5AFPA

Neuronal calcium sensor-1 (ncs-1)from rattus norvegicus complex with rhodopsin kinase peptide from homo sapiens
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
177
structure length
173
Chain Sequence
LKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-Protein Coupled Receptor Kinase 1 (Grk1) Peptides Using Different Modes of Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 67
structure length 173
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5afpA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5afpA02
5IBWA 2LM5A 1FBVA 1QASA 3OB1B 1C7WA 4USLA 1CMGA 2I94A 2AMIA 4GNKB 2IS9A 1DJXA 1SKTA 1XK4C 2ZFDA 3O4YA 1CKKA 1RECA 1EG4A 1CFPA 2SCPA 1WRZA 3KPXA 1ZFSA 1NWDA 1S5GZ 4MSPA 3WNXB 1HT9A 2LC5A 2LMTA 3EKJA 1CDPA 2OPOA 3PLFB 3WXAA 3CS1A 5HYDA 2KBMA 1S6JA 2FJUB 1M45A 1B8RA 2LP3A 1PRWA 3EK7A 3OX5A 3FWCA 2K7OA 1RTP1 2OTGB 1WLMA 3CLNA 1CLMA 1LXFC 1NCZA 3HX4A 1QXPA 4WQ2A 2Q91A 1JUOA 1KFXS 1ODBA 1TTXA 2JT8A 2H61C 2L2EA 1SCMC 1B7TZ 2NCPA 2P6BB 3I5IC 3VRPA 5FYXA 1IQ5A 2CBLA 2JOJA 3MSEB 1R6PA 1XFWO 1FPWA 4M2OA 1MF8B 1KFUL 3GOFA 2L51A 1JFJA 1L7ZA 2LVVA 3CGAA 2WCFA 5AFPA 1S26D 2HQ8A 1PVAA 1K8UA 3F45A 4BY4A 5GQQC 1TCOB 5F6TA 4C0JA 1YRTB 5I2LA 4DRWA 4ETOA 3GK1A 3JTDC 3O78A 5ER5A 1DJYA 1XFUO 2HPSA 1SPYA 3SG3A 3ZNIA 4MZKA 3CWGA 1JC2A 1OSAA 1KK8B 3PFVA 1DJIA 4GGFA 1QATA 3FS7A 2JQ6A 3KEVA 4DUQA 2JRFA 3IF7A 4GFTA 4QJ3B 2LVKA 2BKIB 1JBAA 3BOWB 1IJ5A 1DJZA 4UPGA 2LVJA 1ZUZA 2KGBC 2QACA 5I2OA 2EC6B 1XFXO 2JNXA 1EXRA 1CM1A 2JZIA 1OMDA 1WY9A 1IGVA 4DCKA 2K0JA 1WRLA 3AAJA 1LKJA 4WRIA 2L50A 4CFQA 2F3YA 2KI4C 2L4HA 3CTNA 4NDDA 4ORCB 1CTRA 3SG2A 2KBIA 5PALA 1G4YR 1UP5A 1IG5A 1SL9A 4MZJA 3TUYC 1OZOA 1MQ1A 1JSAA 2K8MB 1OQPA 1Y1XA 4JQ0D 2PMYA 4TNCA 1S5GY 1GJYA 1KSMA 2MHHA 1PK0D 2O5GA 3I5GC 4PCWA 1A75A 2BECA 2L0PA 2I7AA 1VRKA 2LLUA 1PSRA 4NDCA 1BMOA 2GGMA 3D10A 1DGVA 4FQOA 1A4PA 2LCPA 3ZWHA 1F54A 1UHIA 4R1EA 1AUIB 2MAZA 1FF1A 1BR4B 2L98A 2F33A 4XYNA 3A8RA 3A4UB 4HRGA 1B7TY 3TDIA 1S3PA 2KAXA 3LK1A 2JU0A 1B4CA 1CDNA 2KQYA 4PE1A 1CDLA 3I5FB 1XK4A 5CPVA 1JF0A 1WDCB 1Y6WA 2JT3A 1XFZO 2JT0A 4I5LB 3RLZA 1NX1A 1NX0A 2F8PA 3BUXB 1Y1AA 2PVBA 4M2QA 4A4BA 4F0ZB 3PSRA 1IQ3A 2BL0C 1IH0A 2EHBA 2MLEC 4I5JA 4MRYA 3SIAA 1QS7A 4N5XA 1DJHA 3KF9A 2LUXA 2M1KB 3BXKA 2KQ6A 3EK4A 1J55A 2GGZA 2KFGA 3HCMA 4YGEB 5HKZA 1J7QA 3CR5X 2ISDA 1CB1A 3SG7A 1SR6C 2OS8C 4OVNF 2FOTA 1TNQA 5CSFA 2NXQA 3PALA 3DVMA 3JVTB 2M29A 1CNPA 4JPZB 1B8LA 1XFYO 2KDHA 1U5IA 2BBMA 3DVJA 3NXAA 5JJGA 2LUCA 4PHJA 1KQMB 1NCXA 2G2BA 1KFUS 3SIBA 3C1VA 2I2RE 4BY5A 1CFFA 2KGRA 3AKBA 1NX3A 2JNFA 3TS5B 3BUNB 2TN4A 5K89A 1DT7B 4HREE 2MBXA 3K21A 1F4QA 2MLFC 5KSZA 4PE7A 3BUMB 1K93D 1AJ5A 1TRFA 4N1FA 4CPVA 1JWDA 2M3WA 1UHKA 1A75B 1IJ6A 3O2PA 1A03A 1KK8C 2KI6D 1EL4A 1F70A 1C7VA 1NPQA 2F3ZA 1IKUA 1K95A 1N2DA 1NX2A 2CXJA 1N65A 2KNEA 3DVEA 1GGZA 1W7IB 3AKAA 1G33A 1SK6D 1CDMA 1M63B 3I5HC 1DF0A 2ZKMX 2JWWA 5JOLA 1UHJA 5CSNA 4M2PA 1FI5A 2M7LA 5DKQA 2LV7A 1OE9B 3PN7C 1FW4A 3LK0A 3RM1A 2SASA 3VRNA 1ZOTB 4U8DA 4MEWA 2R2IA 4OR9B 1AJ4A 2K7CA 3TDZA 3VRQA 2WNDA 1DMOA 4MN0A 1MXLC 2MJWB 4PDZA 1R2UA 2WCEA 2ZRSA 4D1EA 3CR4X 2M1UA 3LLEA 2ZRTA 2DOQA 5AERA 4MVFA 5AANA 4HRHA 1S1EA 1DJGA 3TDUA 1SCMB 5HLVA 2JC2A 1QLSA 3NSIA 3DD4A 1YURA 4XJKA 1L2OC 4YBHB 1KWOC 1G8IA 4YGDB 4PE0A 5AEQA 4NQGA 4JWQA 4AQIA 5AXIA 1J7PA 2ZNDA 1Y0VH 2FCEA 1WRKA 1EJ3A 1KK7Z 4DIRA 1GGWA 1RFJA 1U5IB 4AQJA 2KOTA 3WHUB 3IQQA 3I5FC 1ALVA 2KYCA 1H8BA 3M0WA 1K9KA 2KYFA 4NDBA 5I2QA 4E68A 4N1GA 1ZACA 3GK2A 1J7OA 1B9AA 4OCIA 2LVIA 4QJ5B 2CTNA 2FCDA 2KAVA 5DKRA 2PRUA 2KI6C 2CNPA 1BODA 1SBJA 3FWBA 1X02A 2JTTA 5HKWA 1TN4A 2LE9B 4DS7A 1A2XA 1C07A 2HF5A 3CR2A 3OP0A 2BKHB 4C0KA 3KO0A 4CIDA 1CMFA 3D0YA 3KHEA 2M7NA 1SL8A 5J3XA 1J1DA 1KSOA 1PSBA 2KI4B 2NLNA 3GK4X 4OV2A 4PHKA 3ICBA 4YGBB 1HQVA 2JTZA 4YGAA 4GPLB 1XYDA 1DF0B 2NZ0A 5HKYA 3EVUA 2LLTA 3TUYB 5BPJA 2NCOA 1DVIA 3WHTB 3VGOA 2KFFA 2H61A 1D1OA 1XA5A 1RJVA 1TNWA 1ALWA 1BJFA 1XVJA 1DGUA 1OOJA 1BT6A 4CLNA 3PM8A 3TS5C 4A4CA 2KFHA 2F2PA 2OTGC 3IQOA 1GQMA 1SMGA 1BF5A 4GBAA 1QTXA 3SJSA 3OHMB 1RK9A 2BE4A 1QV1A 1MR8A 1UUSA 3BQ3A 3VROA 2AAOA 4MLWA 4ZCVA 1M31A 1YRUB 2RGIA 4YGCB 1K2HA 1AK8A 1NSHA 4ORAB 2BCBA 1CM4A 2V53A 1K94A 2LHLA 3QRXA 1MUXA 4CFRA 1BU3A 1OMVA 1K96A 1S36A 1NP8A 1UHHA 4XJKB 1KK7Y 1QIVA 1YUSA 1TNXA 1SCVA 1SY9A 1F55A 1LINA 1TOPA 2H2KA 4C0LA 1TIZA 2BL0B 1K90D 2LLSA 3OX6A 1B1GA 4I5KA 2E30A 1JF2A 2K7DA 1AHRA 1K9PA 1SNLA 5ER4X 1QX7A 4HSZA 2QPTA 3EVRA 2EGDA 2WORA 2K7BA 1SR6B 2OS8B 2JXLA 1QVIY 1CFCA 2Y5IA 1QV0A 4PE4A 1MXEA 1W7JB 1BG1A 2EC6C 1LA0A 1QX5B 3OB2B 4P5OE 3DF0A 1QX2A 4ICBA 2CCMA 1JFKA 5D7FA 4GUKA 5DKNA 1QLKA 2L4IA 1XFVO 1YR5A 3O6BA 3PATA 5CSJA 1WLZA 1QIWA 2GV5A 2Q4UA 1OMRA 3D0YB 3BYAA 5G08A 1SL7A 1F8HA 1NIWA 4PHMA 1B47A 2L5XB 1Q80A 2CT9A 1V1FA 1XO5A 2BBNA 1AP4A 2BCAA 1ZMZA 5KTYA 1MHOA 2LHIA 1E8AA 1NUBA 1RWYA 1SYMA 2WC8A 4ZCUA 2A4JA 3I5IB 1RROA 2PSRA 2G9BA 2LAPA 3NSKA 1KFXL 1IWQA 2JXCA 3NSLA 3EVVA 2Y1MA 3EK8A 2LANA 1TCFA 2KHNA 2HQWA 5KU1A 1F4OA 1Y1UA 4PALA 1YUUA 1CLLA 3SG4A 1CLBA 2Y4QA 1J1EA 2LMUA 1YUTA 2D8NA 2K2AA 1SRAA 1WDCC 3I5HB 4IL1A 5B8IB 1BLQA 2MA2A 3SG5A 2KSPA 2M8UA 1V1GA 1BOCA 2VRGA 3EKHA 4MBEA 4MZLA 3JTDB 1FI6A 1UURA 3PN7B 4GAOA 2B1UA 2BE6A 3VRRA 1PVBA 3BUOB 1MWNA 2Y1NA 1CFDA 1F71A 1KQVA 1BR1B 3NSOA 2ZN9A 1YVHA 4ORBB 1PALA 1QVIZ 2LMVA 3FIAA 1NYAA 2K2FA 2M0RA 2HETA 4OKHA 2WOSA 4YRUA 5CSIA 3LCPC 2M9GA 1NCYA 1YX8A 3CZTX 2O60A 1UWOA 4GGFC 4YI9A 1QJTA 3E3RA 3H4SE 3JVTC 3SG6A 2JPTA 4PHNA 5HLOA 2ZN8A 1OZSA 1SW8A 1AVSA 1L2OB 2LNKA 2JULA 1KQMC 1DTLA 1J7RA 1KWOB 1B8CA 3DF0B 3BUWB 2E6WA 3DVKA 1EG3A 1PULA 2K61A 1YTZC 1EH2A 1A29A 1IRJA 3I5GB 2PALA 1K9UA 1UHNA 1LA3A 4GGNA 5I8NA 2COLB 1S6CA 1TNPA 2AUCA 2LP2A 2ZNEA 1DJWA 2F2OA 2M97A 3LL8B 3BOWA 4Q04A 4YI8A 4WQ3A 3AAKA 4P2YB 1N0YA 1YVLA 4L9MA 2KAYA 4I5NB 5TNCA 3TZ1A 1LVCD 2PASA 1S6IA 1YX7A 4QJ4B 4MRXA 4AOMA 2M49B 1M39A 4FTGA 2I18A 2WCBA 2MRDA 2BCXA 5D69A 1H4BA 1KCYA 1M46A
chains in the Genus database with same CATH superfamily
5IBWA 2LM5A 1FBVA 1QASA 3OB1B 3CZ2A 1XFRA 1C7WA 4USLA 1CMGA 2I94A 2AMIA 4GNKB 2IS9A 1DJXA 1SKTA 1XK4C 2ZFDA 3O4YA 1CKKA 1RECA 1EG4A 3BFBA 1CFPA 2SCPA 1WRZA 3KPXA 1ZFSA 1NWDA 1S5GZ 2QEVA 4MSPA 3WNXB 1HT9A 2LC5A 2LMTA 3EKJA 1CDPA 2OPOA 3PLFB 3WXAA 3CS1A 5HYDA 1OOFA 3O4XA 2KBMA 1S6JA 2FJUB 1M45A 3SS5A 1B8RA 2LP3A 1PRWA 3EK7A 3OX5A 1TWOA 2K7OA 1RTP1 2OTGB 1WLMA 3CLNA 3FWCA 1CLMA 1LXFC 1NCZA 3HX4A 1QXPA 4WQ2A 2Q91A 1JUOA 1KFXS 1ODBA 1TTXA 2JT8A 2H61C 2L2EA 1SCMC 1B7TZ 2NCPA 2P6BB 3I5IC 2QEHA 5FYXA 1IQ5A 2CBLA 3CZ1A 2JOJA 3B88A 3MSEB 1R6PA 1XFWO 1FPWA 4M2OA 1MF8B 1KFUL 1W9ZA 3GOFA 2L51A 1JFJA 1L7ZA 2LVVA 3CGAA 2WCFA 5AFPA 3IVTA 1S26D 2HQ8A 1PVAA 1Z2CB 1K8UA 3B86A 3F45A 4BY4A 5GQQC 1TCOB 5F6TA 3EG5B 4C0JA 1YRTB 5I2LA 4DRWA 4ETOA 3GK1A 3S0GA 3JTDC 3O78A 5ER5A 1DJYA 1XFUO 1TUJA 1SPYA 2HPSA 3SG3A 3ZNIA 4MZKA 3CWGA 3Q8IA 1JC2A 1OSAA 3FE9A 1KK8B 3PFVA 1DJIA 4GGFA 1QATA 3FS7A 2JQ6A 3KEVA 4DUQA 2JRFA 3IF7A 4GFTA 4QJ3B 2LVKA 2BKIB 3NGVA 3BOWB 1JBAA 1IJ5A 1DJZA 4UPGA 2LVJA 1ZUZA 2KGBC 2QACA 2P70A 5I2OA 2EC6B 2WC6A 1XFXO 2JNXA 1EXRA 1CM1A 3BFHA 2JZIA 1OMDA 1WY9A 1IGVA 4DCKA 2K0JA 1WRLA 3AAJA 1LKJA 4WRIA 2L50A 4CFQA 2QEBA 2F3YA 2KI4C 2L4HA 3CTNA 4NDDA 4ORCB 1CTRA 1P28A 3SG2A 3CDNA 2KBIA 3V2LA 5PALA 1G4YR 1UP5A 1IG5A 1SL9A 4MZJA 3TUYC 1OZOA 1MQ1A 1JSAA 2K8MB 1OQPA 1Y1XA 4JQ0D 2PMYA 3B7AA 1S5GY 1GJYA 1KSMA 2MHHA 4TNCA 5DICA 1PK0D 2O5GA 3I5GC 4PCWA 1A75A 2BECA 2BNXA 2L0PA 3S0DA 2I7AA 1Z4HA 1VRKA 2LLUA 1PSRA 4NDCA 1BMOA 2GGMA 3D10A 1DGVA 4FQOA 1A4PA 1DEKA 2LCPA 3ZWHA 1F54A 1UHIA 4R1EA 1AUIB 2MAZA 1FF1A 1BR4B 2L98A 2F33A 4XYNA 3A8RA 3A4UB 4HRGA 1B7TY 3TDIA 1S3PA 2KAXA 4OZDA 3LK1A 2JU0A 1B4CA 3N7HA 1CDNA 2KQYA 4PE1A 1CDLA 3I5FB 2WCKA 1XK4A 5CPVA 1JF0A 1WDCB 2GTEA 1Y6WA 2JT3A 1XFZO 2JT0A 4I5LB 3RLZA 1NX1A 1NX0A 2F8PA 3BUXB 1Y1AA 2PVBA 4M2QA 4A4BA 4F0ZB 3PSRA 1IQ3A 3CZ0A 5D3OA 2BL0C 1IH0A 2EHBA 2MLEC 4I5JA 4MRYA 3SIAA 1QS7A 4N5XA 1DJHA 2KLEA 2LUXA 2M1KB 3KF9A 3BXKA 2KQ6A 3EK4A 1J55A 2GGZA 2KFGA 3HCMA 4YGEB 5HKZA 1J7QA 3CR5X 2ISDA 1CB1A 3SG7A 1SR6C 4JD9A 4FQTA 2OS8C 4OVNF 2FOTA 1TNQA 2KLDA 5CSFA 2NXQA 3PALA 3DVMA 3JVTB 2M29A 1CNPA 4JPZB 1B8LA 1XFYO 2KDHA 1U5IA 2BBMA 3DVJA 3NXAA 5JJGA 2LUCA 4PHJA 1KQMB 1NCXA 1OOIX 2G2BA 1KFUS 3SIBA 3C1VA 2I2RE 4BY5A 1CFFA 2KGRA 2ERBA 3AKBA 1NX3A 2JNFA 1GM0A 1C3YA 3TS5B 2JPOA 3BUNB 3B87A 2TN4A 5K89A 1DT7B 4HREE 2MBXA 3D75A 1F4QA 3K21A 3VB1A 2MLFC 5KSZA 4PE7A 3BUMB 1K93D 1AJ5A 1TRFA 4N1FA 4CPVA 1JWDA 2M3WA 1UHKA 1OW4A 1A75B 1IJ6A 3O2PA 1A03A 1KK8C 2KI6D 2WCHA 1EL4A 1F70A 1C7VA 1NPQA 2F3ZA 1IKUA 1K95A 1N2DA 1NX2A 1TUZA 2CXJA 1N65A 2KNEA 3DVEA 1GGZA 1W7IB 3AKAA 1G33A 5FI6A 3SS4A 2WCLA 1SK6D 1CDMA 1M63B 2PYQA 3I5HC 1DF0A 2ZKMX 2JWWA 5JOLA 1UHJA 5CSNA 4M2PA 1FI5A 2M7LA 5EL2A 5DKQA 2LV7A 1OE9B 2WCJA 3FE6A 3PN7C 1IIOA 1FW4A 3LK0A 3RM1A 2SASA 3UO9A 3VRNA 1ZOTB 3FE8A 4U8DA 4MEWA 2R2IA 3DY9A 4OR9B 1AJ4A 2K7CA 3TDZA 3VRQA 2WNDA 1DMOA 4MN0A 1MXLC 2MJWB 4PDZA 1R2UA 2WCEA 2ZRSA 2QDIA 4D1EA 3CR4X 2M1UA 3DXLA 3LLEA 2ZRTA 2DOQA 5AERA 4MVFA 1LS8A 5AANA 4HRHA 1S1EA 1DJGA 3TDUA 1SCMB 5HLVA 2JC2A 1QLSA 3NSIA 3DD4A 2PQLA 1YURA 4XJKA 1L2OC 4YBHB 1KWOC 1G8IA 4YGDB 4PE0A 5AEQA 4NQGA 4JWQA 4AQIA 5AXIA 1J7PA 2ZNDA 1Y0VH 2FCEA 1WRKA 1EJ3A 1KK7Z 4DIRA 1GGWA 1RFJA 1U5IB 4AQJA 2KOTA 3WHUB 3IQQA 3I5FC 1ALVA 2KYCA 3QMEA 1H8BA 3M0WA 1K9KA 2KYFA 4NDBA 5I2QA 4E68A 4N1GA 1ZACA 3GK2A 3BJHA 1J7OA 1SSEB 1B9AA 4OCIA 2LVIA 4QJ5B 2CTNA 2FCDA 2KAVA 5DKRA 2PRUA 2KI6C 2CNPA 1BODA 1SBJA 3PM2A 3FWBA 1X02A 2JTTA 5HKWA 1TN4A 2LE9B 4DS7A 1A2XA 1C07A 2HF5A 3CR2A 3OP0A 2BKHB 4C0KA 3KO0A 4CIDA 1CMFA 3D0YA 2L2CA 2M7NA 1SL8A 3D78A 1J1DA 1C3ZA 1OOHA 1KSOA 3KHEA 4KYNA 5J3XA 1PSBA 2KI4B 2NLNA 3GK4X 4OV2A 4PHKA 3ICBA 4YGBB 1HQVA 2JTZA 4YGAA 4GPLB 1XYDA 1DF0B 2NZ0A 5HKYA 3S0AA 3EVUA 2LLTA 3TUYB 3VRPA 5BPJA 2NCOA 1DVIA 3WHTB 3VGOA 2KFFA 3L4AA 2H61A 1ORGA 1XA5A 1D1OA 1RJVA 1TNWA 1ALWA 1BJFA 1XVJA 1DGUA 1OOJA 1BT6A 4CLNA 4F7FA 3PM8A 3TS5C 4A4CA 3R1VA 2KFHA 2F2PA 2OTGC 3IQOA 2FJYA 1GQMA 1SMGA 1BF5A 4GBAA 1QTXA 3D77A 4IJ7A 3OHMB 3SJSA 1RK9A 2BE4A 1QV1A 1MR8A 1UUSA 3BQ3A 3VROA 2AAOA 4MLWA 4ZCVA 1M31A 1YRUB 2RGIA 4YGCB 1K2HA 1AK8A 1NSHA 4ORAB 2BCBA 1CM4A 2V53A 1K94A 2LHLA 3QRXA 1MUXA 4CFRA 1BU3A 1OMVA 1K96A 1S36A 1NP8A 1UHHA 4XJKB 1KK7Y 1QIVA 1YUSA 1TNXA 1SCVA 1SY9A 3R72A 3L4LA 1LINA 1TOPA 2H2KA 4C0LA 2H8VA 1F55A 1TIZA 2BL0B 3DYEA 1K90D 2LLSA 3PJIA 3OX6A 1B1GA 4I5KA 2E30A 1JF2A 2K7DA 1AHRA 1K9PA 1SNLA 5ER4X 1QX7A 4HSZA 2QPTA 3EVRA 2EGDA 3S0EA 3B6XA 2WORA 3UNWA 2K7BA 1SR6B 3BFAA 2OS8B 2JXLA 1QVIY 1CFCA 2YGUA 2Y5IA 1QV0A 4PE4A 1MXEA 1W7JB 1BG1A 2EC6C 1LA0A 1QX5B 3OB2B 4P5OE 3DF0A 1OOGA 3SS3A 1QX2A 4ICBA 2CCMA 1JFKA 5D7FA 4GUKA 5DKNA 5FI7A 1QLKA 2L4IA 4INXA 1XFVO 1YR5A 2L5YA 3O6BA 3PATA 5CSJA 1WLZA 1QIWA 2GV5A 2Q4UA 3D74A 1OMRA 3D0YB 3BYAA 2WC5A 1SL7A 3D76A 5G08A 1F8HA 3L47A 1NIWA 4PHMA 1B47A 2L5XB 1Q80A 2CT9A 1V1FA 1XO5A 2BBNA 1AP4A 2BCAA 1ZMZA 5KTYA 1MHOA 2LHIA 1E8AA 3NHTA 1NUBA 1RWYA 1SYMA 2WC8A 4ZCUA 2WCMA 2A4JA 3I5IB 1RROA 2PSRA 5FI2A 1T14A 2G9BA 2LAPA 3NSKA 1KFXL 1IWQA 2JXCA 3NSLA 3EVVA 2Y1MA 3EK8A 2LANA 1TCFA 2KHNA 2HQWA 5KU1A 1F4OA 1Y1UA 3CYZA 4PALA 1YUUA 1CLLA 3SG4A 3K1EA 1CLBA 2Y4QA 1J1EA 2LMUA 1YUTA 2D8NA 2K2AA 1SRAA 1WDCC 3I5HB 3R1OA 4IL1A 5B8IB 1BLQA 2MA2A 3SG5A 2KSPA 2M8UA 1V1GA 1BOCA 2VRGA 3EKHA 4MBEA 4MZLA 3JTDB 1FI6A 1UURA 3PN7B 4GAOA 2B1UA 2BE6A 3VRRA 1PVBA 3BUOB 1MWNA 2Y1NA 1CFDA 3OBVA 1F71A 1BR1B 3NSOA 1KQVA 1DELA 1YVHA 2ZN9A 4ORBB 1PALA 1QVIZ 2LMVA 3FIAA 1NYAA 2K2FA 2M0RA 2HETA 4OKHA 2WOSA 4YRUA 5CSIA 3LCPC 2M9GA 1NCYA 1YX8A 3CZTX 2O60A 1UWOA 4GGFC 4YI9A 1DQEA 1QJTA 3E3RA 3H4SE 3JVTC 3SG6A 2JPTA 4PHNA 5HLOA 5I94A 2KPHA 3D73A 2ZN8A 3DZTA 1OZSA 1SW8A 1AVSA 1L2OB 1QWVA 2JULA 1KQMC 1DTLA 2LNKA 1J7RA 1KWOB 1B8CA 3DF0B 3OGNA 3BUWB 3RZSA 2E6WA 3DVKA 1EG3A 1PULA 3S0BA 2QEOA 2K61A 1YTZC 1EH2A 1A29A 1IRJA 3I5GB 2PALA 1K9UA 1UHNA 1LA3A 4GGNA 5I8NA 2COLB 2K60A 1S6CA 1TNPA 2AUCA 2LP2A 3R1PA 2ZNEA 1DJWA 2F2OA 2M97A 3LL8B 3BOWA 4Q04A 4YI8A 4WQ3A 3AAKA 4P2YB 1N0YA 1YVLA 2P71A 2KAYA 4L9MA 5HL1A 4I5NB 5TNCA 1DC1A 3TZ1A 1LVCD 2PASA 1S6IA 1YX7A 4JKTA 3S0FA 4QJ4B 4MRXA 4AOMA 3NHIA 2M49B 1M39A 4FTGA 2BAPA 2I18A 3CABA 2WCBA 2MRDA 2BCXA 5D69A 4INWA 1H4BA 1KCYA 1M46A 4PT1A
chains in the Genus database with same CATH topology
5IBWA 2LM5A 1FBVA 1QASA 3OB1B 1C7WA 4USLA 1CMGA 2I94A 2AMIA 4GNKB 2IS9A 1DJXA 1SKTA 1XK4C 2ZFDA 3O4YA 1CKKA 1RECA 1EG4A 1CFPA 2SCPA 1WRZA 3KPXA 1ZFSA 1NWDA 1S5GZ 4MSPA 3WNXB 1HT9A 2LC5A 2LMTA 3EKJA 1CDPA 2OPOA 3PLFB 3WXAA 3CS1A 5HYDA 2KBMA 1S6JA 2FJUB 1M45A 1B8RA 2LP3A 1PRWA 3EK7A 3OX5A 3FWCA 2K7OA 1RTP1 2OTGB 1WLMA 3CLNA 1CLMA 1LXFC 1NCZA 3HX4A 1QXPA 4WQ2A 2Q91A 1JUOA 1KFXS 1ODBA 1TTXA 2JT8A 2H61C 2L2EA 1SCMC 1B7TZ 2NCPA 2P6BB 3I5IC 3VRPA 5FYXA 1IQ5A 2CBLA 2JOJA 3MSEB 1R6PA 1XFWO 1FPWA 4M2OA 1MF8B 1KFUL 3GOFA 2L51A 1JFJA 1L7ZA 2LVVA 3CGAA 2WCFA 5AFPA 1S26D 2HQ8A 1PVAA 1K8UA 3F45A 4BY4A 5GQQC 1TCOB 5F6TA 4C0JA 1YRTB 5I2LA 4DRWA 4ETOA 3GK1A 3JTDC 3O78A 5ER5A 1DJYA 1XFUO 2HPSA 1SPYA 3SG3A 3ZNIA 4MZKA 3CWGA 1JC2A 1OSAA 1KK8B 3PFVA 1DJIA 4GGFA 1QATA 3FS7A 2JQ6A 3KEVA 4DUQA 2JRFA 3IF7A 4GFTA 4QJ3B 2LVKA 2BKIB 1JBAA 3BOWB 1IJ5A 1DJZA 4UPGA 2LVJA 1ZUZA 2KGBC 2QACA 5I2OA 2EC6B 1XFXO 2JNXA 1EXRA 1CM1A 2JZIA 1OMDA 1WY9A 1IGVA 4DCKA 2K0JA 1WRLA 3AAJA 1LKJA 4WRIA 2L50A 4CFQA 2F3YA 2KI4C 2L4HA 3CTNA 4NDDA 4ORCB 1CTRA 3SG2A 2KBIA 5PALA 1G4YR 1UP5A 1IG5A 1SL9A 4MZJA 3TUYC 1OZOA 1MQ1A 1JSAA 2K8MB 1OQPA 1Y1XA 4JQ0D 2PMYA 4TNCA 1S5GY 1GJYA 1KSMA 2MHHA 1PK0D 2O5GA 3I5GC 4PCWA 1A75A 2BECA 2L0PA 2I7AA 1VRKA 2LLUA 1PSRA 4NDCA 1BMOA 2GGMA 3D10A 1DGVA 4FQOA 1A4PA 2LCPA 3ZWHA 1F54A 1UHIA 4R1EA 1AUIB 2MAZA 1FF1A 1BR4B 2L98A 2F33A 4XYNA 3A8RA 3A4UB 4HRGA 1B7TY 3TDIA 1S3PA 2KAXA 3LK1A 2JU0A 1B4CA 1CDNA 2KQYA 4PE1A 1CDLA 3I5FB 1XK4A 5CPVA 1JF0A 1WDCB 1Y6WA 2JT3A 1XFZO 2JT0A 4I5LB 3RLZA 1NX1A 1NX0A 2F8PA 3BUXB 1Y1AA 2PVBA 4M2QA 4A4BA 4F0ZB 3PSRA 1IQ3A 2BL0C 1IH0A 2EHBA 2MLEC 4I5JA 4MRYA 3SIAA 1QS7A 4N5XA 1DJHA 3KF9A 2LUXA 2M1KB 3BXKA 2KQ6A 3EK4A 1J55A 2GGZA 2KFGA 3HCMA 4YGEB 5HKZA 1J7QA 3CR5X 2ISDA 1CB1A 3SG7A 1SR6C 2OS8C 4OVNF 2FOTA 1TNQA 5CSFA 2NXQA 3PALA 3DVMA 3JVTB 2M29A 1CNPA 4JPZB 1B8LA 1XFYO 2KDHA 1U5IA 2BBMA 3DVJA 3NXAA 5JJGA 2LUCA 4PHJA 1KQMB 1NCXA 2G2BA 1KFUS 3SIBA 3C1VA 2I2RE 4BY5A 1CFFA 2KGRA 3AKBA 1NX3A 2JNFA 3TS5B 3BUNB 2TN4A 5K89A 1DT7B 4HREE 2MBXA 3K21A 1F4QA 2MLFC 5KSZA 4PE7A 3BUMB 1K93D 1AJ5A 1TRFA 4N1FA 4CPVA 1JWDA 2M3WA 1UHKA 1A75B 1IJ6A 3O2PA 1A03A 1KK8C 2KI6D 1EL4A 1F70A 1C7VA 1NPQA 2F3ZA 1IKUA 1K95A 1N2DA 1NX2A 2CXJA 1N65A 2KNEA 3DVEA 1GGZA 1W7IB 3AKAA 1G33A 1SK6D 1CDMA 1M63B 3I5HC 1DF0A 2ZKMX 2JWWA 5JOLA 1UHJA 5CSNA 4M2PA 1FI5A 2M7LA 5DKQA 2LV7A 1OE9B 3PN7C 1FW4A 3LK0A 3RM1A 2SASA 3VRNA 1ZOTB 4U8DA 4MEWA 2R2IA 4OR9B 1AJ4A 2K7CA 3TDZA 3VRQA 2WNDA 1DMOA 4MN0A 1MXLC 2MJWB 4PDZA 1R2UA 2WCEA 2ZRSA 4D1EA 3CR4X 2M1UA 3LLEA 2ZRTA 2DOQA 5AERA 4MVFA 5AANA 4HRHA 1S1EA 1DJGA 3TDUA 1SCMB 5HLVA 2JC2A 1QLSA 3NSIA 3DD4A 1YURA 4XJKA 1L2OC 4YBHB 1KWOC 1G8IA 4YGDB 4PE0A 5AEQA 4NQGA 4JWQA 4AQIA 5AXIA 1J7PA 2ZNDA 1Y0VH 2FCEA 1WRKA 1EJ3A 1KK7Z 4DIRA 1GGWA 1RFJA 1U5IB 4AQJA 2KOTA 3WHUB 3IQQA 3I5FC 1ALVA 2KYCA 1H8BA 3M0WA 1K9KA 2KYFA 4NDBA 5I2QA 4E68A 4N1GA 1ZACA 3GK2A 1J7OA 1B9AA 4OCIA 2LVIA 4QJ5B 2CTNA 2FCDA 2KAVA 5DKRA 2PRUA 2KI6C 2CNPA 1BODA 1SBJA 3FWBA 1X02A 2JTTA 5HKWA 1TN4A 2LE9B 4DS7A 1A2XA 1C07A 2HF5A 3CR2A 3OP0A 2BKHB 4C0KA 3KO0A 4CIDA 1CMFA 3D0YA 3KHEA 2M7NA 1SL8A 5J3XA 1J1DA 1KSOA 1PSBA 2KI4B 2NLNA 3GK4X 4OV2A 4PHKA 3ICBA 4YGBB 1HQVA 2JTZA 4YGAA 4GPLB 1XYDA 1DF0B 2NZ0A 5HKYA 3EVUA 2LLTA 3TUYB 5BPJA 2NCOA 1DVIA 3WHTB 3VGOA 2KFFA 2H61A 1D1OA 1XA5A 1RJVA 1TNWA 1ALWA 1BJFA 1XVJA 1DGUA 1OOJA 1BT6A 4CLNA 3PM8A 3TS5C 4A4CA 2KFHA 2F2PA 2OTGC 3IQOA 1GQMA 1SMGA 1BF5A 4GBAA 1QTXA 3SJSA 3OHMB 1RK9A 2BE4A 1QV1A 1MR8A 1UUSA 3BQ3A 3VROA 2AAOA 4MLWA 4ZCVA 1M31A 1YRUB 2RGIA 4YGCB 1K2HA 1AK8A 1NSHA 4ORAB 2BCBA 1CM4A 2V53A 1K94A 2LHLA 3QRXA 1MUXA 4CFRA 1BU3A 1OMVA 1K96A 1S36A 1NP8A 1UHHA 4XJKB 1KK7Y 1QIVA 1YUSA 1TNXA 1SCVA 1SY9A 1F55A 1LINA 1TOPA 2H2KA 4C0LA 1TIZA 2BL0B 1K90D 2LLSA 3OX6A 1B1GA 4I5KA 2E30A 1JF2A 2K7DA 1AHRA 1K9PA 1SNLA 5ER4X 1QX7A 4HSZA 2QPTA 3EVRA 2EGDA 2WORA 2K7BA 1SR6B 2OS8B 2JXLA 1QVIY 1CFCA 2Y5IA 1QV0A 4PE4A 1MXEA 1W7JB 1BG1A 2EC6C 1LA0A 1QX5B 3OB2B 4P5OE 3DF0A 1QX2A 4ICBA 2CCMA 1JFKA 5D7FA 4GUKA 5DKNA 1QLKA 2L4IA 1XFVO 1YR5A 3O6BA 3PATA 5CSJA 1WLZA 1QIWA 2GV5A 2Q4UA 1OMRA 3D0YB 3BYAA 5G08A 1SL7A 1F8HA 1NIWA 4PHMA 1B47A 2L5XB 1Q80A 2CT9A 1V1FA 1XO5A 2BBNA 1AP4A 2BCAA 1ZMZA 5KTYA 1MHOA 2LHIA 1E8AA 1NUBA 1RWYA 1SYMA 2WC8A 4ZCUA 2A4JA 3I5IB 1RROA 2PSRA 2G9BA 2LAPA 3NSKA 1KFXL 1IWQA 2JXCA 3NSLA 3EVVA 2Y1MA 3EK8A 2LANA 1TCFA 2KHNA 2HQWA 5KU1A 1F4OA 1Y1UA 4PALA 1YUUA 1CLLA 3SG4A 1CLBA 2Y4QA 1J1EA 2LMUA 1YUTA 2D8NA 2K2AA 1SRAA 1WDCC 3I5HB 4IL1A 5B8IB 1BLQA 2MA2A 3SG5A 2KSPA 2M8UA 1V1GA 1BOCA 2VRGA 3EKHA 4MBEA 4MZLA 3JTDB 1FI6A 1UURA 3PN7B 4GAOA 2B1UA 2BE6A 3VRRA 1PVBA 3BUOB 1MWNA 2Y1NA 1CFDA 1F71A 1KQVA 1BR1B 3NSOA 2ZN9A 1YVHA 4ORBB 1PALA 1QVIZ 2LMVA 3FIAA 1NYAA 2K2FA 2M0RA 2HETA 4OKHA 2WOSA 4YRUA 5CSIA 3LCPC 2M9GA 1NCYA 1YX8A 3CZTX 2O60A 1UWOA 4GGFC 4YI9A 1QJTA 3E3RA 3H4SE 3JVTC 3SG6A 2JPTA 4PHNA 5HLOA 2ZN8A 1OZSA 1SW8A 1AVSA 1L2OB 2LNKA 2JULA 1KQMC 1DTLA 1J7RA 1KWOB 1B8CA 3DF0B 3BUWB 2E6WA 3DVKA 1EG3A 1PULA 2K61A 1YTZC 1EH2A 1A29A 1IRJA 3I5GB 2PALA 1K9UA 1UHNA 1LA3A 4GGNA 5I8NA 2COLB 1S6CA 1TNPA 2AUCA 2LP2A 2ZNEA 1DJWA 2F2OA 2M97A 3LL8B 3BOWA 4Q04A 4YI8A 4WQ3A 3AAKA 4P2YB 1N0YA 1YVLA 4L9MA 2KAYA 4I5NB 5TNCA 3TZ1A 1LVCD 2PASA 1S6IA 1YX7A 4QJ4B 4MRXA 4AOMA 2M49B 1M39A 4FTGA 2I18A 2WCBA 2MRDA 2BCXA 5D69A 1H4BA 1KCYA 1M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IBW A;  2LM5 A;  1FBV A;  1QAS A;  3OB1 B;  1C7W A;  4USL A;  1CMG A;  2I94 A;  2AMI A;  4GNK B;  2IS9 A;  1DJX A;  1SKT A;  1XK4 C;  2ZFD A;  3O4Y A;  1CKK A;  1REC A;  1EG4 A;  1CFP A;  2SCP A;  1WRZ A;  3KPX A;  1ZFS A;  1NWD A;  1S5G Z;  4MSP A;  3WNX B;  1HT9 A;  2LC5 A;  2LMT A;  3EKJ A;  1CDP A;  2OPO A;  3PLF B;  3WXA A;  3CS1 A;  5HYD A;  2KBM A;  1S6J A;  2FJU B;  1M45 A;  1B8R A;  2LP3 A;  1PRW A;  3EK7 A;  3OX5 A;  3FWC A;  2K7O A;  1RTP 1;  2OTG B;  1WLM A;  3CLN A;  1CLM A;  1LXF C;  1NCZ A;  3HX4 A;  1QXP A;  4WQ2 A;  2Q91 A;  1JUO A;  1KFX S;  1ODB A;  1TTX A;  2JT8 A;  2H61 C;  2L2E A;  1SCM C;  1B7T Z;  2NCP A;  2P6B B;  3I5I C;  3VRP A;  5FYX A;  1IQ5 A;  2CBL A;  2JOJ A;  3MSE B;  1R6P A;  1XFW O;  1FPW A;  4M2O A;  1MF8 B;  1KFU L;  3GOF A;  2L51 A;  1JFJ A;  1L7Z A;  2LVV A;  3CGA A;  2WCF A;  5AFP A;  1S26 D;  2HQ8 A;  1PVA A;  1K8U A;  3F45 A;  4BY4 A;  5GQQ C;  1TCO B;  5F6T A;  4C0J A;  1YRT B;  5I2L A;  4DRW A;  4ETO A;  3GK1 A;  3JTD C;  3O78 A;  5ER5 A;  1DJY A;  1XFU O;  2HPS A;  1SPY A;  3SG3 A;  3ZNI A;  4MZK A;  3CWG A;  1JC2 A;  1OSA A;  1KK8 B;  3PFV A;  1DJI A;  4GGF A;  1QAT A;  3FS7 A;  2JQ6 A;  3KEV A;  4DUQ A;  2JRF A;  3IF7 A;  4GFT A;  4QJ3 B;  2LVK A;  2BKI B;  1JBA A;  3BOW B;  1IJ5 A;  1DJZ A;  4UPG A;  2LVJ A;  1ZUZ A;  2KGB C;  2QAC A;  5I2O A;  2EC6 B;  1XFX O;  2JNX A;  1EXR A;  1CM1 A;  2JZI A;  1OMD A;  1WY9 A;  1IGV A;  4DCK A;  2K0J A;  1WRL A;  3AAJ A;  1LKJ A;  4WRI A;  2L50 A;  4CFQ A;  2F3Y A;  2KI4 C;  2L4H A;  3CTN A;  4NDD A;  4ORC B;  1CTR A;  3SG2 A;  2KBI A;  5PAL A;  1G4Y R;  1UP5 A;  1IG5 A;  1SL9 A;  4MZJ A;  3TUY C;  1OZO A;  1MQ1 A;  1JSA A;  2K8M B;  1OQP A;  1Y1X A;  4JQ0 D;  2PMY A;  4TNC A;  1S5G Y;  1GJY A;  1KSM A;  2MHH A;  1PK0 D;  2O5G A;  3I5G C;  4PCW A;  1A75 A;  2BEC A;  2L0P A;  2I7A A;  1VRK A;  2LLU A;  1PSR A;  4NDC A;  1BMO A;  2GGM A;  3D10 A;  1DGV A;  4FQO A;  1A4P A;  2LCP A;  3ZWH A;  1F54 A;  1UHI A;  4R1E A;  1AUI B;  2MAZ A;  1FF1 A;  1BR4 B;  2L98 A;  2F33 A;  4XYN A;  3A8R A;  3A4U B;  4HRG A;  1B7T Y;  3TDI A;  1S3P A;  2KAX A;  3LK1 A;  2JU0 A;  1B4C A;  1CDN A;  2KQY A;  4PE1 A;  1CDL A;  3I5F B;  1XK4 A;  5CPV A;  1JF0 A;  1WDC B;  1Y6W A;  2JT3 A;  1XFZ O;  2JT0 A;  4I5L B;  3RLZ A;  1NX1 A;  1NX0 A;  2F8P A;  3BUX B;  1Y1A A;  2PVB A;  4M2Q A;  4A4B A;  4F0Z B;  3PSR A;  1IQ3 A;  2BL0 C;  1IH0 A;  2EHB A;  2MLE C;  4I5J A;  4MRY A;  3SIA A;  1QS7 A;  4N5X A;  1DJH A;  3KF9 A;  2LUX A;  2M1K B;  3BXK A;  2KQ6 A;  3EK4 A;  1J55 A;  2GGZ A;  2KFG A;  3HCM A;  4YGE B;  5HKZ A;  1J7Q A;  3CR5 X;  2ISD A;  1CB1 A;  3SG7 A;  1SR6 C;  2OS8 C;  4OVN F;  2FOT A;  1TNQ A;  5CSF A;  2NXQ A;  3PAL A;  3DVM A;  3JVT B;  2M29 A;  1CNP A;  4JPZ B;  1B8L A;  1XFY O;  2KDH A;  1U5I A;  2BBM A;  3DVJ A;  3NXA A;  5JJG A;  2LUC A;  4PHJ A;  1KQM B;  1NCX A;  2G2B A;  1KFU S;  3SIB A;  3C1V A;  2I2R E;  4BY5 A;  1CFF A;  2KGR A;  3AKB A;  1NX3 A;  2JNF A;  3TS5 B;  3BUN B;  2TN4 A;  5K89 A;  1DT7 B;  4HRE E;  2MBX A;  3K21 A;  1F4Q A;  2MLF C;  5KSZ A;  4PE7 A;  3BUM B;  1K93 D;  1AJ5 A;  1TRF A;  4N1F A;  4CPV A;  1JWD A;  2M3W A;  1UHK A;  1A75 B;  1IJ6 A;  3O2P A;  1A03 A;  1KK8 C;  2KI6 D;  1EL4 A;  1F70 A;  1C7V A;  1NPQ A;  2F3Z A;  1IKU A;  1K95 A;  1N2D A;  1NX2 A;  2CXJ A;  1N65 A;  2KNE A;  3DVE A;  1GGZ A;  1W7I B;  3AKA A;  1G33 A;  1SK6 D;  1CDM A;  1M63 B;  3I5H C;  1DF0 A;  2ZKM X;  2JWW A;  5JOL A;  1UHJ A;  5CSN A;  4M2P A;  1FI5 A;  2M7L A;  5DKQ A;  2LV7 A;  1OE9 B;  3PN7 C;  1FW4 A;  3LK0 A;  3RM1 A;  2SAS A;  3VRN A;  1ZOT B;  4U8D A;  4MEW A;  2R2I A;  4OR9 B;  1AJ4 A;  2K7C A;  3TDZ A;  3VRQ A;  2WND A;  1DMO A;  4MN0 A;  1MXL C;  2MJW B;  4PDZ A;  1R2U A;  2WCE A;  2ZRS A;  4D1E A;  3CR4 X;  2M1U A;  3LLE A;  2ZRT A;  2DOQ A;  5AER A;  4MVF A;  5AAN A;  4HRH A;  1S1E A;  1DJG A;  3TDU A;  1SCM B;  5HLV A;  2JC2 A;  1QLS A;  3NSI A;  3DD4 A;  1YUR A;  4XJK A;  1L2O C;  4YBH B;  1KWO C;  1G8I A;  4YGD B;  4PE0 A;  5AEQ A;  4NQG A;  4JWQ A;  4AQI A;  5AXI A;  1J7P A;  2ZND A;  1Y0V H;  2FCE A;  1WRK A;  1EJ3 A;  1KK7 Z;  4DIR A;  1GGW A;  1RFJ A;  1U5I B;  4AQJ A;  2KOT A;  3WHU B;  3IQQ A;  3I5F C;  1ALV A;  2KYC A;  1H8B A;  3M0W A;  1K9K A;  2KYF A;  4NDB A;  5I2Q A;  4E68 A;  4N1G A;  1ZAC A;  3GK2 A;  1J7O A;  1B9A A;  4OCI A;  2LVI A;  4QJ5 B;  2CTN A;  2FCD A;  2KAV A;  5DKR A;  2PRU A;  2KI6 C;  2CNP A;  1BOD A;  1SBJ A;  3FWB A;  1X02 A;  2JTT A;  5HKW A;  1TN4 A;  2LE9 B;  4DS7 A;  1A2X A;  1C07 A;  2HF5 A;  3CR2 A;  3OP0 A;  2BKH B;  4C0K A;  3KO0 A;  4CID A;  1CMF A;  3D0Y A;  3KHE A;  2M7N A;  1SL8 A;  5J3X A;  1J1D A;  1KSO A;  1PSB A;  2KI4 B;  2NLN A;  3GK4 X;  4OV2 A;  4PHK A;  3ICB A;  4YGB B;  1HQV A;  2JTZ A;  4YGA A;  4GPL B;  1XYD A;  1DF0 B;  2NZ0 A;  5HKY A;  3EVU A;  2LLT A;  3TUY B;  5BPJ A;  2NCO A;  1DVI A;  3WHT B;  3VGO A;  2KFF A;  2H61 A;  1D1O A;  1XA5 A;  1RJV A;  1TNW A;  1ALW A;  1BJF A;  1XVJ A;  1DGU A;  1OOJ A;  1BT6 A;  4CLN A;  3PM8 A;  3TS5 C;  4A4C A;  2KFH A;  2F2P A;  2OTG C;  3IQO A;  1GQM A;  1SMG A;  1BF5 A;  4GBA A;  1QTX A;  3SJS A;  3OHM B;  1RK9 A;  2BE4 A;  1QV1 A;  1MR8 A;  1UUS A;  3BQ3 A;  3VRO A;  2AAO A;  4MLW A;  4ZCV A;  1M31 A;  1YRU B;  2RGI A;  4YGC B;  1K2H A;  1AK8 A;  1NSH A;  4ORA B;  2BCB A;  1CM4 A;  2V53 A;  1K94 A;  2LHL A;  3QRX A;  1MUX A;  4CFR A;  1BU3 A;  1OMV A;  1K96 A;  1S36 A;  1NP8 A;  1UHH A;  4XJK B;  1KK7 Y;  1QIV A;  1YUS A;  1TNX A;  1SCV A;  1SY9 A;  1F55 A;  1LIN A;  1TOP A;  2H2K A;  4C0L A;  1TIZ A;  2BL0 B;  1K90 D;  2LLS A;  3OX6 A;  1B1G A;  4I5K A;  2E30 A;  1JF2 A;  2K7D A;  1AHR A;  1K9P A;  1SNL A;  5ER4 X;  1QX7 A;  4HSZ A;  2QPT A;  3EVR A;  2EGD A;  2WOR A;  2K7B A;  1SR6 B;  2OS8 B;  2JXL A;  1QVI Y;  1CFC A;  2Y5I A;  1QV0 A;  4PE4 A;  1MXE A;  1W7J B;  1BG1 A;  2EC6 C;  1LA0 A;  1QX5 B;  3OB2 B;  4P5O E;  3DF0 A;  1QX2 A;  4ICB A;  2CCM A;  1JFK A;  5D7F A;  4GUK A;  5DKN A;  1QLK A;  2L4I A;  1XFV O;  1YR5 A;  3O6B A;  3PAT A;  5CSJ A;  1WLZ A;  1QIW A;  2GV5 A;  2Q4U A;  1OMR A;  3D0Y B;  3BYA A;  5G08 A;  1SL7 A;  1F8H A;  1NIW A;  4PHM A;  1B47 A;  2L5X B;  1Q80 A;  2CT9 A;  1V1F A;  1XO5 A;  2BBN A;  1AP4 A;  2BCA A;  1ZMZ A;  5KTY A;  1MHO A;  2LHI A;  1E8A A;  1NUB A;  1RWY A;  1SYM A;  2WC8 A;  4ZCU A;  2A4J A;  3I5I B;  1RRO A;  2PSR A;  2G9B A;  2LAP A;  3NSK A;  1KFX L;  1IWQ A;  2JXC A;  3NSL A;  3EVV A;  2Y1M A;  3EK8 A;  2LAN A;  1TCF A;  2KHN A;  2HQW A;  5KU1 A;  1F4O A;  1Y1U A;  4PAL A;  1YUU A;  1CLL A;  3SG4 A;  1CLB A;  2Y4Q A;  1J1E A;  2LMU A;  1YUT A;  2D8N A;  2K2A A;  1SRA A;  1WDC C;  3I5H B;  4IL1 A;  5B8I B;  1BLQ A;  2MA2 A;  3SG5 A;  2KSP A;  2M8U A;  1V1G A;  1BOC A;  2VRG A;  3EKH A;  4MBE A;  4MZL A;  3JTD B;  1FI6 A;  1UUR A;  3PN7 B;  4GAO A;  2B1U A;  2BE6 A;  3VRR A;  1PVB A;  3BUO B;  1MWN A;  2Y1N A;  1CFD A;  1F71 A;  1KQV A;  1BR1 B;  3NSO A;  2ZN9 A;  1YVH A;  4ORB B;  1PAL A;  1QVI Z;  2LMV A;  3FIA A;  1NYA A;  2K2F A;  2M0R A;  2HET A;  4OKH A;  2WOS A;  4YRU A;  5CSI A;  3LCP C;  2M9G A;  1NCY A;  1YX8 A;  3CZT X;  2O60 A;  1UWO A;  4GGF C;  4YI9 A;  1QJT A;  3E3R A;  3H4S E;  3JVT C;  3SG6 A;  2JPT A;  4PHN A;  5HLO A;  2ZN8 A;  1OZS A;  1SW8 A;  1AVS A;  1L2O B;  2LNK A;  2JUL A;  1KQM C;  1DTL A;  1J7R A;  1KWO B;  1B8C A;  3DF0 B;  3BUW B;  2E6W A;  3DVK A;  1EG3 A;  1PUL A;  2K61 A;  1YTZ C;  1EH2 A;  1A29 A;  1IRJ A;  3I5G B;  2PAL A;  1K9U A;  1UHN A;  1LA3 A;  4GGN A;  5I8N A;  2COL B;  1S6C A;  1TNP A;  2AUC A;  2LP2 A;  2ZNE A;  1DJW A;  2F2O A;  2M97 A;  3LL8 B;  3BOW A;  4Q04 A;  4YI8 A;  4WQ3 A;  3AAK A;  4P2Y B;  1N0Y A;  1YVL A;  4L9M A;  2KAY A;  4I5N B;  5TNC A;  3TZ1 A;  1LVC D;  2PAS A;  1S6I A;  1YX7 A;  4QJ4 B;  4MRX A;  4AOM A;  2M49 B;  1M39 A;  4FTG A;  2I18 A;  2WCB A;  2MRD A;  2BCX A;  5D69 A;  1H4B A;  1KCY A;  1M46 A; 
#chains in the Genus database with same CATH topology
 5IBW A;  2LM5 A;  1FBV A;  1QAS A;  3OB1 B;  3CZ2 A;  1XFR A;  1C7W A;  4USL A;  1CMG A;  2I94 A;  2AMI A;  4GNK B;  2IS9 A;  1DJX A;  1SKT A;  1XK4 C;  2ZFD A;  3O4Y A;  1CKK A;  1REC A;  1EG4 A;  3BFB A;  1CFP A;  2SCP A;  1WRZ A;  3KPX A;  1ZFS A;  1NWD A;  1S5G Z;  2QEV A;  4MSP A;  3WNX B;  1HT9 A;  2LC5 A;  2LMT A;  3EKJ A;  1CDP A;  2OPO A;  3PLF B;  3WXA A;  3CS1 A;  5HYD A;  1OOF A;  3O4X A;  2KBM A;  1S6J A;  2FJU B;  1M45 A;  3SS5 A;  1B8R A;  2LP3 A;  1PRW A;  3EK7 A;  3OX5 A;  1TWO A;  2K7O A;  1RTP 1;  2OTG B;  1WLM A;  3CLN A;  3FWC A;  1CLM A;  1LXF C;  1NCZ A;  3HX4 A;  1QXP A;  4WQ2 A;  2Q91 A;  1JUO A;  1KFX S;  1ODB A;  1TTX A;  2JT8 A;  2H61 C;  2L2E A;  1SCM C;  1B7T Z;  2NCP A;  2P6B B;  3I5I C;  2QEH A;  5FYX A;  1IQ5 A;  2CBL A;  3CZ1 A;  2JOJ A;  3B88 A;  3MSE B;  1R6P A;  1XFW O;  1FPW A;  4M2O A;  1MF8 B;  1KFU L;  1W9Z A;  3GOF A;  2L51 A;  1JFJ A;  1L7Z A;  2LVV A;  3CGA A;  2WCF A;  5AFP A;  3IVT A;  1S26 D;  2HQ8 A;  1PVA A;  1Z2C B;  1K8U A;  3B86 A;  3F45 A;  4BY4 A;  5GQQ C;  1TCO B;  5F6T A;  3EG5 B;  4C0J A;  1YRT B;  5I2L A;  4DRW A;  4ETO A;  3GK1 A;  3S0G A;  3JTD C;  3O78 A;  5ER5 A;  1DJY A;  1XFU O;  1TUJ A;  1SPY A;  2HPS A;  3SG3 A;  3ZNI A;  4MZK A;  3CWG A;  3Q8I A;  1JC2 A;  1OSA A;  3FE9 A;  1KK8 B;  3PFV A;  1DJI A;  4GGF A;  1QAT A;  3FS7 A;  2JQ6 A;  3KEV A;  4DUQ A;  2JRF A;  3IF7 A;  4GFT A;  4QJ3 B;  2LVK A;  2BKI B;  3NGV A;  3BOW B;  1JBA A;  1IJ5 A;  1DJZ A;  4UPG A;  2LVJ A;  1ZUZ A;  2KGB C;  2QAC A;  2P70 A;  5I2O A;  2EC6 B;  2WC6 A;  1XFX O;  2JNX A;  1EXR A;  1CM1 A;  3BFH A;  2JZI A;  1OMD A;  1WY9 A;  1IGV A;  4DCK A;  2K0J A;  1WRL A;  3AAJ A;  1LKJ A;  4WRI A;  2L50 A;  4CFQ A;  2QEB A;  2F3Y A;  2KI4 C;  2L4H A;  3CTN A;  4NDD A;  4ORC B;  1CTR A;  1P28 A;  3SG2 A;  3CDN A;  2KBI A;  3V2L A;  5PAL A;  1G4Y R;  1UP5 A;  1IG5 A;  1SL9 A;  4MZJ A;  3TUY C;  1OZO A;  1MQ1 A;  1JSA A;  2K8M B;  1OQP A;  1Y1X A;  4JQ0 D;  2PMY A;  3B7A A;  1S5G Y;  1GJY A;  1KSM A;  2MHH A;  4TNC A;  5DIC A;  1PK0 D;  2O5G A;  3I5G C;  4PCW A;  1A75 A;  2BEC A;  2BNX A;  2L0P A;  3S0D A;  2I7A A;  1Z4H A;  1VRK A;  2LLU A;  1PSR A;  4NDC A;  1BMO A;  2GGM A;  3D10 A;  1DGV A;  4FQO A;  1A4P A;  1DEK A;  2LCP A;  3ZWH A;  1F54 A;  1UHI A;  4R1E A;  1AUI B;  2MAZ A;  1FF1 A;  1BR4 B;  2L98 A;  2F33 A;  4XYN A;  3A8R A;  3A4U B;  4HRG A;  1B7T Y;  3TDI A;  1S3P A;  2KAX A;  4OZD A;  3LK1 A;  2JU0 A;  1B4C A;  3N7H A;  1CDN A;  2KQY A;  4PE1 A;  1CDL A;  3I5F B;  2WCK A;  1XK4 A;  5CPV A;  1JF0 A;  1WDC B;  2GTE A;  1Y6W A;  2JT3 A;  1XFZ O;  2JT0 A;  4I5L B;  3RLZ A;  1NX1 A;  1NX0 A;  2F8P A;  3BUX B;  1Y1A A;  2PVB A;  4M2Q A;  4A4B A;  4F0Z B;  3PSR A;  1IQ3 A;  3CZ0 A;  5D3O A;  2BL0 C;  1IH0 A;  2EHB A;  2MLE C;  4I5J A;  4MRY A;  3SIA A;  1QS7 A;  4N5X A;  1DJH A;  2KLE A;  2LUX A;  2M1K B;  3KF9 A;  3BXK A;  2KQ6 A;  3EK4 A;  1J55 A;  2GGZ A;  2KFG A;  3HCM A;  4YGE B;  5HKZ A;  1J7Q A;  3CR5 X;  2ISD A;  1CB1 A;  3SG7 A;  1SR6 C;  4JD9 A;  4FQT A;  2OS8 C;  4OVN F;  2FOT A;  1TNQ A;  2KLD A;  5CSF A;  2NXQ A;  3PAL A;  3DVM A;  3JVT B;  2M29 A;  1CNP A;  4JPZ B;  1B8L A;  1XFY O;  2KDH A;  1U5I A;  2BBM A;  3DVJ A;  3NXA A;  5JJG A;  2LUC A;  4PHJ A;  1KQM B;  1NCX A;  1OOI X;  2G2B A;  1KFU S;  3SIB A;  3C1V A;  2I2R E;  4BY5 A;  1CFF A;  2KGR A;  2ERB A;  3AKB A;  1NX3 A;  2JNF A;  1GM0 A;  1C3Y A;  3TS5 B;  2JPO A;  3BUN B;  3B87 A;  2TN4 A;  5K89 A;  1DT7 B;  4HRE E;  2MBX A;  3D75 A;  1F4Q A;  3K21 A;  3VB1 A;  2MLF C;  5KSZ A;  4PE7 A;  3BUM B;  1K93 D;  1AJ5 A;  1TRF A;  4N1F A;  4CPV A;  1JWD A;  2M3W A;  1UHK A;  1OW4 A;  1A75 B;  1IJ6 A;  3O2P A;  1A03 A;  1KK8 C;  2KI6 D;  2WCH A;  1EL4 A;  1F70 A;  1C7V A;  1NPQ A;  2F3Z A;  1IKU A;  1K95 A;  1N2D A;  1NX2 A;  1TUZ A;  2CXJ A;  1N65 A;  2KNE A;  3DVE A;  1GGZ A;  1W7I B;  3AKA A;  1G33 A;  5FI6 A;  3SS4 A;  2WCL A;  1SK6 D;  1CDM A;  1M63 B;  2PYQ A;  3I5H C;  1DF0 A;  2ZKM X;  2JWW A;  5JOL A;  1UHJ A;  5CSN A;  4M2P A;  1FI5 A;  2M7L A;  5EL2 A;  5DKQ A;  2LV7 A;  1OE9 B;  2WCJ A;  3FE6 A;  3PN7 C;  1IIO A;  1FW4 A;  3LK0 A;  3RM1 A;  2SAS A;  3UO9 A;  3VRN A;  1ZOT B;  3FE8 A;  4U8D A;  4MEW A;  2R2I A;  3DY9 A;  4OR9 B;  1AJ4 A;  2K7C A;  3TDZ A;  3VRQ A;  2WND A;  1DMO A;  4MN0 A;  1MXL C;  2MJW B;  4PDZ A;  1R2U A;  2WCE A;  2ZRS A;  2QDI A;  4D1E A;  3CR4 X;  2M1U A;  3DXL A;  3LLE A;  2ZRT A;  2DOQ A;  5AER A;  4MVF A;  1LS8 A;  5AAN A;  4HRH A;  1S1E A;  1DJG A;  3TDU A;  1SCM B;  5HLV A;  2JC2 A;  1QLS A;  3NSI A;  3DD4 A;  2PQL A;  1YUR A;  4XJK A;  1L2O C;  4YBH B;  1KWO C;  1G8I A;  4YGD B;  4PE0 A;  5AEQ A;  4NQG A;  4JWQ A;  4AQI A;  5AXI A;  1J7P A;  2ZND A;  1Y0V H;  2FCE A;  1WRK A;  1EJ3 A;  1KK7 Z;  4DIR A;  1GGW A;  1RFJ A;  1U5I B;  4AQJ A;  2KOT A;  3WHU B;  3IQQ A;  3I5F C;  1ALV A;  2KYC A;  3QME A;  1H8B A;  3M0W A;  1K9K A;  2KYF A;  4NDB A;  5I2Q A;  4E68 A;  4N1G A;  1ZAC A;  3GK2 A;  3BJH A;  1J7O A;  1SSE B;  1B9A A;  4OCI A;  2LVI A;  4QJ5 B;  2CTN A;  2FCD A;  2KAV A;  5DKR A;  2PRU A;  2KI6 C;  2CNP A;  1BOD A;  1SBJ A;  3PM2 A;  3FWB A;  1X02 A;  2JTT A;  5HKW A;  1TN4 A;  2LE9 B;  4DS7 A;  1A2X A;  1C07 A;  2HF5 A;  3CR2 A;  3OP0 A;  2BKH B;  4C0K A;  3KO0 A;  4CID A;  1CMF A;  3D0Y A;  2L2C A;  2M7N A;  1SL8 A;  3D78 A;  1J1D A;  1C3Z A;  1OOH A;  1KSO A;  3KHE A;  4KYN A;  5J3X A;  1PSB A;  2KI4 B;  2NLN A;  3GK4 X;  4OV2 A;  4PHK A;  3ICB A;  4YGB B;  1HQV A;  2JTZ A;  4YGA A;  4GPL B;  1XYD A;  1DF0 B;  2NZ0 A;  5HKY A;  3S0A A;  3EVU A;  2LLT A;  3TUY B;  3VRP A;  5BPJ A;  2NCO A;  1DVI A;  3WHT B;  3VGO A;  2KFF A;  3L4A A;  2H61 A;  1ORG A;  1XA5 A;  1D1O A;  1RJV A;  1TNW A;  1ALW A;  1BJF A;  1XVJ A;  1DGU A;  1OOJ A;  1BT6 A;  4CLN A;  4F7F A;  3PM8 A;  3TS5 C;  4A4C A;  3R1V A;  2KFH A;  2F2P A;  2OTG C;  3IQO A;  2FJY A;  1GQM A;  1SMG A;  1BF5 A;  4GBA A;  1QTX A;  3D77 A;  4IJ7 A;  3OHM B;  3SJS A;  1RK9 A;  2BE4 A;  1QV1 A;  1MR8 A;  1UUS A;  3BQ3 A;  3VRO A;  2AAO A;  4MLW A;  4ZCV A;  1M31 A;  1YRU B;  2RGI A;  4YGC B;  1K2H A;  1AK8 A;  1NSH A;  4ORA B;  2BCB A;  1CM4 A;  2V53 A;  1K94 A;  2LHL A;  3QRX A;  1MUX A;  4CFR A;  1BU3 A;  1OMV A;  1K96 A;  1S36 A;  1NP8 A;  1UHH A;  4XJK B;  1KK7 Y;  1QIV A;  1YUS A;  1TNX A;  1SCV A;  1SY9 A;  3R72 A;  3L4L A;  1LIN A;  1TOP A;  2H2K A;  4C0L A;  2H8V A;  1F55 A;  1TIZ A;  2BL0 B;  3DYE A;  1K90 D;  2LLS A;  3PJI A;  3OX6 A;  1B1G A;  4I5K A;  2E30 A;  1JF2 A;  2K7D A;  1AHR A;  1K9P A;  1SNL A;  5ER4 X;  1QX7 A;  4HSZ A;  2QPT A;  3EVR A;  2EGD A;  3S0E A;  3B6X A;  2WOR A;  3UNW A;  2K7B A;  1SR6 B;  3BFA A;  2OS8 B;  2JXL A;  1QVI Y;  1CFC A;  2YGU A;  2Y5I A;  1QV0 A;  4PE4 A;  1MXE A;  1W7J B;  1BG1 A;  2EC6 C;  1LA0 A;  1QX5 B;  3OB2 B;  4P5O E;  3DF0 A;  1OOG A;  3SS3 A;  1QX2 A;  4ICB A;  2CCM A;  1JFK A;  5D7F A;  4GUK A;  5DKN A;  5FI7 A;  1QLK A;  2L4I A;  4INX A;  1XFV O;  1YR5 A;  2L5Y A;  3O6B A;  3PAT A;  5CSJ A;  1WLZ A;  1QIW A;  2GV5 A;  2Q4U A;  3D74 A;  1OMR A;  3D0Y B;  3BYA A;  2WC5 A;  1SL7 A;  3D76 A;  5G08 A;  1F8H A;  3L47 A;  1NIW A;  4PHM A;  1B47 A;  2L5X B;  1Q80 A;  2CT9 A;  1V1F A;  1XO5 A;  2BBN A;  1AP4 A;  2BCA A;  1ZMZ A;  5KTY A;  1MHO A;  2LHI A;  1E8A A;  3NHT A;  1NUB A;  1RWY A;  1SYM A;  2WC8 A;  4ZCU A;  2WCM A;  2A4J A;  3I5I B;  1RRO A;  2PSR A;  5FI2 A;  1T14 A;  2G9B A;  2LAP A;  3NSK A;  1KFX L;  1IWQ A;  2JXC A;  3NSL A;  3EVV A;  2Y1M A;  3EK8 A;  2LAN A;  1TCF A;  2KHN A;  2HQW A;  5KU1 A;  1F4O A;  1Y1U A;  3CYZ A;  4PAL A;  1YUU A;  1CLL A;  3SG4 A;  3K1E A;  1CLB A;  2Y4Q A;  1J1E A;  2LMU A;  1YUT A;  2D8N A;  2K2A A;  1SRA A;  1WDC C;  3I5H B;  3R1O A;  4IL1 A;  5B8I B;  1BLQ A;  2MA2 A;  3SG5 A;  2KSP A;  2M8U A;  1V1G A;  1BOC A;  2VRG A;  3EKH A;  4MBE A;  4MZL A;  3JTD B;  1FI6 A;  1UUR A;  3PN7 B;  4GAO A;  2B1U A;  2BE6 A;  3VRR A;  1PVB A;  3BUO B;  1MWN A;  2Y1N A;  1CFD A;  3OBV A;  1F71 A;  1BR1 B;  3NSO A;  1KQV A;  1DEL A;  1YVH A;  2ZN9 A;  4ORB B;  1PAL A;  1QVI Z;  2LMV A;  3FIA A;  1NYA A;  2K2F A;  2M0R A;  2HET A;  4OKH A;  2WOS A;  4YRU A;  5CSI A;  3LCP C;  2M9G A;  1NCY A;  1YX8 A;  3CZT X;  2O60 A;  1UWO A;  4GGF C;  4YI9 A;  1DQE A;  1QJT A;  3E3R A;  3H4S E;  3JVT C;  3SG6 A;  2JPT A;  4PHN A;  5HLO A;  5I94 A;  2KPH A;  3D73 A;  2ZN8 A;  3DZT A;  1OZS A;  1SW8 A;  1AVS A;  1L2O B;  1QWV A;  2JUL A;  1KQM C;  1DTL A;  2LNK A;  1J7R A;  1KWO B;  1B8C A;  3DF0 B;  3OGN A;  3BUW B;  3RZS A;  2E6W A;  3DVK A;  1EG3 A;  1PUL A;  3S0B A;  2QEO A;  2K61 A;  1YTZ C;  1EH2 A;  1A29 A;  1IRJ A;  3I5G B;  2PAL A;  1K9U A;  1UHN A;  1LA3 A;  4GGN A;  5I8N A;  2COL B;  2K60 A;  1S6C A;  1TNP A;  2AUC A;  2LP2 A;  3R1P A;  2ZNE A;  1DJW A;  2F2O A;  2M97 A;  3LL8 B;  3BOW A;  4Q04 A;  4YI8 A;  4WQ3 A;  3AAK A;  4P2Y B;  1N0Y A;  1YVL A;  2P71 A;  2KAY A;  4L9M A;  5HL1 A;  4I5N B;  5TNC A;  1DC1 A;  3TZ1 A;  1LVC D;  2PAS A;  1S6I A;  1YX7 A;  4JKT A;  3S0F A;  4QJ4 B;  4MRX A;  4AOM A;  3NHI A;  2M49 B;  1M39 A;  4FTG A;  2BAP A;  2I18 A;  3CAB A;  2WCB A;  2MRD A;  2BCX A;  5D69 A;  4INW A;  1H4B A;  1KCY A;  1M46 A;  4PT1 A; 
#chains in the Genus database with same CATH homology
 5IBW A;  2LM5 A;  1FBV A;  1QAS A;  3OB1 B;  1C7W A;  4USL A;  1CMG A;  2I94 A;  2AMI A;  4GNK B;  2IS9 A;  1DJX A;  1SKT A;  1XK4 C;  2ZFD A;  3O4Y A;  1CKK A;  1REC A;  1EG4 A;  1CFP A;  2SCP A;  1WRZ A;  3KPX A;  1ZFS A;  1NWD A;  1S5G Z;  4MSP A;  3WNX B;  1HT9 A;  2LC5 A;  2LMT A;  3EKJ A;  1CDP A;  2OPO A;  3PLF B;  3WXA A;  3CS1 A;  5HYD A;  2KBM A;  1S6J A;  2FJU B;  1M45 A;  1B8R A;  2LP3 A;  1PRW A;  3EK7 A;  3OX5 A;  3FWC A;  2K7O A;  1RTP 1;  2OTG B;  1WLM A;  3CLN A;  1CLM A;  1LXF C;  1NCZ A;  3HX4 A;  1QXP A;  4WQ2 A;  2Q91 A;  1JUO A;  1KFX S;  1ODB A;  1TTX A;  2JT8 A;  2H61 C;  2L2E A;  1SCM C;  1B7T Z;  2NCP A;  2P6B B;  3I5I C;  3VRP A;  5FYX A;  1IQ5 A;  2CBL A;  2JOJ A;  3MSE B;  1R6P A;  1XFW O;  1FPW A;  4M2O A;  1MF8 B;  1KFU L;  3GOF A;  2L51 A;  1JFJ A;  1L7Z A;  2LVV A;  3CGA A;  2WCF A;  5AFP A;  1S26 D;  2HQ8 A;  1PVA A;  1K8U A;  3F45 A;  4BY4 A;  5GQQ C;  1TCO B;  5F6T A;  4C0J A;  1YRT B;  5I2L A;  4DRW A;  4ETO A;  3GK1 A;  3JTD C;  3O78 A;  5ER5 A;  1DJY A;  1XFU O;  2HPS A;  1SPY A;  3SG3 A;  3ZNI A;  4MZK A;  3CWG A;  1JC2 A;  1OSA A;  1KK8 B;  3PFV A;  1DJI A;  4GGF A;  1QAT A;  3FS7 A;  2JQ6 A;  3KEV A;  4DUQ A;  2JRF A;  3IF7 A;  4GFT A;  4QJ3 B;  2LVK A;  2BKI B;  1JBA A;  3BOW B;  1IJ5 A;  1DJZ A;  4UPG A;  2LVJ A;  1ZUZ A;  2KGB C;  2QAC A;  5I2O A;  2EC6 B;  1XFX O;  2JNX A;  1EXR A;  1CM1 A;  2JZI A;  1OMD A;  1WY9 A;  1IGV A;  4DCK A;  2K0J A;  1WRL A;  3AAJ A;  1LKJ A;  4WRI A;  2L50 A;  4CFQ A;  2F3Y A;  2KI4 C;  2L4H A;  3CTN A;  4NDD A;  4ORC B;  1CTR A;  3SG2 A;  2KBI A;  5PAL A;  1G4Y R;  1UP5 A;  1IG5 A;  1SL9 A;  4MZJ A;  3TUY C;  1OZO A;  1MQ1 A;  1JSA A;  2K8M B;  1OQP A;  1Y1X A;  4JQ0 D;  2PMY A;  4TNC A;  1S5G Y;  1GJY A;  1KSM A;  2MHH A;  1PK0 D;  2O5G A;  3I5G C;  4PCW A;  1A75 A;  2BEC A;  2L0P A;  2I7A A;  1VRK A;  2LLU A;  1PSR A;  4NDC A;  1BMO A;  2GGM A;  3D10 A;  1DGV A;  4FQO A;  1A4P A;  2LCP A;  3ZWH A;  1F54 A;  1UHI A;  4R1E A;  1AUI B;  2MAZ A;  1FF1 A;  1BR4 B;  2L98 A;  2F33 A;  4XYN A;  3A8R A;  3A4U B;  4HRG A;  1B7T Y;  3TDI A;  1S3P A;  2KAX A;  3LK1 A;  2JU0 A;  1B4C A;  1CDN A;  2KQY A;  4PE1 A;  1CDL A;  3I5F B;  1XK4 A;  5CPV A;  1JF0 A;  1WDC B;  1Y6W A;  2JT3 A;  1XFZ O;  2JT0 A;  4I5L B;  3RLZ A;  1NX1 A;  1NX0 A;  2F8P A;  3BUX B;  1Y1A A;  2PVB A;  4M2Q A;  4A4B A;  4F0Z B;  3PSR A;  1IQ3 A;  2BL0 C;  1IH0 A;  2EHB A;  2MLE C;  4I5J A;  4MRY A;  3SIA A;  1QS7 A;  4N5X A;  1DJH A;  3KF9 A;  2LUX A;  2M1K B;  3BXK A;  2KQ6 A;  3EK4 A;  1J55 A;  2GGZ A;  2KFG A;  3HCM A;  4YGE B;  5HKZ A;  1J7Q A;  3CR5 X;  2ISD A;  1CB1 A;  3SG7 A;  1SR6 C;  2OS8 C;  4OVN F;  2FOT A;  1TNQ A;  5CSF A;  2NXQ A;  3PAL A;  3DVM A;  3JVT B;  2M29 A;  1CNP A;  4JPZ B;  1B8L A;  1XFY O;  2KDH A;  1U5I A;  2BBM A;  3DVJ A;  3NXA A;  5JJG A;  2LUC A;  4PHJ A;  1KQM B;  1NCX A;  2G2B A;  1KFU S;  3SIB A;  3C1V A;  2I2R E;  4BY5 A;  1CFF A;  2KGR A;  3AKB A;  1NX3 A;  2JNF A;  3TS5 B;  3BUN B;  2TN4 A;  5K89 A;  1DT7 B;  4HRE E;  2MBX A;  3K21 A;  1F4Q A;  2MLF C;  5KSZ A;  4PE7 A;  3BUM B;  1K93 D;  1AJ5 A;  1TRF A;  4N1F A;  4CPV A;  1JWD A;  2M3W A;  1UHK A;  1A75 B;  1IJ6 A;  3O2P A;  1A03 A;  1KK8 C;  2KI6 D;  1EL4 A;  1F70 A;  1C7V A;  1NPQ A;  2F3Z A;  1IKU A;  1K95 A;  1N2D A;  1NX2 A;  2CXJ A;  1N65 A;  2KNE A;  3DVE A;  1GGZ A;  1W7I B;  3AKA A;  1G33 A;  1SK6 D;  1CDM A;  1M63 B;  3I5H C;  1DF0 A;  2ZKM X;  2JWW A;  5JOL A;  1UHJ A;  5CSN A;  4M2P A;  1FI5 A;  2M7L A;  5DKQ A;  2LV7 A;  1OE9 B;  3PN7 C;  1FW4 A;  3LK0 A;  3RM1 A;  2SAS A;  3VRN A;  1ZOT B;  4U8D A;  4MEW A;  2R2I A;  4OR9 B;  1AJ4 A;  2K7C A;  3TDZ A;  3VRQ A;  2WND A;  1DMO A;  4MN0 A;  1MXL C;  2MJW B;  4PDZ A;  1R2U A;  2WCE A;  2ZRS A;  4D1E A;  3CR4 X;  2M1U A;  3LLE A;  2ZRT A;  2DOQ A;  5AER A;  4MVF A;  5AAN A;  4HRH A;  1S1E A;  1DJG A;  3TDU A;  1SCM B;  5HLV A;  2JC2 A;  1QLS A;  3NSI A;  3DD4 A;  1YUR A;  4XJK A;  1L2O C;  4YBH B;  1KWO C;  1G8I A;  4YGD B;  4PE0 A;  5AEQ A;  4NQG A;  4JWQ A;  4AQI A;  5AXI A;  1J7P A;  2ZND A;  1Y0V H;  2FCE A;  1WRK A;  1EJ3 A;  1KK7 Z;  4DIR A;  1GGW A;  1RFJ A;  1U5I B;  4AQJ A;  2KOT A;  3WHU B;  3IQQ A;  3I5F C;  1ALV A;  2KYC A;  1H8B A;  3M0W A;  1K9K A;  2KYF A;  4NDB A;  5I2Q A;  4E68 A;  4N1G A;  1ZAC A;  3GK2 A;  1J7O A;  1B9A A;  4OCI A;  2LVI A;  4QJ5 B;  2CTN A;  2FCD A;  2KAV A;  5DKR A;  2PRU A;  2KI6 C;  2CNP A;  1BOD A;  1SBJ A;  3FWB A;  1X02 A;  2JTT A;  5HKW A;  1TN4 A;  2LE9 B;  4DS7 A;  1A2X A;  1C07 A;  2HF5 A;  3CR2 A;  3OP0 A;  2BKH B;  4C0K A;  3KO0 A;  4CID A;  1CMF A;  3D0Y A;  3KHE A;  2M7N A;  1SL8 A;  5J3X A;  1J1D A;  1KSO A;  1PSB A;  2KI4 B;  2NLN A;  3GK4 X;  4OV2 A;  4PHK A;  3ICB A;  4YGB B;  1HQV A;  2JTZ A;  4YGA A;  4GPL B;  1XYD A;  1DF0 B;  2NZ0 A;  5HKY A;  3EVU A;  2LLT A;  3TUY B;  5BPJ A;  2NCO A;  1DVI A;  3WHT B;  3VGO A;  2KFF A;  2H61 A;  1D1O A;  1XA5 A;  1RJV A;  1TNW A;  1ALW A;  1BJF A;  1XVJ A;  1DGU A;  1OOJ A;  1BT6 A;  4CLN A;  3PM8 A;  3TS5 C;  4A4C A;  2KFH A;  2F2P A;  2OTG C;  3IQO A;  1GQM A;  1SMG A;  1BF5 A;  4GBA A;  1QTX A;  3SJS A;  3OHM B;  1RK9 A;  2BE4 A;  1QV1 A;  1MR8 A;  1UUS A;  3BQ3 A;  3VRO A;  2AAO A;  4MLW A;  4ZCV A;  1M31 A;  1YRU B;  2RGI A;  4YGC B;  1K2H A;  1AK8 A;  1NSH A;  4ORA B;  2BCB A;  1CM4 A;  2V53 A;  1K94 A;  2LHL A;  3QRX A;  1MUX A;  4CFR A;  1BU3 A;  1OMV A;  1K96 A;  1S36 A;  1NP8 A;  1UHH A;  4XJK B;  1KK7 Y;  1QIV A;  1YUS A;  1TNX A;  1SCV A;  1SY9 A;  1F55 A;  1LIN A;  1TOP A;  2H2K A;  4C0L A;  1TIZ A;  2BL0 B;  1K90 D;  2LLS A;  3OX6 A;  1B1G A;  4I5K A;  2E30 A;  1JF2 A;  2K7D A;  1AHR A;  1K9P A;  1SNL A;  5ER4 X;  1QX7 A;  4HSZ A;  2QPT A;  3EVR A;  2EGD A;  2WOR A;  2K7B A;  1SR6 B;  2OS8 B;  2JXL A;  1QVI Y;  1CFC A;  2Y5I A;  1QV0 A;  4PE4 A;  1MXE A;  1W7J B;  1BG1 A;  2EC6 C;  1LA0 A;  1QX5 B;  3OB2 B;  4P5O E;  3DF0 A;  1QX2 A;  4ICB A;  2CCM A;  1JFK A;  5D7F A;  4GUK A;  5DKN A;  1QLK A;  2L4I A;  1XFV O;  1YR5 A;  3O6B A;  3PAT A;  5CSJ A;  1WLZ A;  1QIW A;  2GV5 A;  2Q4U A;  1OMR A;  3D0Y B;  3BYA A;  5G08 A;  1SL7 A;  1F8H A;  1NIW A;  4PHM A;  1B47 A;  2L5X B;  1Q80 A;  2CT9 A;  1V1F A;  1XO5 A;  2BBN A;  1AP4 A;  2BCA A;  1ZMZ A;  5KTY A;  1MHO A;  2LHI A;  1E8A A;  1NUB A;  1RWY A;  1SYM A;  2WC8 A;  4ZCU A;  2A4J A;  3I5I B;  1RRO A;  2PSR A;  2G9B A;  2LAP A;  3NSK A;  1KFX L;  1IWQ A;  2JXC A;  3NSL A;  3EVV A;  2Y1M A;  3EK8 A;  2LAN A;  1TCF A;  2KHN A;  2HQW A;  5KU1 A;  1F4O A;  1Y1U A;  4PAL A;  1YUU A;  1CLL A;  3SG4 A;  1CLB A;  2Y4Q A;  1J1E A;  2LMU A;  1YUT A;  2D8N A;  2K2A A;  1SRA A;  1WDC C;  3I5H B;  4IL1 A;  5B8I B;  1BLQ A;  2MA2 A;  3SG5 A;  2KSP A;  2M8U A;  1V1G A;  1BOC A;  2VRG A;  3EKH A;  4MBE A;  4MZL A;  3JTD B;  1FI6 A;  1UUR A;  3PN7 B;  4GAO A;  2B1U A;  2BE6 A;  3VRR A;  1PVB A;  3BUO B;  1MWN A;  2Y1N A;  1CFD A;  1F71 A;  1KQV A;  1BR1 B;  3NSO A;  2ZN9 A;  1YVH A;  4ORB B;  1PAL A;  1QVI Z;  2LMV A;  3FIA A;  1NYA A;  2K2F A;  2M0R A;  2HET A;  4OKH A;  2WOS A;  4YRU A;  5CSI A;  3LCP C;  2M9G A;  1NCY A;  1YX8 A;  3CZT X;  2O60 A;  1UWO A;  4GGF C;  4YI9 A;  1QJT A;  3E3R A;  3H4S E;  3JVT C;  3SG6 A;  2JPT A;  4PHN A;  5HLO A;  2ZN8 A;  1OZS A;  1SW8 A;  1AVS A;  1L2O B;  2LNK A;  2JUL A;  1KQM C;  1DTL A;  1J7R A;  1KWO B;  1B8C A;  3DF0 B;  3BUW B;  2E6W A;  3DVK A;  1EG3 A;  1PUL A;  2K61 A;  1YTZ C;  1EH2 A;  1A29 A;  1IRJ A;  3I5G B;  2PAL A;  1K9U A;  1UHN A;  1LA3 A;  4GGN A;  5I8N A;  2COL B;  1S6C A;  1TNP A;  2AUC A;  2LP2 A;  2ZNE A;  1DJW A;  2F2O A;  2M97 A;  3LL8 B;  3BOW A;  4Q04 A;  4YI8 A;  4WQ3 A;  3AAK A;  4P2Y B;  1N0Y A;  1YVL A;  4L9M A;  2KAY A;  4I5N B;  5TNC A;  3TZ1 A;  1LVC D;  2PAS A;  1S6I A;  1YX7 A;  4QJ4 B;  4MRX A;  4AOM A;  2M49 B;  1M39 A;  4FTG A;  2I18 A;  2WCB A;  2MRD A;  2BCX A;  5D69 A;  1H4B A;  1KCY A;  1M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...