2JXCA

Structure of the eps15-eh2 stonin2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor substrate 15
publication title Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/protein binding
total genus 32
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxcA00
2FCDA 1U5IB 2NZ0A 4WQ2A 1DJGA 1XFXO 2OPOA 4AQIA 2HQ8A 4PHMA 4PCWA 3WXAA 3A4UB 1Q80A 4P2YB 1PSBA 2KOTA 3KPXA 1CM4A 4GGNA 1B1GA 2KFGA 1IGVA 3SG5A 2ZNEA 1S6JA 2JNXA 2LCPA 5DKNA 1OQPA 5J3XA 3PM8A 2LM5A 3C1VA 1DJWA 2LVKA 1EXRA 2BCAA 1NCYA 2NLNA 5KTYA 1QX7A 3ZWHA 1IJ5A 1K90D 2JRFA 2JZIA 3A8RA 1KCYA 1Y1XA 1CDNA 2CTNA 1J7PA 1OE9B 1WRKA 2KI4C 1MR8A 1QJTA 3SG3A 1QIWA 3PALA 4I5NB 1UP5A 2KFFA 2M1KB 1CFPA 1DMOA 1BJFA 4I5LB 4FTGA 1DJYA 1QXPA 3RM1A 2LAPA 1B7TZ 2BKHB 2MHHA 1A75A 2AAOA 2KI4B 3BOWA 2F2OA 5BPJA 1ZFSA 1LKJA 1L7ZA 1S6IA 2KQYA 1WRLA 2JT0A 1G4YR 5CSFA 4GGFA 4HREE 1JC2A 3VGOA 2HF5A 1PK0D 1CB1A 3OB1B 1AUIB 4CFQA 1YR5A 1GQMA 4YGEB 3BUWB 1CMFA 3D10A 2QPTA 1LXFC 1SL7A 3BUNB 3CZTX 1QV1A 2K8MB 1S5GZ 1XVJA 4XYNA 4I5KA 1NX0A 3I5IB 4USLA 3BYAA 1KK8C 1MUXA 1K9KA 2I18A 4JQ0D 1IG5A 4DCKA 1FW4A 2M29A 3K21A 1Y0VH 4I5JA 1RJVA 4OKHA 1SK6D 2GV5A 2K7BA 1JFJA 1CM1A 4JWQA 1KK8B 1YUUA 1L2OC 1AP4A 2M7LA 2WCBA 1YRTB 3FIAA 5HKYA 5AFPA 1DJHA 3LL8B 2ZN9A 1NX1A 1PRWA 2G2BA 2OS8B 4FQOA 1S1EA 2LHLA 1UURA 1BG1A 2L51A 1BLQA 1KFXS 1A29A 2B1UA 4ZCVA 1AJ4A 2F3ZA 1Y1UA 2JULA 2CXJA 2E6WA 1NP8A 4CPVA 2ZRTA 1BR1B 1SPYA 2LP2A 3I5FC 4HRHA 4ICBA 1ODBA 1B8CA 2KHNA 1FI5A 3TS5B 1CDMA 2M0RA 1CLBA 1HT9A 2PSRA 2ZNDA 4DUQA 1D1OA 1PULA 1CDLA 3I5FB 3CWGA 1MWNA 2Y4QA 2CNPA 2L98A 5PALA 1K94A 1NWDA 1J7OA 1Y6WA 2D8NA 1XK4A 4XJKA 4YGCB 2KGBC 3SG6A 3EKHA 1A2XA 1M63B 1J1DA 2FCEA 1AJ5A 4P5OE 2JXLA 2JOJA 3SIAA 3LLEA 2KYCA 1NX2A 3I5GB 1TCOB 2LMTA 3HX4A 2SCPA 2LLUA 3VRRA 3PN7C 5DKQA 1FBVA 4GBAA 4A4BA 1PALA 2LNKA 1ZOTB 1ZMZA 3WNXB 1JFKA 2AMIA 2BBMA 2KNEA 4YRUA 2JXCA 5IBWA 2Q4UA 5AANA 4BY4A 3SG4A 1IRJA 2K7DA 1S5GY 3PN7B 2SASA 1AVSA 4DS7A 5B8IB 1F8HA 2M3WA 1TN4A 3CR5X 1JF2A 2VRGA 4QJ4B 2DOQA 1PVBA 3EVVA 2BE6A 2FOTA 2FJUB 1BU3A 2H61C 1SBJA 1ZUZA 3VRNA 3DVJA 2M97A 1F71A 2EGDA 1E8AA 1ALVA 3FS7A 1XA5A 2LHIA 3TDUA 4HRGA 3DVMA 5HKZA 1RWYA 2K2AA 1OOJA 1UHHA 3E3RA 3LK0A 5CSNA 3TDIA 3SJSA 3ICBA 5AEQA 2JWWA 3NSLA 2WORA 4IL1A 2ZN8A 2BCBA 1H8BA 2TN4A 1BOCA 2NCPA 3FWCA 5D69A 1VRKA 1J1EA 2KDHA 2JC2A 1KQMC 1RTP1 3CTNA 3PSRA 5HYDA 2KAYA 4MRYA 1V1FA 3JVTB 2BKIB 1SMGA 4MZJA 3O2PA 4N5XA 4YGAA 1WDCC 2JT3A 1LA3A 4C0KA 1KQMB 2CBLA 1ZACA 2K0JA 1F55A 2GGZA 2E30A 3BUOB 1V1GA 2MRDA 1SY9A 3I5IC 1CFCA 2KFHA 4AOMA 1K2HA 2KBIA 1WDCB 1CMGA 5I2QA 1QASA 3AAKA 3I5HC 1R6PA 2QACA 3TUYC 2Y1NA 1UWOA 1YRUB 1TNPA 2A4JA 4U8DA 3D0YB 1QV0A 3O4YA 3SIBA 3FWBA 1TNWA 2LUXA 4XJKB 1BMOA 1CLMA 1YUSA 2L5XB 2PALA 3I5HB 3DD4A 3DVKA 3OHMB 3PLFB 4M2OA 2KI6D 3TUYB 1CFDA 1UHKA 3O6BA 1WLZA 1DJZA 4PE4A 2JTTA 1IWQA 2CCMA 3MSEB 2OS8C 5CSJA 2ZKMX 2L4IA 1PVAA 1J7QA 2KYFA 1WLMA 1YTZC 3EK8A 1QS7A 1DF0A 2M9GA 1W7JB 3NSOA 1F54A 2OTGC 3M0WA 3TS5C 1JUOA 2JNFA 1NUBA 4OCIA 1SCMB 2KI6C 4N1GA 3AKBA 3LK1A 5K89A 1EG3A 4BY5A 2MJWB 1SKTA 3EVRA 2O60A 4QJ5B 2MAZA 2OTGB 1FI6A 4YI9A 1G8IA 1B4CA 4OR9B 1SR6C 1NCXA 5CPVA 1SL9A 1QATA 1LVCD 1DGUA 4NDBA 1K9PA 1MHOA 2I2RE 1XFYO 1Y1AA 2LANA 3QRXA 1M46A 4N1FA 3I5GC 1N65A 4NDCA 1SR6B 1NX3A 1KFUL 4MN0A 4F0ZB 3RLZA 2BL0C 3IQOA 1TIZA 3ZNIA 1TNXA 4OVNF 1YVHA 2WOSA 3CLNA 1IQ5A 4ORCB 2KBMA 4PDZA 3GK2A 2BECA 2K61A 3DF0A 4L9MA 5HKWA 2ISDA 1IKUA 2M1UA 2BL0B 3OX5A 1SW8A 2AUCA 2M7NA 4GGFC 4GPLB 1NCZA 2LMVA 5FYXA 1YX7A 2LC5A 3AKAA 1A75B 3BOWB 2I7AA 1IJ6A 1RECA 3AAJA 3OP0A 4YGDB 1K95A 1ALWA 2M49B 3EK4A 4GNKB 1XFVO 5D7FA 2WC8A 1NSHA 4MZKA 1KSOA 2KGRA 2PVBA 4M2QA 4GUKA 4GAOA 5JOLA 1X02A 1SRAA 2Y5IA 3NXAA 5JJGA 1LINA 3OX6A 1UUSA 1XFWO 4ZCUA 4MSPA 2BBNA 2LE9B 1OMRA 1XYDA 1S26D 1QTXA 2K7CA 1F4OA 1KWOC 2MLFC 1F70A 1EG4A 4MZLA 4PHKA 2PASA 2EC6B 2HETA 1RFJA 2LMUA 4ETOA 4WQ3A 2RGIA 5G08A 1KWOB 2O5GA 2LVIA 1S3PA 2JQ6A 1QVIY 1QX5B 2V53A 5KU1A 1TOPA 1C7VA 1DT7B 4CFRA 1OSAA 2WCEA 3EKJA 3JVTC 3NSKA 1FPWA 1GJYA 3EVUA 1IH0A 1DF0B 2F3YA 3GOFA 3JTDC 2K2FA 1CDPA 1RROA 2GGMA 4PE7A 1XFZO 1SCVA 2MA2A 5GQQC 1DTLA 1CNPA 1EH2A 2KQ6A 4ORBB 1DJXA 1TTXA 3JTDB 5I8NA 2H2KA 2IS9A 4MVFA 1UHIA 5KSZA 5AERA 1XK4C 1EJ3A 3BQ3A 3DVEA 3VRQA 1PSRA 1G33A 2KAXA 1SYMA 1B9AA 1AHRA 1J55A 1K96A 1DVIA 1M45A 5AXIA 1EL4A 1JSAA 1W7IB 1S36A 2KSPA 2F33A 2NXQA 4MLWA 5ER4X 5I2OA 3KEVA 1SNLA 1MXEA 2EHBA 2NCOA 1BT6A 2LP3A 4TNCA 4YGBB 3CS1A 1TRFA 5HLVA 4NDDA 1KFXL 4QJ3B 1KK7Y 2M8UA 2JTZA 3DF0B 2HPSA 1QX2A 1UHJA 1CKKA 5HLOA 1K8UA 3IQQA 1JBAA 1U5IA 1QIVA 3HCMA 4E68A 1SCMC 2WCFA 4HSZA 2LVJA 3VRPA 3WHTB 4MBEA 3H4SE 1A03A 1H4BA 1TCFA 2P6BB 1HQVA 1RK9A 1QVIZ 4OV2A 4WRIA 1GGZA 1JWDA 2H61A 3KHEA 2JT8A 4R1EA 1MXLC 4GFTA 1BR4B 2LUCA 1OMDA 2JU0A 1N0YA 1BODA 2Q91A 4YBHB 3OB2B 5F6TA 3TDZA 5I2LA 1IQ3A 4PE0A 2LVVA 1JF0A 1CTRA 1MF8B 1KSMA 3CR2A 4ORAB 1K93D 1OZOA 1QLSA 2K7OA 3BUMB 3BXKA 4PE1A 2ZFDA 5TNCA 5CSIA 4C0JA 1L2OB 1S6CA 3BUXB 2ZRSA 4NQGA 2HQWA 1WRZA 1SL8A 3CR4X 4MRXA 5ER5A 2F8PA 1YVLA 4A4CA 1BF5A 3GK4X 2F2PA 4C0LA 3LCPC 1AK8A 2WNDA 1XFUO 1XO5A 4Q04A 4CIDA 3VROA 1DGVA 1GGWA 5DKRA 1J7RA 3IF7A 3NSIA 1OMVA 4M2PA 1UHNA 2JPTA 3KO0A 1DJIA 1CLLA 1YX8A 4DIRA 4UPGA 2I94A 4JPZB 2MBXA 1N2DA 3F45A 1KQVA 3O78A 4MEWA 2BE4A 3D0YA 1KK7Z 1LA0A 1TNQA 2MLEC 2LV7A 1K9UA 4DRWA 2KAVA 1C07A 3KF9A 1M31A 1B7TY 2PMYA 1CFFA 1C7WA 2Y1MA 4D1EA 4YI8A 1B8RA 1R2UA 2EC6C 3EK7A 2BCXA 3SG2A 4AQJA 2L2EA 2L50A 1WY9A 3GK1A 1FF1A 3PATA 3SG7A 1KFUS 2PRUA 2COLB 4CLNA 1B47A 4PHNA 1OZSA 2R2IA 2LLSA 3CGAA 4PALA 1NPQA 1B8LA 2CT9A 4PHJA 1A4PA 1NIWA 1NYAA 3WHUB 1YUTA 2L0PA 2LLTA 3TZ1A 2L4HA 1M39A 3PFVA 1F4QA 1QLKA 1MQ1A 1YURA 2G9BA
chains in the Genus database with same CATH superfamily
2FCDA 1U5IB 2NZ0A 4WQ2A 1DJGA 1XFXO 2OPOA 4AQIA 2HQ8A 4PHMA 4PCWA 3WXAA 3A4UB 1Q80A 4P2YB 1PSBA 3R1VA 2KOTA 2KLDA 1CM4A 3KPXA 4GGNA 5D3OA 3B87A 1B1GA 2KFGA 1IGVA 3SG5A 2ZNEA 1S6JA 2JNXA 2LCPA 5DKNA 1OQPA 5J3XA 3PM8A 2LM5A 3C1VA 1DJWA 2LVKA 1EXRA 2BCAA 1NCYA 2NLNA 5KTYA 1QX7A 3ZWHA 1OOFA 1IJ5A 1K90D 2JRFA 2JZIA 2QDIA 3A8RA 1KCYA 1Y1XA 1CDNA 2CTNA 1J7PA 1OE9B 1WRKA 2KI4C 1MR8A 1QJTA 3SG3A 1QIWA 3PALA 4I5NB 1UP5A 2KFFA 2M1KB 1CFPA 1DMOA 1BJFA 1TUZA 4I5LB 4FTGA 1T14A 3SS5A 1DJYA 1QXPA 3B88A 3RM1A 2LAPA 1B7TZ 5FI7A 2BKHB 2MHHA 1A75A 2AAOA 2KI4B 3BOWA 2F2OA 5BPJA 1ZFSA 1LKJA 1L7ZA 1S6IA 2KQYA 1WRLA 2JT0A 1G4YR 5CSFA 4GGFA 4HREE 1JC2A 3VGOA 2HF5A 1PK0D 1CB1A 3OB1B 1AUIB 4CFQA 1YR5A 1GQMA 4YGEB 3BUWB 1CMFA 3D10A 2QPTA 1LXFC 1SL7A 3BUNB 3CZTX 1QV1A 2K8MB 1S5GZ 1XVJA 4XYNA 4I5KA 1NX0A 3I5IB 4USLA 3BYAA 1KK8C 1MUXA 1K9KA 2I18A 4JQ0D 1IG5A 4DCKA 1FW4A 2M29A 3CYZA 3K21A 1Y0VH 4I5JA 1RJVA 4OKHA 1SK6D 4INWA 2GV5A 2K7BA 1JFJA 1CM1A 4JWQA 1KK8B 1YUUA 3QMEA 1L2OC 1AP4A 2M7LA 2L2CA 2WCBA 1YRTB 1XFRA 3FIAA 5AFPA 1DJHA 5HKYA 3LL8B 2ZN9A 1NX1A 4INXA 1PRWA 2G2BA 2OS8B 4FQOA 1S1EA 2LHLA 1LS8A 1UURA 1BG1A 2L51A 1BLQA 2GTEA 1KFXS 3UO9A 1A29A 2B1UA 4ZCVA 1AJ4A 2F3ZA 1Y1UA 2JULA 2CXJA 2E6WA 2K60A 2WCJA 1NP8A 4CPVA 2ZRTA 1QWVA 1BR1B 1SPYA 2LP2A 3I5FC 4HRHA 4ICBA 1ODBA 1B8CA 2KHNA 1FI5A 3TS5B 1CDMA 2M0RA 1C3YA 1CLBA 1HT9A 3R72A 2PSRA 2ZNDA 4DUQA 3L4AA 3N7HA 1D1OA 1PULA 1CDLA 3I5FB 3CWGA 1MWNA 3SS3A 2Y4QA 2CNPA 2L98A 5PALA 1K94A 5EL2A 1DELA 1NWDA 1J7OA 1Y6WA 2D8NA 1XK4A 4XJKA 4YGCB 2KGBC 1Z4HA 3SG6A 3EKHA 1A2XA 1M63B 1J1DA 2FCEA 1AJ5A 4P5OE 2JXLA 2JOJA 3SIAA 3LLEA 3DY9A 2KYCA 1NX2A 3I5GB 1TCOB 2LMTA 3HX4A 3R1OA 4JD9A 2SCPA 2LLUA 3VRRA 3PN7C 5DKQA 1FBVA 4GBAA 4A4BA 1PALA 2LNKA 1ZOTB 1ZMZA 3WNXB 1JFKA 2AMIA 2BBMA 2KNEA 4YRUA 2JXCA 5IBWA 2Q4UA 5AANA 1DQEA 4BY4A 3CZ2A 3SG4A 2P71A 1IRJA 2K7DA 1S5GY 1OW4A 3BFAA 3PN7B 2SASA 1AVSA 4DS7A 5B8IB 1F8HA 2M3WA 1TN4A 3CR5X 1JF2A 2VRGA 4QJ4B 2DOQA 1PVBA 3EVVA 2BE6A 2FOTA 2FJUB 1BU3A 2H61C 1SBJA 1ZUZA 3VRNA 3DVJA 2M97A 1F71A 2EGDA 2QEHA 1E8AA 1ALVA 3FS7A 3D73A 1XA5A 2LHIA 3TDUA 4HRGA 3DVMA 3S0BA 3VB1A 5HKZA 1RWYA 2K2AA 1OOJA 3BJHA 1UHHA 3E3RA 3EG5B 3LK0A 5CSNA 1TWOA 3TDIA 3SJSA 3ICBA 3FE8A 5AEQA 2JWWA 3NSLA 2WORA 4IL1A 2ZN8A 2BCBA 1H8BA 2TN4A 1BOCA 2NCPA 3FWCA 5D69A 3NHIA 1VRKA 1J1EA 2KDHA 2JC2A 1KQMC 1RTP1 3CTNA 1ORGA 3PSRA 5HYDA 2KAYA 3BFHA 4MRYA 1V1FA 3JVTB 2BKIB 1SMGA 4MZJA 3O2PA 4N5XA 4YGAA 1WDCC 2JT3A 1LA3A 4C0KA 3RZSA 1KQMB 2CBLA 1ZACA 2K0JA 1F55A 2GGZA 2E30A 3BUOB 1V1GA 3IVTA 2MRDA 1SY9A 3I5IC 1CFCA 1OOIX 3Q8IA 2KFHA 4AOMA 1K2HA 2KBIA 1WDCB 2FJYA 1CMGA 5I2QA 3NHTA 1QASA 3AAKA 2QEBA 1R6PA 3CABA 3I5HC 2QACA 3TUYC 2KPHA 1UWOA 2Y1NA 1YRUB 1TNPA 2A4JA 4U8DA 3D0YB 1QV0A 3O4YA 3SIBA 3FWBA 1TNWA 2LUXA 4XJKB 1BMOA 1CLMA 1YUSA 2L5XB 2PALA 3I5HB 3DD4A 3DVKA 3OHMB 3PLFB 4M2OA 2KI6D 5I94A 3TUYB 1CFDA 1UHKA 3O6BA 1WLZA 1DJZA 4PE4A 2JTTA 1IWQA 2CCMA 3MSEB 2OS8C 5CSJA 2YGUA 3D78A 2ZKMX 2L4IA 1TUJA 1PVAA 2WC5A 1J7QA 2KYFA 1IIOA 3CZ1A 5FI6A 1WLMA 1OOGA 1YTZC 3EK8A 1QS7A 1DF0A 2M9GA 1W7JB 1P28A 3NSOA 1F54A 2OTGC 3M0WA 3TS5C 1JUOA 2JNFA 3D74A 1NUBA 4OCIA 3DXLA 1SCMB 2KI6C 4N1GA 3AKBA 3LK1A 4PT1A 5K89A 1EG3A 4BY5A 2MJWB 1SKTA 3EVRA 2O60A 4QJ5B 2MAZA 2OTGB 1FI6A 4YI9A 1G8IA 1B4CA 4OR9B 1OOHA 1NCXA 1SR6C 5CPVA 2PYQA 1SL9A 1QATA 1LVCD 1DGUA 4NDBA 1K9PA 1MHOA 2I2RE 1XFYO 1Y1AA 2LANA 3QRXA 1M46A 4N1FA 3I5GC 1N65A 4NDCA 1SR6B 1NX3A 1KFUL 2JPOA 4MN0A 4F0ZB 3RLZA 2BL0C 3IQOA 1TIZA 3ZNIA 1TNXA 5FI2A 4OVNF 1YVHA 2WOSA 3CLNA 1DEKA 1IQ5A 2WCMA 4ORCB 3CZ0A 2P70A 2KBMA 4PDZA 3GK2A 2BECA 2K61A 3DF0A 4L9MA 5HKWA 2ISDA 1IKUA 2M1UA 2BL0B 3OX5A 3OBVA 4FQTA 1SW8A 3L47A 2AUCA 2M7NA 4GGFC 4GPLB 5DICA 1NCZA 2LMVA 5FYXA 1YX7A 2LC5A 3AKAA 1A75B 3BOWB 2I7AA 2PQLA 1IJ6A 1RECA 3AAJA 3OP0A 2WCKA 4YGDB 1K95A 2ERBA 1ALWA 2M49B 3EK4A 3D77A 4GNKB 1XFVO 5D7FA 2WC8A 1NSHA 4MZKA 1KSOA 2KGRA 2PVBA 4M2QA 4GUKA 4GAOA 5JOLA 1X02A 1SRAA 2Y5IA 3NXAA 5JJGA 1LINA 3OX6A 1UUSA 1XFWO 4ZCUA 4MSPA 2BBNA 2LE9B 1OMRA 1XYDA 2QEVA 3S0FA 1S26D 1QTXA 2K7CA 1F4OA 1KWOC 2MLFC 1F70A 1EG4A 3SS4A 4MZLA 4PHKA 2PASA 2BAPA 2EC6B 2HETA 1C3ZA 1RFJA 2LMUA 4ETOA 4WQ3A 2RGIA 5G08A 2WCLA 1KWOB 2O5GA 2LVIA 1S3PA 2L5YA 2JQ6A 1QVIY 1QX5B 2V53A 5KU1A 1TOPA 1C7VA 1DT7B 4CFRA 1OSAA 2WCEA 3EKJA 3JVTC 3NSKA 1FPWA 1GJYA 3EVUA 1IH0A 1DF0B 3R1PA 2F3YA 3GOFA 3JTDC 2K2FA 3B86A 1CDPA 1RROA 2GGMA 4PE7A 4OZDA 1XFZO 1SCVA 2MA2A 2QEOA 1DTLA 5GQQC 1CNPA 1EH2A 2KQ6A 4ORBB 1DJXA 1TTXA 3JTDB 3PJIA 5I8NA 3K1EA 2H2KA 2IS9A 4MVFA 3S0DA 1UHIA 5KSZA 5AERA 3S0EA 1XK4C 1EJ3A 3BQ3A 3DVEA 3VRQA 1PSRA 1G33A 4JKTA 2KAXA 1SYMA 1B9AA 1AHRA 1J55A 1K96A 3UNWA 1DVIA 1M45A 5AXIA 1EL4A 3DZTA 1JSAA 1W7IB 1S36A 2KSPA 2F33A 2NXQA 4MLWA 5ER4X 5I2OA 3KEVA 1SNLA 1MXEA 2EHBA 2NCOA 1BT6A 3B6XA 2LP3A 4TNCA 4YGBB 3CS1A 3L4LA 1TRFA 5HLVA 4NDDA 1KFXL 3CDNA 4QJ3B 1KK7Y 2M8UA 1DC1A 2BNXA 2JTZA 3DF0B 2HPSA 1QX2A 1UHJA 1CKKA 3FE9A 1K8UA 3IQQA 5HLOA 1U5IA 1QIVA 3D75A 3HCMA 4E68A 1JBAA 1SCMC 4F7FA 2WCFA 4HSZA 3OGNA 2LVJA 2KLEA 3VRPA 4MBEA 3H4SE 2WC6A 3WHTB 1A03A 1H4BA 1TCFA 2P6BB 1HQVA 1RK9A 1QVIZ 4OV2A 4WRIA 1GGZA 1JWDA 2H61A 3KHEA 2JT8A 4R1EA 1MXLC 4GFTA 1BR4B 2LUCA 1OMDA 2JU0A 1N0YA 1BODA 2Q91A 4YBHB 3OB2B 5F6TA 3TDZA 5I2LA 1IQ3A 4PE0A 2LVVA 1JF0A 1CTRA 1MF8B 1Z2CB 1KSMA 3CR2A 4ORAB 1K93D 1OZOA 1QLSA 2K7OA 3BUMB 3BXKA 4PE1A 2ZFDA 5TNCA 5CSIA 4C0JA 3S0AA 1L2OB 1S6CA 1SSEB 3BUXB 2ZRSA 4NQGA 2HQWA 1WRZA 4IJ7A 1SL8A 3CR4X 4MRXA 5ER5A 5HL1A 3DYEA 2F8PA 1W9ZA 1YVLA 4A4CA 1BF5A 3GK4X 2F2PA 4C0LA 3LCPC 3O4XA 1AK8A 2WNDA 1XFUO 1XO5A 4Q04A 4CIDA 3VROA 1DGVA 1GGWA 5DKRA 1J7RA 3IF7A 3NSIA 1OMVA 4M2PA 1UHNA 2JPTA 3KO0A 1DJIA 1CLLA 1YX8A 4DIRA 4UPGA 2I94A 4JPZB 2MBXA 1N2DA 3F45A 1KQVA 3O78A 4MEWA 2BE4A 3D0YA 3D76A 1KK7Z 1LA0A 1TNQA 2MLEC 2LV7A 3B7AA 3NGVA 1K9UA 4DRWA 2WCHA 2KAVA 1C07A 3KF9A 1M31A 1B7TY 2PMYA 1CFFA 1C7WA 2Y1MA 4D1EA 4YI8A 1B8RA 1R2UA 4KYNA 2EC6C 3EK7A 2BCXA 3PM2A 3SG2A 2L2EA 4AQJA 2L50A 1WY9A 3GK1A 1FF1A 3PATA 3SG7A 1KFUS 2PRUA 2COLB 4CLNA 1B47A 4PHNA 1OZSA 2R2IA 2LLSA 3CGAA 4PALA 1NPQA 1B8LA 2CT9A 4PHJA 1A4PA 3V2LA 1NIWA 1NYAA 3S0GA 3WHUB 1YUTA 2L0PA 2LLTA 3FE6A 3TZ1A 2L4HA 2H8VA 1M39A 3PFVA 1GM0A 1F4QA 3BFBA 1QLKA 1MQ1A 1YURA 2G9BA
chains in the Genus database with same CATH topology
2FCDA 1U5IB 2NZ0A 4WQ2A 1DJGA 1XFXO 2OPOA 4AQIA 2HQ8A 4PHMA 4PCWA 3WXAA 3A4UB 1Q80A 4P2YB 1PSBA 2KOTA 3KPXA 1CM4A 4GGNA 1B1GA 2KFGA 1IGVA 3SG5A 2ZNEA 1S6JA 2JNXA 2LCPA 5DKNA 1OQPA 5J3XA 3PM8A 2LM5A 3C1VA 1DJWA 2LVKA 1EXRA 2BCAA 1NCYA 2NLNA 5KTYA 1QX7A 3ZWHA 1IJ5A 1K90D 2JRFA 2JZIA 3A8RA 1KCYA 1Y1XA 1CDNA 2CTNA 1J7PA 1OE9B 1WRKA 2KI4C 1MR8A 1QJTA 3SG3A 1QIWA 3PALA 4I5NB 1UP5A 2KFFA 2M1KB 1CFPA 1DMOA 1BJFA 4I5LB 4FTGA 1DJYA 1QXPA 3RM1A 2LAPA 1B7TZ 2BKHB 2MHHA 1A75A 2AAOA 2KI4B 3BOWA 2F2OA 5BPJA 1ZFSA 1LKJA 1L7ZA 1S6IA 2KQYA 1WRLA 2JT0A 1G4YR 5CSFA 4GGFA 4HREE 1JC2A 3VGOA 2HF5A 1PK0D 1CB1A 3OB1B 1AUIB 4CFQA 1YR5A 1GQMA 4YGEB 3BUWB 1CMFA 3D10A 2QPTA 1LXFC 1SL7A 3BUNB 3CZTX 1QV1A 2K8MB 1S5GZ 1XVJA 4XYNA 4I5KA 1NX0A 3I5IB 4USLA 3BYAA 1KK8C 1MUXA 1K9KA 2I18A 4JQ0D 1IG5A 4DCKA 1FW4A 2M29A 3K21A 1Y0VH 4I5JA 1RJVA 4OKHA 1SK6D 2GV5A 2K7BA 1JFJA 1CM1A 4JWQA 1KK8B 1YUUA 1L2OC 1AP4A 2M7LA 2WCBA 1YRTB 3FIAA 5HKYA 5AFPA 1DJHA 3LL8B 2ZN9A 1NX1A 1PRWA 2G2BA 2OS8B 4FQOA 1S1EA 2LHLA 1UURA 1BG1A 2L51A 1BLQA 1KFXS 1A29A 2B1UA 4ZCVA 1AJ4A 2F3ZA 1Y1UA 2JULA 2CXJA 2E6WA 1NP8A 4CPVA 2ZRTA 1BR1B 1SPYA 2LP2A 3I5FC 4HRHA 4ICBA 1ODBA 1B8CA 2KHNA 1FI5A 3TS5B 1CDMA 2M0RA 1CLBA 1HT9A 2PSRA 2ZNDA 4DUQA 1D1OA 1PULA 1CDLA 3I5FB 3CWGA 1MWNA 2Y4QA 2CNPA 2L98A 5PALA 1K94A 1NWDA 1J7OA 1Y6WA 2D8NA 1XK4A 4XJKA 4YGCB 2KGBC 3SG6A 3EKHA 1A2XA 1M63B 1J1DA 2FCEA 1AJ5A 4P5OE 2JXLA 2JOJA 3SIAA 3LLEA 2KYCA 1NX2A 3I5GB 1TCOB 2LMTA 3HX4A 2SCPA 2LLUA 3VRRA 3PN7C 5DKQA 1FBVA 4GBAA 4A4BA 1PALA 2LNKA 1ZOTB 1ZMZA 3WNXB 1JFKA 2AMIA 2BBMA 2KNEA 4YRUA 2JXCA 5IBWA 2Q4UA 5AANA 4BY4A 3SG4A 1IRJA 2K7DA 1S5GY 3PN7B 2SASA 1AVSA 4DS7A 5B8IB 1F8HA 2M3WA 1TN4A 3CR5X 1JF2A 2VRGA 4QJ4B 2DOQA 1PVBA 3EVVA 2BE6A 2FOTA 2FJUB 1BU3A 2H61C 1SBJA 1ZUZA 3VRNA 3DVJA 2M97A 1F71A 2EGDA 1E8AA 1ALVA 3FS7A 1XA5A 2LHIA 3TDUA 4HRGA 3DVMA 5HKZA 1RWYA 2K2AA 1OOJA 1UHHA 3E3RA 3LK0A 5CSNA 3TDIA 3SJSA 3ICBA 5AEQA 2JWWA 3NSLA 2WORA 4IL1A 2ZN8A 2BCBA 1H8BA 2TN4A 1BOCA 2NCPA 3FWCA 5D69A 1VRKA 1J1EA 2KDHA 2JC2A 1KQMC 1RTP1 3CTNA 3PSRA 5HYDA 2KAYA 4MRYA 1V1FA 3JVTB 2BKIB 1SMGA 4MZJA 3O2PA 4N5XA 4YGAA 1WDCC 2JT3A 1LA3A 4C0KA 1KQMB 2CBLA 1ZACA 2K0JA 1F55A 2GGZA 2E30A 3BUOB 1V1GA 2MRDA 1SY9A 3I5IC 1CFCA 2KFHA 4AOMA 1K2HA 2KBIA 1WDCB 1CMGA 5I2QA 1QASA 3AAKA 3I5HC 1R6PA 2QACA 3TUYC 2Y1NA 1UWOA 1YRUB 1TNPA 2A4JA 4U8DA 3D0YB 1QV0A 3O4YA 3SIBA 3FWBA 1TNWA 2LUXA 4XJKB 1BMOA 1CLMA 1YUSA 2L5XB 2PALA 3I5HB 3DD4A 3DVKA 3OHMB 3PLFB 4M2OA 2KI6D 3TUYB 1CFDA 1UHKA 3O6BA 1WLZA 1DJZA 4PE4A 2JTTA 1IWQA 2CCMA 3MSEB 2OS8C 5CSJA 2ZKMX 2L4IA 1PVAA 1J7QA 2KYFA 1WLMA 1YTZC 3EK8A 1QS7A 1DF0A 2M9GA 1W7JB 3NSOA 1F54A 2OTGC 3M0WA 3TS5C 1JUOA 2JNFA 1NUBA 4OCIA 1SCMB 2KI6C 4N1GA 3AKBA 3LK1A 5K89A 1EG3A 4BY5A 2MJWB 1SKTA 3EVRA 2O60A 4QJ5B 2MAZA 2OTGB 1FI6A 4YI9A 1G8IA 1B4CA 4OR9B 1SR6C 1NCXA 5CPVA 1SL9A 1QATA 1LVCD 1DGUA 4NDBA 1K9PA 1MHOA 2I2RE 1XFYO 1Y1AA 2LANA 3QRXA 1M46A 4N1FA 3I5GC 1N65A 4NDCA 1SR6B 1NX3A 1KFUL 4MN0A 4F0ZB 3RLZA 2BL0C 3IQOA 1TIZA 3ZNIA 1TNXA 4OVNF 1YVHA 2WOSA 3CLNA 1IQ5A 4ORCB 2KBMA 4PDZA 3GK2A 2BECA 2K61A 3DF0A 4L9MA 5HKWA 2ISDA 1IKUA 2M1UA 2BL0B 3OX5A 1SW8A 2AUCA 2M7NA 4GGFC 4GPLB 1NCZA 2LMVA 5FYXA 1YX7A 2LC5A 3AKAA 1A75B 3BOWB 2I7AA 1IJ6A 1RECA 3AAJA 3OP0A 4YGDB 1K95A 1ALWA 2M49B 3EK4A 4GNKB 1XFVO 5D7FA 2WC8A 1NSHA 4MZKA 1KSOA 2KGRA 2PVBA 4M2QA 4GUKA 4GAOA 5JOLA 1X02A 1SRAA 2Y5IA 3NXAA 5JJGA 1LINA 3OX6A 1UUSA 1XFWO 4ZCUA 4MSPA 2BBNA 2LE9B 1OMRA 1XYDA 1S26D 1QTXA 2K7CA 1F4OA 1KWOC 2MLFC 1F70A 1EG4A 4MZLA 4PHKA 2PASA 2EC6B 2HETA 1RFJA 2LMUA 4ETOA 4WQ3A 2RGIA 5G08A 1KWOB 2O5GA 2LVIA 1S3PA 2JQ6A 1QVIY 1QX5B 2V53A 5KU1A 1TOPA 1C7VA 1DT7B 4CFRA 1OSAA 2WCEA 3EKJA 3JVTC 3NSKA 1FPWA 1GJYA 3EVUA 1IH0A 1DF0B 2F3YA 3GOFA 3JTDC 2K2FA 1CDPA 1RROA 2GGMA 4PE7A 1XFZO 1SCVA 2MA2A 5GQQC 1DTLA 1CNPA 1EH2A 2KQ6A 4ORBB 1DJXA 1TTXA 3JTDB 5I8NA 2H2KA 2IS9A 4MVFA 1UHIA 5KSZA 5AERA 1XK4C 1EJ3A 3BQ3A 3DVEA 3VRQA 1PSRA 1G33A 2KAXA 1SYMA 1B9AA 1AHRA 1J55A 1K96A 1DVIA 1M45A 5AXIA 1EL4A 1JSAA 1W7IB 1S36A 2KSPA 2F33A 2NXQA 4MLWA 5ER4X 5I2OA 3KEVA 1SNLA 1MXEA 2EHBA 2NCOA 1BT6A 2LP3A 4TNCA 4YGBB 3CS1A 1TRFA 5HLVA 4NDDA 1KFXL 4QJ3B 1KK7Y 2M8UA 2JTZA 3DF0B 2HPSA 1QX2A 1UHJA 1CKKA 5HLOA 1K8UA 3IQQA 1JBAA 1U5IA 1QIVA 3HCMA 4E68A 1SCMC 2WCFA 4HSZA 2LVJA 3VRPA 3WHTB 4MBEA 3H4SE 1A03A 1H4BA 1TCFA 2P6BB 1HQVA 1RK9A 1QVIZ 4OV2A 4WRIA 1GGZA 1JWDA 2H61A 3KHEA 2JT8A 4R1EA 1MXLC 4GFTA 1BR4B 2LUCA 1OMDA 2JU0A 1N0YA 1BODA 2Q91A 4YBHB 3OB2B 5F6TA 3TDZA 5I2LA 1IQ3A 4PE0A 2LVVA 1JF0A 1CTRA 1MF8B 1KSMA 3CR2A 4ORAB 1K93D 1OZOA 1QLSA 2K7OA 3BUMB 3BXKA 4PE1A 2ZFDA 5TNCA 5CSIA 4C0JA 1L2OB 1S6CA 3BUXB 2ZRSA 4NQGA 2HQWA 1WRZA 1SL8A 3CR4X 4MRXA 5ER5A 2F8PA 1YVLA 4A4CA 1BF5A 3GK4X 2F2PA 4C0LA 3LCPC 1AK8A 2WNDA 1XFUO 1XO5A 4Q04A 4CIDA 3VROA 1DGVA 1GGWA 5DKRA 1J7RA 3IF7A 3NSIA 1OMVA 4M2PA 1UHNA 2JPTA 3KO0A 1DJIA 1CLLA 1YX8A 4DIRA 4UPGA 2I94A 4JPZB 2MBXA 1N2DA 3F45A 1KQVA 3O78A 4MEWA 2BE4A 3D0YA 1KK7Z 1LA0A 1TNQA 2MLEC 2LV7A 1K9UA 4DRWA 2KAVA 1C07A 3KF9A 1M31A 1B7TY 2PMYA 1CFFA 1C7WA 2Y1MA 4D1EA 4YI8A 1B8RA 1R2UA 2EC6C 3EK7A 2BCXA 3SG2A 4AQJA 2L2EA 2L50A 1WY9A 3GK1A 1FF1A 3PATA 3SG7A 1KFUS 2PRUA 2COLB 4CLNA 1B47A 4PHNA 1OZSA 2R2IA 2LLSA 3CGAA 4PALA 1NPQA 1B8LA 2CT9A 4PHJA 1A4PA 1NIWA 1NYAA 3WHUB 1YUTA 2L0PA 2LLTA 3TZ1A 2L4HA 1M39A 3PFVA 1F4QA 1QLKA 1MQ1A 1YURA 2G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCD A;  1U5I B;  2NZ0 A;  4WQ2 A;  1DJG A;  1XFX O;  2OPO A;  4AQI A;  2HQ8 A;  4PHM A;  4PCW A;  3WXA A;  3A4U B;  1Q80 A;  4P2Y B;  1PSB A;  2KOT A;  3KPX A;  1CM4 A;  4GGN A;  1B1G A;  2KFG A;  1IGV A;  3SG5 A;  2ZNE A;  1S6J A;  2JNX A;  2LCP A;  5DKN A;  1OQP A;  5J3X A;  3PM8 A;  2LM5 A;  3C1V A;  1DJW A;  2LVK A;  1EXR A;  2BCA A;  1NCY A;  2NLN A;  5KTY A;  1QX7 A;  3ZWH A;  1IJ5 A;  1K90 D;  2JRF A;  2JZI A;  3A8R A;  1KCY A;  1Y1X A;  1CDN A;  2CTN A;  1J7P A;  1OE9 B;  1WRK A;  2KI4 C;  1MR8 A;  1QJT A;  3SG3 A;  1QIW A;  3PAL A;  4I5N B;  1UP5 A;  2KFF A;  2M1K B;  1CFP A;  1DMO A;  1BJF A;  4I5L B;  4FTG A;  1DJY A;  1QXP A;  3RM1 A;  2LAP A;  1B7T Z;  2BKH B;  2MHH A;  1A75 A;  2AAO A;  2KI4 B;  3BOW A;  2F2O A;  5BPJ A;  1ZFS A;  1LKJ A;  1L7Z A;  1S6I A;  2KQY A;  1WRL A;  2JT0 A;  1G4Y R;  5CSF A;  4GGF A;  4HRE E;  1JC2 A;  3VGO A;  2HF5 A;  1PK0 D;  1CB1 A;  3OB1 B;  1AUI B;  4CFQ A;  1YR5 A;  1GQM A;  4YGE B;  3BUW B;  1CMF A;  3D10 A;  2QPT A;  1LXF C;  1SL7 A;  3BUN B;  3CZT X;  1QV1 A;  2K8M B;  1S5G Z;  1XVJ A;  4XYN A;  4I5K A;  1NX0 A;  3I5I B;  4USL A;  3BYA A;  1KK8 C;  1MUX A;  1K9K A;  2I18 A;  4JQ0 D;  1IG5 A;  4DCK A;  1FW4 A;  2M29 A;  3K21 A;  1Y0V H;  4I5J A;  1RJV A;  4OKH A;  1SK6 D;  2GV5 A;  2K7B A;  1JFJ A;  1CM1 A;  4JWQ A;  1KK8 B;  1YUU A;  1L2O C;  1AP4 A;  2M7L A;  2WCB A;  1YRT B;  3FIA A;  5HKY A;  5AFP A;  1DJH A;  3LL8 B;  2ZN9 A;  1NX1 A;  1PRW A;  2G2B A;  2OS8 B;  4FQO A;  1S1E A;  2LHL A;  1UUR A;  1BG1 A;  2L51 A;  1BLQ A;  1KFX S;  1A29 A;  2B1U A;  4ZCV A;  1AJ4 A;  2F3Z A;  1Y1U A;  2JUL A;  2CXJ A;  2E6W A;  1NP8 A;  4CPV A;  2ZRT A;  1BR1 B;  1SPY A;  2LP2 A;  3I5F C;  4HRH A;  4ICB A;  1ODB A;  1B8C A;  2KHN A;  1FI5 A;  3TS5 B;  1CDM A;  2M0R A;  1CLB A;  1HT9 A;  2PSR A;  2ZND A;  4DUQ A;  1D1O A;  1PUL A;  1CDL A;  3I5F B;  3CWG A;  1MWN A;  2Y4Q A;  2CNP A;  2L98 A;  5PAL A;  1K94 A;  1NWD A;  1J7O A;  1Y6W A;  2D8N A;  1XK4 A;  4XJK A;  4YGC B;  2KGB C;  3SG6 A;  3EKH A;  1A2X A;  1M63 B;  1J1D A;  2FCE A;  1AJ5 A;  4P5O E;  2JXL A;  2JOJ A;  3SIA A;  3LLE A;  2KYC A;  1NX2 A;  3I5G B;  1TCO B;  2LMT A;  3HX4 A;  2SCP A;  2LLU A;  3VRR A;  3PN7 C;  5DKQ A;  1FBV A;  4GBA A;  4A4B A;  1PAL A;  2LNK A;  1ZOT B;  1ZMZ A;  3WNX B;  1JFK A;  2AMI A;  2BBM A;  2KNE A;  4YRU A;  2JXC A;  5IBW A;  2Q4U A;  5AAN A;  4BY4 A;  3SG4 A;  1IRJ A;  2K7D A;  1S5G Y;  3PN7 B;  2SAS A;  1AVS A;  4DS7 A;  5B8I B;  1F8H A;  2M3W A;  1TN4 A;  3CR5 X;  1JF2 A;  2VRG A;  4QJ4 B;  2DOQ A;  1PVB A;  3EVV A;  2BE6 A;  2FOT A;  2FJU B;  1BU3 A;  2H61 C;  1SBJ A;  1ZUZ A;  3VRN A;  3DVJ A;  2M97 A;  1F71 A;  2EGD A;  1E8A A;  1ALV A;  3FS7 A;  1XA5 A;  2LHI A;  3TDU A;  4HRG A;  3DVM A;  5HKZ A;  1RWY A;  2K2A A;  1OOJ A;  1UHH A;  3E3R A;  3LK0 A;  5CSN A;  3TDI A;  3SJS A;  3ICB A;  5AEQ A;  2JWW A;  3NSL A;  2WOR A;  4IL1 A;  2ZN8 A;  2BCB A;  1H8B A;  2TN4 A;  1BOC A;  2NCP A;  3FWC A;  5D69 A;  1VRK A;  1J1E A;  2KDH A;  2JC2 A;  1KQM C;  1RTP 1;  3CTN A;  3PSR A;  5HYD A;  2KAY A;  4MRY A;  1V1F A;  3JVT B;  2BKI B;  1SMG A;  4MZJ A;  3O2P A;  4N5X A;  4YGA A;  1WDC C;  2JT3 A;  1LA3 A;  4C0K A;  1KQM B;  2CBL A;  1ZAC A;  2K0J A;  1F55 A;  2GGZ A;  2E30 A;  3BUO B;  1V1G A;  2MRD A;  1SY9 A;  3I5I C;  1CFC A;  2KFH A;  4AOM A;  1K2H A;  2KBI A;  1WDC B;  1CMG A;  5I2Q A;  1QAS A;  3AAK A;  3I5H C;  1R6P A;  2QAC A;  3TUY C;  2Y1N A;  1UWO A;  1YRU B;  1TNP A;  2A4J A;  4U8D A;  3D0Y B;  1QV0 A;  3O4Y A;  3SIB A;  3FWB A;  1TNW A;  2LUX A;  4XJK B;  1BMO A;  1CLM A;  1YUS A;  2L5X B;  2PAL A;  3I5H B;  3DD4 A;  3DVK A;  3OHM B;  3PLF B;  4M2O A;  2KI6 D;  3TUY B;  1CFD A;  1UHK A;  3O6B A;  1WLZ A;  1DJZ A;  4PE4 A;  2JTT A;  1IWQ A;  2CCM A;  3MSE B;  2OS8 C;  5CSJ A;  2ZKM X;  2L4I A;  1PVA A;  1J7Q A;  2KYF A;  1WLM A;  1YTZ C;  3EK8 A;  1QS7 A;  1DF0 A;  2M9G A;  1W7J B;  3NSO A;  1F54 A;  2OTG C;  3M0W A;  3TS5 C;  1JUO A;  2JNF A;  1NUB A;  4OCI A;  1SCM B;  2KI6 C;  4N1G A;  3AKB A;  3LK1 A;  5K89 A;  1EG3 A;  4BY5 A;  2MJW B;  1SKT A;  3EVR A;  2O60 A;  4QJ5 B;  2MAZ A;  2OTG B;  1FI6 A;  4YI9 A;  1G8I A;  1B4C A;  4OR9 B;  1SR6 C;  1NCX A;  5CPV A;  1SL9 A;  1QAT A;  1LVC D;  1DGU A;  4NDB A;  1K9P A;  1MHO A;  2I2R E;  1XFY O;  1Y1A A;  2LAN A;  3QRX A;  1M46 A;  4N1F A;  3I5G C;  1N65 A;  4NDC A;  1SR6 B;  1NX3 A;  1KFU L;  4MN0 A;  4F0Z B;  3RLZ A;  2BL0 C;  3IQO A;  1TIZ A;  3ZNI A;  1TNX A;  4OVN F;  1YVH A;  2WOS A;  3CLN A;  1IQ5 A;  4ORC B;  2KBM A;  4PDZ A;  3GK2 A;  2BEC A;  2K61 A;  3DF0 A;  4L9M A;  5HKW A;  2ISD A;  1IKU A;  2M1U A;  2BL0 B;  3OX5 A;  1SW8 A;  2AUC A;  2M7N A;  4GGF C;  4GPL B;  1NCZ A;  2LMV A;  5FYX A;  1YX7 A;  2LC5 A;  3AKA A;  1A75 B;  3BOW B;  2I7A A;  1IJ6 A;  1REC A;  3AAJ A;  3OP0 A;  4YGD B;  1K95 A;  1ALW A;  2M49 B;  3EK4 A;  4GNK B;  1XFV O;  5D7F A;  2WC8 A;  1NSH A;  4MZK A;  1KSO A;  2KGR A;  2PVB A;  4M2Q A;  4GUK A;  4GAO A;  5JOL A;  1X02 A;  1SRA A;  2Y5I A;  3NXA A;  5JJG A;  1LIN A;  3OX6 A;  1UUS A;  1XFW O;  4ZCU A;  4MSP A;  2BBN A;  2LE9 B;  1OMR A;  1XYD A;  1S26 D;  1QTX A;  2K7C A;  1F4O A;  1KWO C;  2MLF C;  1F70 A;  1EG4 A;  4MZL A;  4PHK A;  2PAS A;  2EC6 B;  2HET A;  1RFJ A;  2LMU A;  4ETO A;  4WQ3 A;  2RGI A;  5G08 A;  1KWO B;  2O5G A;  2LVI A;  1S3P A;  2JQ6 A;  1QVI Y;  1QX5 B;  2V53 A;  5KU1 A;  1TOP A;  1C7V A;  1DT7 B;  4CFR A;  1OSA A;  2WCE A;  3EKJ A;  3JVT C;  3NSK A;  1FPW A;  1GJY A;  3EVU A;  1IH0 A;  1DF0 B;  2F3Y A;  3GOF A;  3JTD C;  2K2F A;  1CDP A;  1RRO A;  2GGM A;  4PE7 A;  1XFZ O;  1SCV A;  2MA2 A;  5GQQ C;  1DTL A;  1CNP A;  1EH2 A;  2KQ6 A;  4ORB B;  1DJX A;  1TTX A;  3JTD B;  5I8N A;  2H2K A;  2IS9 A;  4MVF A;  1UHI A;  5KSZ A;  5AER A;  1XK4 C;  1EJ3 A;  3BQ3 A;  3DVE A;  3VRQ A;  1PSR A;  1G33 A;  2KAX A;  1SYM A;  1B9A A;  1AHR A;  1J55 A;  1K96 A;  1DVI A;  1M45 A;  5AXI A;  1EL4 A;  1JSA A;  1W7I B;  1S36 A;  2KSP A;  2F33 A;  2NXQ A;  4MLW A;  5ER4 X;  5I2O A;  3KEV A;  1SNL A;  1MXE A;  2EHB A;  2NCO A;  1BT6 A;  2LP3 A;  4TNC A;  4YGB B;  3CS1 A;  1TRF A;  5HLV A;  4NDD A;  1KFX L;  4QJ3 B;  1KK7 Y;  2M8U A;  2JTZ A;  3DF0 B;  2HPS A;  1QX2 A;  1UHJ A;  1CKK A;  5HLO A;  1K8U A;  3IQQ A;  1JBA A;  1U5I A;  1QIV A;  3HCM A;  4E68 A;  1SCM C;  2WCF A;  4HSZ A;  2LVJ A;  3VRP A;  3WHT B;  4MBE A;  3H4S E;  1A03 A;  1H4B A;  1TCF A;  2P6B B;  1HQV A;  1RK9 A;  1QVI Z;  4OV2 A;  4WRI A;  1GGZ A;  1JWD A;  2H61 A;  3KHE A;  2JT8 A;  4R1E A;  1MXL C;  4GFT A;  1BR4 B;  2LUC A;  1OMD A;  2JU0 A;  1N0Y A;  1BOD A;  2Q91 A;  4YBH B;  3OB2 B;  5F6T A;  3TDZ A;  5I2L A;  1IQ3 A;  4PE0 A;  2LVV A;  1JF0 A;  1CTR A;  1MF8 B;  1KSM A;  3CR2 A;  4ORA B;  1K93 D;  1OZO A;  1QLS A;  2K7O A;  3BUM B;  3BXK A;  4PE1 A;  2ZFD A;  5TNC A;  5CSI A;  4C0J A;  1L2O B;  1S6C A;  3BUX B;  2ZRS A;  4NQG A;  2HQW A;  1WRZ A;  1SL8 A;  3CR4 X;  4MRX A;  5ER5 A;  2F8P A;  1YVL A;  4A4C A;  1BF5 A;  3GK4 X;  2F2P A;  4C0L A;  3LCP C;  1AK8 A;  2WND A;  1XFU O;  1XO5 A;  4Q04 A;  4CID A;  3VRO A;  1DGV A;  1GGW A;  5DKR A;  1J7R A;  3IF7 A;  3NSI A;  1OMV A;  4M2P A;  1UHN A;  2JPT A;  3KO0 A;  1DJI A;  1CLL A;  1YX8 A;  4DIR A;  4UPG A;  2I94 A;  4JPZ B;  2MBX A;  1N2D A;  3F45 A;  1KQV A;  3O78 A;  4MEW A;  2BE4 A;  3D0Y A;  1KK7 Z;  1LA0 A;  1TNQ A;  2MLE C;  2LV7 A;  1K9U A;  4DRW A;  2KAV A;  1C07 A;  3KF9 A;  1M31 A;  1B7T Y;  2PMY A;  1CFF A;  1C7W A;  2Y1M A;  4D1E A;  4YI8 A;  1B8R A;  1R2U A;  2EC6 C;  3EK7 A;  2BCX A;  3SG2 A;  4AQJ A;  2L2E A;  2L50 A;  1WY9 A;  3GK1 A;  1FF1 A;  3PAT A;  3SG7 A;  1KFU S;  2PRU A;  2COL B;  4CLN A;  1B47 A;  4PHN A;  1OZS A;  2R2I A;  2LLS A;  3CGA A;  4PAL A;  1NPQ A;  1B8L A;  2CT9 A;  4PHJ A;  1A4P A;  1NIW A;  1NYA A;  3WHU B;  1YUT A;  2L0P A;  2LLT A;  3TZ1 A;  2L4H A;  1M39 A;  3PFV A;  1F4Q A;  1QLK A;  1MQ1 A;  1YUR A;  2G9B A; 
#chains in the Genus database with same CATH topology
 2FCD A;  1U5I B;  2NZ0 A;  4WQ2 A;  1DJG A;  1XFX O;  2OPO A;  4AQI A;  2HQ8 A;  4PHM A;  4PCW A;  3WXA A;  3A4U B;  1Q80 A;  4P2Y B;  1PSB A;  3R1V A;  2KOT A;  2KLD A;  1CM4 A;  3KPX A;  4GGN A;  5D3O A;  3B87 A;  1B1G A;  2KFG A;  1IGV A;  3SG5 A;  2ZNE A;  1S6J A;  2JNX A;  2LCP A;  5DKN A;  1OQP A;  5J3X A;  3PM8 A;  2LM5 A;  3C1V A;  1DJW A;  2LVK A;  1EXR A;  2BCA A;  1NCY A;  2NLN A;  5KTY A;  1QX7 A;  3ZWH A;  1OOF A;  1IJ5 A;  1K90 D;  2JRF A;  2JZI A;  2QDI A;  3A8R A;  1KCY A;  1Y1X A;  1CDN A;  2CTN A;  1J7P A;  1OE9 B;  1WRK A;  2KI4 C;  1MR8 A;  1QJT A;  3SG3 A;  1QIW A;  3PAL A;  4I5N B;  1UP5 A;  2KFF A;  2M1K B;  1CFP A;  1DMO A;  1BJF A;  1TUZ A;  4I5L B;  4FTG A;  1T14 A;  3SS5 A;  1DJY A;  1QXP A;  3B88 A;  3RM1 A;  2LAP A;  1B7T Z;  5FI7 A;  2BKH B;  2MHH A;  1A75 A;  2AAO A;  2KI4 B;  3BOW A;  2F2O A;  5BPJ A;  1ZFS A;  1LKJ A;  1L7Z A;  1S6I A;  2KQY A;  1WRL A;  2JT0 A;  1G4Y R;  5CSF A;  4GGF A;  4HRE E;  1JC2 A;  3VGO A;  2HF5 A;  1PK0 D;  1CB1 A;  3OB1 B;  1AUI B;  4CFQ A;  1YR5 A;  1GQM A;  4YGE B;  3BUW B;  1CMF A;  3D10 A;  2QPT A;  1LXF C;  1SL7 A;  3BUN B;  3CZT X;  1QV1 A;  2K8M B;  1S5G Z;  1XVJ A;  4XYN A;  4I5K A;  1NX0 A;  3I5I B;  4USL A;  3BYA A;  1KK8 C;  1MUX A;  1K9K A;  2I18 A;  4JQ0 D;  1IG5 A;  4DCK A;  1FW4 A;  2M29 A;  3CYZ A;  3K21 A;  1Y0V H;  4I5J A;  1RJV A;  4OKH A;  1SK6 D;  4INW A;  2GV5 A;  2K7B A;  1JFJ A;  1CM1 A;  4JWQ A;  1KK8 B;  1YUU A;  3QME A;  1L2O C;  1AP4 A;  2M7L A;  2L2C A;  2WCB A;  1YRT B;  1XFR A;  3FIA A;  5AFP A;  1DJH A;  5HKY A;  3LL8 B;  2ZN9 A;  1NX1 A;  4INX A;  1PRW A;  2G2B A;  2OS8 B;  4FQO A;  1S1E A;  2LHL A;  1LS8 A;  1UUR A;  1BG1 A;  2L51 A;  1BLQ A;  2GTE A;  1KFX S;  3UO9 A;  1A29 A;  2B1U A;  4ZCV A;  1AJ4 A;  2F3Z A;  1Y1U A;  2JUL A;  2CXJ A;  2E6W A;  2K60 A;  2WCJ A;  1NP8 A;  4CPV A;  2ZRT A;  1QWV A;  1BR1 B;  1SPY A;  2LP2 A;  3I5F C;  4HRH A;  4ICB A;  1ODB A;  1B8C A;  2KHN A;  1FI5 A;  3TS5 B;  1CDM A;  2M0R A;  1C3Y A;  1CLB A;  1HT9 A;  3R72 A;  2PSR A;  2ZND A;  4DUQ A;  3L4A A;  3N7H A;  1D1O A;  1PUL A;  1CDL A;  3I5F B;  3CWG A;  1MWN A;  3SS3 A;  2Y4Q A;  2CNP A;  2L98 A;  5PAL A;  1K94 A;  5EL2 A;  1DEL A;  1NWD A;  1J7O A;  1Y6W A;  2D8N A;  1XK4 A;  4XJK A;  4YGC B;  2KGB C;  1Z4H A;  3SG6 A;  3EKH A;  1A2X A;  1M63 B;  1J1D A;  2FCE A;  1AJ5 A;  4P5O E;  2JXL A;  2JOJ A;  3SIA A;  3LLE A;  3DY9 A;  2KYC A;  1NX2 A;  3I5G B;  1TCO B;  2LMT A;  3HX4 A;  3R1O A;  4JD9 A;  2SCP A;  2LLU A;  3VRR A;  3PN7 C;  5DKQ A;  1FBV A;  4GBA A;  4A4B A;  1PAL A;  2LNK A;  1ZOT B;  1ZMZ A;  3WNX B;  1JFK A;  2AMI A;  2BBM A;  2KNE A;  4YRU A;  2JXC A;  5IBW A;  2Q4U A;  5AAN A;  1DQE A;  4BY4 A;  3CZ2 A;  3SG4 A;  2P71 A;  1IRJ A;  2K7D A;  1S5G Y;  1OW4 A;  3BFA A;  3PN7 B;  2SAS A;  1AVS A;  4DS7 A;  5B8I B;  1F8H A;  2M3W A;  1TN4 A;  3CR5 X;  1JF2 A;  2VRG A;  4QJ4 B;  2DOQ A;  1PVB A;  3EVV A;  2BE6 A;  2FOT A;  2FJU B;  1BU3 A;  2H61 C;  1SBJ A;  1ZUZ A;  3VRN A;  3DVJ A;  2M97 A;  1F71 A;  2EGD A;  2QEH A;  1E8A A;  1ALV A;  3FS7 A;  3D73 A;  1XA5 A;  2LHI A;  3TDU A;  4HRG A;  3DVM A;  3S0B A;  3VB1 A;  5HKZ A;  1RWY A;  2K2A A;  1OOJ A;  3BJH A;  1UHH A;  3E3R A;  3EG5 B;  3LK0 A;  5CSN A;  1TWO A;  3TDI A;  3SJS A;  3ICB A;  3FE8 A;  5AEQ A;  2JWW A;  3NSL A;  2WOR A;  4IL1 A;  2ZN8 A;  2BCB A;  1H8B A;  2TN4 A;  1BOC A;  2NCP A;  3FWC A;  5D69 A;  3NHI A;  1VRK A;  1J1E A;  2KDH A;  2JC2 A;  1KQM C;  1RTP 1;  3CTN A;  1ORG A;  3PSR A;  5HYD A;  2KAY A;  3BFH A;  4MRY A;  1V1F A;  3JVT B;  2BKI B;  1SMG A;  4MZJ A;  3O2P A;  4N5X A;  4YGA A;  1WDC C;  2JT3 A;  1LA3 A;  4C0K A;  3RZS A;  1KQM B;  2CBL A;  1ZAC A;  2K0J A;  1F55 A;  2GGZ A;  2E30 A;  3BUO B;  1V1G A;  3IVT A;  2MRD A;  1SY9 A;  3I5I C;  1CFC A;  1OOI X;  3Q8I A;  2KFH A;  4AOM A;  1K2H A;  2KBI A;  1WDC B;  2FJY A;  1CMG A;  5I2Q A;  3NHT A;  1QAS A;  3AAK A;  2QEB A;  1R6P A;  3CAB A;  3I5H C;  2QAC A;  3TUY C;  2KPH A;  1UWO A;  2Y1N A;  1YRU B;  1TNP A;  2A4J A;  4U8D A;  3D0Y B;  1QV0 A;  3O4Y A;  3SIB A;  3FWB A;  1TNW A;  2LUX A;  4XJK B;  1BMO A;  1CLM A;  1YUS A;  2L5X B;  2PAL A;  3I5H B;  3DD4 A;  3DVK A;  3OHM B;  3PLF B;  4M2O A;  2KI6 D;  5I94 A;  3TUY B;  1CFD A;  1UHK A;  3O6B A;  1WLZ A;  1DJZ A;  4PE4 A;  2JTT A;  1IWQ A;  2CCM A;  3MSE B;  2OS8 C;  5CSJ A;  2YGU A;  3D78 A;  2ZKM X;  2L4I A;  1TUJ A;  1PVA A;  2WC5 A;  1J7Q A;  2KYF A;  1IIO A;  3CZ1 A;  5FI6 A;  1WLM A;  1OOG A;  1YTZ C;  3EK8 A;  1QS7 A;  1DF0 A;  2M9G A;  1W7J B;  1P28 A;  3NSO A;  1F54 A;  2OTG C;  3M0W A;  3TS5 C;  1JUO A;  2JNF A;  3D74 A;  1NUB A;  4OCI A;  3DXL A;  1SCM B;  2KI6 C;  4N1G A;  3AKB A;  3LK1 A;  4PT1 A;  5K89 A;  1EG3 A;  4BY5 A;  2MJW B;  1SKT A;  3EVR A;  2O60 A;  4QJ5 B;  2MAZ A;  2OTG B;  1FI6 A;  4YI9 A;  1G8I A;  1B4C A;  4OR9 B;  1OOH A;  1NCX A;  1SR6 C;  5CPV A;  2PYQ A;  1SL9 A;  1QAT A;  1LVC D;  1DGU A;  4NDB A;  1K9P A;  1MHO A;  2I2R E;  1XFY O;  1Y1A A;  2LAN A;  3QRX A;  1M46 A;  4N1F A;  3I5G C;  1N65 A;  4NDC A;  1SR6 B;  1NX3 A;  1KFU L;  2JPO A;  4MN0 A;  4F0Z B;  3RLZ A;  2BL0 C;  3IQO A;  1TIZ A;  3ZNI A;  1TNX A;  5FI2 A;  4OVN F;  1YVH A;  2WOS A;  3CLN A;  1DEK A;  1IQ5 A;  2WCM A;  4ORC B;  3CZ0 A;  2P70 A;  2KBM A;  4PDZ A;  3GK2 A;  2BEC A;  2K61 A;  3DF0 A;  4L9M A;  5HKW A;  2ISD A;  1IKU A;  2M1U A;  2BL0 B;  3OX5 A;  3OBV A;  4FQT A;  1SW8 A;  3L47 A;  2AUC A;  2M7N A;  4GGF C;  4GPL B;  5DIC A;  1NCZ A;  2LMV A;  5FYX A;  1YX7 A;  2LC5 A;  3AKA A;  1A75 B;  3BOW B;  2I7A A;  2PQL A;  1IJ6 A;  1REC A;  3AAJ A;  3OP0 A;  2WCK A;  4YGD B;  1K95 A;  2ERB A;  1ALW A;  2M49 B;  3EK4 A;  3D77 A;  4GNK B;  1XFV O;  5D7F A;  2WC8 A;  1NSH A;  4MZK A;  1KSO A;  2KGR A;  2PVB A;  4M2Q A;  4GUK A;  4GAO A;  5JOL A;  1X02 A;  1SRA A;  2Y5I A;  3NXA A;  5JJG A;  1LIN A;  3OX6 A;  1UUS A;  1XFW O;  4ZCU A;  4MSP A;  2BBN A;  2LE9 B;  1OMR A;  1XYD A;  2QEV A;  3S0F A;  1S26 D;  1QTX A;  2K7C A;  1F4O A;  1KWO C;  2MLF C;  1F70 A;  1EG4 A;  3SS4 A;  4MZL A;  4PHK A;  2PAS A;  2BAP A;  2EC6 B;  2HET A;  1C3Z A;  1RFJ A;  2LMU A;  4ETO A;  4WQ3 A;  2RGI A;  5G08 A;  2WCL A;  1KWO B;  2O5G A;  2LVI A;  1S3P A;  2L5Y A;  2JQ6 A;  1QVI Y;  1QX5 B;  2V53 A;  5KU1 A;  1TOP A;  1C7V A;  1DT7 B;  4CFR A;  1OSA A;  2WCE A;  3EKJ A;  3JVT C;  3NSK A;  1FPW A;  1GJY A;  3EVU A;  1IH0 A;  1DF0 B;  3R1P A;  2F3Y A;  3GOF A;  3JTD C;  2K2F A;  3B86 A;  1CDP A;  1RRO A;  2GGM A;  4PE7 A;  4OZD A;  1XFZ O;  1SCV A;  2MA2 A;  2QEO A;  1DTL A;  5GQQ C;  1CNP A;  1EH2 A;  2KQ6 A;  4ORB B;  1DJX A;  1TTX A;  3JTD B;  3PJI A;  5I8N A;  3K1E A;  2H2K A;  2IS9 A;  4MVF A;  3S0D A;  1UHI A;  5KSZ A;  5AER A;  3S0E A;  1XK4 C;  1EJ3 A;  3BQ3 A;  3DVE A;  3VRQ A;  1PSR A;  1G33 A;  4JKT A;  2KAX A;  1SYM A;  1B9A A;  1AHR A;  1J55 A;  1K96 A;  3UNW A;  1DVI A;  1M45 A;  5AXI A;  1EL4 A;  3DZT A;  1JSA A;  1W7I B;  1S36 A;  2KSP A;  2F33 A;  2NXQ A;  4MLW A;  5ER4 X;  5I2O A;  3KEV A;  1SNL A;  1MXE A;  2EHB A;  2NCO A;  1BT6 A;  3B6X A;  2LP3 A;  4TNC A;  4YGB B;  3CS1 A;  3L4L A;  1TRF A;  5HLV A;  4NDD A;  1KFX L;  3CDN A;  4QJ3 B;  1KK7 Y;  2M8U A;  1DC1 A;  2BNX A;  2JTZ A;  3DF0 B;  2HPS A;  1QX2 A;  1UHJ A;  1CKK A;  3FE9 A;  1K8U A;  3IQQ A;  5HLO A;  1U5I A;  1QIV A;  3D75 A;  3HCM A;  4E68 A;  1JBA A;  1SCM C;  4F7F A;  2WCF A;  4HSZ A;  3OGN A;  2LVJ A;  2KLE A;  3VRP A;  4MBE A;  3H4S E;  2WC6 A;  3WHT B;  1A03 A;  1H4B A;  1TCF A;  2P6B B;  1HQV A;  1RK9 A;  1QVI Z;  4OV2 A;  4WRI A;  1GGZ A;  1JWD A;  2H61 A;  3KHE A;  2JT8 A;  4R1E A;  1MXL C;  4GFT A;  1BR4 B;  2LUC A;  1OMD A;  2JU0 A;  1N0Y A;  1BOD A;  2Q91 A;  4YBH B;  3OB2 B;  5F6T A;  3TDZ A;  5I2L A;  1IQ3 A;  4PE0 A;  2LVV A;  1JF0 A;  1CTR A;  1MF8 B;  1Z2C B;  1KSM A;  3CR2 A;  4ORA B;  1K93 D;  1OZO A;  1QLS A;  2K7O A;  3BUM B;  3BXK A;  4PE1 A;  2ZFD A;  5TNC A;  5CSI A;  4C0J A;  3S0A A;  1L2O B;  1S6C A;  1SSE B;  3BUX B;  2ZRS A;  4NQG A;  2HQW A;  1WRZ A;  4IJ7 A;  1SL8 A;  3CR4 X;  4MRX A;  5ER5 A;  5HL1 A;  3DYE A;  2F8P A;  1W9Z A;  1YVL A;  4A4C A;  1BF5 A;  3GK4 X;  2F2P A;  4C0L A;  3LCP C;  3O4X A;  1AK8 A;  2WND A;  1XFU O;  1XO5 A;  4Q04 A;  4CID A;  3VRO A;  1DGV A;  1GGW A;  5DKR A;  1J7R A;  3IF7 A;  3NSI A;  1OMV A;  4M2P A;  1UHN A;  2JPT A;  3KO0 A;  1DJI A;  1CLL A;  1YX8 A;  4DIR A;  4UPG A;  2I94 A;  4JPZ B;  2MBX A;  1N2D A;  3F45 A;  1KQV A;  3O78 A;  4MEW A;  2BE4 A;  3D0Y A;  3D76 A;  1KK7 Z;  1LA0 A;  1TNQ A;  2MLE C;  2LV7 A;  3B7A A;  3NGV A;  1K9U A;  4DRW A;  2WCH A;  2KAV A;  1C07 A;  3KF9 A;  1M31 A;  1B7T Y;  2PMY A;  1CFF A;  1C7W A;  2Y1M A;  4D1E A;  4YI8 A;  1B8R A;  1R2U A;  4KYN A;  2EC6 C;  3EK7 A;  2BCX A;  3PM2 A;  3SG2 A;  2L2E A;  4AQJ A;  2L50 A;  1WY9 A;  3GK1 A;  1FF1 A;  3PAT A;  3SG7 A;  1KFU S;  2PRU A;  2COL B;  4CLN A;  1B47 A;  4PHN A;  1OZS A;  2R2I A;  2LLS A;  3CGA A;  4PAL A;  1NPQ A;  1B8L A;  2CT9 A;  4PHJ A;  1A4P A;  3V2L A;  1NIW A;  1NYA A;  3S0G A;  3WHU B;  1YUT A;  2L0P A;  2LLT A;  3FE6 A;  3TZ1 A;  2L4H A;  2H8V A;  1M39 A;  3PFV A;  1GM0 A;  1F4Q A;  3BFB A;  1QLK A;  1MQ1 A;  1YUR A;  2G9B A; 
#chains in the Genus database with same CATH homology
 2FCD A;  1U5I B;  2NZ0 A;  4WQ2 A;  1DJG A;  1XFX O;  2OPO A;  4AQI A;  2HQ8 A;  4PHM A;  4PCW A;  3WXA A;  3A4U B;  1Q80 A;  4P2Y B;  1PSB A;  2KOT A;  3KPX A;  1CM4 A;  4GGN A;  1B1G A;  2KFG A;  1IGV A;  3SG5 A;  2ZNE A;  1S6J A;  2JNX A;  2LCP A;  5DKN A;  1OQP A;  5J3X A;  3PM8 A;  2LM5 A;  3C1V A;  1DJW A;  2LVK A;  1EXR A;  2BCA A;  1NCY A;  2NLN A;  5KTY A;  1QX7 A;  3ZWH A;  1IJ5 A;  1K90 D;  2JRF A;  2JZI A;  3A8R A;  1KCY A;  1Y1X A;  1CDN A;  2CTN A;  1J7P A;  1OE9 B;  1WRK A;  2KI4 C;  1MR8 A;  1QJT A;  3SG3 A;  1QIW A;  3PAL A;  4I5N B;  1UP5 A;  2KFF A;  2M1K B;  1CFP A;  1DMO A;  1BJF A;  4I5L B;  4FTG A;  1DJY A;  1QXP A;  3RM1 A;  2LAP A;  1B7T Z;  2BKH B;  2MHH A;  1A75 A;  2AAO A;  2KI4 B;  3BOW A;  2F2O A;  5BPJ A;  1ZFS A;  1LKJ A;  1L7Z A;  1S6I A;  2KQY A;  1WRL A;  2JT0 A;  1G4Y R;  5CSF A;  4GGF A;  4HRE E;  1JC2 A;  3VGO A;  2HF5 A;  1PK0 D;  1CB1 A;  3OB1 B;  1AUI B;  4CFQ A;  1YR5 A;  1GQM A;  4YGE B;  3BUW B;  1CMF A;  3D10 A;  2QPT A;  1LXF C;  1SL7 A;  3BUN B;  3CZT X;  1QV1 A;  2K8M B;  1S5G Z;  1XVJ A;  4XYN A;  4I5K A;  1NX0 A;  3I5I B;  4USL A;  3BYA A;  1KK8 C;  1MUX A;  1K9K A;  2I18 A;  4JQ0 D;  1IG5 A;  4DCK A;  1FW4 A;  2M29 A;  3K21 A;  1Y0V H;  4I5J A;  1RJV A;  4OKH A;  1SK6 D;  2GV5 A;  2K7B A;  1JFJ A;  1CM1 A;  4JWQ A;  1KK8 B;  1YUU A;  1L2O C;  1AP4 A;  2M7L A;  2WCB A;  1YRT B;  3FIA A;  5HKY A;  5AFP A;  1DJH A;  3LL8 B;  2ZN9 A;  1NX1 A;  1PRW A;  2G2B A;  2OS8 B;  4FQO A;  1S1E A;  2LHL A;  1UUR A;  1BG1 A;  2L51 A;  1BLQ A;  1KFX S;  1A29 A;  2B1U A;  4ZCV A;  1AJ4 A;  2F3Z A;  1Y1U A;  2JUL A;  2CXJ A;  2E6W A;  1NP8 A;  4CPV A;  2ZRT A;  1BR1 B;  1SPY A;  2LP2 A;  3I5F C;  4HRH A;  4ICB A;  1ODB A;  1B8C A;  2KHN A;  1FI5 A;  3TS5 B;  1CDM A;  2M0R A;  1CLB A;  1HT9 A;  2PSR A;  2ZND A;  4DUQ A;  1D1O A;  1PUL A;  1CDL A;  3I5F B;  3CWG A;  1MWN A;  2Y4Q A;  2CNP A;  2L98 A;  5PAL A;  1K94 A;  1NWD A;  1J7O A;  1Y6W A;  2D8N A;  1XK4 A;  4XJK A;  4YGC B;  2KGB C;  3SG6 A;  3EKH A;  1A2X A;  1M63 B;  1J1D A;  2FCE A;  1AJ5 A;  4P5O E;  2JXL A;  2JOJ A;  3SIA A;  3LLE A;  2KYC A;  1NX2 A;  3I5G B;  1TCO B;  2LMT A;  3HX4 A;  2SCP A;  2LLU A;  3VRR A;  3PN7 C;  5DKQ A;  1FBV A;  4GBA A;  4A4B A;  1PAL A;  2LNK A;  1ZOT B;  1ZMZ A;  3WNX B;  1JFK A;  2AMI A;  2BBM A;  2KNE A;  4YRU A;  2JXC A;  5IBW A;  2Q4U A;  5AAN A;  4BY4 A;  3SG4 A;  1IRJ A;  2K7D A;  1S5G Y;  3PN7 B;  2SAS A;  1AVS A;  4DS7 A;  5B8I B;  1F8H A;  2M3W A;  1TN4 A;  3CR5 X;  1JF2 A;  2VRG A;  4QJ4 B;  2DOQ A;  1PVB A;  3EVV A;  2BE6 A;  2FOT A;  2FJU B;  1BU3 A;  2H61 C;  1SBJ A;  1ZUZ A;  3VRN A;  3DVJ A;  2M97 A;  1F71 A;  2EGD A;  1E8A A;  1ALV A;  3FS7 A;  1XA5 A;  2LHI A;  3TDU A;  4HRG A;  3DVM A;  5HKZ A;  1RWY A;  2K2A A;  1OOJ A;  1UHH A;  3E3R A;  3LK0 A;  5CSN A;  3TDI A;  3SJS A;  3ICB A;  5AEQ A;  2JWW A;  3NSL A;  2WOR A;  4IL1 A;  2ZN8 A;  2BCB A;  1H8B A;  2TN4 A;  1BOC A;  2NCP A;  3FWC A;  5D69 A;  1VRK A;  1J1E A;  2KDH A;  2JC2 A;  1KQM C;  1RTP 1;  3CTN A;  3PSR A;  5HYD A;  2KAY A;  4MRY A;  1V1F A;  3JVT B;  2BKI B;  1SMG A;  4MZJ A;  3O2P A;  4N5X A;  4YGA A;  1WDC C;  2JT3 A;  1LA3 A;  4C0K A;  1KQM B;  2CBL A;  1ZAC A;  2K0J A;  1F55 A;  2GGZ A;  2E30 A;  3BUO B;  1V1G A;  2MRD A;  1SY9 A;  3I5I C;  1CFC A;  2KFH A;  4AOM A;  1K2H A;  2KBI A;  1WDC B;  1CMG A;  5I2Q A;  1QAS A;  3AAK A;  3I5H C;  1R6P A;  2QAC A;  3TUY C;  2Y1N A;  1UWO A;  1YRU B;  1TNP A;  2A4J A;  4U8D A;  3D0Y B;  1QV0 A;  3O4Y A;  3SIB A;  3FWB A;  1TNW A;  2LUX A;  4XJK B;  1BMO A;  1CLM A;  1YUS A;  2L5X B;  2PAL A;  3I5H B;  3DD4 A;  3DVK A;  3OHM B;  3PLF B;  4M2O A;  2KI6 D;  3TUY B;  1CFD A;  1UHK A;  3O6B A;  1WLZ A;  1DJZ A;  4PE4 A;  2JTT A;  1IWQ A;  2CCM A;  3MSE B;  2OS8 C;  5CSJ A;  2ZKM X;  2L4I A;  1PVA A;  1J7Q A;  2KYF A;  1WLM A;  1YTZ C;  3EK8 A;  1QS7 A;  1DF0 A;  2M9G A;  1W7J B;  3NSO A;  1F54 A;  2OTG C;  3M0W A;  3TS5 C;  1JUO A;  2JNF A;  1NUB A;  4OCI A;  1SCM B;  2KI6 C;  4N1G A;  3AKB A;  3LK1 A;  5K89 A;  1EG3 A;  4BY5 A;  2MJW B;  1SKT A;  3EVR A;  2O60 A;  4QJ5 B;  2MAZ A;  2OTG B;  1FI6 A;  4YI9 A;  1G8I A;  1B4C A;  4OR9 B;  1SR6 C;  1NCX A;  5CPV A;  1SL9 A;  1QAT A;  1LVC D;  1DGU A;  4NDB A;  1K9P A;  1MHO A;  2I2R E;  1XFY O;  1Y1A A;  2LAN A;  3QRX A;  1M46 A;  4N1F A;  3I5G C;  1N65 A;  4NDC A;  1SR6 B;  1NX3 A;  1KFU L;  4MN0 A;  4F0Z B;  3RLZ A;  2BL0 C;  3IQO A;  1TIZ A;  3ZNI A;  1TNX A;  4OVN F;  1YVH A;  2WOS A;  3CLN A;  1IQ5 A;  4ORC B;  2KBM A;  4PDZ A;  3GK2 A;  2BEC A;  2K61 A;  3DF0 A;  4L9M A;  5HKW A;  2ISD A;  1IKU A;  2M1U A;  2BL0 B;  3OX5 A;  1SW8 A;  2AUC A;  2M7N A;  4GGF C;  4GPL B;  1NCZ A;  2LMV A;  5FYX A;  1YX7 A;  2LC5 A;  3AKA A;  1A75 B;  3BOW B;  2I7A A;  1IJ6 A;  1REC A;  3AAJ A;  3OP0 A;  4YGD B;  1K95 A;  1ALW A;  2M49 B;  3EK4 A;  4GNK B;  1XFV O;  5D7F A;  2WC8 A;  1NSH A;  4MZK A;  1KSO A;  2KGR A;  2PVB A;  4M2Q A;  4GUK A;  4GAO A;  5JOL A;  1X02 A;  1SRA A;  2Y5I A;  3NXA A;  5JJG A;  1LIN A;  3OX6 A;  1UUS A;  1XFW O;  4ZCU A;  4MSP A;  2BBN A;  2LE9 B;  1OMR A;  1XYD A;  1S26 D;  1QTX A;  2K7C A;  1F4O A;  1KWO C;  2MLF C;  1F70 A;  1EG4 A;  4MZL A;  4PHK A;  2PAS A;  2EC6 B;  2HET A;  1RFJ A;  2LMU A;  4ETO A;  4WQ3 A;  2RGI A;  5G08 A;  1KWO B;  2O5G A;  2LVI A;  1S3P A;  2JQ6 A;  1QVI Y;  1QX5 B;  2V53 A;  5KU1 A;  1TOP A;  1C7V A;  1DT7 B;  4CFR A;  1OSA A;  2WCE A;  3EKJ A;  3JVT C;  3NSK A;  1FPW A;  1GJY A;  3EVU A;  1IH0 A;  1DF0 B;  2F3Y A;  3GOF A;  3JTD C;  2K2F A;  1CDP A;  1RRO A;  2GGM A;  4PE7 A;  1XFZ O;  1SCV A;  2MA2 A;  5GQQ C;  1DTL A;  1CNP A;  1EH2 A;  2KQ6 A;  4ORB B;  1DJX A;  1TTX A;  3JTD B;  5I8N A;  2H2K A;  2IS9 A;  4MVF A;  1UHI A;  5KSZ A;  5AER A;  1XK4 C;  1EJ3 A;  3BQ3 A;  3DVE A;  3VRQ A;  1PSR A;  1G33 A;  2KAX A;  1SYM A;  1B9A A;  1AHR A;  1J55 A;  1K96 A;  1DVI A;  1M45 A;  5AXI A;  1EL4 A;  1JSA A;  1W7I B;  1S36 A;  2KSP A;  2F33 A;  2NXQ A;  4MLW A;  5ER4 X;  5I2O A;  3KEV A;  1SNL A;  1MXE A;  2EHB A;  2NCO A;  1BT6 A;  2LP3 A;  4TNC A;  4YGB B;  3CS1 A;  1TRF A;  5HLV A;  4NDD A;  1KFX L;  4QJ3 B;  1KK7 Y;  2M8U A;  2JTZ A;  3DF0 B;  2HPS A;  1QX2 A;  1UHJ A;  1CKK A;  5HLO A;  1K8U A;  3IQQ A;  1JBA A;  1U5I A;  1QIV A;  3HCM A;  4E68 A;  1SCM C;  2WCF A;  4HSZ A;  2LVJ A;  3VRP A;  3WHT B;  4MBE A;  3H4S E;  1A03 A;  1H4B A;  1TCF A;  2P6B B;  1HQV A;  1RK9 A;  1QVI Z;  4OV2 A;  4WRI A;  1GGZ A;  1JWD A;  2H61 A;  3KHE A;  2JT8 A;  4R1E A;  1MXL C;  4GFT A;  1BR4 B;  2LUC A;  1OMD A;  2JU0 A;  1N0Y A;  1BOD A;  2Q91 A;  4YBH B;  3OB2 B;  5F6T A;  3TDZ A;  5I2L A;  1IQ3 A;  4PE0 A;  2LVV A;  1JF0 A;  1CTR A;  1MF8 B;  1KSM A;  3CR2 A;  4ORA B;  1K93 D;  1OZO A;  1QLS A;  2K7O A;  3BUM B;  3BXK A;  4PE1 A;  2ZFD A;  5TNC A;  5CSI A;  4C0J A;  1L2O B;  1S6C A;  3BUX B;  2ZRS A;  4NQG A;  2HQW A;  1WRZ A;  1SL8 A;  3CR4 X;  4MRX A;  5ER5 A;  2F8P A;  1YVL A;  4A4C A;  1BF5 A;  3GK4 X;  2F2P A;  4C0L A;  3LCP C;  1AK8 A;  2WND A;  1XFU O;  1XO5 A;  4Q04 A;  4CID A;  3VRO A;  1DGV A;  1GGW A;  5DKR A;  1J7R A;  3IF7 A;  3NSI A;  1OMV A;  4M2P A;  1UHN A;  2JPT A;  3KO0 A;  1DJI A;  1CLL A;  1YX8 A;  4DIR A;  4UPG A;  2I94 A;  4JPZ B;  2MBX A;  1N2D A;  3F45 A;  1KQV A;  3O78 A;  4MEW A;  2BE4 A;  3D0Y A;  1KK7 Z;  1LA0 A;  1TNQ A;  2MLE C;  2LV7 A;  1K9U A;  4DRW A;  2KAV A;  1C07 A;  3KF9 A;  1M31 A;  1B7T Y;  2PMY A;  1CFF A;  1C7W A;  2Y1M A;  4D1E A;  4YI8 A;  1B8R A;  1R2U A;  2EC6 C;  3EK7 A;  2BCX A;  3SG2 A;  4AQJ A;  2L2E A;  2L50 A;  1WY9 A;  3GK1 A;  1FF1 A;  3PAT A;  3SG7 A;  1KFU S;  2PRU A;  2COL B;  4CLN A;  1B47 A;  4PHN A;  1OZS A;  2R2I A;  2LLS A;  3CGA A;  4PAL A;  1NPQ A;  1B8L A;  2CT9 A;  4PHJ A;  1A4P A;  1NIW A;  1NYA A;  3WHU B;  1YUT A;  2L0P A;  2LLT A;  3TZ1 A;  2L4H A;  1M39 A;  3PFV A;  1F4Q A;  1QLK A;  1MQ1 A;  1YUR A;  2G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...