1K93D 1NX2A 1SPYA 3MSEB 1G33A 1GGZA 1DJWA 3WHTB 1M39A 1JUOA 2LP2A 2JXCA 2LVKA 3CZ2A 1NX0A 2I2RE 2P71A 2JT0A 3VRQA 1MWNA 1M45A 1U5IA 1G4YR 1Y0VH 1R2UA 3OB2B 1IJ5A 1DQEA 1DJYA 3EVVA 1XFUO 2MLFC 4JQ0D 5DKNA 3CWGA 2WOSA 1UUSA 5EL2A 3GK2A 1S3PA 3CZ0A 3BUWB 4WQ3A 2F8PA 1IKUA 1MR8A 2CBLA 1QIWA 1KK7Y 2M9GA 1KFUS 5AFPA 1F4QA 3IVTA 4PHMA 2KQ6A 3PM8A 4L9MA 1MUXA 1KQMB 1BMOA 2KI6D 1QV0A 5I2QA 1KCYA 2AAOA 3PLFB 3TS5C 3R72A 3BJHA 1CDNA 1QXPA 1QV1A 2JC2A 3I5GB 4GGFA 4N1GA 2PVBA 4MZLA 2L4IA 3RZSA 4QJ3B 1B9AA 1LXFC 2FCDA 1K2HA 1CM4A 2KYFA 5ER4X 1SL7A 2QEBA 1QX7A 1NCYA 1XFZO 2M1KB 3EK8A 5ER5A 1DJHA 2BAPA 3SIAA 3ZNIA 3R1VA 1DELA 2E30A 1FBVA 2P6BB 3DD4A 1DC1A 3CABA 2JPOA 4C0KA 4WRIA 1RTP1 4HRHA 3SS4A 2HF5A 2ZKMX 1CDMA 2EC6B 2HQWA 2QEVA 3EVUA 3I5FB 4JPZB 1SMGA 2KI4C 3TDIA 1BLQA 1BT6A 1GQMA 2LHIA 1SCMB 4WQ2A 2KLEA 1TOPA 1NX3A 2B1UA 1SR6B 4GGNA 3CS1A 1K9UA 2KGBC 2PRUA 4XYNA 1AVSA 3RM1A 2YGUA 2K7CA 2L98A 1ORGA 2MLEC 5I2LA 3CGAA 3PJIA 2NXQA 1Z2CB 1QS7A 2DOQA 2JXLA 2LM5A 5CSJA 2PASA 4YGBB 1TIZA 3VB1A 4USLA 2BL0C 1LA3A 3SG4A 4IJ7A 1EXRA 2NZ0A 1PRWA 1K95A 1NP8A 1OZOA 2LVIA 3BUXB 3B88A 4N1FA 3TDUA 3BUOB 2ZFDA 1OSAA 1QX5B 3DF0A 2EGDA 4ICBA 4CIDA 2QEHA 4MBEA 1G8IA 3NGVA 1QX2A 4PE4A 1LA0A 3BFBA 4INWA 1LS8A 2K7BA 2I7AA 2H8VA 1IRJA 3EVRA 2I18A 3BXKA 2LUCA 1S5GZ 2KBMA 3K21A 4ZCUA 1Q80A 5HLVA 1RECA 2M7NA 1CFCA 2FJYA 2M3WA 4I5JA 3DVJA 5IBWA 1UHJA 5D3OA 1F8HA 2CNPA 2JZIA 5AXIA 1A29A 2JNFA 1S1EA 1OQPA 3D78A 3I5IC 3S0AA 2L0PA 3CDNA 1W7JB 3M0WA 3NHTA 3FWCA 1J1EA 4YI9A 2LMTA 1J55A 2F2OA 3L47A 4KYNA 1XK4A 4GPLB 4OZDA 2CT9A 4A4BA 2MJWB 1CMFA 1F55A 2EC6C 5FI7A 3I5FC 1N2DA 1J1DA 1SKTA 3B86A 1UHIA 2MHHA 1OMRA 1Y1XA 3ZWHA 3D77A 1S6IA 2LUXA 1OOFA 4I5KA 3LL8B 4F7FA 1JF0A 1PVBA 2KYCA 3L4LA 1SR6C 2F3ZA 4PE0A 3SG2A 3WNXB 1UURA 4FQTA 3NHIA 1R6PA 2OTGB 5AANA 1CLBA 5FI6A 1F4OA 2M8UA 4XJKA 2KAVA 1HT9A 1Z4HA 2RGIA 1CNPA 2ZRTA 1OMDA 1M31A 4CPVA 4ORBB 1EG4A 1ZMZA 3IQOA 3D74A 1H8BA 1U5IB 1ZUZA 5HLOA 3V2LA 1N0YA 1TWOA 3SS3A 1NSHA 3CYZA 2LE9B 3B7AA 1EG3A 1QATA 1SK6D 1TUZA 4HSZA 2M7LA 1X02A 5G08A 1JFKA 2BCBA 2LMVA 1C3ZA 2SCPA 1PK0D 4OV2A 1QIVA 1YX7A 1MF8B 3VGOA 2JT8A 4MZKA 3CR4X 2PYQA 1DEKA 5K89A 2H2KA 3O78A 5JOLA 1JWDA 3IQQA 4MEWA 5DKRA 2LLTA 1FF1A 1CDLA 2OS8B 3D0YB 1WRZA 3VRRA 2K61A 3LCPC 4HRGA 1EJ3A 4CLNA 2H61C 3QMEA 5I8NA 1IWQA 3I5HB 5CSFA 1WY9A 1TNPA 1J7RA 1YRUB 4M2PA 3D75A 3D0YA 1KWOC 5KTYA 1DJGA 2BKIB 2FOTA 2F33A 2M29A 4MN0A 2QEOA
chains in the Genus database with same CATH topology
1ORGA 3K1EA 3D73A 1OOIX 2WCKA 2WCLA 3D76A 3PJIA 3DY9A 3N7HA 3VB1A 3R1OA 3B88A 2P70A 3FE9A 3DZTA 2QEHA 1OOGA 3NGVA 3BFBA 4INWA 1LS8A 4OZDA 2H8VA 2ERBA 2WCMA 3S0BA 3CZ1A 2WC6A 3S0DA 2FJYA 3BFAA 2PQLA 3D78A 3S0AA 3B87A 3CDNA 3S0EA 1XFRA 3NHTA 3BFHA 3Q8IA 3L47A 2L2CA 2WC5A 5DICA 3B86A 3L4AA 3S0FA 3CZ2A 3D77A 1OOFA 2P71A 4F7FA 3L4LA 1DQEA 1C3YA 3OGNA 1OOHA 5EL2A 3B6XA 4FQTA 3CZ0A 3NHIA 4PT1A 2WCHA 1QWVA 1GM0A 3D74A 3V2LA 1TWOA 3R1PA 3CYZA 3R72A 3BJHA 3B7AA 3FE6A 1C3ZA 3RZSA 1TUJA 2QEBA 3DXLA 3DYEA 2WCJA 3R1VA 2GTEA 3CABA 2JPOA 1T14A 3QMEA 2QEVA 4INXA 1P28A 3D75A 4JD9A 1OW4A 3S0GA 2QDIA 2QEOA 3FE8A 2KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORG A;  3K1E A;  3D73 A;  1OOI X;  2WCK A;  2WCL A;  3D76 A;  3PJI A;  3DY9 A;  3N7H A;  3VB1 A;  3R1O A;  3B88 A;  2P70 A;  3FE9 A;  3DZT A;  2QEH A;  1OOG A;  3NGV A;  3BFB A;  4INW A;  1LS8 A;  4OZD A;  2H8V A;  2ERB A;  2WCM A;  3S0B A;  3CZ1 A;  2WC6 A;  3S0D A;  2FJY A;  3BFA A;  2PQL A;  3D78 A;  3S0A A;  3B87 A;  3CDN A;  3S0E A;  1XFR A;  3NHT A;  3BFH A;  3Q8I A;  3L47 A;  2L2C A;  2WC5 A;  5DIC A;  3B86 A;  3L4A A;  3S0F A;  3CZ2 A;  3D77 A;  1OOF A;  2P71 A;  4F7F A;  3L4L A;  1DQE A;  1C3Y A;  3OGN A;  1OOH A;  5EL2 A;  3B6X A;  4FQT A;  3CZ0 A;  3NHI A;  4PT1 A;  2WCH A;  1QWV A;  1GM0 A;  3D74 A;  3V2L A;  1TWO A;  3R1P A;  3CYZ A;  3R72 A;  3BJH A;  3B7A A;  3FE6 A;  1C3Z A;  3RZS A;  1TUJ A;  2QEB A;  3DXL A;  3DYE A;  2WCJ A;  3R1V A;  2GTE A;  3CAB A;  2JPO A;  1T14 A;  3QME A;  2QEV A;  4INX A;  1P28 A;  3D75 A;  4JD9 A;  1OW4 A;  3S0G A;  2QDI A;  2QEO A;  3FE8 A;  2KPH A; 
#chains in the Genus database with same CATH topology
 3UNW A;  4OCI A;  1AJ5 A;  1OMV A;  1XFV O;  3O2P A;  5TNC A;  2K2A A;  2WCK A;  4FQO A;  1IIO A;  1RFJ A;  1QLS A;  2TN4 A;  3NSK A;  1KSM A;  1BU3 A;  2AUC A;  2GGM A;  4FTG A;  3CZT X;  1PSR A;  4PHJ A;  4N5X A;  4P2Y B;  3F45 A;  5KSZ A;  4NDD A;  1YR5 A;  2OTG C;  1WDC C;  2GGZ A;  1A4P A;  2BEC A;  4MZJ A;  1B47 A;  3OP0 A;  4UPG A;  1C07 A;  2ZRS A;  3BUM B;  1YRT B;  2LVV A;  5JJG A;  1J7O A;  3IF7 A;  4YGE B;  1UHN A;  4GAO A;  1L2O C;  1NIW A;  1FI6 A;  2O60 A;  1BOD A;  1H4B A;  1B7T Y;  1BR1 B;  2KFH A;  1XFW O;  2ERB A;  3BUN B;  5I2O A;  1NWD A;  1YTZ C;  2G9B A;  1YX8 A;  3BQ3 A;  1YVH A;  5DKQ A;  4Q04 A;  3CLN A;  3S0D A;  2LC5 A;  2MA2 A;  4CFQ A;  1AJ4 A;  1TNX A;  3BFA A;  2KGR A;  3BYA A;  2K0J A;  2PQL A;  3DF0 B;  1XYD A;  1XFX O;  3CR5 X;  1DF0 A;  1SW8 A;  1YUT A;  2JPT A;  1XFR A;  3LK0 A;  1SCV A;  2K7D A;  1PVA A;  4R1E A;  3TUY B;  4DUQ A;  1TNQ A;  1Y1U A;  2OS8 C;  2MAZ A;  3HX4 A;  1QVI Z;  1SY9 A;  1WRL A;  2L2C A;  3EK4 A;  2L50 A;  2WC5 A;  4DS7 A;  1A75 B;  4GGF C;  5DIC A;  5J3X A;  5BPJ A;  3S0F A;  1NX1 A;  1KQM C;  2R2I A;  3JVT B;  1DVI A;  2L4H A;  2JTT A;  2BE6 A;  1BR4 B;  1DT7 B;  2JTZ A;  4JWQ A;  1A75 A;  3I5G C;  2V53 A;  1UHH A;  3DVE A;  3KPX A;  3OGN A;  1Y1A A;  1OOH A;  4MVF A;  4YGD B;  2JQ6 A;  4YGA A;  3B6X A;  1LKJ A;  1S6J A;  4IL1 A;  1S5G Y;  2OPO A;  1RJV A;  3LLE A;  1BF5 A;  1ODB A;  3EKJ A;  1CM1 A;  3NXA A;  4PT1 A;  5I94 A;  1A03 A;  2JNX A;  2WCH A;  1J7Q A;  1DMO A;  3EG5 B;  3SG6 A;  2PAL A;  3EKH A;  1GM0 A;  2FCE A;  4NQG A;  1AP4 A;  4OVN F;  4CFR A;  1C7V A;  1BOC A;  2KOT A;  3R1P A;  1J7P A;  1XO5 A;  1K94 A;  2LLS A;  1D1O A;  2JUL A;  3SIB A;  1SCM C;  1ALV A;  2AMI A;  2LP3 A;  3A8R A;  3FE6 A;  3PAT A;  4OKH A;  1RRO A;  4GNK B;  4QJ4 B;  1EL4 A;  1TUJ A;  1YVL A;  2KDH A;  4XJK B;  1JFJ A;  3DXL A;  3NSI A;  1SYM A;  1BJF A;  3D10 A;  3OBV A;  4E68 A;  1NYA A;  3BOW B;  4QJ5 B;  2WCJ A;  4ZCV A;  2WCE A;  2A4J A;  5CSN A;  1XVJ A;  4D1E A;  2LLU A;  1JSA A;  1B8C A;  2COL B;  3FIA A;  1SSE B;  1T14 A;  5FYX A;  1VRK A;  3DVK A;  3TS5 B;  2L5X B;  3SS5 A;  3TUY C;  5D69 A;  3BOW A;  1B4C A;  2BKH B;  1B8R A;  1KK8 B;  3CTN A;  1TCO B;  3E3R A;  1LVC D;  1AHR A;  1YUR A;  4JD9 A;  5FI2 A;  1OW4 A;  2ISD A;  1WLZ A;  2K8M B;  1S6C A;  2QDI A;  4YI8 A;  3FE8 A;  2KPH A;  5F6T A;  4AQI A;  1E8A A;  3PN7 B;  1QTX A;  2KAX A;  2GV5 A;  1OOI X;  1SBJ A;  2F2P A;  2WCL A;  3D76 A;  2LVJ A;  3HCM A;  1JF2 A;  2LCP A;  3DY9 A;  5B8I B;  1FW4 A;  1ZOT B;  3N7H A;  1F70 A;  3VRO A;  3GK4 X;  2L5Y A;  1XK4 C;  4M2O A;  3KHE A;  1CFP A;  3DZT A;  1V1G A;  1WLM A;  3LK1 A;  2I94 A;  1OOG A;  3KEV A;  1EH2 A;  2Q4U A;  2LAP A;  2IS9 A;  5PAL A;  3SG5 A;  4TNC A;  2QPT A;  3RLZ A;  1PAL A;  1K90 D;  3AKB A;  1RK9 A;  4DRW A;  1DJX A;  3PM2 A;  2L51 A;  5CSI A;  2G2B A;  3O4X A;  2WCM A;  2KFF A;  5CPV A;  2PMY A;  2JWW A;  2Y1M A;  4PCW A;  1MQ1 A;  1KK7 Z;  5AEQ A;  3SJS A;  2BL0 B;  2MBX A;  3UO9 A;  1XFY O;  3EK7 A;  1S26 D;  1YUU A;  1QAS A;  4PHK A;  2JRF A;  2LHL A;  3B87 A;  1YUS A;  2M49 B;  2Y4Q A;  3S0E A;  4PHN A;  2Q91 A;  3O6B A;  3PAL A;  2Y5I A;  1A2X A;  3QRX A;  1CLM A;  1QJT A;  4BY5 A;  2O5G A;  3OHM B;  1IQ5 A;  2MRD A;  2JOJ A;  1WRK A;  1CB1 A;  1HQV A;  1L7Z A;  1QLK A;  1CDP A;  1W7I B;  2BBM A;  2NCP A;  1CLL A;  3GK1 A;  3L4A A;  1AK8 A;  2CTN A;  2CCM A;  4MRX A;  1SL8 A;  3PFV A;  1KK8 C;  2WCB A;  2K2F A;  4ETO A;  3KF9 A;  3AKA A;  2HQ8 A;  1DF0 B;  3SG7 A;  1C3Y A;  1FPW A;  1FI5 A;  1JC2 A;  3I5I B;  1V1F A;  1NCX A;  5HL1 A;  2LAN A;  1UHK A;  1KSO A;  3PN7 C;  4MLW A;  3OB1 B;  2QAC A;  5D7F A;  1CFF A;  2M0R A;  1ZAC A;  1IG5 A;  2ZN8 A;  1K96 A;  1SRA A;  4GBA A;  4P5O E;  2ZNE A;  1B7T Z;  4PDZ A;  2EHB A;  2KHN A;  2LNK A;  5HYD A;  1QWV A;  1MXE A;  3O4Y A;  1K8U A;  1XA5 A;  2Y1N A;  1DGU A;  1CFD A;  1K9K A;  2LV7 A;  1DJZ A;  2NLN A;  4GFT A;  3WHU B;  1S36 A;  3TZ1 A;  3I5H C;  5AER A;  1NUB A;  3JTD B;  1QVI Y;  1TRF A;  3FS7 A;  4I5L B;  4AOM A;  4C0J A;  1CMG A;  2KLD A;  5HKW A;  1PUL A;  1K9P A;  4PE1 A;  4I5N B;  1N65 A;  2D8N A;  2E6W A;  2KBI A;  3DYE A;  3CR2 A;  3VRP A;  2CXJ A;  2BNX A;  2WND A;  1TTX A;  1IJ6 A;  4A4C A;  1CKK A;  2F3Y A;  2JU0 A;  4M2Q A;  1B8L A;  2GTE A;  1UP5 A;  1TCF A;  5HKY A;  4F0Z B;  4DCK A;  4NDC A;  1M63 B;  1OOJ A;  4INX A;  1SNL A;  1IH0 A;  1P28 A;  3H4S E;  1M46 A;  4JKT A;  4U8D A;  2HET A;  2KQY A;  2WCF A;  1OE9 B;  1DTL A;  3S0G A;  2BCX A;  2BE4 A;  1C7W A;  3K1E A;  1CTR A;  3D73 A;  3FWB A;  1OZS A;  3A4U B;  4ORC B;  3WXA A;  4AQJ A;  4C0L A;  4YRU A;  3AAK A;  4GUK A;  3PSR A;  2L2E A;  1TN4 A;  2HPS A;  1IQ3 A;  1KQV A;  2KFG A;  1GGW A;  2BBN A;  3R1O A;  1BG1 A;  2PSR A;  1KFX L;  3OX5 A;  5KU1 A;  2P70 A;  2NCO A;  3FE9 A;  1KWO B;  4MSP A;  3SG3 A;  3VRN A;  1MXL C;  4NDB A;  1DGV A;  2K60 A;  3ICB A;  2ZND A;  4MRY A;  1LIN A;  3C1V A;  1PSB A;  2H61 A;  4HRE E;  4YBH B;  1F71 A;  2K7O A;  2M97 A;  2LMU A;  4PAL A;  2FJU B;  2VRG A;  1GJY A;  2JT3 A;  2M1U A;  1W9Z A;  1AUI B;  2KNE A;  4ORA B;  1NPQ A;  4YGC B;  1F54 A;  2ZN9 A;  3KO0 A;  2KAY A;  3GOF A;  3S0B A;  1DJI A;  3CZ1 A;  3JVT C;  2WC6 A;  3DVM A;  3JTD C;  3TDZ A;  2WC8 A;  4BY4 A;  2WOR A;  1SL9 A;  1ZFS A;  1WDC B;  1RWY A;  3AAJ A;  1MHO A;  4PE7 A;  1NCZ A;  4DIR A;  1KFX S;  1TNW A;  2BCA A;  5GQQ C;  3BFH A;  3NSO A;  4OR9 B;  2KI4 B;  1L2O B;  3Q8I A;  2SAS A;  1UWO A;  2KI6 C;  3NSL A;  1KFU L;  1Y6W A;  3OX6 A;  1IGV A;  1JBA A;  1B1G A;  5HKZ A;  2KSP A;  1ALW A;  1K93 D;  1NX2 A;  1SPY A;  3MSE B;  1G33 A;  1GGZ A;  1DJW A;  3WHT B;  1M39 A;  1JUO A;  2LP2 A;  2JXC A;  2LVK A;  3CZ2 A;  1NX0 A;  2I2R E;  2P71 A;  2JT0 A;  3VRQ A;  1MWN A;  1M45 A;  1U5I A;  1G4Y R;  1Y0V H;  1R2U A;  3OB2 B;  1IJ5 A;  1DQE A;  1DJY A;  3EVV A;  1XFU O;  2MLF C;  4JQ0 D;  5DKN A;  3CWG A;  2WOS A;  1UUS A;  5EL2 A;  3GK2 A;  1S3P A;  3CZ0 A;  3BUW B;  4WQ3 A;  2F8P A;  1IKU A;  1MR8 A;  2CBL A;  1QIW A;  1KK7 Y;  2M9G A;  1KFU S;  5AFP A;  1F4Q A;  3IVT A;  4PHM A;  2KQ6 A;  3PM8 A;  4L9M A;  1MUX A;  1KQM B;  1BMO A;  2KI6 D;  1QV0 A;  5I2Q A;  1KCY A;  2AAO A;  3PLF B;  3TS5 C;  3R72 A;  3BJH A;  1CDN A;  1QXP A;  1QV1 A;  2JC2 A;  3I5G B;  4GGF A;  4N1G A;  2PVB A;  4MZL A;  2L4I A;  3RZS A;  4QJ3 B;  1B9A A;  1LXF C;  2FCD A;  1K2H A;  1CM4 A;  2KYF A;  5ER4 X;  1SL7 A;  2QEB A;  1QX7 A;  1NCY A;  1XFZ O;  2M1K B;  3EK8 A;  5ER5 A;  1DJH A;  2BAP A;  3SIA A;  3ZNI A;  3R1V A;  1DEL A;  2E30 A;  1FBV A;  2P6B B;  3DD4 A;  1DC1 A;  3CAB A;  2JPO A;  4C0K A;  4WRI A;  1RTP 1;  4HRH A;  3SS4 A;  2HF5 A;  2ZKM X;  1CDM A;  2EC6 B;  2HQW A;  2QEV A;  3EVU A;  3I5F B;  4JPZ B;  1SMG A;  2KI4 C;  3TDI A;  1BLQ A;  1BT6 A;  1GQM A;  2LHI A;  1SCM B;  4WQ2 A;  2KLE A;  1TOP A;  1NX3 A;  2B1U A;  1SR6 B;  4GGN A;  3CS1 A;  1K9U A;  2KGB C;  2PRU A;  4XYN A;  1AVS A;  3RM1 A;  2YGU A;  2K7C A;  2L98 A;  1ORG A;  2MLE C;  5I2L A;  3CGA A;  3PJI A;  2NXQ A;  1Z2C B;  1QS7 A;  2DOQ A;  2JXL A;  2LM5 A;  5CSJ A;  2PAS A;  4YGB B;  1TIZ A;  3VB1 A;  4USL A;  2BL0 C;  1LA3 A;  3SG4 A;  4IJ7 A;  1EXR A;  2NZ0 A;  1PRW A;  1K95 A;  1NP8 A;  1OZO A;  2LVI A;  3BUX B;  3B88 A;  4N1F A;  3TDU A;  3BUO B;  2ZFD A;  1OSA A;  1QX5 B;  3DF0 A;  2EGD A;  4ICB A;  4CID A;  2QEH A;  4MBE A;  1G8I A;  3NGV A;  1QX2 A;  4PE4 A;  1LA0 A;  3BFB A;  4INW A;  1LS8 A;  2K7B A;  2I7A A;  2H8V A;  1IRJ A;  3EVR A;  2I18 A;  3BXK A;  2LUC A;  1S5G Z;  2KBM A;  3K21 A;  4ZCU A;  1Q80 A;  5HLV A;  1REC A;  2M7N A;  1CFC A;  2FJY A;  2M3W A;  4I5J A;  3DVJ A;  5IBW A;  1UHJ A;  5D3O A;  1F8H A;  2CNP A;  2JZI A;  5AXI A;  1A29 A;  2JNF A;  1S1E A;  1OQP A;  3D78 A;  3I5I C;  3S0A A;  2L0P A;  3CDN A;  1W7J B;  3M0W A;  3NHT A;  3FWC A;  1J1E A;  4YI9 A;  2LMT A;  1J55 A;  2F2O A;  3L47 A;  4KYN A;  1XK4 A;  4GPL B;  4OZD A;  2CT9 A;  4A4B A;  2MJW B;  1CMF A;  1F55 A;  2EC6 C;  5FI7 A;  3I5F C;  1N2D A;  1J1D A;  1SKT A;  3B86 A;  1UHI A;  2MHH A;  1OMR A;  1Y1X A;  3ZWH A;  3D77 A;  1S6I A;  2LUX A;  1OOF A;  4I5K A;  3LL8 B;  4F7F A;  1JF0 A;  1PVB A;  2KYC A;  3L4L A;  1SR6 C;  2F3Z A;  4PE0 A;  3SG2 A;  3WNX B;  1UUR A;  4FQT A;  3NHI A;  1R6P A;  2OTG B;  5AAN A;  1CLB A;  5FI6 A;  1F4O A;  2M8U A;  4XJK A;  2KAV A;  1HT9 A;  1Z4H A;  2RGI A;  1CNP A;  2ZRT A;  1OMD A;  1M31 A;  4CPV A;  4ORB B;  1EG4 A;  1ZMZ A;  3IQO A;  3D74 A;  1H8B A;  1U5I B;  1ZUZ A;  5HLO A;  3V2L A;  1N0Y A;  1TWO A;  3SS3 A;  1NSH A;  3CYZ A;  2LE9 B;  3B7A A;  1EG3 A;  1QAT A;  1SK6 D;  1TUZ A;  4HSZ A;  2M7L A;  1X02 A;  5G08 A;  1JFK A;  2BCB A;  2LMV A;  1C3Z A;  2SCP A;  1PK0 D;  4OV2 A;  1QIV A;  1YX7 A;  1MF8 B;  3VGO A;  2JT8 A;  4MZK A;  3CR4 X;  2PYQ A;  1DEK A;  5K89 A;  2H2K A;  3O78 A;  5JOL A;  1JWD A;  3IQQ A;  4MEW A;  5DKR A;  2LLT A;  1FF1 A;  1CDL A;  2OS8 B;  3D0Y B;  1WRZ A;  3VRR A;  2K61 A;  3LCP C;  4HRG A;  1EJ3 A;  4CLN A;  2H61 C;  3QME A;  5I8N A;  1IWQ A;  3I5H B;  5CSF A;  1WY9 A;  1TNP A;  1J7R A;  1YRU B;  4M2P A;  3D75 A;  3D0Y A;  1KWO C;  5KTY A;  1DJG A;  2BKI B;  2FOT A;  2F33 A;  2M29 A;  4MN0 A;  2QEO A; 
#chains in the Genus database with same CATH homology
 1ORG A;  3K1E A;  3D73 A;  1OOI X;  2WCK A;  2WCL A;  3D76 A;  3PJI A;  3DY9 A;  3N7H A;  3VB1 A;  3R1O A;  3B88 A;  2P70 A;  3FE9 A;  3DZT A;  2QEH A;  1OOG A;  3NGV A;  3BFB A;  4INW A;  1LS8 A;  4OZD A;  2H8V A;  2ERB A;  2WCM A;  3S0B A;  3CZ1 A;  2WC6 A;  3S0D A;  2FJY A;  3BFA A;  2PQL A;  3D78 A;  3S0A A;  3B87 A;  3CDN A;  3S0E A;  1XFR A;  3NHT A;  3BFH A;  3Q8I A;  3L47 A;  2L2C A;  2WC5 A;  5DIC A;  3B86 A;  3L4A A;  3S0F A;  3CZ2 A;  3D77 A;  1OOF A;  2P71 A;  4F7F A;  3L4L A;  1DQE A;  1C3Y A;  3OGN A;  1OOH A;  5EL2 A;  3B6X A;  4FQT A;  3CZ0 A;  3NHI A;  4PT1 A;  2WCH A;  1QWV A;  1GM0 A;  3D74 A;  3V2L A;  1TWO A;  3R1P A;  3CYZ A;  3R72 A;  3BJH A;  3B7A A;  3FE6 A;  1C3Z A;  3RZS A;  1TUJ A;  2QEB A;  3DXL A;  3DYE A;  2WCJ A;  3R1V A;  2GTE A;  3CAB A;  2JPO A;  1T14 A;  3QME A;  2QEV A;  4INX A;  1P28 A;  3D75 A;  4JD9 A;  1OW4 A;  3S0G A;  2QDI A;  2QEO A;  3FE8 A;  2KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...