2JXCA

Structure of the eps15-eh2 stonin2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/protein binding
molecule keywords Epidermal growth factor receptor substrate 15
total genus 32
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxcA00
1UWOA 4MLWA 3CWGA 4PE7A 3CGAA 3CR4X 4AOMA 3NSIA 3O4YA 2LM5A 3PN7C 1OQPA 1NSHA 1XFXO 5KTYA 5I8NA 1CLBA 1ZFSA 1V1GA 1NP8A 3EK4A 4DS7A 2QACA 2ZRSA 1MWNA 1XYDA 4I5KA 3CLNA 4PHJA 1WLZA 4DCKA 2JTZA 3JTDB 4Q04A 1CDPA 1J7RA 1IGVA 3KO0A 1FW4A 1TCFA 5DKRA 3I5FB 3WHTB 4E68A 1AUIB 1RTP1 2L98A 3AAKA 3M0WA 1CDNA 3GK4X 5J3XA 1CFFA 1TNQA 1K9PA 1SR6C 2LVIA 3BQ3A 2MJWB 1K94A 1QIWA 2M49B 4GGFA 1MXLC 1OZSA 4L9MA 1GGZA 1LINA 2L51A 3LLEA 2PMYA 4PHKA 4PCWA 2Q91A 3PFVA 1WRLA 4PE4A 5JOLA 1YUUA 3IQQA 3MSEB 2AAOA 1NCXA 1CLMA 1M45A 1A75A 1SR6B 2M9GA 2M7LA 2I18A 2MA2A 3C1VA 4GGNA 1F4QA 1RWYA 2MLEC 1F55A 3PLFB 1K90D 2KYFA 1S5GZ 1Y0VH 3HCMA 1BR1B 1QASA 2KFFA 3DF0A 1NCYA 2BKHB 2ZNEA 4GNKB 1IWQA 1DJGA 1PVBA 2KI6C 4R1EA 2EC6B 2NXQA 3OX6A 2OPOA 4YRUA 1FPWA 3SG2A 4C0KA 1F71A 1S1EA 1YVHA 1B9AA 1QJTA 3WHUB 4GBAA 3LK1A 1SCMC 2GGMA 4PALA 1JFKA 3VROA 4ZCVA 2BKIB 1CB1A 1DJXA 1V1FA 1J1DA 4PDZA 1NX0A 1KCYA 4I5JA 1B1GA 1SRAA 5HKZA 2Y5IA 4NDCA 1LA3A 2EC6C 2JULA 3HX4A 5FYXA 1D1OA 1NWDA 1M31A 1PALA 1R2UA 1UHHA 1EJ3A 2F33A 2CBLA 4CPVA 5CSFA 1BJFA 1TN4A 2O60A 5G08A 1DJHA 1U5IA 2BCAA 2QPTA 1SCMB 1J7OA 2MAZA 2M8UA 3FIAA 4XJKA 4YGDB 3SIAA 1OSAA 1PRWA 2K2FA 5I2LA 1J1EA 4CIDA 1IRJA 2JNFA 3EVVA 1QIVA 1XFUO 1K9KA 1HQVA 4USLA 1W7JB 2PALA 1AJ5A 4CFRA 1FI5A 1B8RA 1YRUB 2BCXA 1KK8B 4GUKA 1KSMA 1TNXA 1XA5A 1FI6A 1CMGA 2LHIA 1A2XA 1PSBA 1UP5A 2TN4A 3EKJA 4ICBA 4OV2A 1OOJA 3IQOA 1YTZC 2BCBA 2CT9A 1SPYA 1AVSA 1CNPA 1IH0A 5K89A 1KSOA 1K9UA 5HLOA 3EK7A 2KSPA 1XFVO 3DVJA 1AP4A 1Y1AA 2MHHA 1Y6WA 1BODA 2B1UA 3DVEA 2A4JA 1QLSA 1WY9A 1ZMZA 4HRGA 2FOTA 2JT0A 1QS7A 1QX2A 2OS8C 2JT8A 3F45A 3TS5C 2JRFA 3OX5A 1JC2A 1B7TY 3SIBA 1AJ4A 1ALWA 2Y1MA 1OE9B 1BOCA 1A03A 3DF0B 3OB1B 1UHIA 2OS8B 1PSRA 3BUWB 3O78A 3I5FC 2MLFC 1DVIA 2E30A 3GOFA 2KNEA 5HKWA 1CFPA 2R2IA 2ISDA 4DRWA 1UUSA 4NDDA 3VRNA 2KOTA 4JWQA 3LL8B 3A8RA 2WCEA 2JU0A 1K93D 1WDCB 1WRKA 2BBMA 2JQ6A 3NSLA 1S6CA 4MEWA 1KK7Z 1B4CA 1SKTA 5D7FA 1Q80A 3GK2A 1TIZA 3OB2B 4DUQA 1CKKA 1QXPA 4DIRA 1BR4B 2KFHA 2LE9B 3PSRA 4HREE 2CNPA 3PN7B 2M7NA 1UHJA 1JBAA 3QRXA 1G4YR 1H8BA 5AXIA 3EVRA 3SG4A 1LA0A 1Y1UA 3BUXB 3CR5X 4MRYA 1DGUA 1LXFC 2BE4A 2L0PA 1E8AA 4IL1A 4MZJA 3SG6A 1BT6A 1YUTA 4P5OE 2M3WA 4QJ5B 1JUOA 2LHLA 2H61C 4YGEB 1WRZA 1B7TZ 2PVBA 3AAJA 4ORCB 1K96A 1Y1XA 2ZKMX 4BY4A 3BUMB 4P2YB 2BBNA 1S6IA 4U8DA 1N0YA 4FQOA 1KQVA 5BPJA 1TCOB 3NXAA 4NDBA 2GGZA 3A4UB 1DF0B 4NQGA 1L7ZA 1JF2A 4N1FA 1KK8C 2G2BA 4N5XA 2NZ0A 2Y4QA 2ZRTA 2LAPA 2LCPA 1DJWA 4YBHB 1UHKA 2KQ6A 1CLLA 4QJ4B 2LNKA 2KAXA 2F3YA 3OP0A 3D0YA 3RM1A 2ZFDA 1DGVA 1IG5A 2LLTA 3CS1A 4PHMA 3EK8A 1C07A 4GFTA 2K7DA 1OZOA 2LLUA 4PE0A 2K2AA 1XFWO 2WCFA 2IS9A 1RROA 5JJGA 1YRTB 2KFGA 1RJVA 1S6JA 2FCEA 3BUNB 3CZTX 4QJ3B 1NX2A 3OHMB 1SNLA 2I94A 2LVJA 5DKQA 2JT3A 1H4BA 4MRXA 3H4SE 1XK4A 2LMTA 2KI6D 1CMFA 1YUSA 1S36A 2JXCA 2CXJA 3SG5A 4GAOA 4OVNF 2HF5A 2JNXA 1K95A 3TDIA 5HLVA 1C7WA 1DMOA 2G9BA 2PASA 1BMOA 1YR5A 2WC8A 5AERA 4N1GA 1OMDA 2JPTA 1YX8A 1JF0A 2LVKA 1M46A 1N2DA 4YGCB 1KWOB 4OR9B 4XJKB 1EH2A 3FS7A 2WOSA 1WDCC 4XYNA 2KGRA 1A4PA 5DKNA 1MF8B 2OTGC 1JSAA 3KHEA 2LUXA 4M2PA 5AEQA 2M29A 1NX3A 2ZN8A 2E6WA 1AHRA 1MHOA 1N65A 2WORA 4D1EA 3TUYB 3I5IB 2KBMA 3WXAA 4A4BA 1YX7A 5I2QA 4JQ0D 3RLZA 2KBIA 2KI4C 2L50A 1LKJA 3JVTB 1SMGA 1C7VA 1UURA 3SG3A 2MBXA 1MXEA 2KAVA 4CFQA 1IQ5A 2JXLA 1F54A 3SG7A 3BYAA 2JTTA 4PE1A 2I2RE 3JTDC 1XFYO 2FJUB 1J55A 3IF7A 4MZLA 4MN0A 5GQQC 1DF0A 1GQMA 1JWDA 2COLB 1FF1A 1RECA 1SW8A 1SL8A 5CPVA 3JVTC 1PK0D 3I5HB 3EVUA 3BUOB 2PSRA 3KPXA 4JPZB 1G33A 2JWWA 1QVIY 3TZ1A 1SK6D 1IJ6A 1HT9A 2L4IA 2LMVA 1S3PA 3VGOA 1XK4C 2CTNA 2FCDA 5IBWA 3TS5B 3TDZA 3DVMA 1K2HA 1ZOTB 1BLQA 2JOJA 1TOPA 1F8HA 2LV7A 2M97A 2WCBA 4CLNA 1KFUL 2F3ZA 3PALA 1NCZA 2BL0C 2JZIA 3ZNIA 2I7AA 4YGBB 3ZWHA 1QV1A 1BU3A 4C0JA 5HKYA 1IKUA 1QV0A 1SYMA 3VRPA 2K61A 2O5GA 1CM4A 2Y1NA 2H2KA 4I5NB 3E3RA 1QLKA 1SL7A 5TNCA 1KQMC 1SBJA 2SCPA 4FTGA 1X02A 1SCVA 1YVLA 1QX7A 3O2PA 2KQYA 3TDUA 5KU1A 1QATA 4MZKA 3WNXB 4F0ZB 4YI9A 2KYCA 3BXKA 2AMIA 2NCOA 1CDMA 1W7IB 1DT7B 2SASA 4MSPA 4TNCA 2D8NA 1CDLA 3CTNA 1CFCA 1L2OB 1KK7Y 2F8PA 1R6PA 1MQ1A 1SL9A 2H61A 1NYAA 2Q4UA 4AQIA 1U5IB 2F2OA 3NSKA 5ER5A 2LP3A 2K8MB 3D10A 1J7QA 5CSIA 1VRKA 1IJ5A 1CM1A 2HQWA 1TNPA 3TUYC 4HRHA 4HSZA 4ETOA 2HPSA 5B8IB 1PULA 1EXRA 4MBEA 2M1UA 1TNWA 1A75B 1OMRA 4AQJA 1A29A 2K7OA 1ALVA 1SY9A 1MR8A 2LLSA 4GPLB 2CCMA 4YI8A 1NPQA 2DOQA 4M2OA 2M0RA 2K0JA 2BECA 3FWCA 2OTGB 1NIWA 3AKBA 4ORAB 2M1KB 1XO5A 2KHNA 1ZACA 1B8LA 2RGIA 1TRFA 3NSOA 4YGAA 1KFXS 2GV5A 1WLMA 5AANA 5F6TA 1S26D 2JC2A 5HYDA 2L2EA 4ORBB 5D69A 1KFXL 2F2PA 2HETA 4WQ3A 2ZN9A 2V53A 1LVCD 1BF5A 1BG1A 2HQ8A 1EG3A 3EKHA 3SJSA 2WNDA 1YURA 2LMUA 1K8UA 2KI4B 4OKHA 3GK1A 1GJYA 1RFJA 1FBVA 3BOWA 1ZUZA 4ZCUA 5AFPA 3LCPC 5I2OA 1EL4A 1JFJA 3I5HC 3CR2A 1DJZA 2BE6A 1B47A 2P6BB 2ZNDA 4WRIA 1CFDA 2EGDA 1AK8A 4WQ2A 2LC5A 3D0YB 5ER4X 2VRGA 3AKAA 1J7PA 2L5XB 4PHNA 5PALA 1OMVA 3I5IC 2LVVA 3PM8A 2NLNA 1F70A 2NCPA 1S5GY 1GGWA 1M39A 4A4CA 2KGBC 4I5LB 1NUBA 3I5GC 3LK0A 4GGFC 1RK9A 2KAYA 3K21A 1QX5B 3BOWB 4MVFA 1G8IA 1L2OC 1QVIZ 3KF9A 3I5GB 2PRUA 3KEVA 2L4HA 1UHNA 1XVJA 5CSNA 4OCIA 4M2QA 2EHBA 3VRRA 3VRQA 4UPGA 1IQ3A 5CSJA 1DJIA 1DJYA 1DTLA 1PVAA 4BY5A 1CTRA 2LUCA 2BL0B 1KQMB 3FWBA 2MRDA 3PATA 1B8CA 2K7BA 2LANA 1NX1A 1XFZO 1ODBA 1M63B 1KWOC 3DVKA 2AUCA 1F4OA 1TTXA 2KDHA 2K7CA 1KFUS 1MUXA 2LP2A 3DD4A 1EG4A 5KSZA 3O6BA 1QTXA 3ICBA 4C0LA
chains in the Genus database with same CATH superfamily
1UWOA 4MLWA 3CWGA 4PE7A 3CGAA 3CR4X 4AOMA 3NSIA 3O4YA 2LM5A 3PN7C 1OQPA 1NSHA 1XFXO 5KTYA 5I8NA 1CLBA 1ZFSA 4INWA 1V1GA 1NP8A 3EK4A 4DS7A 2QACA 3B86A 2ZRSA 1MWNA 1XYDA 4I5KA 3CLNA 4PHJA 1WLZA 4DCKA 2BNXA 2JTZA 3JTDB 4Q04A 1CDPA 1J7RA 1IGVA 3KO0A 1FW4A 1TCFA 5DKRA 3I5FB 3WHTB 4E68A 1AUIB 1RTP1 2L2CA 2L98A 3AAKA 1OW4A 3M0WA 1CDNA 3GK4X 5J3XA 1CFFA 1TNQA 5HL1A 1K9PA 1SR6C 2LVIA 3BQ3A 2MJWB 1K94A 1QIWA 2M49B 3PM2A 4GGFA 3CDNA 1MXLC 1OZSA 4L9MA 1GGZA 1LINA 2L51A 4INXA 3B87A 3LLEA 1TUJA 2BAPA 2PMYA 3RZSA 4PHKA 4PCWA 2Q91A 3PFVA 1WRLA 4PE4A 5JOLA 3NHIA 3SS3A 1YUUA 3IQQA 3MSEB 2AAOA 1NCXA 1CLMA 1M45A 3S0DA 3B7AA 1A75A 1SR6B 2M9GA 2M7LA 2I18A 2MA2A 3C1VA 4GGNA 1F4QA 1RWYA 2MLEC 1F55A 3PLFB 1K90D 2KYFA 4F7FA 1S5GZ 1Y0VH 3OGNA 5I94A 3HCMA 1BR1B 1QASA 2KFFA 3DF0A 1NCYA 3VB1A 2BKHB 2ZNEA 4GNKB 1IWQA 1DJGA 5FI7A 3SS5A 1PVBA 2KI6C 3BJHA 2EC6B 2NXQA 3OX6A 4R1EA 2OPOA 4YRUA 1FPWA 3SG2A 4C0KA 1F71A 1S1EA 3UNWA 1YVHA 1B9AA 1QJTA 3NGVA 4GBAA 3WHUB 3LK1A 1SCMC 5FI6A 2GGMA 4PALA 1JFKA 1QWVA 2WCKA 3VROA 4ZCVA 2BKIB 1CB1A 1DJXA 1V1FA 1J1DA 4PDZA 1NX0A 1KCYA 4I5JA 1B1GA 1SRAA 5HKZA 2Y5IA 4NDCA 1LA3A 2EC6C 2JULA 3HX4A 5FYXA 1D1OA 1NWDA 1M31A 1PALA 1R2UA 1UHHA 1C3ZA 1EJ3A 2F33A 2CBLA 4CPVA 5CSFA 1BJFA 1TN4A 2O60A 5G08A 1DJHA 1U5IA 2BCAA 2QPTA 1SCMB 1J7OA 2MAZA 2M8UA 3FIAA 4XJKA 5FI2A 4YGDB 3SIAA 1OSAA 1PRWA 2K2FA 5I2LA 1J1EA 4CIDA 1IRJA 2JNFA 5EL2A 3EVVA 1QIVA 1XFUO 1K9KA 1HQVA 4USLA 1W7JB 2PALA 1AJ5A 4CFRA 1FI5A 1B8RA 2BCXA 1YRUB 1KK8B 4GUKA 1KSMA 1TNXA 1XA5A 1FI6A 1CMGA 2LHIA 1OOHA 1A2XA 1TWOA 1PSBA 1UP5A 2TN4A 3EKJA 4ICBA 4OV2A 1OOJA 3IQOA 1YTZC 2BCBA 2CT9A 1SPYA 1AVSA 1CNPA 1IH0A 5K89A 1KSOA 1K9UA 5HLOA 3EK7A 2KSPA 1XFVO 3DVJA 1ORGA 1AP4A 1Y1AA 2WCLA 2MHHA 1Y6WA 1BODA 2B1UA 3DVEA 2A4JA 1QLSA 1WY9A 1ZMZA 4HRGA 2FOTA 2JT0A 1QS7A 1QX2A 2OS8C 2JT8A 3F45A 3TS5C 2JRFA 3OX5A 1JC2A 1B7TY 3SIBA 1AJ4A 1ALWA 2Y1MA 1OE9B 1BOCA 1A03A 3DF0B 3OB1B 1UHIA 2OS8B 1PSRA 3BUWB 3O78A 3I5FC 2MLFC 1DVIA 2E30A 3GOFA 2KNEA 5HKWA 1CFPA 2R2IA 2ISDA 5DICA 4DRWA 1UUSA 4NDDA 4JD9A 3VRNA 2KOTA 4JWQA 3LL8B 3A8RA 2WCEA 2JU0A 2WCHA 1K93D 1WDCB 1WRKA 2BBMA 2JQ6A 3NSLA 1S6CA 4MEWA 1KK7Z 1B4CA 1SKTA 5D7FA 1Q80A 3GK2A 1TIZA 3OB2B 4DUQA 1CKKA 1QXPA 4DIRA 1BR4B 2KFHA 3R1VA 2LE9B 3PSRA 4HREE 2CNPA 3PN7B 2M7NA 1UHJA 3O4XA 1JBAA 3QRXA 1G4YR 2L5YA 1H8BA 5AXIA 3EVRA 3SG4A 1LA0A 1Y1UA 3BUXB 3CR5X 4MRYA 1DGUA 4IJ7A 1LXFC 2BE4A 2PYQA 2L0PA 1E8AA 4IL1A 4MZJA 3SG6A 1BT6A 1YUTA 4P5OE 2M3WA 4QJ5B 1JUOA 2LHLA 2H61C 4YGEB 1WRZA 1B7TZ 2PVBA 3AAJA 4ORCB 1K96A 1Y1XA 2ZKMX 4BY4A 3BUMB 4P2YB 1OOFA 1S6IA 2BBNA 4U8DA 3NHTA 2WCMA 3K1EA 1N0YA 4FQOA 1KQVA 5BPJA 1TCOB 2KPHA 3NXAA 4NDBA 2GGZA 4JKTA 3A4UB 1DF0B 4NQGA 1L7ZA 2KLEA 1JF2A 4N1FA 1KK8C 2G2BA 4N5XA 2NZ0A 2Y4QA 2ZRTA 2LAPA 2LCPA 1DJWA 4YBHB 1UHKA 2KQ6A 1CLLA 4QJ4B 2LNKA 2KAXA 2F3YA 3OP0A 3D0YA 3RM1A 2ZFDA 1DGVA 1IG5A 2LLTA 3D74A 3CS1A 3N7HA 3EK8A 4PHMA 1C07A 4GFTA 2K7DA 1OZOA 3S0EA 2LLUA 4PE0A 2K2AA 1T14A 3CZ0A 3PJIA 1XFWO 2WCFA 2IS9A 1RROA 5JJGA 1YRTB 2KFGA 1RJVA 3B88A 1S6JA 2FCEA 3BUNB 3CZTX 4QJ3B 1NX2A 3OHMB 1SNLA 2I94A 2LVJA 5DKQA 2JT3A 3BFAA 1H4BA 4MRXA 3B6XA 1DQEA 3H4SE 1XK4A 2LMTA 2KI6D 1CMFA 1YUSA 1S36A 2JXCA 2CXJA 3SG5A 4GAOA 4OVNF 2ERBA 2HF5A 2JNXA 1K95A 3D73A 3TDIA 3L4LA 5HLVA 3CABA 1C7WA 1DMOA 2G9BA 2PASA 1BMOA 1YR5A 2WC8A 5AERA 4N1GA 1OMDA 3Q8IA 2JPTA 1YX8A 1JF0A 2LVKA 1M46A 1N2DA 4YGCB 1C3YA 1KWOB 4OR9B 4XJKB 1EH2A 3FS7A 2WOSA 1WDCC 4XYNA 2KGRA 1A4PA 5DKNA 1MF8B 2OTGC 1JSAA 2P70A 3KHEA 2LUXA 4M2PA 5AEQA 2M29A 1NX3A 3OBVA 2ZN8A 3D77A 2E6WA 2YGUA 1AHRA 1MHOA 1N65A 2WORA 4D1EA 3TUYB 3I5IB 3L4AA 2KBMA 3WXAA 4A4BA 1YX7A 5I2QA 4JQ0D 3RLZA 2KBIA 2KI4C 2L50A 3QMEA 1LKJA 3JVTB 1SMGA 1C7VA 1UURA 3SG3A 1Z2CB 2MBXA 1MXEA 2KAVA 2K60A 1IQ5A 2JXLA 3FE9A 4CFQA 3SG7A 1F54A 3BYAA 2JTTA 4PE1A 2I2RE 3JTDC 1XFYO 2WCJA 2FJUB 1J55A 1TUZA 3IF7A 4MZLA 4PT1A 4KYNA 4MN0A 5GQQC 1DF0A 3UO9A 1GQMA 1JWDA 2COLB 1FF1A 1RECA 1SW8A 1SL8A 5CPVA 3JVTC 1PK0D 2KLDA 3CZ2A 3I5HB 3BFBA 3EVUA 3BUOB 2PSRA 3KPXA 4JPZB 1G33A 2JWWA 1QVIY 2WC5A 3TZ1A 3S0FA 1SK6D 1IJ6A 1HT9A 2L4IA 2LMVA 1S3PA 3VGOA 1XK4C 2CTNA 2FCDA 5IBWA 3TS5B 3TDZA 3DVMA 1K2HA 5D3OA 1ZOTB 1BLQA 2JOJA 1TOPA 1F8HA 2LV7A 2M97A 2WCBA 4CLNA 1KFUL 2F3ZA 2WC6A 3PALA 1NCZA 2BL0C 2JZIA 3IVTA 3ZNIA 2I7AA 4YGBB 2PQLA 1QV1A 1SSEB 1BU3A 3ZWHA 4C0JA 5HKYA 1IKUA 1QV0A 1SYMA 3VRPA 2K61A 2O5GA 1CM4A 2Y1NA 1P28A 2H2KA 4I5NB 3E3RA 1QLKA 1SL7A 5TNCA 1KQMC 1SBJA 2SCPA 4FTGA 1X02A 1SCVA 1YVLA 1QX7A 3O2PA 2KQYA 3TDUA 3R1OA 1QATA 5KU1A 1W9ZA 4MZKA 2QEVA 3WNXB 4YI9A 4F0ZB 2KYCA 3BXKA 2AMIA 2NCOA 1CDMA 1W7IB 1DT7B 2JPOA 1OOIX 2SASA 4MSPA 4TNCA 2D8NA 1CDLA 3CTNA 1DELA 1CFCA 1L2OB 1KK7Y 1SL9A 1R6PA 1MQ1A 2F8PA 2H61A 3SS4A 1NYAA 2Q4UA 4AQIA 1U5IB 2QEBA 2F2OA 3NSKA 1DEKA 2LP3A 2K8MB 3D10A 5ER5A 1J7QA 5CSIA 3EG5B 1VRKA 1IJ5A 1CM1A 2HQWA 1TNPA 3TUYC 4HRHA 4HSZA 4ETOA 2HPSA 5B8IB 1PULA 2GTEA 3S0BA 1EXRA 3D76A 4MBEA 3CYZA 2M1UA 1TNWA 1A75B 1OMRA 4AQJA 4OZDA 1A29A 2K7OA 1ALVA 1OOGA 1MR8A 1SY9A 2H8VA 2LLSA 4GPLB 2CCMA 4YI8A 1NPQA 2DOQA 4M2OA 2M0RA 3L47A 2K0JA 2BECA 3FWCA 2OTGB 4FQTA 1NIWA 3AKBA 4ORAB 2M1KB 1XO5A 2KHNA 1ZACA 1B8LA 3S0AA 2RGIA 1TRFA 3BFHA 3NSOA 1KFXS 2GV5A 1WLMA 4YGAA 3FE8A 2QEHA 3DY9A 5F6TA 5AANA 1S26D 2JC2A 5HYDA 2L2EA 1LS8A 4ORBB 5D69A 1KFXL 2F2PA 2HETA 3S0GA 4WQ3A 3R1PA 3D78A 3DYEA 2ZN9A 2QDIA 2V53A 1LVCD 3FE6A 1BF5A 1BG1A 2HQ8A 1EG3A 3EKHA 3R72A 3DZTA 2WNDA 3SJSA 2P71A 1YURA 2LMUA 1K8UA 2KI4B 4OKHA 2FJYA 3GK1A 1GJYA 1RFJA 1FBVA 3BOWA 1ZUZA 4ZCUA 5AFPA 3LCPC 5I2OA 1EL4A 1JFJA 3CZ1A 3I5HC 3CR2A 1IIOA 2QEOA 1DJZA 2BE6A 1B47A 2P6BB 2ZNDA 4WRIA 1CFDA 2EGDA 1AK8A 4WQ2A 2LC5A 3D0YB 5ER4X 2VRGA 3AKAA 1J7PA 2L5XB 4PHNA 5PALA 3D75A 1OMVA 3I5IC 2LVVA 3PM8A 2NLNA 1F70A 2NCPA 1S5GY 1GGWA 1M39A 4A4CA 2KGBC 4I5LB 1NUBA 3V2LA 3I5GC 3LK0A 4GGFC 1RK9A 2KAYA 3K21A 1QX5B 3BOWB 4MVFA 1G8IA 1L2OC 1QVIZ 3KF9A 3I5GB 2PRUA 3KEVA 2L4HA 1UHNA 1XVJA 5CSNA 4OCIA 4M2QA 2EHBA 3VRRA 3VRQA 4UPGA 1IQ3A 5CSJA 1DJIA 1DJYA 1DTLA 1PVAA 4BY5A 1CTRA 2LUCA 2BL0B 1KQMB 3FWBA 2MRDA 3PATA 1B8CA 2K7BA 2LANA 1NX1A 1XFZO 1ODBA 1M63B 1KWOC 3DVKA 1XFRA 2AUCA 1F4OA 1TTXA 2KDHA 1Z4HA 1KFUS 1MUXA 2K7CA 2LP2A 1EG4A 3DD4A 5KSZA 1GM0A 3DXLA 3O6BA 1QTXA 3ICBA 4C0LA 1DC1A
chains in the Genus database with same CATH topology
1UWOA 4MLWA 3CWGA 4PE7A 3CGAA 3CR4X 4AOMA 3NSIA 3O4YA 2LM5A 3PN7C 1OQPA 1NSHA 1XFXO 5KTYA 5I8NA 1CLBA 1ZFSA 1V1GA 1NP8A 3EK4A 4DS7A 2QACA 2ZRSA 1MWNA 1XYDA 4I5KA 3CLNA 4PHJA 1WLZA 4DCKA 2JTZA 3JTDB 4Q04A 1CDPA 1J7RA 1IGVA 3KO0A 1FW4A 1TCFA 5DKRA 3I5FB 3WHTB 4E68A 1AUIB 1RTP1 2L98A 3AAKA 3M0WA 1CDNA 3GK4X 5J3XA 1CFFA 1TNQA 1K9PA 1SR6C 2LVIA 3BQ3A 2MJWB 1K94A 1QIWA 2M49B 4GGFA 1MXLC 1OZSA 4L9MA 1GGZA 1LINA 2L51A 3LLEA 2PMYA 4PHKA 4PCWA 2Q91A 3PFVA 1WRLA 4PE4A 5JOLA 1YUUA 3IQQA 3MSEB 2AAOA 1NCXA 1CLMA 1M45A 1A75A 1SR6B 2M9GA 2M7LA 2I18A 2MA2A 3C1VA 4GGNA 1F4QA 1RWYA 2MLEC 1F55A 3PLFB 1K90D 2KYFA 1S5GZ 1Y0VH 3HCMA 1BR1B 1QASA 2KFFA 3DF0A 1NCYA 2BKHB 2ZNEA 4GNKB 1IWQA 1DJGA 1PVBA 2KI6C 4R1EA 2EC6B 2NXQA 3OX6A 2OPOA 4YRUA 1FPWA 3SG2A 4C0KA 1F71A 1S1EA 1YVHA 1B9AA 1QJTA 3WHUB 4GBAA 3LK1A 1SCMC 2GGMA 4PALA 1JFKA 3VROA 4ZCVA 2BKIB 1CB1A 1DJXA 1V1FA 1J1DA 4PDZA 1NX0A 1KCYA 4I5JA 1B1GA 1SRAA 5HKZA 2Y5IA 4NDCA 1LA3A 2EC6C 2JULA 3HX4A 5FYXA 1D1OA 1NWDA 1M31A 1PALA 1R2UA 1UHHA 1EJ3A 2F33A 2CBLA 4CPVA 5CSFA 1BJFA 1TN4A 2O60A 5G08A 1DJHA 1U5IA 2BCAA 2QPTA 1SCMB 1J7OA 2MAZA 2M8UA 3FIAA 4XJKA 4YGDB 3SIAA 1OSAA 1PRWA 2K2FA 5I2LA 1J1EA 4CIDA 1IRJA 2JNFA 3EVVA 1QIVA 1XFUO 1K9KA 1HQVA 4USLA 1W7JB 2PALA 1AJ5A 4CFRA 1FI5A 1B8RA 1YRUB 2BCXA 1KK8B 4GUKA 1KSMA 1TNXA 1XA5A 1FI6A 1CMGA 2LHIA 1A2XA 1PSBA 1UP5A 2TN4A 3EKJA 4ICBA 4OV2A 1OOJA 3IQOA 1YTZC 2BCBA 2CT9A 1SPYA 1AVSA 1CNPA 1IH0A 5K89A 1KSOA 1K9UA 5HLOA 3EK7A 2KSPA 1XFVO 3DVJA 1AP4A 1Y1AA 2MHHA 1Y6WA 1BODA 2B1UA 3DVEA 2A4JA 1QLSA 1WY9A 1ZMZA 4HRGA 2FOTA 2JT0A 1QS7A 1QX2A 2OS8C 2JT8A 3F45A 3TS5C 2JRFA 3OX5A 1JC2A 1B7TY 3SIBA 1AJ4A 1ALWA 2Y1MA 1OE9B 1BOCA 1A03A 3DF0B 3OB1B 1UHIA 2OS8B 1PSRA 3BUWB 3O78A 3I5FC 2MLFC 1DVIA 2E30A 3GOFA 2KNEA 5HKWA 1CFPA 2R2IA 2ISDA 4DRWA 1UUSA 4NDDA 3VRNA 2KOTA 4JWQA 3LL8B 3A8RA 2WCEA 2JU0A 1K93D 1WDCB 1WRKA 2BBMA 2JQ6A 3NSLA 1S6CA 4MEWA 1KK7Z 1B4CA 1SKTA 5D7FA 1Q80A 3GK2A 1TIZA 3OB2B 4DUQA 1CKKA 1QXPA 4DIRA 1BR4B 2KFHA 2LE9B 3PSRA 4HREE 2CNPA 3PN7B 2M7NA 1UHJA 1JBAA 3QRXA 1G4YR 1H8BA 5AXIA 3EVRA 3SG4A 1LA0A 1Y1UA 3BUXB 3CR5X 4MRYA 1DGUA 1LXFC 2BE4A 2L0PA 1E8AA 4IL1A 4MZJA 3SG6A 1BT6A 1YUTA 4P5OE 2M3WA 4QJ5B 1JUOA 2LHLA 2H61C 4YGEB 1WRZA 1B7TZ 2PVBA 3AAJA 4ORCB 1K96A 1Y1XA 2ZKMX 4BY4A 3BUMB 4P2YB 2BBNA 1S6IA 4U8DA 1N0YA 4FQOA 1KQVA 5BPJA 1TCOB 3NXAA 4NDBA 2GGZA 3A4UB 1DF0B 4NQGA 1L7ZA 1JF2A 4N1FA 1KK8C 2G2BA 4N5XA 2NZ0A 2Y4QA 2ZRTA 2LAPA 2LCPA 1DJWA 4YBHB 1UHKA 2KQ6A 1CLLA 4QJ4B 2LNKA 2KAXA 2F3YA 3OP0A 3D0YA 3RM1A 2ZFDA 1DGVA 1IG5A 2LLTA 3CS1A 4PHMA 3EK8A 1C07A 4GFTA 2K7DA 1OZOA 2LLUA 4PE0A 2K2AA 1XFWO 2WCFA 2IS9A 1RROA 5JJGA 1YRTB 2KFGA 1RJVA 1S6JA 2FCEA 3BUNB 3CZTX 4QJ3B 1NX2A 3OHMB 1SNLA 2I94A 2LVJA 5DKQA 2JT3A 1H4BA 4MRXA 3H4SE 1XK4A 2LMTA 2KI6D 1CMFA 1YUSA 1S36A 2JXCA 2CXJA 3SG5A 4GAOA 4OVNF 2HF5A 2JNXA 1K95A 3TDIA 5HLVA 1C7WA 1DMOA 2G9BA 2PASA 1BMOA 1YR5A 2WC8A 5AERA 4N1GA 1OMDA 2JPTA 1YX8A 1JF0A 2LVKA 1M46A 1N2DA 4YGCB 1KWOB 4OR9B 4XJKB 1EH2A 3FS7A 2WOSA 1WDCC 4XYNA 2KGRA 1A4PA 5DKNA 1MF8B 2OTGC 1JSAA 3KHEA 2LUXA 4M2PA 5AEQA 2M29A 1NX3A 2ZN8A 2E6WA 1AHRA 1MHOA 1N65A 2WORA 4D1EA 3TUYB 3I5IB 2KBMA 3WXAA 4A4BA 1YX7A 5I2QA 4JQ0D 3RLZA 2KBIA 2KI4C 2L50A 1LKJA 3JVTB 1SMGA 1C7VA 1UURA 3SG3A 2MBXA 1MXEA 2KAVA 4CFQA 1IQ5A 2JXLA 1F54A 3SG7A 3BYAA 2JTTA 4PE1A 2I2RE 3JTDC 1XFYO 2FJUB 1J55A 3IF7A 4MZLA 4MN0A 5GQQC 1DF0A 1GQMA 1JWDA 2COLB 1FF1A 1RECA 1SW8A 1SL8A 5CPVA 3JVTC 1PK0D 3I5HB 3EVUA 3BUOB 2PSRA 3KPXA 4JPZB 1G33A 2JWWA 1QVIY 3TZ1A 1SK6D 1IJ6A 1HT9A 2L4IA 2LMVA 1S3PA 3VGOA 1XK4C 2CTNA 2FCDA 5IBWA 3TS5B 3TDZA 3DVMA 1K2HA 1ZOTB 1BLQA 2JOJA 1TOPA 1F8HA 2LV7A 2M97A 2WCBA 4CLNA 1KFUL 2F3ZA 3PALA 1NCZA 2BL0C 2JZIA 3ZNIA 2I7AA 4YGBB 3ZWHA 1QV1A 1BU3A 4C0JA 5HKYA 1IKUA 1QV0A 1SYMA 3VRPA 2K61A 2O5GA 1CM4A 2Y1NA 2H2KA 4I5NB 3E3RA 1QLKA 1SL7A 5TNCA 1KQMC 1SBJA 2SCPA 4FTGA 1X02A 1SCVA 1YVLA 1QX7A 3O2PA 2KQYA 3TDUA 5KU1A 1QATA 4MZKA 3WNXB 4F0ZB 4YI9A 2KYCA 3BXKA 2AMIA 2NCOA 1CDMA 1W7IB 1DT7B 2SASA 4MSPA 4TNCA 2D8NA 1CDLA 3CTNA 1CFCA 1L2OB 1KK7Y 2F8PA 1R6PA 1MQ1A 1SL9A 2H61A 1NYAA 2Q4UA 4AQIA 1U5IB 2F2OA 3NSKA 5ER5A 2LP3A 2K8MB 3D10A 1J7QA 5CSIA 1VRKA 1IJ5A 1CM1A 2HQWA 1TNPA 3TUYC 4HRHA 4HSZA 4ETOA 2HPSA 5B8IB 1PULA 1EXRA 4MBEA 2M1UA 1TNWA 1A75B 1OMRA 4AQJA 1A29A 2K7OA 1ALVA 1SY9A 1MR8A 2LLSA 4GPLB 2CCMA 4YI8A 1NPQA 2DOQA 4M2OA 2M0RA 2K0JA 2BECA 3FWCA 2OTGB 1NIWA 3AKBA 4ORAB 2M1KB 1XO5A 2KHNA 1ZACA 1B8LA 2RGIA 1TRFA 3NSOA 4YGAA 1KFXS 2GV5A 1WLMA 5AANA 5F6TA 1S26D 2JC2A 5HYDA 2L2EA 4ORBB 5D69A 1KFXL 2F2PA 2HETA 4WQ3A 2ZN9A 2V53A 1LVCD 1BF5A 1BG1A 2HQ8A 1EG3A 3EKHA 3SJSA 2WNDA 1YURA 2LMUA 1K8UA 2KI4B 4OKHA 3GK1A 1GJYA 1RFJA 1FBVA 3BOWA 1ZUZA 4ZCUA 5AFPA 3LCPC 5I2OA 1EL4A 1JFJA 3I5HC 3CR2A 1DJZA 2BE6A 1B47A 2P6BB 2ZNDA 4WRIA 1CFDA 2EGDA 1AK8A 4WQ2A 2LC5A 3D0YB 5ER4X 2VRGA 3AKAA 1J7PA 2L5XB 4PHNA 5PALA 1OMVA 3I5IC 2LVVA 3PM8A 2NLNA 1F70A 2NCPA 1S5GY 1GGWA 1M39A 4A4CA 2KGBC 4I5LB 1NUBA 3I5GC 3LK0A 4GGFC 1RK9A 2KAYA 3K21A 1QX5B 3BOWB 4MVFA 1G8IA 1L2OC 1QVIZ 3KF9A 3I5GB 2PRUA 3KEVA 2L4HA 1UHNA 1XVJA 5CSNA 4OCIA 4M2QA 2EHBA 3VRRA 3VRQA 4UPGA 1IQ3A 5CSJA 1DJIA 1DJYA 1DTLA 1PVAA 4BY5A 1CTRA 2LUCA 2BL0B 1KQMB 3FWBA 2MRDA 3PATA 1B8CA 2K7BA 2LANA 1NX1A 1XFZO 1ODBA 1M63B 1KWOC 3DVKA 2AUCA 1F4OA 1TTXA 2KDHA 2K7CA 1KFUS 1MUXA 2LP2A 3DD4A 1EG4A 5KSZA 3O6BA 1QTXA 3ICBA 4C0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWO A;  4MLW A;  3CWG A;  4PE7 A;  3CGA A;  3CR4 X;  4AOM A;  3NSI A;  3O4Y A;  2LM5 A;  3PN7 C;  1OQP A;  1NSH A;  1XFX O;  5KTY A;  5I8N A;  1CLB A;  1ZFS A;  1V1G A;  1NP8 A;  3EK4 A;  4DS7 A;  2QAC A;  2ZRS A;  1MWN A;  1XYD A;  4I5K A;  3CLN A;  4PHJ A;  1WLZ A;  4DCK A;  2JTZ A;  3JTD B;  4Q04 A;  1CDP A;  1J7R A;  1IGV A;  3KO0 A;  1FW4 A;  1TCF A;  5DKR A;  3I5F B;  3WHT B;  4E68 A;  1AUI B;  1RTP 1;  2L98 A;  3AAK A;  3M0W A;  1CDN A;  3GK4 X;  5J3X A;  1CFF A;  1TNQ A;  1K9P A;  1SR6 C;  2LVI A;  3BQ3 A;  2MJW B;  1K94 A;  1QIW A;  2M49 B;  4GGF A;  1MXL C;  1OZS A;  4L9M A;  1GGZ A;  1LIN A;  2L51 A;  3LLE A;  2PMY A;  4PHK A;  4PCW A;  2Q91 A;  3PFV A;  1WRL A;  4PE4 A;  5JOL A;  1YUU A;  3IQQ A;  3MSE B;  2AAO A;  1NCX A;  1CLM A;  1M45 A;  1A75 A;  1SR6 B;  2M9G A;  2M7L A;  2I18 A;  2MA2 A;  3C1V A;  4GGN A;  1F4Q A;  1RWY A;  2MLE C;  1F55 A;  3PLF B;  1K90 D;  2KYF A;  1S5G Z;  1Y0V H;  3HCM A;  1BR1 B;  1QAS A;  2KFF A;  3DF0 A;  1NCY A;  2BKH B;  2ZNE A;  4GNK B;  1IWQ A;  1DJG A;  1PVB A;  2KI6 C;  4R1E A;  2EC6 B;  2NXQ A;  3OX6 A;  2OPO A;  4YRU A;  1FPW A;  3SG2 A;  4C0K A;  1F71 A;  1S1E A;  1YVH A;  1B9A A;  1QJT A;  3WHU B;  4GBA A;  3LK1 A;  1SCM C;  2GGM A;  4PAL A;  1JFK A;  3VRO A;  4ZCV A;  2BKI B;  1CB1 A;  1DJX A;  1V1F A;  1J1D A;  4PDZ A;  1NX0 A;  1KCY A;  4I5J A;  1B1G A;  1SRA A;  5HKZ A;  2Y5I A;  4NDC A;  1LA3 A;  2EC6 C;  2JUL A;  3HX4 A;  5FYX A;  1D1O A;  1NWD A;  1M31 A;  1PAL A;  1R2U A;  1UHH A;  1EJ3 A;  2F33 A;  2CBL A;  4CPV A;  5CSF A;  1BJF A;  1TN4 A;  2O60 A;  5G08 A;  1DJH A;  1U5I A;  2BCA A;  2QPT A;  1SCM B;  1J7O A;  2MAZ A;  2M8U A;  3FIA A;  4XJK A;  4YGD B;  3SIA A;  1OSA A;  1PRW A;  2K2F A;  5I2L A;  1J1E A;  4CID A;  1IRJ A;  2JNF A;  3EVV A;  1QIV A;  1XFU O;  1K9K A;  1HQV A;  4USL A;  1W7J B;  2PAL A;  1AJ5 A;  4CFR A;  1FI5 A;  1B8R A;  1YRU B;  2BCX A;  1KK8 B;  4GUK A;  1KSM A;  1TNX A;  1XA5 A;  1FI6 A;  1CMG A;  2LHI A;  1A2X A;  1PSB A;  1UP5 A;  2TN4 A;  3EKJ A;  4ICB A;  4OV2 A;  1OOJ A;  3IQO A;  1YTZ C;  2BCB A;  2CT9 A;  1SPY A;  1AVS A;  1CNP A;  1IH0 A;  5K89 A;  1KSO A;  1K9U A;  5HLO A;  3EK7 A;  2KSP A;  1XFV O;  3DVJ A;  1AP4 A;  1Y1A A;  2MHH A;  1Y6W A;  1BOD A;  2B1U A;  3DVE A;  2A4J A;  1QLS A;  1WY9 A;  1ZMZ A;  4HRG A;  2FOT A;  2JT0 A;  1QS7 A;  1QX2 A;  2OS8 C;  2JT8 A;  3F45 A;  3TS5 C;  2JRF A;  3OX5 A;  1JC2 A;  1B7T Y;  3SIB A;  1AJ4 A;  1ALW A;  2Y1M A;  1OE9 B;  1BOC A;  1A03 A;  3DF0 B;  3OB1 B;  1UHI A;  2OS8 B;  1PSR A;  3BUW B;  3O78 A;  3I5F C;  2MLF C;  1DVI A;  2E30 A;  3GOF A;  2KNE A;  5HKW A;  1CFP A;  2R2I A;  2ISD A;  4DRW A;  1UUS A;  4NDD A;  3VRN A;  2KOT A;  4JWQ A;  3LL8 B;  3A8R A;  2WCE A;  2JU0 A;  1K93 D;  1WDC B;  1WRK A;  2BBM A;  2JQ6 A;  3NSL A;  1S6C A;  4MEW A;  1KK7 Z;  1B4C A;  1SKT A;  5D7F A;  1Q80 A;  3GK2 A;  1TIZ A;  3OB2 B;  4DUQ A;  1CKK A;  1QXP A;  4DIR A;  1BR4 B;  2KFH A;  2LE9 B;  3PSR A;  4HRE E;  2CNP A;  3PN7 B;  2M7N A;  1UHJ A;  1JBA A;  3QRX A;  1G4Y R;  1H8B A;  5AXI A;  3EVR A;  3SG4 A;  1LA0 A;  1Y1U A;  3BUX B;  3CR5 X;  4MRY A;  1DGU A;  1LXF C;  2BE4 A;  2L0P A;  1E8A A;  4IL1 A;  4MZJ A;  3SG6 A;  1BT6 A;  1YUT A;  4P5O E;  2M3W A;  4QJ5 B;  1JUO A;  2LHL A;  2H61 C;  4YGE B;  1WRZ A;  1B7T Z;  2PVB A;  3AAJ A;  4ORC B;  1K96 A;  1Y1X A;  2ZKM X;  4BY4 A;  3BUM B;  4P2Y B;  2BBN A;  1S6I A;  4U8D A;  1N0Y A;  4FQO A;  1KQV A;  5BPJ A;  1TCO B;  3NXA A;  4NDB A;  2GGZ A;  3A4U B;  1DF0 B;  4NQG A;  1L7Z A;  1JF2 A;  4N1F A;  1KK8 C;  2G2B A;  4N5X A;  2NZ0 A;  2Y4Q A;  2ZRT A;  2LAP A;  2LCP A;  1DJW A;  4YBH B;  1UHK A;  2KQ6 A;  1CLL A;  4QJ4 B;  2LNK A;  2KAX A;  2F3Y A;  3OP0 A;  3D0Y A;  3RM1 A;  2ZFD A;  1DGV A;  1IG5 A;  2LLT A;  3CS1 A;  4PHM A;  3EK8 A;  1C07 A;  4GFT A;  2K7D A;  1OZO A;  2LLU A;  4PE0 A;  2K2A A;  1XFW O;  2WCF A;  2IS9 A;  1RRO A;  5JJG A;  1YRT B;  2KFG A;  1RJV A;  1S6J A;  2FCE A;  3BUN B;  3CZT X;  4QJ3 B;  1NX2 A;  3OHM B;  1SNL A;  2I94 A;  2LVJ A;  5DKQ A;  2JT3 A;  1H4B A;  4MRX A;  3H4S E;  1XK4 A;  2LMT A;  2KI6 D;  1CMF A;  1YUS A;  1S36 A;  2JXC A;  2CXJ A;  3SG5 A;  4GAO A;  4OVN F;  2HF5 A;  2JNX A;  1K95 A;  3TDI A;  5HLV A;  1C7W A;  1DMO A;  2G9B A;  2PAS A;  1BMO A;  1YR5 A;  2WC8 A;  5AER A;  4N1G A;  1OMD A;  2JPT A;  1YX8 A;  1JF0 A;  2LVK A;  1M46 A;  1N2D A;  4YGC B;  1KWO B;  4OR9 B;  4XJK B;  1EH2 A;  3FS7 A;  2WOS A;  1WDC C;  4XYN A;  2KGR A;  1A4P A;  5DKN A;  1MF8 B;  2OTG C;  1JSA A;  3KHE A;  2LUX A;  4M2P A;  5AEQ A;  2M29 A;  1NX3 A;  2ZN8 A;  2E6W A;  1AHR A;  1MHO A;  1N65 A;  2WOR A;  4D1E A;  3TUY B;  3I5I B;  2KBM A;  3WXA A;  4A4B A;  1YX7 A;  5I2Q A;  4JQ0 D;  3RLZ A;  2KBI A;  2KI4 C;  2L50 A;  1LKJ A;  3JVT B;  1SMG A;  1C7V A;  1UUR A;  3SG3 A;  2MBX A;  1MXE A;  2KAV A;  4CFQ A;  1IQ5 A;  2JXL A;  1F54 A;  3SG7 A;  3BYA A;  2JTT A;  4PE1 A;  2I2R E;  3JTD C;  1XFY O;  2FJU B;  1J55 A;  3IF7 A;  4MZL A;  4MN0 A;  5GQQ C;  1DF0 A;  1GQM A;  1JWD A;  2COL B;  1FF1 A;  1REC A;  1SW8 A;  1SL8 A;  5CPV A;  3JVT C;  1PK0 D;  3I5H B;  3EVU A;  3BUO B;  2PSR A;  3KPX A;  4JPZ B;  1G33 A;  2JWW A;  1QVI Y;  3TZ1 A;  1SK6 D;  1IJ6 A;  1HT9 A;  2L4I A;  2LMV A;  1S3P A;  3VGO A;  1XK4 C;  2CTN A;  2FCD A;  5IBW A;  3TS5 B;  3TDZ A;  3DVM A;  1K2H A;  1ZOT B;  1BLQ A;  2JOJ A;  1TOP A;  1F8H A;  2LV7 A;  2M97 A;  2WCB A;  4CLN A;  1KFU L;  2F3Z A;  3PAL A;  1NCZ A;  2BL0 C;  2JZI A;  3ZNI A;  2I7A A;  4YGB B;  3ZWH A;  1QV1 A;  1BU3 A;  4C0J A;  5HKY A;  1IKU A;  1QV0 A;  1SYM A;  3VRP A;  2K61 A;  2O5G A;  1CM4 A;  2Y1N A;  2H2K A;  4I5N B;  3E3R A;  1QLK A;  1SL7 A;  5TNC A;  1KQM C;  1SBJ A;  2SCP A;  4FTG A;  1X02 A;  1SCV A;  1YVL A;  1QX7 A;  3O2P A;  2KQY A;  3TDU A;  5KU1 A;  1QAT A;  4MZK A;  3WNX B;  4F0Z B;  4YI9 A;  2KYC A;  3BXK A;  2AMI A;  2NCO A;  1CDM A;  1W7I B;  1DT7 B;  2SAS A;  4MSP A;  4TNC A;  2D8N A;  1CDL A;  3CTN A;  1CFC A;  1L2O B;  1KK7 Y;  2F8P A;  1R6P A;  1MQ1 A;  1SL9 A;  2H61 A;  1NYA A;  2Q4U A;  4AQI A;  1U5I B;  2F2O A;  3NSK A;  5ER5 A;  2LP3 A;  2K8M B;  3D10 A;  1J7Q A;  5CSI A;  1VRK A;  1IJ5 A;  1CM1 A;  2HQW A;  1TNP A;  3TUY C;  4HRH A;  4HSZ A;  4ETO A;  2HPS A;  5B8I B;  1PUL A;  1EXR A;  4MBE A;  2M1U A;  1TNW A;  1A75 B;  1OMR A;  4AQJ A;  1A29 A;  2K7O A;  1ALV A;  1SY9 A;  1MR8 A;  2LLS A;  4GPL B;  2CCM A;  4YI8 A;  1NPQ A;  2DOQ A;  4M2O A;  2M0R A;  2K0J A;  2BEC A;  3FWC A;  2OTG B;  1NIW A;  3AKB A;  4ORA B;  2M1K B;  1XO5 A;  2KHN A;  1ZAC A;  1B8L A;  2RGI A;  1TRF A;  3NSO A;  4YGA A;  1KFX S;  2GV5 A;  1WLM A;  5AAN A;  5F6T A;  1S26 D;  2JC2 A;  5HYD A;  2L2E A;  4ORB B;  5D69 A;  1KFX L;  2F2P A;  2HET A;  4WQ3 A;  2ZN9 A;  2V53 A;  1LVC D;  1BF5 A;  1BG1 A;  2HQ8 A;  1EG3 A;  3EKH A;  3SJS A;  2WND A;  1YUR A;  2LMU A;  1K8U A;  2KI4 B;  4OKH A;  3GK1 A;  1GJY A;  1RFJ A;  1FBV A;  3BOW A;  1ZUZ A;  4ZCU A;  5AFP A;  3LCP C;  5I2O A;  1EL4 A;  1JFJ A;  3I5H C;  3CR2 A;  1DJZ A;  2BE6 A;  1B47 A;  2P6B B;  2ZND A;  4WRI A;  1CFD A;  2EGD A;  1AK8 A;  4WQ2 A;  2LC5 A;  3D0Y B;  5ER4 X;  2VRG A;  3AKA A;  1J7P A;  2L5X B;  4PHN A;  5PAL A;  1OMV A;  3I5I C;  2LVV A;  3PM8 A;  2NLN A;  1F70 A;  2NCP A;  1S5G Y;  1GGW A;  1M39 A;  4A4C A;  2KGB C;  4I5L B;  1NUB A;  3I5G C;  3LK0 A;  4GGF C;  1RK9 A;  2KAY A;  3K21 A;  1QX5 B;  3BOW B;  4MVF A;  1G8I A;  1L2O C;  1QVI Z;  3KF9 A;  3I5G B;  2PRU A;  3KEV A;  2L4H A;  1UHN A;  1XVJ A;  5CSN A;  4OCI A;  4M2Q A;  2EHB A;  3VRR A;  3VRQ A;  4UPG A;  1IQ3 A;  5CSJ A;  1DJI A;  1DJY A;  1DTL A;  1PVA A;  4BY5 A;  1CTR A;  2LUC A;  2BL0 B;  1KQM B;  3FWB A;  2MRD A;  3PAT A;  1B8C A;  2K7B A;  2LAN A;  1NX1 A;  1XFZ O;  1ODB A;  1M63 B;  1KWO C;  3DVK A;  2AUC A;  1F4O A;  1TTX A;  2KDH A;  2K7C A;  1KFU S;  1MUX A;  2LP2 A;  3DD4 A;  1EG4 A;  5KSZ A;  3O6B A;  1QTX A;  3ICB A;  4C0L A; 
#chains in the Genus database with same CATH topology
 1UWO A;  4MLW A;  3CWG A;  4PE7 A;  3CGA A;  3CR4 X;  4AOM A;  3NSI A;  3O4Y A;  2LM5 A;  3PN7 C;  1OQP A;  1NSH A;  1XFX O;  5KTY A;  5I8N A;  1CLB A;  1ZFS A;  4INW A;  1V1G A;  1NP8 A;  3EK4 A;  4DS7 A;  2QAC A;  3B86 A;  2ZRS A;  1MWN A;  1XYD A;  4I5K A;  3CLN A;  4PHJ A;  1WLZ A;  4DCK A;  2BNX A;  2JTZ A;  3JTD B;  4Q04 A;  1CDP A;  1J7R A;  1IGV A;  3KO0 A;  1FW4 A;  1TCF A;  5DKR A;  3I5F B;  3WHT B;  4E68 A;  1AUI B;  1RTP 1;  2L2C A;  2L98 A;  3AAK A;  1OW4 A;  3M0W A;  1CDN A;  3GK4 X;  5J3X A;  1CFF A;  1TNQ A;  5HL1 A;  1K9P A;  1SR6 C;  2LVI A;  3BQ3 A;  2MJW B;  1K94 A;  1QIW A;  2M49 B;  3PM2 A;  4GGF A;  3CDN A;  1MXL C;  1OZS A;  4L9M A;  1GGZ A;  1LIN A;  2L51 A;  4INX A;  3B87 A;  3LLE A;  1TUJ A;  2BAP A;  2PMY A;  3RZS A;  4PHK A;  4PCW A;  2Q91 A;  3PFV A;  1WRL A;  4PE4 A;  5JOL A;  3NHI A;  3SS3 A;  1YUU A;  3IQQ A;  3MSE B;  2AAO A;  1NCX A;  1CLM A;  1M45 A;  3S0D A;  3B7A A;  1A75 A;  1SR6 B;  2M9G A;  2M7L A;  2I18 A;  2MA2 A;  3C1V A;  4GGN A;  1F4Q A;  1RWY A;  2MLE C;  1F55 A;  3PLF B;  1K90 D;  2KYF A;  4F7F A;  1S5G Z;  1Y0V H;  3OGN A;  5I94 A;  3HCM A;  1BR1 B;  1QAS A;  2KFF A;  3DF0 A;  1NCY A;  3VB1 A;  2BKH B;  2ZNE A;  4GNK B;  1IWQ A;  1DJG A;  5FI7 A;  3SS5 A;  1PVB A;  2KI6 C;  3BJH A;  2EC6 B;  2NXQ A;  3OX6 A;  4R1E A;  2OPO A;  4YRU A;  1FPW A;  3SG2 A;  4C0K A;  1F71 A;  1S1E A;  3UNW A;  1YVH A;  1B9A A;  1QJT A;  3NGV A;  4GBA A;  3WHU B;  3LK1 A;  1SCM C;  5FI6 A;  2GGM A;  4PAL A;  1JFK A;  1QWV A;  2WCK A;  3VRO A;  4ZCV A;  2BKI B;  1CB1 A;  1DJX A;  1V1F A;  1J1D A;  4PDZ A;  1NX0 A;  1KCY A;  4I5J A;  1B1G A;  1SRA A;  5HKZ A;  2Y5I A;  4NDC A;  1LA3 A;  2EC6 C;  2JUL A;  3HX4 A;  5FYX A;  1D1O A;  1NWD A;  1M31 A;  1PAL A;  1R2U A;  1UHH A;  1C3Z A;  1EJ3 A;  2F33 A;  2CBL A;  4CPV A;  5CSF A;  1BJF A;  1TN4 A;  2O60 A;  5G08 A;  1DJH A;  1U5I A;  2BCA A;  2QPT A;  1SCM B;  1J7O A;  2MAZ A;  2M8U A;  3FIA A;  4XJK A;  5FI2 A;  4YGD B;  3SIA A;  1OSA A;  1PRW A;  2K2F A;  5I2L A;  1J1E A;  4CID A;  1IRJ A;  2JNF A;  5EL2 A;  3EVV A;  1QIV A;  1XFU O;  1K9K A;  1HQV A;  4USL A;  1W7J B;  2PAL A;  1AJ5 A;  4CFR A;  1FI5 A;  1B8R A;  2BCX A;  1YRU B;  1KK8 B;  4GUK A;  1KSM A;  1TNX A;  1XA5 A;  1FI6 A;  1CMG A;  2LHI A;  1OOH A;  1A2X A;  1TWO A;  1PSB A;  1UP5 A;  2TN4 A;  3EKJ A;  4ICB A;  4OV2 A;  1OOJ A;  3IQO A;  1YTZ C;  2BCB A;  2CT9 A;  1SPY A;  1AVS A;  1CNP A;  1IH0 A;  5K89 A;  1KSO A;  1K9U A;  5HLO A;  3EK7 A;  2KSP A;  1XFV O;  3DVJ A;  1ORG A;  1AP4 A;  1Y1A A;  2WCL A;  2MHH A;  1Y6W A;  1BOD A;  2B1U A;  3DVE A;  2A4J A;  1QLS A;  1WY9 A;  1ZMZ A;  4HRG A;  2FOT A;  2JT0 A;  1QS7 A;  1QX2 A;  2OS8 C;  2JT8 A;  3F45 A;  3TS5 C;  2JRF A;  3OX5 A;  1JC2 A;  1B7T Y;  3SIB A;  1AJ4 A;  1ALW A;  2Y1M A;  1OE9 B;  1BOC A;  1A03 A;  3DF0 B;  3OB1 B;  1UHI A;  2OS8 B;  1PSR A;  3BUW B;  3O78 A;  3I5F C;  2MLF C;  1DVI A;  2E30 A;  3GOF A;  2KNE A;  5HKW A;  1CFP A;  2R2I A;  2ISD A;  5DIC A;  4DRW A;  1UUS A;  4NDD A;  4JD9 A;  3VRN A;  2KOT A;  4JWQ A;  3LL8 B;  3A8R A;  2WCE A;  2JU0 A;  2WCH A;  1K93 D;  1WDC B;  1WRK A;  2BBM A;  2JQ6 A;  3NSL A;  1S6C A;  4MEW A;  1KK7 Z;  1B4C A;  1SKT A;  5D7F A;  1Q80 A;  3GK2 A;  1TIZ A;  3OB2 B;  4DUQ A;  1CKK A;  1QXP A;  4DIR A;  1BR4 B;  2KFH A;  3R1V A;  2LE9 B;  3PSR A;  4HRE E;  2CNP A;  3PN7 B;  2M7N A;  1UHJ A;  3O4X A;  1JBA A;  3QRX A;  1G4Y R;  2L5Y A;  1H8B A;  5AXI A;  3EVR A;  3SG4 A;  1LA0 A;  1Y1U A;  3BUX B;  3CR5 X;  4MRY A;  1DGU A;  4IJ7 A;  1LXF C;  2BE4 A;  2PYQ A;  2L0P A;  1E8A A;  4IL1 A;  4MZJ A;  3SG6 A;  1BT6 A;  1YUT A;  4P5O E;  2M3W A;  4QJ5 B;  1JUO A;  2LHL A;  2H61 C;  4YGE B;  1WRZ A;  1B7T Z;  2PVB A;  3AAJ A;  4ORC B;  1K96 A;  1Y1X A;  2ZKM X;  4BY4 A;  3BUM B;  4P2Y B;  1OOF A;  1S6I A;  2BBN A;  4U8D A;  3NHT A;  2WCM A;  3K1E A;  1N0Y A;  4FQO A;  1KQV A;  5BPJ A;  1TCO B;  2KPH A;  3NXA A;  4NDB A;  2GGZ A;  4JKT A;  3A4U B;  1DF0 B;  4NQG A;  1L7Z A;  2KLE A;  1JF2 A;  4N1F A;  1KK8 C;  2G2B A;  4N5X A;  2NZ0 A;  2Y4Q A;  2ZRT A;  2LAP A;  2LCP A;  1DJW A;  4YBH B;  1UHK A;  2KQ6 A;  1CLL A;  4QJ4 B;  2LNK A;  2KAX A;  2F3Y A;  3OP0 A;  3D0Y A;  3RM1 A;  2ZFD A;  1DGV A;  1IG5 A;  2LLT A;  3D74 A;  3CS1 A;  3N7H A;  3EK8 A;  4PHM A;  1C07 A;  4GFT A;  2K7D A;  1OZO A;  3S0E A;  2LLU A;  4PE0 A;  2K2A A;  1T14 A;  3CZ0 A;  3PJI A;  1XFW O;  2WCF A;  2IS9 A;  1RRO A;  5JJG A;  1YRT B;  2KFG A;  1RJV A;  3B88 A;  1S6J A;  2FCE A;  3BUN B;  3CZT X;  4QJ3 B;  1NX2 A;  3OHM B;  1SNL A;  2I94 A;  2LVJ A;  5DKQ A;  2JT3 A;  3BFA A;  1H4B A;  4MRX A;  3B6X A;  1DQE A;  3H4S E;  1XK4 A;  2LMT A;  2KI6 D;  1CMF A;  1YUS A;  1S36 A;  2JXC A;  2CXJ A;  3SG5 A;  4GAO A;  4OVN F;  2ERB A;  2HF5 A;  2JNX A;  1K95 A;  3D73 A;  3TDI A;  3L4L A;  5HLV A;  3CAB A;  1C7W A;  1DMO A;  2G9B A;  2PAS A;  1BMO A;  1YR5 A;  2WC8 A;  5AER A;  4N1G A;  1OMD A;  3Q8I A;  2JPT A;  1YX8 A;  1JF0 A;  2LVK A;  1M46 A;  1N2D A;  4YGC B;  1C3Y A;  1KWO B;  4OR9 B;  4XJK B;  1EH2 A;  3FS7 A;  2WOS A;  1WDC C;  4XYN A;  2KGR A;  1A4P A;  5DKN A;  1MF8 B;  2OTG C;  1JSA A;  2P70 A;  3KHE A;  2LUX A;  4M2P A;  5AEQ A;  2M29 A;  1NX3 A;  3OBV A;  2ZN8 A;  3D77 A;  2E6W A;  2YGU A;  1AHR A;  1MHO A;  1N65 A;  2WOR A;  4D1E A;  3TUY B;  3I5I B;  3L4A A;  2KBM A;  3WXA A;  4A4B A;  1YX7 A;  5I2Q A;  4JQ0 D;  3RLZ A;  2KBI A;  2KI4 C;  2L50 A;  3QME A;  1LKJ A;  3JVT B;  1SMG A;  1C7V A;  1UUR A;  3SG3 A;  1Z2C B;  2MBX A;  1MXE A;  2KAV A;  2K60 A;  1IQ5 A;  2JXL A;  3FE9 A;  4CFQ A;  3SG7 A;  1F54 A;  3BYA A;  2JTT A;  4PE1 A;  2I2R E;  3JTD C;  1XFY O;  2WCJ A;  2FJU B;  1J55 A;  1TUZ A;  3IF7 A;  4MZL A;  4PT1 A;  4KYN A;  4MN0 A;  5GQQ C;  1DF0 A;  3UO9 A;  1GQM A;  1JWD A;  2COL B;  1FF1 A;  1REC A;  1SW8 A;  1SL8 A;  5CPV A;  3JVT C;  1PK0 D;  2KLD A;  3CZ2 A;  3I5H B;  3BFB A;  3EVU A;  3BUO B;  2PSR A;  3KPX A;  4JPZ B;  1G33 A;  2JWW A;  1QVI Y;  2WC5 A;  3TZ1 A;  3S0F A;  1SK6 D;  1IJ6 A;  1HT9 A;  2L4I A;  2LMV A;  1S3P A;  3VGO A;  1XK4 C;  2CTN A;  2FCD A;  5IBW A;  3TS5 B;  3TDZ A;  3DVM A;  1K2H A;  5D3O A;  1ZOT B;  1BLQ A;  2JOJ A;  1TOP A;  1F8H A;  2LV7 A;  2M97 A;  2WCB A;  4CLN A;  1KFU L;  2F3Z A;  2WC6 A;  3PAL A;  1NCZ A;  2BL0 C;  2JZI A;  3IVT A;  3ZNI A;  2I7A A;  4YGB B;  2PQL A;  1QV1 A;  1SSE B;  1BU3 A;  3ZWH A;  4C0J A;  5HKY A;  1IKU A;  1QV0 A;  1SYM A;  3VRP A;  2K61 A;  2O5G A;  1CM4 A;  2Y1N A;  1P28 A;  2H2K A;  4I5N B;  3E3R A;  1QLK A;  1SL7 A;  5TNC A;  1KQM C;  1SBJ A;  2SCP A;  4FTG A;  1X02 A;  1SCV A;  1YVL A;  1QX7 A;  3O2P A;  2KQY A;  3TDU A;  3R1O A;  1QAT A;  5KU1 A;  1W9Z A;  4MZK A;  2QEV A;  3WNX B;  4YI9 A;  4F0Z B;  2KYC A;  3BXK A;  2AMI A;  2NCO A;  1CDM A;  1W7I B;  1DT7 B;  2JPO A;  1OOI X;  2SAS A;  4MSP A;  4TNC A;  2D8N A;  1CDL A;  3CTN A;  1DEL A;  1CFC A;  1L2O B;  1KK7 Y;  1SL9 A;  1R6P A;  1MQ1 A;  2F8P A;  2H61 A;  3SS4 A;  1NYA A;  2Q4U A;  4AQI A;  1U5I B;  2QEB A;  2F2O A;  3NSK A;  1DEK A;  2LP3 A;  2K8M B;  3D10 A;  5ER5 A;  1J7Q A;  5CSI A;  3EG5 B;  1VRK A;  1IJ5 A;  1CM1 A;  2HQW A;  1TNP A;  3TUY C;  4HRH A;  4HSZ A;  4ETO A;  2HPS A;  5B8I B;  1PUL A;  2GTE A;  3S0B A;  1EXR A;  3D76 A;  4MBE A;  3CYZ A;  2M1U A;  1TNW A;  1A75 B;  1OMR A;  4AQJ A;  4OZD A;  1A29 A;  2K7O A;  1ALV A;  1OOG A;  1MR8 A;  1SY9 A;  2H8V A;  2LLS A;  4GPL B;  2CCM A;  4YI8 A;  1NPQ A;  2DOQ A;  4M2O A;  2M0R A;  3L47 A;  2K0J A;  2BEC A;  3FWC A;  2OTG B;  4FQT A;  1NIW A;  3AKB A;  4ORA B;  2M1K B;  1XO5 A;  2KHN A;  1ZAC A;  1B8L A;  3S0A A;  2RGI A;  1TRF A;  3BFH A;  3NSO A;  1KFX S;  2GV5 A;  1WLM A;  4YGA A;  3FE8 A;  2QEH A;  3DY9 A;  5F6T A;  5AAN A;  1S26 D;  2JC2 A;  5HYD A;  2L2E A;  1LS8 A;  4ORB B;  5D69 A;  1KFX L;  2F2P A;  2HET A;  3S0G A;  4WQ3 A;  3R1P A;  3D78 A;  3DYE A;  2ZN9 A;  2QDI A;  2V53 A;  1LVC D;  3FE6 A;  1BF5 A;  1BG1 A;  2HQ8 A;  1EG3 A;  3EKH A;  3R72 A;  3DZT A;  2WND A;  3SJS A;  2P71 A;  1YUR A;  2LMU A;  1K8U A;  2KI4 B;  4OKH A;  2FJY A;  3GK1 A;  1GJY A;  1RFJ A;  1FBV A;  3BOW A;  1ZUZ A;  4ZCU A;  5AFP A;  3LCP C;  5I2O A;  1EL4 A;  1JFJ A;  3CZ1 A;  3I5H C;  3CR2 A;  1IIO A;  2QEO A;  1DJZ A;  2BE6 A;  1B47 A;  2P6B B;  2ZND A;  4WRI A;  1CFD A;  2EGD A;  1AK8 A;  4WQ2 A;  2LC5 A;  3D0Y B;  5ER4 X;  2VRG A;  3AKA A;  1J7P A;  2L5X B;  4PHN A;  5PAL A;  3D75 A;  1OMV A;  3I5I C;  2LVV A;  3PM8 A;  2NLN A;  1F70 A;  2NCP A;  1S5G Y;  1GGW A;  1M39 A;  4A4C A;  2KGB C;  4I5L B;  1NUB A;  3V2L A;  3I5G C;  3LK0 A;  4GGF C;  1RK9 A;  2KAY A;  3K21 A;  1QX5 B;  3BOW B;  4MVF A;  1G8I A;  1L2O C;  1QVI Z;  3KF9 A;  3I5G B;  2PRU A;  3KEV A;  2L4H A;  1UHN A;  1XVJ A;  5CSN A;  4OCI A;  4M2Q A;  2EHB A;  3VRR A;  3VRQ A;  4UPG A;  1IQ3 A;  5CSJ A;  1DJI A;  1DJY A;  1DTL A;  1PVA A;  4BY5 A;  1CTR A;  2LUC A;  2BL0 B;  1KQM B;  3FWB A;  2MRD A;  3PAT A;  1B8C A;  2K7B A;  2LAN A;  1NX1 A;  1XFZ O;  1ODB A;  1M63 B;  1KWO C;  3DVK A;  1XFR A;  2AUC A;  1F4O A;  1TTX A;  2KDH A;  1Z4H A;  1KFU S;  1MUX A;  2K7C A;  2LP2 A;  1EG4 A;  3DD4 A;  5KSZ A;  1GM0 A;  3DXL A;  3O6B A;  1QTX A;  3ICB A;  4C0L A;  1DC1 A; 
#chains in the Genus database with same CATH homology
 1UWO A;  4MLW A;  3CWG A;  4PE7 A;  3CGA A;  3CR4 X;  4AOM A;  3NSI A;  3O4Y A;  2LM5 A;  3PN7 C;  1OQP A;  1NSH A;  1XFX O;  5KTY A;  5I8N A;  1CLB A;  1ZFS A;  1V1G A;  1NP8 A;  3EK4 A;  4DS7 A;  2QAC A;  2ZRS A;  1MWN A;  1XYD A;  4I5K A;  3CLN A;  4PHJ A;  1WLZ A;  4DCK A;  2JTZ A;  3JTD B;  4Q04 A;  1CDP A;  1J7R A;  1IGV A;  3KO0 A;  1FW4 A;  1TCF A;  5DKR A;  3I5F B;  3WHT B;  4E68 A;  1AUI B;  1RTP 1;  2L98 A;  3AAK A;  3M0W A;  1CDN A;  3GK4 X;  5J3X A;  1CFF A;  1TNQ A;  1K9P A;  1SR6 C;  2LVI A;  3BQ3 A;  2MJW B;  1K94 A;  1QIW A;  2M49 B;  4GGF A;  1MXL C;  1OZS A;  4L9M A;  1GGZ A;  1LIN A;  2L51 A;  3LLE A;  2PMY A;  4PHK A;  4PCW A;  2Q91 A;  3PFV A;  1WRL A;  4PE4 A;  5JOL A;  1YUU A;  3IQQ A;  3MSE B;  2AAO A;  1NCX A;  1CLM A;  1M45 A;  1A75 A;  1SR6 B;  2M9G A;  2M7L A;  2I18 A;  2MA2 A;  3C1V A;  4GGN A;  1F4Q A;  1RWY A;  2MLE C;  1F55 A;  3PLF B;  1K90 D;  2KYF A;  1S5G Z;  1Y0V H;  3HCM A;  1BR1 B;  1QAS A;  2KFF A;  3DF0 A;  1NCY A;  2BKH B;  2ZNE A;  4GNK B;  1IWQ A;  1DJG A;  1PVB A;  2KI6 C;  4R1E A;  2EC6 B;  2NXQ A;  3OX6 A;  2OPO A;  4YRU A;  1FPW A;  3SG2 A;  4C0K A;  1F71 A;  1S1E A;  1YVH A;  1B9A A;  1QJT A;  3WHU B;  4GBA A;  3LK1 A;  1SCM C;  2GGM A;  4PAL A;  1JFK A;  3VRO A;  4ZCV A;  2BKI B;  1CB1 A;  1DJX A;  1V1F A;  1J1D A;  4PDZ A;  1NX0 A;  1KCY A;  4I5J A;  1B1G A;  1SRA A;  5HKZ A;  2Y5I A;  4NDC A;  1LA3 A;  2EC6 C;  2JUL A;  3HX4 A;  5FYX A;  1D1O A;  1NWD A;  1M31 A;  1PAL A;  1R2U A;  1UHH A;  1EJ3 A;  2F33 A;  2CBL A;  4CPV A;  5CSF A;  1BJF A;  1TN4 A;  2O60 A;  5G08 A;  1DJH A;  1U5I A;  2BCA A;  2QPT A;  1SCM B;  1J7O A;  2MAZ A;  2M8U A;  3FIA A;  4XJK A;  4YGD B;  3SIA A;  1OSA A;  1PRW A;  2K2F A;  5I2L A;  1J1E A;  4CID A;  1IRJ A;  2JNF A;  3EVV A;  1QIV A;  1XFU O;  1K9K A;  1HQV A;  4USL A;  1W7J B;  2PAL A;  1AJ5 A;  4CFR A;  1FI5 A;  1B8R A;  1YRU B;  2BCX A;  1KK8 B;  4GUK A;  1KSM A;  1TNX A;  1XA5 A;  1FI6 A;  1CMG A;  2LHI A;  1A2X A;  1PSB A;  1UP5 A;  2TN4 A;  3EKJ A;  4ICB A;  4OV2 A;  1OOJ A;  3IQO A;  1YTZ C;  2BCB A;  2CT9 A;  1SPY A;  1AVS A;  1CNP A;  1IH0 A;  5K89 A;  1KSO A;  1K9U A;  5HLO A;  3EK7 A;  2KSP A;  1XFV O;  3DVJ A;  1AP4 A;  1Y1A A;  2MHH A;  1Y6W A;  1BOD A;  2B1U A;  3DVE A;  2A4J A;  1QLS A;  1WY9 A;  1ZMZ A;  4HRG A;  2FOT A;  2JT0 A;  1QS7 A;  1QX2 A;  2OS8 C;  2JT8 A;  3F45 A;  3TS5 C;  2JRF A;  3OX5 A;  1JC2 A;  1B7T Y;  3SIB A;  1AJ4 A;  1ALW A;  2Y1M A;  1OE9 B;  1BOC A;  1A03 A;  3DF0 B;  3OB1 B;  1UHI A;  2OS8 B;  1PSR A;  3BUW B;  3O78 A;  3I5F C;  2MLF C;  1DVI A;  2E30 A;  3GOF A;  2KNE A;  5HKW A;  1CFP A;  2R2I A;  2ISD A;  4DRW A;  1UUS A;  4NDD A;  3VRN A;  2KOT A;  4JWQ A;  3LL8 B;  3A8R A;  2WCE A;  2JU0 A;  1K93 D;  1WDC B;  1WRK A;  2BBM A;  2JQ6 A;  3NSL A;  1S6C A;  4MEW A;  1KK7 Z;  1B4C A;  1SKT A;  5D7F A;  1Q80 A;  3GK2 A;  1TIZ A;  3OB2 B;  4DUQ A;  1CKK A;  1QXP A;  4DIR A;  1BR4 B;  2KFH A;  2LE9 B;  3PSR A;  4HRE E;  2CNP A;  3PN7 B;  2M7N A;  1UHJ A;  1JBA A;  3QRX A;  1G4Y R;  1H8B A;  5AXI A;  3EVR A;  3SG4 A;  1LA0 A;  1Y1U A;  3BUX B;  3CR5 X;  4MRY A;  1DGU A;  1LXF C;  2BE4 A;  2L0P A;  1E8A A;  4IL1 A;  4MZJ A;  3SG6 A;  1BT6 A;  1YUT A;  4P5O E;  2M3W A;  4QJ5 B;  1JUO A;  2LHL A;  2H61 C;  4YGE B;  1WRZ A;  1B7T Z;  2PVB A;  3AAJ A;  4ORC B;  1K96 A;  1Y1X A;  2ZKM X;  4BY4 A;  3BUM B;  4P2Y B;  2BBN A;  1S6I A;  4U8D A;  1N0Y A;  4FQO A;  1KQV A;  5BPJ A;  1TCO B;  3NXA A;  4NDB A;  2GGZ A;  3A4U B;  1DF0 B;  4NQG A;  1L7Z A;  1JF2 A;  4N1F A;  1KK8 C;  2G2B A;  4N5X A;  2NZ0 A;  2Y4Q A;  2ZRT A;  2LAP A;  2LCP A;  1DJW A;  4YBH B;  1UHK A;  2KQ6 A;  1CLL A;  4QJ4 B;  2LNK A;  2KAX A;  2F3Y A;  3OP0 A;  3D0Y A;  3RM1 A;  2ZFD A;  1DGV A;  1IG5 A;  2LLT A;  3CS1 A;  4PHM A;  3EK8 A;  1C07 A;  4GFT A;  2K7D A;  1OZO A;  2LLU A;  4PE0 A;  2K2A A;  1XFW O;  2WCF A;  2IS9 A;  1RRO A;  5JJG A;  1YRT B;  2KFG A;  1RJV A;  1S6J A;  2FCE A;  3BUN B;  3CZT X;  4QJ3 B;  1NX2 A;  3OHM B;  1SNL A;  2I94 A;  2LVJ A;  5DKQ A;  2JT3 A;  1H4B A;  4MRX A;  3H4S E;  1XK4 A;  2LMT A;  2KI6 D;  1CMF A;  1YUS A;  1S36 A;  2JXC A;  2CXJ A;  3SG5 A;  4GAO A;  4OVN F;  2HF5 A;  2JNX A;  1K95 A;  3TDI A;  5HLV A;  1C7W A;  1DMO A;  2G9B A;  2PAS A;  1BMO A;  1YR5 A;  2WC8 A;  5AER A;  4N1G A;  1OMD A;  2JPT A;  1YX8 A;  1JF0 A;  2LVK A;  1M46 A;  1N2D A;  4YGC B;  1KWO B;  4OR9 B;  4XJK B;  1EH2 A;  3FS7 A;  2WOS A;  1WDC C;  4XYN A;  2KGR A;  1A4P A;  5DKN A;  1MF8 B;  2OTG C;  1JSA A;  3KHE A;  2LUX A;  4M2P A;  5AEQ A;  2M29 A;  1NX3 A;  2ZN8 A;  2E6W A;  1AHR A;  1MHO A;  1N65 A;  2WOR A;  4D1E A;  3TUY B;  3I5I B;  2KBM A;  3WXA A;  4A4B A;  1YX7 A;  5I2Q A;  4JQ0 D;  3RLZ A;  2KBI A;  2KI4 C;  2L50 A;  1LKJ A;  3JVT B;  1SMG A;  1C7V A;  1UUR A;  3SG3 A;  2MBX A;  1MXE A;  2KAV A;  4CFQ A;  1IQ5 A;  2JXL A;  1F54 A;  3SG7 A;  3BYA A;  2JTT A;  4PE1 A;  2I2R E;  3JTD C;  1XFY O;  2FJU B;  1J55 A;  3IF7 A;  4MZL A;  4MN0 A;  5GQQ C;  1DF0 A;  1GQM A;  1JWD A;  2COL B;  1FF1 A;  1REC A;  1SW8 A;  1SL8 A;  5CPV A;  3JVT C;  1PK0 D;  3I5H B;  3EVU A;  3BUO B;  2PSR A;  3KPX A;  4JPZ B;  1G33 A;  2JWW A;  1QVI Y;  3TZ1 A;  1SK6 D;  1IJ6 A;  1HT9 A;  2L4I A;  2LMV A;  1S3P A;  3VGO A;  1XK4 C;  2CTN A;  2FCD A;  5IBW A;  3TS5 B;  3TDZ A;  3DVM A;  1K2H A;  1ZOT B;  1BLQ A;  2JOJ A;  1TOP A;  1F8H A;  2LV7 A;  2M97 A;  2WCB A;  4CLN A;  1KFU L;  2F3Z A;  3PAL A;  1NCZ A;  2BL0 C;  2JZI A;  3ZNI A;  2I7A A;  4YGB B;  3ZWH A;  1QV1 A;  1BU3 A;  4C0J A;  5HKY A;  1IKU A;  1QV0 A;  1SYM A;  3VRP A;  2K61 A;  2O5G A;  1CM4 A;  2Y1N A;  2H2K A;  4I5N B;  3E3R A;  1QLK A;  1SL7 A;  5TNC A;  1KQM C;  1SBJ A;  2SCP A;  4FTG A;  1X02 A;  1SCV A;  1YVL A;  1QX7 A;  3O2P A;  2KQY A;  3TDU A;  5KU1 A;  1QAT A;  4MZK A;  3WNX B;  4F0Z B;  4YI9 A;  2KYC A;  3BXK A;  2AMI A;  2NCO A;  1CDM A;  1W7I B;  1DT7 B;  2SAS A;  4MSP A;  4TNC A;  2D8N A;  1CDL A;  3CTN A;  1CFC A;  1L2O B;  1KK7 Y;  2F8P A;  1R6P A;  1MQ1 A;  1SL9 A;  2H61 A;  1NYA A;  2Q4U A;  4AQI A;  1U5I B;  2F2O A;  3NSK A;  5ER5 A;  2LP3 A;  2K8M B;  3D10 A;  1J7Q A;  5CSI A;  1VRK A;  1IJ5 A;  1CM1 A;  2HQW A;  1TNP A;  3TUY C;  4HRH A;  4HSZ A;  4ETO A;  2HPS A;  5B8I B;  1PUL A;  1EXR A;  4MBE A;  2M1U A;  1TNW A;  1A75 B;  1OMR A;  4AQJ A;  1A29 A;  2K7O A;  1ALV A;  1SY9 A;  1MR8 A;  2LLS A;  4GPL B;  2CCM A;  4YI8 A;  1NPQ A;  2DOQ A;  4M2O A;  2M0R A;  2K0J A;  2BEC A;  3FWC A;  2OTG B;  1NIW A;  3AKB A;  4ORA B;  2M1K B;  1XO5 A;  2KHN A;  1ZAC A;  1B8L A;  2RGI A;  1TRF A;  3NSO A;  4YGA A;  1KFX S;  2GV5 A;  1WLM A;  5AAN A;  5F6T A;  1S26 D;  2JC2 A;  5HYD A;  2L2E A;  4ORB B;  5D69 A;  1KFX L;  2F2P A;  2HET A;  4WQ3 A;  2ZN9 A;  2V53 A;  1LVC D;  1BF5 A;  1BG1 A;  2HQ8 A;  1EG3 A;  3EKH A;  3SJS A;  2WND A;  1YUR A;  2LMU A;  1K8U A;  2KI4 B;  4OKH A;  3GK1 A;  1GJY A;  1RFJ A;  1FBV A;  3BOW A;  1ZUZ A;  4ZCU A;  5AFP A;  3LCP C;  5I2O A;  1EL4 A;  1JFJ A;  3I5H C;  3CR2 A;  1DJZ A;  2BE6 A;  1B47 A;  2P6B B;  2ZND A;  4WRI A;  1CFD A;  2EGD A;  1AK8 A;  4WQ2 A;  2LC5 A;  3D0Y B;  5ER4 X;  2VRG A;  3AKA A;  1J7P A;  2L5X B;  4PHN A;  5PAL A;  1OMV A;  3I5I C;  2LVV A;  3PM8 A;  2NLN A;  1F70 A;  2NCP A;  1S5G Y;  1GGW A;  1M39 A;  4A4C A;  2KGB C;  4I5L B;  1NUB A;  3I5G C;  3LK0 A;  4GGF C;  1RK9 A;  2KAY A;  3K21 A;  1QX5 B;  3BOW B;  4MVF A;  1G8I A;  1L2O C;  1QVI Z;  3KF9 A;  3I5G B;  2PRU A;  3KEV A;  2L4H A;  1UHN A;  1XVJ A;  5CSN A;  4OCI A;  4M2Q A;  2EHB A;  3VRR A;  3VRQ A;  4UPG A;  1IQ3 A;  5CSJ A;  1DJI A;  1DJY A;  1DTL A;  1PVA A;  4BY5 A;  1CTR A;  2LUC A;  2BL0 B;  1KQM B;  3FWB A;  2MRD A;  3PAT A;  1B8C A;  2K7B A;  2LAN A;  1NX1 A;  1XFZ O;  1ODB A;  1M63 B;  1KWO C;  3DVK A;  2AUC A;  1F4O A;  1TTX A;  2KDH A;  2K7C A;  1KFU S;  1MUX A;  2LP2 A;  3DD4 A;  1EG4 A;  5KSZ A;  3O6B A;  1QTX A;  3ICB A;  4C0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...