2JXCA

Structure of the eps15-eh2 stonin2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor substrate 15
publication title Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/protein binding
total genus 32
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxcA00
1EG4A 4PHKA 4HSZA 1QJTA 4PE0A 3IF7A 1W7IB 1EG3A 2LANA 4YGBB 4C0KA 1NX1A 4DS7A 2KDHA 3A4UB 4UPGA 2F33A 1CLBA 2E30A 1BG1A 1NX0A 1F54A 3SIAA 1U5IA 2GGMA 3BYAA 3I5GC 1RFJA 2NCOA 2M8UA 3TDUA 1KFUS 2LLSA 1FW4A 1PVAA 2I18A 3I5IC 4GPLB 3SG3A 4JWQA 3VRRA 1CDNA 1ZUZA 1V1FA 3PN7C 4AQIA 5ER4X 2SCPA 2LHLA 1E8AA 2MJWB 5BPJA 2DOQA 1K94A 2MAZA 2BECA 4MSPA 3NSLA 2QPTA 1B8RA 3AAJA 5AXIA 1KSOA 3BQ3A 2KOTA 1U5IB 1SNLA 1V1GA 3EVUA 1BOCA 3PFVA 1SCMC 1HQVA 1ZACA 1J7QA 4ORBB 4MRYA 4AQJA 2LNKA 3WNXB 4BY5A 5K89A 1GGWA 1AJ5A 1J1EA 1PULA 3CGAA 2GGZA 1OE9B 2M29A 3FWBA 1FI6A 1FI5A 1SK6D 1M31A 1B8CA 1AHRA 1IG5A 1IKUA 4DRWA 1Y1UA 1CDPA 5HKZA 1YUUA 1NPQA 2QACA 3SIBA 1SCVA 1EH2A 2LVIA 4PDZA 1K2HA 3DVMA 1XFVO 2K7CA 2OTGC 1A2XA 1KQMC 4PCWA 3TZ1A 3I5GB 1FPWA 4QJ5B 2JNXA 3I5IB 3JVTB 2I2RE 3PN7B 1J7RA 1TTXA 4CFQA 3CLNA 2WORA 4YRUA 4AOMA 1UP5A 3C1VA 3PSRA 3TDIA 1GJYA 1YUTA 5CSFA 1YURA 4DCKA 1CFCA 2NCPA 4WRIA 1CFDA 1SL8A 1BR1B 2ZRTA 1L2OC 2HF5A 1QS7A 4L9MA 2KFHA 2O5GA 2F8PA 2L50A 3GK1A 5F6TA 3AKBA 2JT8A 4NDCA 3LCPC 1CFPA 1BR4B 1VRKA 2H2KA 3VRPA 2KI6C 1WLZA 2CBLA 1JUOA 1IH0A 4R1EA 4I5NB 4M2QA 1RK9A 4ZCVA 2OTGB 2JOJA 3MSEB 2KI4B 2EC6C 4N1GA 4OV2A 1K96A 4BY4A 1QX5B 1NUBA 3DD4A 2PALA 1KSMA 2KI6D 1CDMA 2FCEA 2K2AA 2M49B 1ALVA 1SKTA 2O60A 1TCFA 1JF2A 2M7NA 3NSOA 3OB2B 2LV7A 1K9UA 2TN4A 1UUSA 4NDBA 2HQWA 4MVFA 2BCBA 4GBAA 2NZ0A 1OSAA 1M39A 2RGIA 1QV1A 5HKWA 5AFPA 1QVIY 3PALA 1KWOC 5D7FA 2MA2A 4MN0A 1XFUO 2Y4QA 1F71A 1S6JA 5IBWA 5KU1A 3LK1A 1SR6B 2L98A 5CSJA 4I5LB 2L4HA 2L5XB 3LK0A 3LL8B 2KHNA 2WNDA 1UWOA 1YVLA 4PHJA 1Y1AA 4XYNA 1LVCD 3WHUB 1B7TY 1AP4A 3RLZA 1S5GZ 3ZWHA 2BKHB 2M1UA 3FS7A 1DF0A 2EC6B 1XFYO 3CR4X 3CTNA 1MQ1A 1DJWA 4DIRA 5I8NA 4YI9A 2KYCA 3QRXA 3RM1A 2BCAA 2FOTA 1M46A 2E6WA 1UHKA 2L4IA 1QV0A 1BF5A 1IRJA 2D8NA 1B8LA 1CM1A 2ZN9A 1CMGA 1KWOB 3H4SE 1H8BA 1DF0B 1YUSA 3OHMB 4PE7A 1UURA 2EHBA 2F2PA 2BE4A 1TRFA 2LP2A 2Y5IA 4ETOA 2JC2A 1QASA 4ORCB 2ZNEA 3EVRA 2JXLA 3ZNIA 3O78A 2PRUA 1TNPA 1KCYA 1MF8B 1J7OA 3O6BA 2KQYA 2KAXA 1DJIA 3JTDB 1BMOA 1BU3A 3JVTC 4FQOA 4C0LA 1CFFA 2F3ZA 1B9AA 4OVNF 2LVVA 1G4YR 3HCMA 3SG2A 1SMGA 4YGEB 1UHJA 1DT7B 1YX7A 2F2OA 1NX3A 2KGBC 5AEQA 1BLQA 1XYDA 3TDZA 1RJVA 3CZTX 1L7ZA 3SG5A 2NLNA 2BBNA 2BBMA 1CKKA 2M7LA 4OCIA 1S1EA 1UHHA 2KQ6A 1TCOB 2BKIB 2LMTA 1CB1A 1DJGA 2LE9B 4HREE 4OR9B 2WCFA 5DKNA 1YTZC 2LHIA 2KI4C 1NCZA 2CNPA 2PVBA 2CT9A 2KAVA 2JT0A 2JWWA 4YGCB 1ZFSA 1CMFA 2AUCA 4Q04A 1KQVA 2LLTA 2OPOA 4XJKA 3PLFB 3KF9A 3SG6A 3CWGA 3DF0A 1MWNA 1DJHA 1SBJA 1WRZA 2JRFA 4M2OA 1GQMA 2LCPA 1PSBA 2BCXA 3VRQA 4GGFA 4F0ZB 2JQ6A 2KBMA 1QATA 2NXQA 1SR6C 2M9GA 1R6PA 4ICBA 3E3RA 3WXAA 2MLEC 1IJ6A 4XJKB 1DJYA 3DF0B 2MHHA 1QLKA 1QXPA 2PSRA 1F70A 3DVKA 1A4PA 1BT6A 1M63B 2LP3A 1ODBA 1OZSA 3A8RA 1KFXL 2CTNA 1NSHA 2WC8A 1N65A 1WRLA 1G8IA 2LC5A 2ZFDA 3VRNA 1S6IA 4GNKB 1LKJA 1Y6WA 1CTRA 1N0YA 1AUIB 4CLNA 5FYXA 2Y1MA 3NXAA 2F3YA 1RECA 1SRAA 2JZIA 4GAOA 1RROA 4GUKA 3F45A 1B4CA 2WCBA 1Q80A 4WQ3A 5PALA 3CR2A 3EK8A 1ZOTB 3EVVA 2K7BA 1MR8A 1IJ5A 3WHTB 2A4JA 1F4OA 3IQQA 1CLLA 5HYDA 1LXFC 1QX2A 1CM4A 5I2OA 1KK7Y 2JU0A 2MRDA 3SG4A 1XFXO 1XK4C 1SPYA 2K61A 3D10A 3EKHA 1D1OA 4YGDB 1K8UA 3CS1A 4I5KA 5CPVA 3JTDC 4E68A 5KTYA 4MZLA 3OP0A 1M45A 2COLB 4IL1A 1JFKA 2PMYA 3EK7A 1NCYA 2LVKA 2FJUB 1YRUB 2EGDA 2VRGA 3O4YA 1QTXA 1WDCB 1GGZA 1QVIZ 1NCXA 1YX8A 2M3WA 5AERA 3DVJA 1XK4A 1DTLA 2HPSA 2SASA 2I7AA 2V53A 1FBVA 1K9PA 1NYAA 1UHNA 1S3PA 2CXJA 4D1EA 4NQGA 3HX4A 1QIVA 2K2FA 2JULA 5CSNA 5JOLA 1MXEA 2KSPA 1B7TZ 5J3XA 4CPVA 1DMOA 2ZKMX 3OB1B 3KEVA 1RTP1 1XFWO 1KFUL 2KNEA 4FTGA 1TOPA 2R2IA 1AJ4A 4P2YB 1OMDA 2K7OA 1WRKA 2HETA 2LMVA 1SY9A 1C7VA 2M97A 3BUXB 2MLFC 2LAPA 1B1GA 3AKAA 2BL0B 4A4CA 1K93D 4M2PA 1SW8A 5JJGA 4GFTA 4I5JA 1B47A 2FCDA 1IQ3A 1TN4A 1DGUA 2GV5A 3I5FB 1IGVA 1MUXA 1NP8A 1QIWA 2MBXA 1CNPA 4NDDA 2M0RA 1C07A 3AAKA 2JT3A 4MZKA 2Q4UA 5TNCA 2AAOA 3BXKA 1BODA 3BUNB 3EK4A 3KO0A 4GGFC 3I5HC 2HQ8A 3PM8A 4QJ3B 1FF1A 3FWCA 1YVHA 2KFGA 1EJ3A 1NIWA 1QLSA 1X02A 2LM5A 1MXLC 1PVBA 4JQ0D 2AMIA 2P6BB 2CCMA 1TIZA 1XFZO 1PALA 5AANA 1H4BA 1S26D 3BUWB 1TNQA 3LLEA 5I2QA 1K9KA 2WOSA 1OZOA 4N5XA 4U8DA 1LINA 1DGVA 1JF0A 2KBIA 5HKYA 1DJXA 1S36A 3D0YA 3NSIA 1KK8C 3CR5X 2K8MB 2K0JA 1S6CA 1PRWA 2LMUA 2JNFA 1IQ5A 3NSKA 3TS5C 1LA3A 1OMRA 4P5OE 1WLMA 4MZJA 3BOWA 4HRHA 5G08A 1PK0D 2H61C 2G9BA 1A03A 5DKRA 2G2BA 3SJSA 1LA0A 3I5HB 4PE4A 3D0YB 4C0JA 2KFFA 1J55A 5ER5A 1RWYA 1SCMB 1NX2A 3GOFA 3ICBA 2Y1NA 2ZRSA 4YI8A 1F4QA 1G33A 2JTTA 2KAYA 3BOWB 1F55A 1AK8A 1WY9A 1XVJA 2LUXA 2JPTA 3M0WA 2H61A 1WDCC 2PASA 3IQOA 4QJ4B 1JSAA 4PHMA 1DVIA 4MEWA 3BUMB 2JXCA 2L51A 4WQ2A 1KK8B 5D69A 1S5GY 1JWDA 1KQMB 4MLWA 2ISDA 1R2UA 1ZMZA 4GGNA 1TNWA 3VGOA 4CFRA 4MRXA 1Y1XA 1KFXS 4N1FA 3TS5B 1OQPA 4CIDA 4TNCA 3O2PA 1CDLA 3OX5A 3SG7A 1QX7A 2LLUA 1SYMA 3DVEA 4PALA 4YGAA 2LVJA 1ALWA 2Q91A 1C7WA 5CSIA 5HLVA 4USLA 2ZN8A 1JBAA 1N2DA 1L2OB 1NWDA 1SL7A 3PATA 3TUYC 5B8IB 1IWQA 1A29A 5DKQA 2OS8C 3OX6A 1OOJA 2LUCA 4YBHB 1OMVA 2BE6A 2M1KB 1BJFA 2BL0C 1CLMA 1EL4A 2K7DA 3BUOB 4JPZB 4OKHA 4ORAB 1TNXA 1PSRA 1A75A 2JTZA 2ZNDA 1JFJA 1SL9A 2I94A 1HT9A 3I5FC 1YRTB 4HRGA 4PE1A 4PHNA 2KGRA 3GK4X 5GQQC 1J7PA 1XO5A 3FIAA 2WCEA 4ZCUA 3VROA 1F8HA 1EXRA 1KK7Z 1YR5A 1Y0VH 3EKJA 3GK2A 1AVSA 5I2LA 1JC2A 1A75B 1XA5A 3KPXA 1K90D 1MHOA 2L0PA 4MBEA 3KHEA 3TUYB 5HLOA 5KSZA 1UHIA 1K95A 4DUQA 1DJZA 1W7JB 1J1DA 2KYFA 2L2EA 3K21A 2B1UA 2OS8B 2IS9A 4A4BA
chains in the Genus database with same CATH superfamily
1EG4A 4PHKA 4HSZA 1QJTA 4PE0A 3FE8A 3IF7A 1W7IB 1EG3A 2LANA 4YGBB 4C0KA 1NX1A 3PM2A 2KDHA 3A4UB 4DS7A 2F33A 4UPGA 5I94A 1CLBA 2E30A 1BG1A 1NX0A 5FI6A 1F54A 3SIAA 1U5IA 2GGMA 3BYAA 3I5GC 1RFJA 2NCOA 2M8UA 5DICA 3TDUA 1KFUS 2LLSA 1FW4A 1PVAA 2I18A 3I5IC 4GPLB 3SG3A 4JWQA 3VRRA 1CDNA 1ZUZA 1V1FA 3PN7C 4AQIA 5ER4X 2SCPA 2LHLA 1E8AA 2MJWB 5BPJA 2DOQA 1K94A 2MAZA 2BECA 4MSPA 3NSLA 2QPTA 1B8RA 3AAJA 5AXIA 1KSOA 3BQ3A 2KOTA 1U5IB 1SNLA 1V1GA 3EVUA 1BOCA 3PFVA 1SCMC 1HQVA 1ZACA 1J7QA 4ORBB 3D75A 4MRYA 2LNKA 3WNXB 4AQJA 4BY5A 3CDNA 5K89A 1AJ5A 1J1EA 1PULA 3CGAA 2GGZA 1GGWA 1OE9B 2M29A 3FWBA 1FI6A 2WC6A 1FI5A 1SK6D 1M31A 1B8CA 1AHRA 1IG5A 3CABA 3QMEA 4DRWA 1IKUA 1Y1UA 1CDPA 5HKZA 1YUUA 1NPQA 2QACA 3SIBA 1SCVA 1EH2A 1OOGA 1W9ZA 2LVIA 4PDZA 1K2HA 3DVMA 1XFVO 2K7CA 2OTGC 1A2XA 1KQMC 3DXLA 4PCWA 3TZ1A 3I5GB 1FPWA 4QJ5B 3DYEA 2JNXA 3I5IB 3JVTB 3CZ2A 2I2RE 2PQLA 3PN7B 1J7RA 3FE6A 1TTXA 4CFQA 3CLNA 2WORA 4YRUA 3FE9A 4AOMA 5FI2A 1UP5A 3C1VA 3B6XA 3PSRA 3TDIA 1GJYA 1YUTA 3L4AA 1YURA 5CSFA 4DCKA 1CFCA 2NCPA 4WRIA 1CFDA 1SL8A 1BR1B 2GTEA 2ZRTA 1L2OC 2HF5A 1QS7A 2WCHA 2KFHA 4L9MA 2O5GA 2F8PA 2L50A 3GK1A 5F6TA 3S0BA 3AKBA 1TUJA 2JT8A 4NDCA 3LCPC 1CFPA 1BR4B 1VRKA 2H2KA 3VRPA 2KI6C 1WLZA 2CBLA 1JUOA 3SS5A 1IH0A 4R1EA 4I5NB 4M2QA 1RK9A 3BFBA 4ZCVA 2OTGB 3SS3A 2P70A 2JOJA 3MSEB 2KI4B 2EC6C 4N1GA 4OV2A 1K96A 3DZTA 4BY4A 1QX5B 1NUBA 3DD4A 2PALA 1KSMA 2KI6D 1CDMA 2FCEA 2K2AA 2M49B 1ALVA 1SKTA 2O60A 4OZDA 1TCFA 1JF2A 2M7NA 1DELA 3CYZA 1LS8A 3NSOA 3OB2B 2LV7A 1K9UA 1QWVA 2TN4A 1UUSA 4NDBA 2HQWA 4MVFA 2BCBA 3BFHA 2NZ0A 1OSAA 4GBAA 1M39A 2RGIA 1QV1A 5HKWA 5AFPA 1QVIY 3PALA 1KWOC 5D7FA 2MA2A 4MN0A 1XFUO 2Y4QA 1F71A 1S6JA 5IBWA 5KU1A 3LK1A 1SR6B 2L98A 5CSJA 4I5LB 2L4HA 2WCMA 2L5XB 3LK0A 3LL8B 2KHNA 2WNDA 1UWOA 1YVLA 4PHJA 1Y1AA 4XYNA 1LVCD 3WHUB 1B7TY 1AP4A 3RLZA 3BJHA 4JD9A 1S5GZ 2ERBA 3ZWHA 2BKHB 2M1UA 3FS7A 1DF0A 2EC6B 1XFYO 3CR4X 3CTNA 1MQ1A 3L4LA 1DJWA 4DIRA 5I8NA 4YI9A 2KYCA 3QRXA 3RM1A 2BCAA 2FOTA 1M46A 2E6WA 1UHKA 2L4IA 1QV0A 2L5YA 1BF5A 1IRJA 3B7AA 2D8NA 1B8LA 1CM1A 2ZN9A 2QEOA 1CMGA 1KWOB 3H4SE 1H8BA 1DF0B 1YUSA 3OHMB 4PE7A 1UURA 4JKTA 2EHBA 2F2PA 3K1EA 2BE4A 1TRFA 2LP2A 2Y5IA 4ETOA 2JC2A 1QASA 4ORCB 2ZNEA 3EVRA 2JXLA 3B88A 3ZNIA 3O78A 2PRUA 1TNPA 1KCYA 1MF8B 3CZ1A 1J7OA 3O6BA 2KQYA 2KAXA 1DJIA 3JTDB 1BMOA 1BU3A 3JVTC 4FQOA 4C0LA 1CFFA 2F3ZA 1B9AA 2QEBA 4OVNF 2LVVA 2YGUA 1G4YR 3HCMA 3SG2A 1SMGA 4YGEB 1UHJA 1DT7B 1YX7A 2WCLA 2F2OA 1NX3A 2KGBC 4INWA 5AEQA 1BLQA 1XYDA 3TDZA 1RJVA 3NGVA 3V2LA 3CZTX 1L7ZA 3NHTA 3SG5A 2NLNA 2BBNA 2BBMA 1CKKA 2M7LA 4OCIA 1S1EA 1UHHA 2KQ6A 1TCOB 2BKIB 2LMTA 1CB1A 1DJGA 2LE9B 4HREE 4OR9B 1OOIX 3R1PA 2WCFA 5DKNA 1YTZC 2LHIA 2KI4C 1NCZA 2CNPA 2PVBA 2CT9A 2KAVA 2JT0A 2JWWA 4YGCB 1ZFSA 1CMFA 2AUCA 4Q04A 1KQVA 2LLTA 2OPOA 4XJKA 3PLFB 3KF9A 3SG6A 5HL1A 3CWGA 3DF0A 1MWNA 1DJHA 1SBJA 1WRZA 2JRFA 4M2OA 1GQMA 2LCPA 1PSBA 3NHIA 2BCXA 1TWOA 3VRQA 4GGFA 4F0ZB 2JQ6A 2KBMA 1QATA 2NXQA 2WC5A 1SR6C 4F7FA 2KLDA 2M9GA 1R6PA 4PT1A 4ICBA 3E3RA 3WXAA 2MLEC 1IJ6A 4XJKB 1DJYA 3S0FA 3DF0B 2MHHA 1QLKA 3S0GA 1QXPA 2K60A 2PSRA 1F70A 3DVKA 1A4PA 3D78A 1BT6A 1M63B 2LP3A 1ODBA 1OZSA 3A8RA 1KFXL 3UO9A 2CTNA 1NSHA 2WC8A 1TUZA 1N65A 1WRLA 2KLEA 1G8IA 2LC5A 2ZFDA 3VRNA 3VB1A 1S6IA 4GNKB 1LKJA 1Y6WA 1Z4HA 1CTRA 1N0YA 1AUIB 4CLNA 5FYXA 2L2CA 2Y1MA 1P28A 3NXAA 3D74A 2F3YA 1RECA 1SRAA 2JZIA 4KYNA 4GAOA 1RROA 4GUKA 3OGNA 3F45A 1B4CA 2WCBA 1Q80A 4WQ3A 1OOHA 3CR2A 5PALA 3EK8A 1ZOTB 3EVVA 2K7BA 1MR8A 1IJ5A 3WHTB 2A4JA 3S0AA 1F4OA 1IIOA 3S0DA 3IQQA 1CLLA 5HYDA 1LXFC 1QX2A 1CM4A 5I2OA 1KK7Y 3OBVA 2QEVA 4FQTA 2JU0A 2MRDA 3PJIA 3SS4A 3CZ0A 3SG4A 1XFXO 1XK4C 1SPYA 2K61A 3D10A 3EKHA 1D1OA 4YGDB 1K8UA 3CS1A 4I5KA 5CPVA 3JTDC 2JPOA 3L47A 5EL2A 5KTYA 4MZLA 4E68A 3OP0A 1M45A 2COLB 4IL1A 1JFKA 2PMYA 3EK7A 1NCYA 3R1OA 2LVKA 2FJUB 1YRUB 2EGDA 2VRGA 3BFAA 3O4YA 1QTXA 1WDCB 1DEKA 1GGZA 1NCXA 1QVIZ 1YX8A 2M3WA 5AERA 3DVJA 1XK4A 1DTLA 2HPSA 2SASA 2I7AA 2V53A 1FBVA 2H8VA 1T14A 1K9PA 2WCJA 1NYAA 5FI7A 1UHNA 1S3PA 2CXJA 4D1EA 4NQGA 3HX4A 1QIVA 2K2FA 2JULA 5CSNA 5JOLA 1MXEA 2BAPA 2KSPA 1B7TZ 5J3XA 4CPVA 1DMOA 2ZKMX 3OB1B 2WCKA 3KEVA 1RTP1 1XFWO 1KFUL 2KNEA 4FTGA 1TOPA 2R2IA 1AJ4A 4P2YB 1OMDA 2K7OA 1WRKA 2HETA 2LMVA 1SY9A 1C7VA 2M97A 3BUXB 2MLFC 2LAPA 1B1GA 3AKAA 2BL0B 4A4CA 1K93D 4M2PA 1SW8A 5JJGA 2PYQA 4GFTA 1XFRA 1GM0A 4I5JA 1B47A 2FCDA 1IQ3A 1TN4A 1DGUA 2GV5A 3I5FB 1IGVA 1MUXA 2QDIA 1NP8A 1QIWA 2MBXA 1CNPA 4NDDA 2M0RA 1C07A 3AAKA 2JT3A 4MZKA 2Q4UA 5TNCA 2AAOA 3BXKA 2KPHA 1BODA 3BUNB 3EK4A 3KO0A 1OOFA 4GGFC 3I5HC 2HQ8A 3PM8A 4QJ3B 1FF1A 3FWCA 1YVHA 2KFGA 3EG5B 1EJ3A 1NIWA 1QLSA 1X02A 2LM5A 1MXLC 1PVBA 4JQ0D 2AMIA 2P6BB 2CCMA 1TIZA 1XFZO 1PALA 5AANA 1H4BA 1S26D 3BUWB 1TNQA 3LLEA 5I2QA 1K9KA 2WOSA 1OZOA 4N5XA 4U8DA 1LINA 1DGVA 1JF0A 4IJ7A 2KBIA 5HKYA 1DC1A 1DJXA 1S36A 3D0YA 3NSIA 1KK8C 3CR5X 1OW4A 2K8MB 2K0JA 3UNWA 1S6CA 1PRWA 2LMUA 2JNFA 1IQ5A 3NSKA 3TS5C 1LA3A 1OMRA 4P5OE 1WLMA 4MZJA 3BOWA 4HRHA 3R72A 5G08A 1PK0D 2H61C 2G9BA 1A03A 5DKRA 2G2BA 3SJSA 1LA0A 3B86A 3I5HB 3D0YB 4PE4A 4C0JA 2KFFA 1J55A 5ER5A 1RWYA 1SCMB 1NX2A 3GOFA 3ICBA 2Y1NA 2ZRSA 4YI8A 1F4QA 1G33A 2JTTA 2KAYA 3BOWB 1F55A 5D3OA 1WY9A 1AK8A 1XVJA 1Z2CB 2LUXA 2JPTA 3M0WA 1DQEA 2H61A 1WDCC 2PASA 3IQOA 4QJ4B 1JSAA 4PHMA 1DVIA 4MEWA 3BUMB 2JXCA 2L51A 3B87A 4WQ2A 1KK8B 5D69A 1C3YA 1S5GY 2FJYA 1KQMB 3D76A 1JWDA 4MLWA 2ISDA 1R2UA 1ZMZA 4GGNA 1TNWA 3VGOA 4CFRA 4MRXA 1Y1XA 1KFXS 4N1FA 3TS5B 1OQPA 4CIDA 4TNCA 3O2PA 1CDLA 3OX5A 3SG7A 1QX7A 2LLUA 1SYMA 2QEHA 3DVEA 4PALA 4YGAA 2LVJA 1ALWA 3N7HA 2Q91A 1C7WA 5CSIA 5HLVA 3D73A 4USLA 2ZN8A 1JBAA 3D77A 1N2DA 1L2OB 1NWDA 1SL7A 3O4XA 4INXA 3PATA 3TUYC 5B8IB 1IWQA 1A29A 5DKQA 3S0EA 2OS8C 3OX6A 1OOJA 2LUCA 1C3ZA 1OMVA 2BE6A 2M1KB 4YBHB 1BJFA 2BL0C 1CLMA 1EL4A 2K7DA 3BUOB 4JPZB 4OKHA 4ORAB 3R1VA 1TNXA 1PSRA 1A75A 2JTZA 2ZNDA 1JFJA 1SL9A 2I94A 1HT9A 2P71A 3I5FC 1YRTB 4HRGA 4PE1A 4PHNA 2KGRA 3GK4X 5GQQC 3Q8IA 1J7PA 1XO5A 1ORGA 3FIAA 2WCEA 4ZCUA 3VROA 1F8HA 1EXRA 1KK7Z 1YR5A 1Y0VH 2BNXA 3EKJA 1AVSA 3DY9A 3GK2A 3IVTA 5I2LA 1JC2A 1A75B 1XA5A 3KPXA 1K90D 1MHOA 2L0PA 1SSEB 3RZSA 4MBEA 3KHEA 3TUYB 5HLOA 5KSZA 1UHIA 1K95A 4DUQA 1DJZA 1W7JB 1J1DA 2KYFA 2L2EA 3K21A 2B1UA 2OS8B 2IS9A 4A4BA
chains in the Genus database with same CATH topology
1EG4A 4PHKA 4HSZA 1QJTA 4PE0A 3IF7A 1W7IB 1EG3A 2LANA 4YGBB 4C0KA 1NX1A 4DS7A 2KDHA 3A4UB 4UPGA 2F33A 1CLBA 2E30A 1BG1A 1NX0A 1F54A 3SIAA 1U5IA 2GGMA 3BYAA 3I5GC 1RFJA 2NCOA 2M8UA 3TDUA 1KFUS 2LLSA 1FW4A 1PVAA 2I18A 3I5IC 4GPLB 3SG3A 4JWQA 3VRRA 1CDNA 1ZUZA 1V1FA 3PN7C 4AQIA 5ER4X 2SCPA 2LHLA 1E8AA 2MJWB 5BPJA 2DOQA 1K94A 2MAZA 2BECA 4MSPA 3NSLA 2QPTA 1B8RA 3AAJA 5AXIA 1KSOA 3BQ3A 2KOTA 1U5IB 1SNLA 1V1GA 3EVUA 1BOCA 3PFVA 1SCMC 1HQVA 1ZACA 1J7QA 4ORBB 4MRYA 4AQJA 2LNKA 3WNXB 4BY5A 5K89A 1GGWA 1AJ5A 1J1EA 1PULA 3CGAA 2GGZA 1OE9B 2M29A 3FWBA 1FI6A 1FI5A 1SK6D 1M31A 1B8CA 1AHRA 1IG5A 1IKUA 4DRWA 1Y1UA 1CDPA 5HKZA 1YUUA 1NPQA 2QACA 3SIBA 1SCVA 1EH2A 2LVIA 4PDZA 1K2HA 3DVMA 1XFVO 2K7CA 2OTGC 1A2XA 1KQMC 4PCWA 3TZ1A 3I5GB 1FPWA 4QJ5B 2JNXA 3I5IB 3JVTB 2I2RE 3PN7B 1J7RA 1TTXA 4CFQA 3CLNA 2WORA 4YRUA 4AOMA 1UP5A 3C1VA 3PSRA 3TDIA 1GJYA 1YUTA 5CSFA 1YURA 4DCKA 1CFCA 2NCPA 4WRIA 1CFDA 1SL8A 1BR1B 2ZRTA 1L2OC 2HF5A 1QS7A 4L9MA 2KFHA 2O5GA 2F8PA 2L50A 3GK1A 5F6TA 3AKBA 2JT8A 4NDCA 3LCPC 1CFPA 1BR4B 1VRKA 2H2KA 3VRPA 2KI6C 1WLZA 2CBLA 1JUOA 1IH0A 4R1EA 4I5NB 4M2QA 1RK9A 4ZCVA 2OTGB 2JOJA 3MSEB 2KI4B 2EC6C 4N1GA 4OV2A 1K96A 4BY4A 1QX5B 1NUBA 3DD4A 2PALA 1KSMA 2KI6D 1CDMA 2FCEA 2K2AA 2M49B 1ALVA 1SKTA 2O60A 1TCFA 1JF2A 2M7NA 3NSOA 3OB2B 2LV7A 1K9UA 2TN4A 1UUSA 4NDBA 2HQWA 4MVFA 2BCBA 4GBAA 2NZ0A 1OSAA 1M39A 2RGIA 1QV1A 5HKWA 5AFPA 1QVIY 3PALA 1KWOC 5D7FA 2MA2A 4MN0A 1XFUO 2Y4QA 1F71A 1S6JA 5IBWA 5KU1A 3LK1A 1SR6B 2L98A 5CSJA 4I5LB 2L4HA 2L5XB 3LK0A 3LL8B 2KHNA 2WNDA 1UWOA 1YVLA 4PHJA 1Y1AA 4XYNA 1LVCD 3WHUB 1B7TY 1AP4A 3RLZA 1S5GZ 3ZWHA 2BKHB 2M1UA 3FS7A 1DF0A 2EC6B 1XFYO 3CR4X 3CTNA 1MQ1A 1DJWA 4DIRA 5I8NA 4YI9A 2KYCA 3QRXA 3RM1A 2BCAA 2FOTA 1M46A 2E6WA 1UHKA 2L4IA 1QV0A 1BF5A 1IRJA 2D8NA 1B8LA 1CM1A 2ZN9A 1CMGA 1KWOB 3H4SE 1H8BA 1DF0B 1YUSA 3OHMB 4PE7A 1UURA 2EHBA 2F2PA 2BE4A 1TRFA 2LP2A 2Y5IA 4ETOA 2JC2A 1QASA 4ORCB 2ZNEA 3EVRA 2JXLA 3ZNIA 3O78A 2PRUA 1TNPA 1KCYA 1MF8B 1J7OA 3O6BA 2KQYA 2KAXA 1DJIA 3JTDB 1BMOA 1BU3A 3JVTC 4FQOA 4C0LA 1CFFA 2F3ZA 1B9AA 4OVNF 2LVVA 1G4YR 3HCMA 3SG2A 1SMGA 4YGEB 1UHJA 1DT7B 1YX7A 2F2OA 1NX3A 2KGBC 5AEQA 1BLQA 1XYDA 3TDZA 1RJVA 3CZTX 1L7ZA 3SG5A 2NLNA 2BBNA 2BBMA 1CKKA 2M7LA 4OCIA 1S1EA 1UHHA 2KQ6A 1TCOB 2BKIB 2LMTA 1CB1A 1DJGA 2LE9B 4HREE 4OR9B 2WCFA 5DKNA 1YTZC 2LHIA 2KI4C 1NCZA 2CNPA 2PVBA 2CT9A 2KAVA 2JT0A 2JWWA 4YGCB 1ZFSA 1CMFA 2AUCA 4Q04A 1KQVA 2LLTA 2OPOA 4XJKA 3PLFB 3KF9A 3SG6A 3CWGA 3DF0A 1MWNA 1DJHA 1SBJA 1WRZA 2JRFA 4M2OA 1GQMA 2LCPA 1PSBA 2BCXA 3VRQA 4GGFA 4F0ZB 2JQ6A 2KBMA 1QATA 2NXQA 1SR6C 2M9GA 1R6PA 4ICBA 3E3RA 3WXAA 2MLEC 1IJ6A 4XJKB 1DJYA 3DF0B 2MHHA 1QLKA 1QXPA 2PSRA 1F70A 3DVKA 1A4PA 1BT6A 1M63B 2LP3A 1ODBA 1OZSA 3A8RA 1KFXL 2CTNA 1NSHA 2WC8A 1N65A 1WRLA 1G8IA 2LC5A 2ZFDA 3VRNA 1S6IA 4GNKB 1LKJA 1Y6WA 1CTRA 1N0YA 1AUIB 4CLNA 5FYXA 2Y1MA 3NXAA 2F3YA 1RECA 1SRAA 2JZIA 4GAOA 1RROA 4GUKA 3F45A 1B4CA 2WCBA 1Q80A 4WQ3A 5PALA 3CR2A 3EK8A 1ZOTB 3EVVA 2K7BA 1MR8A 1IJ5A 3WHTB 2A4JA 1F4OA 3IQQA 1CLLA 5HYDA 1LXFC 1QX2A 1CM4A 5I2OA 1KK7Y 2JU0A 2MRDA 3SG4A 1XFXO 1XK4C 1SPYA 2K61A 3D10A 3EKHA 1D1OA 4YGDB 1K8UA 3CS1A 4I5KA 5CPVA 3JTDC 4E68A 5KTYA 4MZLA 3OP0A 1M45A 2COLB 4IL1A 1JFKA 2PMYA 3EK7A 1NCYA 2LVKA 2FJUB 1YRUB 2EGDA 2VRGA 3O4YA 1QTXA 1WDCB 1GGZA 1QVIZ 1NCXA 1YX8A 2M3WA 5AERA 3DVJA 1XK4A 1DTLA 2HPSA 2SASA 2I7AA 2V53A 1FBVA 1K9PA 1NYAA 1UHNA 1S3PA 2CXJA 4D1EA 4NQGA 3HX4A 1QIVA 2K2FA 2JULA 5CSNA 5JOLA 1MXEA 2KSPA 1B7TZ 5J3XA 4CPVA 1DMOA 2ZKMX 3OB1B 3KEVA 1RTP1 1XFWO 1KFUL 2KNEA 4FTGA 1TOPA 2R2IA 1AJ4A 4P2YB 1OMDA 2K7OA 1WRKA 2HETA 2LMVA 1SY9A 1C7VA 2M97A 3BUXB 2MLFC 2LAPA 1B1GA 3AKAA 2BL0B 4A4CA 1K93D 4M2PA 1SW8A 5JJGA 4GFTA 4I5JA 1B47A 2FCDA 1IQ3A 1TN4A 1DGUA 2GV5A 3I5FB 1IGVA 1MUXA 1NP8A 1QIWA 2MBXA 1CNPA 4NDDA 2M0RA 1C07A 3AAKA 2JT3A 4MZKA 2Q4UA 5TNCA 2AAOA 3BXKA 1BODA 3BUNB 3EK4A 3KO0A 4GGFC 3I5HC 2HQ8A 3PM8A 4QJ3B 1FF1A 3FWCA 1YVHA 2KFGA 1EJ3A 1NIWA 1QLSA 1X02A 2LM5A 1MXLC 1PVBA 4JQ0D 2AMIA 2P6BB 2CCMA 1TIZA 1XFZO 1PALA 5AANA 1H4BA 1S26D 3BUWB 1TNQA 3LLEA 5I2QA 1K9KA 2WOSA 1OZOA 4N5XA 4U8DA 1LINA 1DGVA 1JF0A 2KBIA 5HKYA 1DJXA 1S36A 3D0YA 3NSIA 1KK8C 3CR5X 2K8MB 2K0JA 1S6CA 1PRWA 2LMUA 2JNFA 1IQ5A 3NSKA 3TS5C 1LA3A 1OMRA 4P5OE 1WLMA 4MZJA 3BOWA 4HRHA 5G08A 1PK0D 2H61C 2G9BA 1A03A 5DKRA 2G2BA 3SJSA 1LA0A 3I5HB 4PE4A 3D0YB 4C0JA 2KFFA 1J55A 5ER5A 1RWYA 1SCMB 1NX2A 3GOFA 3ICBA 2Y1NA 2ZRSA 4YI8A 1F4QA 1G33A 2JTTA 2KAYA 3BOWB 1F55A 1AK8A 1WY9A 1XVJA 2LUXA 2JPTA 3M0WA 2H61A 1WDCC 2PASA 3IQOA 4QJ4B 1JSAA 4PHMA 1DVIA 4MEWA 3BUMB 2JXCA 2L51A 4WQ2A 1KK8B 5D69A 1S5GY 1JWDA 1KQMB 4MLWA 2ISDA 1R2UA 1ZMZA 4GGNA 1TNWA 3VGOA 4CFRA 4MRXA 1Y1XA 1KFXS 4N1FA 3TS5B 1OQPA 4CIDA 4TNCA 3O2PA 1CDLA 3OX5A 3SG7A 1QX7A 2LLUA 1SYMA 3DVEA 4PALA 4YGAA 2LVJA 1ALWA 2Q91A 1C7WA 5CSIA 5HLVA 4USLA 2ZN8A 1JBAA 1N2DA 1L2OB 1NWDA 1SL7A 3PATA 3TUYC 5B8IB 1IWQA 1A29A 5DKQA 2OS8C 3OX6A 1OOJA 2LUCA 4YBHB 1OMVA 2BE6A 2M1KB 1BJFA 2BL0C 1CLMA 1EL4A 2K7DA 3BUOB 4JPZB 4OKHA 4ORAB 1TNXA 1PSRA 1A75A 2JTZA 2ZNDA 1JFJA 1SL9A 2I94A 1HT9A 3I5FC 1YRTB 4HRGA 4PE1A 4PHNA 2KGRA 3GK4X 5GQQC 1J7PA 1XO5A 3FIAA 2WCEA 4ZCUA 3VROA 1F8HA 1EXRA 1KK7Z 1YR5A 1Y0VH 3EKJA 3GK2A 1AVSA 5I2LA 1JC2A 1A75B 1XA5A 3KPXA 1K90D 1MHOA 2L0PA 4MBEA 3KHEA 3TUYB 5HLOA 5KSZA 1UHIA 1K95A 4DUQA 1DJZA 1W7JB 1J1DA 2KYFA 2L2EA 3K21A 2B1UA 2OS8B 2IS9A 4A4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG4 A;  4PHK A;  4HSZ A;  1QJT A;  4PE0 A;  3IF7 A;  1W7I B;  1EG3 A;  2LAN A;  4YGB B;  4C0K A;  1NX1 A;  4DS7 A;  2KDH A;  3A4U B;  4UPG A;  2F33 A;  1CLB A;  2E30 A;  1BG1 A;  1NX0 A;  1F54 A;  3SIA A;  1U5I A;  2GGM A;  3BYA A;  3I5G C;  1RFJ A;  2NCO A;  2M8U A;  3TDU A;  1KFU S;  2LLS A;  1FW4 A;  1PVA A;  2I18 A;  3I5I C;  4GPL B;  3SG3 A;  4JWQ A;  3VRR A;  1CDN A;  1ZUZ A;  1V1F A;  3PN7 C;  4AQI A;  5ER4 X;  2SCP A;  2LHL A;  1E8A A;  2MJW B;  5BPJ A;  2DOQ A;  1K94 A;  2MAZ A;  2BEC A;  4MSP A;  3NSL A;  2QPT A;  1B8R A;  3AAJ A;  5AXI A;  1KSO A;  3BQ3 A;  2KOT A;  1U5I B;  1SNL A;  1V1G A;  3EVU A;  1BOC A;  3PFV A;  1SCM C;  1HQV A;  1ZAC A;  1J7Q A;  4ORB B;  4MRY A;  4AQJ A;  2LNK A;  3WNX B;  4BY5 A;  5K89 A;  1GGW A;  1AJ5 A;  1J1E A;  1PUL A;  3CGA A;  2GGZ A;  1OE9 B;  2M29 A;  3FWB A;  1FI6 A;  1FI5 A;  1SK6 D;  1M31 A;  1B8C A;  1AHR A;  1IG5 A;  1IKU A;  4DRW A;  1Y1U A;  1CDP A;  5HKZ A;  1YUU A;  1NPQ A;  2QAC A;  3SIB A;  1SCV A;  1EH2 A;  2LVI A;  4PDZ A;  1K2H A;  3DVM A;  1XFV O;  2K7C A;  2OTG C;  1A2X A;  1KQM C;  4PCW A;  3TZ1 A;  3I5G B;  1FPW A;  4QJ5 B;  2JNX A;  3I5I B;  3JVT B;  2I2R E;  3PN7 B;  1J7R A;  1TTX A;  4CFQ A;  3CLN A;  2WOR A;  4YRU A;  4AOM A;  1UP5 A;  3C1V A;  3PSR A;  3TDI A;  1GJY A;  1YUT A;  5CSF A;  1YUR A;  4DCK A;  1CFC A;  2NCP A;  4WRI A;  1CFD A;  1SL8 A;  1BR1 B;  2ZRT A;  1L2O C;  2HF5 A;  1QS7 A;  4L9M A;  2KFH A;  2O5G A;  2F8P A;  2L50 A;  3GK1 A;  5F6T A;  3AKB A;  2JT8 A;  4NDC A;  3LCP C;  1CFP A;  1BR4 B;  1VRK A;  2H2K A;  3VRP A;  2KI6 C;  1WLZ A;  2CBL A;  1JUO A;  1IH0 A;  4R1E A;  4I5N B;  4M2Q A;  1RK9 A;  4ZCV A;  2OTG B;  2JOJ A;  3MSE B;  2KI4 B;  2EC6 C;  4N1G A;  4OV2 A;  1K96 A;  4BY4 A;  1QX5 B;  1NUB A;  3DD4 A;  2PAL A;  1KSM A;  2KI6 D;  1CDM A;  2FCE A;  2K2A A;  2M49 B;  1ALV A;  1SKT A;  2O60 A;  1TCF A;  1JF2 A;  2M7N A;  3NSO A;  3OB2 B;  2LV7 A;  1K9U A;  2TN4 A;  1UUS A;  4NDB A;  2HQW A;  4MVF A;  2BCB A;  4GBA A;  2NZ0 A;  1OSA A;  1M39 A;  2RGI A;  1QV1 A;  5HKW A;  5AFP A;  1QVI Y;  3PAL A;  1KWO C;  5D7F A;  2MA2 A;  4MN0 A;  1XFU O;  2Y4Q A;  1F71 A;  1S6J A;  5IBW A;  5KU1 A;  3LK1 A;  1SR6 B;  2L98 A;  5CSJ A;  4I5L B;  2L4H A;  2L5X B;  3LK0 A;  3LL8 B;  2KHN A;  2WND A;  1UWO A;  1YVL A;  4PHJ A;  1Y1A A;  4XYN A;  1LVC D;  3WHU B;  1B7T Y;  1AP4 A;  3RLZ A;  1S5G Z;  3ZWH A;  2BKH B;  2M1U A;  3FS7 A;  1DF0 A;  2EC6 B;  1XFY O;  3CR4 X;  3CTN A;  1MQ1 A;  1DJW A;  4DIR A;  5I8N A;  4YI9 A;  2KYC A;  3QRX A;  3RM1 A;  2BCA A;  2FOT A;  1M46 A;  2E6W A;  1UHK A;  2L4I A;  1QV0 A;  1BF5 A;  1IRJ A;  2D8N A;  1B8L A;  1CM1 A;  2ZN9 A;  1CMG A;  1KWO B;  3H4S E;  1H8B A;  1DF0 B;  1YUS A;  3OHM B;  4PE7 A;  1UUR A;  2EHB A;  2F2P A;  2BE4 A;  1TRF A;  2LP2 A;  2Y5I A;  4ETO A;  2JC2 A;  1QAS A;  4ORC B;  2ZNE A;  3EVR A;  2JXL A;  3ZNI A;  3O78 A;  2PRU A;  1TNP A;  1KCY A;  1MF8 B;  1J7O A;  3O6B A;  2KQY A;  2KAX A;  1DJI A;  3JTD B;  1BMO A;  1BU3 A;  3JVT C;  4FQO A;  4C0L A;  1CFF A;  2F3Z A;  1B9A A;  4OVN F;  2LVV A;  1G4Y R;  3HCM A;  3SG2 A;  1SMG A;  4YGE B;  1UHJ A;  1DT7 B;  1YX7 A;  2F2O A;  1NX3 A;  2KGB C;  5AEQ A;  1BLQ A;  1XYD A;  3TDZ A;  1RJV A;  3CZT X;  1L7Z A;  3SG5 A;  2NLN A;  2BBN A;  2BBM A;  1CKK A;  2M7L A;  4OCI A;  1S1E A;  1UHH A;  2KQ6 A;  1TCO B;  2BKI B;  2LMT A;  1CB1 A;  1DJG A;  2LE9 B;  4HRE E;  4OR9 B;  2WCF A;  5DKN A;  1YTZ C;  2LHI A;  2KI4 C;  1NCZ A;  2CNP A;  2PVB A;  2CT9 A;  2KAV A;  2JT0 A;  2JWW A;  4YGC B;  1ZFS A;  1CMF A;  2AUC A;  4Q04 A;  1KQV A;  2LLT A;  2OPO A;  4XJK A;  3PLF B;  3KF9 A;  3SG6 A;  3CWG A;  3DF0 A;  1MWN A;  1DJH A;  1SBJ A;  1WRZ A;  2JRF A;  4M2O A;  1GQM A;  2LCP A;  1PSB A;  2BCX A;  3VRQ A;  4GGF A;  4F0Z B;  2JQ6 A;  2KBM A;  1QAT A;  2NXQ A;  1SR6 C;  2M9G A;  1R6P A;  4ICB A;  3E3R A;  3WXA A;  2MLE C;  1IJ6 A;  4XJK B;  1DJY A;  3DF0 B;  2MHH A;  1QLK A;  1QXP A;  2PSR A;  1F70 A;  3DVK A;  1A4P A;  1BT6 A;  1M63 B;  2LP3 A;  1ODB A;  1OZS A;  3A8R A;  1KFX L;  2CTN A;  1NSH A;  2WC8 A;  1N65 A;  1WRL A;  1G8I A;  2LC5 A;  2ZFD A;  3VRN A;  1S6I A;  4GNK B;  1LKJ A;  1Y6W A;  1CTR A;  1N0Y A;  1AUI B;  4CLN A;  5FYX A;  2Y1M A;  3NXA A;  2F3Y A;  1REC A;  1SRA A;  2JZI A;  4GAO A;  1RRO A;  4GUK A;  3F45 A;  1B4C A;  2WCB A;  1Q80 A;  4WQ3 A;  5PAL A;  3CR2 A;  3EK8 A;  1ZOT B;  3EVV A;  2K7B A;  1MR8 A;  1IJ5 A;  3WHT B;  2A4J A;  1F4O A;  3IQQ A;  1CLL A;  5HYD A;  1LXF C;  1QX2 A;  1CM4 A;  5I2O A;  1KK7 Y;  2JU0 A;  2MRD A;  3SG4 A;  1XFX O;  1XK4 C;  1SPY A;  2K61 A;  3D10 A;  3EKH A;  1D1O A;  4YGD B;  1K8U A;  3CS1 A;  4I5K A;  5CPV A;  3JTD C;  4E68 A;  5KTY A;  4MZL A;  3OP0 A;  1M45 A;  2COL B;  4IL1 A;  1JFK A;  2PMY A;  3EK7 A;  1NCY A;  2LVK A;  2FJU B;  1YRU B;  2EGD A;  2VRG A;  3O4Y A;  1QTX A;  1WDC B;  1GGZ A;  1QVI Z;  1NCX A;  1YX8 A;  2M3W A;  5AER A;  3DVJ A;  1XK4 A;  1DTL A;  2HPS A;  2SAS A;  2I7A A;  2V53 A;  1FBV A;  1K9P A;  1NYA A;  1UHN A;  1S3P A;  2CXJ A;  4D1E A;  4NQG A;  3HX4 A;  1QIV A;  2K2F A;  2JUL A;  5CSN A;  5JOL A;  1MXE A;  2KSP A;  1B7T Z;  5J3X A;  4CPV A;  1DMO A;  2ZKM X;  3OB1 B;  3KEV A;  1RTP 1;  1XFW O;  1KFU L;  2KNE A;  4FTG A;  1TOP A;  2R2I A;  1AJ4 A;  4P2Y B;  1OMD A;  2K7O A;  1WRK A;  2HET A;  2LMV A;  1SY9 A;  1C7V A;  2M97 A;  3BUX B;  2MLF C;  2LAP A;  1B1G A;  3AKA A;  2BL0 B;  4A4C A;  1K93 D;  4M2P A;  1SW8 A;  5JJG A;  4GFT A;  4I5J A;  1B47 A;  2FCD A;  1IQ3 A;  1TN4 A;  1DGU A;  2GV5 A;  3I5F B;  1IGV A;  1MUX A;  1NP8 A;  1QIW A;  2MBX A;  1CNP A;  4NDD A;  2M0R A;  1C07 A;  3AAK A;  2JT3 A;  4MZK A;  2Q4U A;  5TNC A;  2AAO A;  3BXK A;  1BOD A;  3BUN B;  3EK4 A;  3KO0 A;  4GGF C;  3I5H C;  2HQ8 A;  3PM8 A;  4QJ3 B;  1FF1 A;  3FWC A;  1YVH A;  2KFG A;  1EJ3 A;  1NIW A;  1QLS A;  1X02 A;  2LM5 A;  1MXL C;  1PVB A;  4JQ0 D;  2AMI A;  2P6B B;  2CCM A;  1TIZ A;  1XFZ O;  1PAL A;  5AAN A;  1H4B A;  1S26 D;  3BUW B;  1TNQ A;  3LLE A;  5I2Q A;  1K9K A;  2WOS A;  1OZO A;  4N5X A;  4U8D A;  1LIN A;  1DGV A;  1JF0 A;  2KBI A;  5HKY A;  1DJX A;  1S36 A;  3D0Y A;  3NSI A;  1KK8 C;  3CR5 X;  2K8M B;  2K0J A;  1S6C A;  1PRW A;  2LMU A;  2JNF A;  1IQ5 A;  3NSK A;  3TS5 C;  1LA3 A;  1OMR A;  4P5O E;  1WLM A;  4MZJ A;  3BOW A;  4HRH A;  5G08 A;  1PK0 D;  2H61 C;  2G9B A;  1A03 A;  5DKR A;  2G2B A;  3SJS A;  1LA0 A;  3I5H B;  4PE4 A;  3D0Y B;  4C0J A;  2KFF A;  1J55 A;  5ER5 A;  1RWY A;  1SCM B;  1NX2 A;  3GOF A;  3ICB A;  2Y1N A;  2ZRS A;  4YI8 A;  1F4Q A;  1G33 A;  2JTT A;  2KAY A;  3BOW B;  1F55 A;  1AK8 A;  1WY9 A;  1XVJ A;  2LUX A;  2JPT A;  3M0W A;  2H61 A;  1WDC C;  2PAS A;  3IQO A;  4QJ4 B;  1JSA A;  4PHM A;  1DVI A;  4MEW A;  3BUM B;  2JXC A;  2L51 A;  4WQ2 A;  1KK8 B;  5D69 A;  1S5G Y;  1JWD A;  1KQM B;  4MLW A;  2ISD A;  1R2U A;  1ZMZ A;  4GGN A;  1TNW A;  3VGO A;  4CFR A;  4MRX A;  1Y1X A;  1KFX S;  4N1F A;  3TS5 B;  1OQP A;  4CID A;  4TNC A;  3O2P A;  1CDL A;  3OX5 A;  3SG7 A;  1QX7 A;  2LLU A;  1SYM A;  3DVE A;  4PAL A;  4YGA A;  2LVJ A;  1ALW A;  2Q91 A;  1C7W A;  5CSI A;  5HLV A;  4USL A;  2ZN8 A;  1JBA A;  1N2D A;  1L2O B;  1NWD A;  1SL7 A;  3PAT A;  3TUY C;  5B8I B;  1IWQ A;  1A29 A;  5DKQ A;  2OS8 C;  3OX6 A;  1OOJ A;  2LUC A;  4YBH B;  1OMV A;  2BE6 A;  2M1K B;  1BJF A;  2BL0 C;  1CLM A;  1EL4 A;  2K7D A;  3BUO B;  4JPZ B;  4OKH A;  4ORA B;  1TNX A;  1PSR A;  1A75 A;  2JTZ A;  2ZND A;  1JFJ A;  1SL9 A;  2I94 A;  1HT9 A;  3I5F C;  1YRT B;  4HRG A;  4PE1 A;  4PHN A;  2KGR A;  3GK4 X;  5GQQ C;  1J7P A;  1XO5 A;  3FIA A;  2WCE A;  4ZCU A;  3VRO A;  1F8H A;  1EXR A;  1KK7 Z;  1YR5 A;  1Y0V H;  3EKJ A;  3GK2 A;  1AVS A;  5I2L A;  1JC2 A;  1A75 B;  1XA5 A;  3KPX A;  1K90 D;  1MHO A;  2L0P A;  4MBE A;  3KHE A;  3TUY B;  5HLO A;  5KSZ A;  1UHI A;  1K95 A;  4DUQ A;  1DJZ A;  1W7J B;  1J1D A;  2KYF A;  2L2E A;  3K21 A;  2B1U A;  2OS8 B;  2IS9 A;  4A4B A; 
#chains in the Genus database with same CATH topology
 1EG4 A;  4PHK A;  4HSZ A;  1QJT A;  4PE0 A;  3FE8 A;  3IF7 A;  1W7I B;  1EG3 A;  2LAN A;  4YGB B;  4C0K A;  1NX1 A;  3PM2 A;  2KDH A;  3A4U B;  4DS7 A;  2F33 A;  4UPG A;  5I94 A;  1CLB A;  2E30 A;  1BG1 A;  1NX0 A;  5FI6 A;  1F54 A;  3SIA A;  1U5I A;  2GGM A;  3BYA A;  3I5G C;  1RFJ A;  2NCO A;  2M8U A;  5DIC A;  3TDU A;  1KFU S;  2LLS A;  1FW4 A;  1PVA A;  2I18 A;  3I5I C;  4GPL B;  3SG3 A;  4JWQ A;  3VRR A;  1CDN A;  1ZUZ A;  1V1F A;  3PN7 C;  4AQI A;  5ER4 X;  2SCP A;  2LHL A;  1E8A A;  2MJW B;  5BPJ A;  2DOQ A;  1K94 A;  2MAZ A;  2BEC A;  4MSP A;  3NSL A;  2QPT A;  1B8R A;  3AAJ A;  5AXI A;  1KSO A;  3BQ3 A;  2KOT A;  1U5I B;  1SNL A;  1V1G A;  3EVU A;  1BOC A;  3PFV A;  1SCM C;  1HQV A;  1ZAC A;  1J7Q A;  4ORB B;  3D75 A;  4MRY A;  2LNK A;  3WNX B;  4AQJ A;  4BY5 A;  3CDN A;  5K89 A;  1AJ5 A;  1J1E A;  1PUL A;  3CGA A;  2GGZ A;  1GGW A;  1OE9 B;  2M29 A;  3FWB A;  1FI6 A;  2WC6 A;  1FI5 A;  1SK6 D;  1M31 A;  1B8C A;  1AHR A;  1IG5 A;  3CAB A;  3QME A;  4DRW A;  1IKU A;  1Y1U A;  1CDP A;  5HKZ A;  1YUU A;  1NPQ A;  2QAC A;  3SIB A;  1SCV A;  1EH2 A;  1OOG A;  1W9Z A;  2LVI A;  4PDZ A;  1K2H A;  3DVM A;  1XFV O;  2K7C A;  2OTG C;  1A2X A;  1KQM C;  3DXL A;  4PCW A;  3TZ1 A;  3I5G B;  1FPW A;  4QJ5 B;  3DYE A;  2JNX A;  3I5I B;  3JVT B;  3CZ2 A;  2I2R E;  2PQL A;  3PN7 B;  1J7R A;  3FE6 A;  1TTX A;  4CFQ A;  3CLN A;  2WOR A;  4YRU A;  3FE9 A;  4AOM A;  5FI2 A;  1UP5 A;  3C1V A;  3B6X A;  3PSR A;  3TDI A;  1GJY A;  1YUT A;  3L4A A;  1YUR A;  5CSF A;  4DCK A;  1CFC A;  2NCP A;  4WRI A;  1CFD A;  1SL8 A;  1BR1 B;  2GTE A;  2ZRT A;  1L2O C;  2HF5 A;  1QS7 A;  2WCH A;  2KFH A;  4L9M A;  2O5G A;  2F8P A;  2L50 A;  3GK1 A;  5F6T A;  3S0B A;  3AKB A;  1TUJ A;  2JT8 A;  4NDC A;  3LCP C;  1CFP A;  1BR4 B;  1VRK A;  2H2K A;  3VRP A;  2KI6 C;  1WLZ A;  2CBL A;  1JUO A;  3SS5 A;  1IH0 A;  4R1E A;  4I5N B;  4M2Q A;  1RK9 A;  3BFB A;  4ZCV A;  2OTG B;  3SS3 A;  2P70 A;  2JOJ A;  3MSE B;  2KI4 B;  2EC6 C;  4N1G A;  4OV2 A;  1K96 A;  3DZT A;  4BY4 A;  1QX5 B;  1NUB A;  3DD4 A;  2PAL A;  1KSM A;  2KI6 D;  1CDM A;  2FCE A;  2K2A A;  2M49 B;  1ALV A;  1SKT A;  2O60 A;  4OZD A;  1TCF A;  1JF2 A;  2M7N A;  1DEL A;  3CYZ A;  1LS8 A;  3NSO A;  3OB2 B;  2LV7 A;  1K9U A;  1QWV A;  2TN4 A;  1UUS A;  4NDB A;  2HQW A;  4MVF A;  2BCB A;  3BFH A;  2NZ0 A;  1OSA A;  4GBA A;  1M39 A;  2RGI A;  1QV1 A;  5HKW A;  5AFP A;  1QVI Y;  3PAL A;  1KWO C;  5D7F A;  2MA2 A;  4MN0 A;  1XFU O;  2Y4Q A;  1F71 A;  1S6J A;  5IBW A;  5KU1 A;  3LK1 A;  1SR6 B;  2L98 A;  5CSJ A;  4I5L B;  2L4H A;  2WCM A;  2L5X B;  3LK0 A;  3LL8 B;  2KHN A;  2WND A;  1UWO A;  1YVL A;  4PHJ A;  1Y1A A;  4XYN A;  1LVC D;  3WHU B;  1B7T Y;  1AP4 A;  3RLZ A;  3BJH A;  4JD9 A;  1S5G Z;  2ERB A;  3ZWH A;  2BKH B;  2M1U A;  3FS7 A;  1DF0 A;  2EC6 B;  1XFY O;  3CR4 X;  3CTN A;  1MQ1 A;  3L4L A;  1DJW A;  4DIR A;  5I8N A;  4YI9 A;  2KYC A;  3QRX A;  3RM1 A;  2BCA A;  2FOT A;  1M46 A;  2E6W A;  1UHK A;  2L4I A;  1QV0 A;  2L5Y A;  1BF5 A;  1IRJ A;  3B7A A;  2D8N A;  1B8L A;  1CM1 A;  2ZN9 A;  2QEO A;  1CMG A;  1KWO B;  3H4S E;  1H8B A;  1DF0 B;  1YUS A;  3OHM B;  4PE7 A;  1UUR A;  4JKT A;  2EHB A;  2F2P A;  3K1E A;  2BE4 A;  1TRF A;  2LP2 A;  2Y5I A;  4ETO A;  2JC2 A;  1QAS A;  4ORC B;  2ZNE A;  3EVR A;  2JXL A;  3B88 A;  3ZNI A;  3O78 A;  2PRU A;  1TNP A;  1KCY A;  1MF8 B;  3CZ1 A;  1J7O A;  3O6B A;  2KQY A;  2KAX A;  1DJI A;  3JTD B;  1BMO A;  1BU3 A;  3JVT C;  4FQO A;  4C0L A;  1CFF A;  2F3Z A;  1B9A A;  2QEB A;  4OVN F;  2LVV A;  2YGU A;  1G4Y R;  3HCM A;  3SG2 A;  1SMG A;  4YGE B;  1UHJ A;  1DT7 B;  1YX7 A;  2WCL A;  2F2O A;  1NX3 A;  2KGB C;  4INW A;  5AEQ A;  1BLQ A;  1XYD A;  3TDZ A;  1RJV A;  3NGV A;  3V2L A;  3CZT X;  1L7Z A;  3NHT A;  3SG5 A;  2NLN A;  2BBN A;  2BBM A;  1CKK A;  2M7L A;  4OCI A;  1S1E A;  1UHH A;  2KQ6 A;  1TCO B;  2BKI B;  2LMT A;  1CB1 A;  1DJG A;  2LE9 B;  4HRE E;  4OR9 B;  1OOI X;  3R1P A;  2WCF A;  5DKN A;  1YTZ C;  2LHI A;  2KI4 C;  1NCZ A;  2CNP A;  2PVB A;  2CT9 A;  2KAV A;  2JT0 A;  2JWW A;  4YGC B;  1ZFS A;  1CMF A;  2AUC A;  4Q04 A;  1KQV A;  2LLT A;  2OPO A;  4XJK A;  3PLF B;  3KF9 A;  3SG6 A;  5HL1 A;  3CWG A;  3DF0 A;  1MWN A;  1DJH A;  1SBJ A;  1WRZ A;  2JRF A;  4M2O A;  1GQM A;  2LCP A;  1PSB A;  3NHI A;  2BCX A;  1TWO A;  3VRQ A;  4GGF A;  4F0Z B;  2JQ6 A;  2KBM A;  1QAT A;  2NXQ A;  2WC5 A;  1SR6 C;  4F7F A;  2KLD A;  2M9G A;  1R6P A;  4PT1 A;  4ICB A;  3E3R A;  3WXA A;  2MLE C;  1IJ6 A;  4XJK B;  1DJY A;  3S0F A;  3DF0 B;  2MHH A;  1QLK A;  3S0G A;  1QXP A;  2K60 A;  2PSR A;  1F70 A;  3DVK A;  1A4P A;  3D78 A;  1BT6 A;  1M63 B;  2LP3 A;  1ODB A;  1OZS A;  3A8R A;  1KFX L;  3UO9 A;  2CTN A;  1NSH A;  2WC8 A;  1TUZ A;  1N65 A;  1WRL A;  2KLE A;  1G8I A;  2LC5 A;  2ZFD A;  3VRN A;  3VB1 A;  1S6I A;  4GNK B;  1LKJ A;  1Y6W A;  1Z4H A;  1CTR A;  1N0Y A;  1AUI B;  4CLN A;  5FYX A;  2L2C A;  2Y1M A;  1P28 A;  3NXA A;  3D74 A;  2F3Y A;  1REC A;  1SRA A;  2JZI A;  4KYN A;  4GAO A;  1RRO A;  4GUK A;  3OGN A;  3F45 A;  1B4C A;  2WCB A;  1Q80 A;  4WQ3 A;  1OOH A;  3CR2 A;  5PAL A;  3EK8 A;  1ZOT B;  3EVV A;  2K7B A;  1MR8 A;  1IJ5 A;  3WHT B;  2A4J A;  3S0A A;  1F4O A;  1IIO A;  3S0D A;  3IQQ A;  1CLL A;  5HYD A;  1LXF C;  1QX2 A;  1CM4 A;  5I2O A;  1KK7 Y;  3OBV A;  2QEV A;  4FQT A;  2JU0 A;  2MRD A;  3PJI A;  3SS4 A;  3CZ0 A;  3SG4 A;  1XFX O;  1XK4 C;  1SPY A;  2K61 A;  3D10 A;  3EKH A;  1D1O A;  4YGD B;  1K8U A;  3CS1 A;  4I5K A;  5CPV A;  3JTD C;  2JPO A;  3L47 A;  5EL2 A;  5KTY A;  4MZL A;  4E68 A;  3OP0 A;  1M45 A;  2COL B;  4IL1 A;  1JFK A;  2PMY A;  3EK7 A;  1NCY A;  3R1O A;  2LVK A;  2FJU B;  1YRU B;  2EGD A;  2VRG A;  3BFA A;  3O4Y A;  1QTX A;  1WDC B;  1DEK A;  1GGZ A;  1NCX A;  1QVI Z;  1YX8 A;  2M3W A;  5AER A;  3DVJ A;  1XK4 A;  1DTL A;  2HPS A;  2SAS A;  2I7A A;  2V53 A;  1FBV A;  2H8V A;  1T14 A;  1K9P A;  2WCJ A;  1NYA A;  5FI7 A;  1UHN A;  1S3P A;  2CXJ A;  4D1E A;  4NQG A;  3HX4 A;  1QIV A;  2K2F A;  2JUL A;  5CSN A;  5JOL A;  1MXE A;  2BAP A;  2KSP A;  1B7T Z;  5J3X A;  4CPV A;  1DMO A;  2ZKM X;  3OB1 B;  2WCK A;  3KEV A;  1RTP 1;  1XFW O;  1KFU L;  2KNE A;  4FTG A;  1TOP A;  2R2I A;  1AJ4 A;  4P2Y B;  1OMD A;  2K7O A;  1WRK A;  2HET A;  2LMV A;  1SY9 A;  1C7V A;  2M97 A;  3BUX B;  2MLF C;  2LAP A;  1B1G A;  3AKA A;  2BL0 B;  4A4C A;  1K93 D;  4M2P A;  1SW8 A;  5JJG A;  2PYQ A;  4GFT A;  1XFR A;  1GM0 A;  4I5J A;  1B47 A;  2FCD A;  1IQ3 A;  1TN4 A;  1DGU A;  2GV5 A;  3I5F B;  1IGV A;  1MUX A;  2QDI A;  1NP8 A;  1QIW A;  2MBX A;  1CNP A;  4NDD A;  2M0R A;  1C07 A;  3AAK A;  2JT3 A;  4MZK A;  2Q4U A;  5TNC A;  2AAO A;  3BXK A;  2KPH A;  1BOD A;  3BUN B;  3EK4 A;  3KO0 A;  1OOF A;  4GGF C;  3I5H C;  2HQ8 A;  3PM8 A;  4QJ3 B;  1FF1 A;  3FWC A;  1YVH A;  2KFG A;  3EG5 B;  1EJ3 A;  1NIW A;  1QLS A;  1X02 A;  2LM5 A;  1MXL C;  1PVB A;  4JQ0 D;  2AMI A;  2P6B B;  2CCM A;  1TIZ A;  1XFZ O;  1PAL A;  5AAN A;  1H4B A;  1S26 D;  3BUW B;  1TNQ A;  3LLE A;  5I2Q A;  1K9K A;  2WOS A;  1OZO A;  4N5X A;  4U8D A;  1LIN A;  1DGV A;  1JF0 A;  4IJ7 A;  2KBI A;  5HKY A;  1DC1 A;  1DJX A;  1S36 A;  3D0Y A;  3NSI A;  1KK8 C;  3CR5 X;  1OW4 A;  2K8M B;  2K0J A;  3UNW A;  1S6C A;  1PRW A;  2LMU A;  2JNF A;  1IQ5 A;  3NSK A;  3TS5 C;  1LA3 A;  1OMR A;  4P5O E;  1WLM A;  4MZJ A;  3BOW A;  4HRH A;  3R72 A;  5G08 A;  1PK0 D;  2H61 C;  2G9B A;  1A03 A;  5DKR A;  2G2B A;  3SJS A;  1LA0 A;  3B86 A;  3I5H B;  3D0Y B;  4PE4 A;  4C0J A;  2KFF A;  1J55 A;  5ER5 A;  1RWY A;  1SCM B;  1NX2 A;  3GOF A;  3ICB A;  2Y1N A;  2ZRS A;  4YI8 A;  1F4Q A;  1G33 A;  2JTT A;  2KAY A;  3BOW B;  1F55 A;  5D3O A;  1WY9 A;  1AK8 A;  1XVJ A;  1Z2C B;  2LUX A;  2JPT A;  3M0W A;  1DQE A;  2H61 A;  1WDC C;  2PAS A;  3IQO A;  4QJ4 B;  1JSA A;  4PHM A;  1DVI A;  4MEW A;  3BUM B;  2JXC A;  2L51 A;  3B87 A;  4WQ2 A;  1KK8 B;  5D69 A;  1C3Y A;  1S5G Y;  2FJY A;  1KQM B;  3D76 A;  1JWD A;  4MLW A;  2ISD A;  1R2U A;  1ZMZ A;  4GGN A;  1TNW A;  3VGO A;  4CFR A;  4MRX A;  1Y1X A;  1KFX S;  4N1F A;  3TS5 B;  1OQP A;  4CID A;  4TNC A;  3O2P A;  1CDL A;  3OX5 A;  3SG7 A;  1QX7 A;  2LLU A;  1SYM A;  2QEH A;  3DVE A;  4PAL A;  4YGA A;  2LVJ A;  1ALW A;  3N7H A;  2Q91 A;  1C7W A;  5CSI A;  5HLV A;  3D73 A;  4USL A;  2ZN8 A;  1JBA A;  3D77 A;  1N2D A;  1L2O B;  1NWD A;  1SL7 A;  3O4X A;  4INX A;  3PAT A;  3TUY C;  5B8I B;  1IWQ A;  1A29 A;  5DKQ A;  3S0E A;  2OS8 C;  3OX6 A;  1OOJ A;  2LUC A;  1C3Z A;  1OMV A;  2BE6 A;  2M1K B;  4YBH B;  1BJF A;  2BL0 C;  1CLM A;  1EL4 A;  2K7D A;  3BUO B;  4JPZ B;  4OKH A;  4ORA B;  3R1V A;  1TNX A;  1PSR A;  1A75 A;  2JTZ A;  2ZND A;  1JFJ A;  1SL9 A;  2I94 A;  1HT9 A;  2P71 A;  3I5F C;  1YRT B;  4HRG A;  4PE1 A;  4PHN A;  2KGR A;  3GK4 X;  5GQQ C;  3Q8I A;  1J7P A;  1XO5 A;  1ORG A;  3FIA A;  2WCE A;  4ZCU A;  3VRO A;  1F8H A;  1EXR A;  1KK7 Z;  1YR5 A;  1Y0V H;  2BNX A;  3EKJ A;  1AVS A;  3DY9 A;  3GK2 A;  3IVT A;  5I2L A;  1JC2 A;  1A75 B;  1XA5 A;  3KPX A;  1K90 D;  1MHO A;  2L0P A;  1SSE B;  3RZS A;  4MBE A;  3KHE A;  3TUY B;  5HLO A;  5KSZ A;  1UHI A;  1K95 A;  4DUQ A;  1DJZ A;  1W7J B;  1J1D A;  2KYF A;  2L2E A;  3K21 A;  2B1U A;  2OS8 B;  2IS9 A;  4A4B A; 
#chains in the Genus database with same CATH homology
 1EG4 A;  4PHK A;  4HSZ A;  1QJT A;  4PE0 A;  3IF7 A;  1W7I B;  1EG3 A;  2LAN A;  4YGB B;  4C0K A;  1NX1 A;  4DS7 A;  2KDH A;  3A4U B;  4UPG A;  2F33 A;  1CLB A;  2E30 A;  1BG1 A;  1NX0 A;  1F54 A;  3SIA A;  1U5I A;  2GGM A;  3BYA A;  3I5G C;  1RFJ A;  2NCO A;  2M8U A;  3TDU A;  1KFU S;  2LLS A;  1FW4 A;  1PVA A;  2I18 A;  3I5I C;  4GPL B;  3SG3 A;  4JWQ A;  3VRR A;  1CDN A;  1ZUZ A;  1V1F A;  3PN7 C;  4AQI A;  5ER4 X;  2SCP A;  2LHL A;  1E8A A;  2MJW B;  5BPJ A;  2DOQ A;  1K94 A;  2MAZ A;  2BEC A;  4MSP A;  3NSL A;  2QPT A;  1B8R A;  3AAJ A;  5AXI A;  1KSO A;  3BQ3 A;  2KOT A;  1U5I B;  1SNL A;  1V1G A;  3EVU A;  1BOC A;  3PFV A;  1SCM C;  1HQV A;  1ZAC A;  1J7Q A;  4ORB B;  4MRY A;  4AQJ A;  2LNK A;  3WNX B;  4BY5 A;  5K89 A;  1GGW A;  1AJ5 A;  1J1E A;  1PUL A;  3CGA A;  2GGZ A;  1OE9 B;  2M29 A;  3FWB A;  1FI6 A;  1FI5 A;  1SK6 D;  1M31 A;  1B8C A;  1AHR A;  1IG5 A;  1IKU A;  4DRW A;  1Y1U A;  1CDP A;  5HKZ A;  1YUU A;  1NPQ A;  2QAC A;  3SIB A;  1SCV A;  1EH2 A;  2LVI A;  4PDZ A;  1K2H A;  3DVM A;  1XFV O;  2K7C A;  2OTG C;  1A2X A;  1KQM C;  4PCW A;  3TZ1 A;  3I5G B;  1FPW A;  4QJ5 B;  2JNX A;  3I5I B;  3JVT B;  2I2R E;  3PN7 B;  1J7R A;  1TTX A;  4CFQ A;  3CLN A;  2WOR A;  4YRU A;  4AOM A;  1UP5 A;  3C1V A;  3PSR A;  3TDI A;  1GJY A;  1YUT A;  5CSF A;  1YUR A;  4DCK A;  1CFC A;  2NCP A;  4WRI A;  1CFD A;  1SL8 A;  1BR1 B;  2ZRT A;  1L2O C;  2HF5 A;  1QS7 A;  4L9M A;  2KFH A;  2O5G A;  2F8P A;  2L50 A;  3GK1 A;  5F6T A;  3AKB A;  2JT8 A;  4NDC A;  3LCP C;  1CFP A;  1BR4 B;  1VRK A;  2H2K A;  3VRP A;  2KI6 C;  1WLZ A;  2CBL A;  1JUO A;  1IH0 A;  4R1E A;  4I5N B;  4M2Q A;  1RK9 A;  4ZCV A;  2OTG B;  2JOJ A;  3MSE B;  2KI4 B;  2EC6 C;  4N1G A;  4OV2 A;  1K96 A;  4BY4 A;  1QX5 B;  1NUB A;  3DD4 A;  2PAL A;  1KSM A;  2KI6 D;  1CDM A;  2FCE A;  2K2A A;  2M49 B;  1ALV A;  1SKT A;  2O60 A;  1TCF A;  1JF2 A;  2M7N A;  3NSO A;  3OB2 B;  2LV7 A;  1K9U A;  2TN4 A;  1UUS A;  4NDB A;  2HQW A;  4MVF A;  2BCB A;  4GBA A;  2NZ0 A;  1OSA A;  1M39 A;  2RGI A;  1QV1 A;  5HKW A;  5AFP A;  1QVI Y;  3PAL A;  1KWO C;  5D7F A;  2MA2 A;  4MN0 A;  1XFU O;  2Y4Q A;  1F71 A;  1S6J A;  5IBW A;  5KU1 A;  3LK1 A;  1SR6 B;  2L98 A;  5CSJ A;  4I5L B;  2L4H A;  2L5X B;  3LK0 A;  3LL8 B;  2KHN A;  2WND A;  1UWO A;  1YVL A;  4PHJ A;  1Y1A A;  4XYN A;  1LVC D;  3WHU B;  1B7T Y;  1AP4 A;  3RLZ A;  1S5G Z;  3ZWH A;  2BKH B;  2M1U A;  3FS7 A;  1DF0 A;  2EC6 B;  1XFY O;  3CR4 X;  3CTN A;  1MQ1 A;  1DJW A;  4DIR A;  5I8N A;  4YI9 A;  2KYC A;  3QRX A;  3RM1 A;  2BCA A;  2FOT A;  1M46 A;  2E6W A;  1UHK A;  2L4I A;  1QV0 A;  1BF5 A;  1IRJ A;  2D8N A;  1B8L A;  1CM1 A;  2ZN9 A;  1CMG A;  1KWO B;  3H4S E;  1H8B A;  1DF0 B;  1YUS A;  3OHM B;  4PE7 A;  1UUR A;  2EHB A;  2F2P A;  2BE4 A;  1TRF A;  2LP2 A;  2Y5I A;  4ETO A;  2JC2 A;  1QAS A;  4ORC B;  2ZNE A;  3EVR A;  2JXL A;  3ZNI A;  3O78 A;  2PRU A;  1TNP A;  1KCY A;  1MF8 B;  1J7O A;  3O6B A;  2KQY A;  2KAX A;  1DJI A;  3JTD B;  1BMO A;  1BU3 A;  3JVT C;  4FQO A;  4C0L A;  1CFF A;  2F3Z A;  1B9A A;  4OVN F;  2LVV A;  1G4Y R;  3HCM A;  3SG2 A;  1SMG A;  4YGE B;  1UHJ A;  1DT7 B;  1YX7 A;  2F2O A;  1NX3 A;  2KGB C;  5AEQ A;  1BLQ A;  1XYD A;  3TDZ A;  1RJV A;  3CZT X;  1L7Z A;  3SG5 A;  2NLN A;  2BBN A;  2BBM A;  1CKK A;  2M7L A;  4OCI A;  1S1E A;  1UHH A;  2KQ6 A;  1TCO B;  2BKI B;  2LMT A;  1CB1 A;  1DJG A;  2LE9 B;  4HRE E;  4OR9 B;  2WCF A;  5DKN A;  1YTZ C;  2LHI A;  2KI4 C;  1NCZ A;  2CNP A;  2PVB A;  2CT9 A;  2KAV A;  2JT0 A;  2JWW A;  4YGC B;  1ZFS A;  1CMF A;  2AUC A;  4Q04 A;  1KQV A;  2LLT A;  2OPO A;  4XJK A;  3PLF B;  3KF9 A;  3SG6 A;  3CWG A;  3DF0 A;  1MWN A;  1DJH A;  1SBJ A;  1WRZ A;  2JRF A;  4M2O A;  1GQM A;  2LCP A;  1PSB A;  2BCX A;  3VRQ A;  4GGF A;  4F0Z B;  2JQ6 A;  2KBM A;  1QAT A;  2NXQ A;  1SR6 C;  2M9G A;  1R6P A;  4ICB A;  3E3R A;  3WXA A;  2MLE C;  1IJ6 A;  4XJK B;  1DJY A;  3DF0 B;  2MHH A;  1QLK A;  1QXP A;  2PSR A;  1F70 A;  3DVK A;  1A4P A;  1BT6 A;  1M63 B;  2LP3 A;  1ODB A;  1OZS A;  3A8R A;  1KFX L;  2CTN A;  1NSH A;  2WC8 A;  1N65 A;  1WRL A;  1G8I A;  2LC5 A;  2ZFD A;  3VRN A;  1S6I A;  4GNK B;  1LKJ A;  1Y6W A;  1CTR A;  1N0Y A;  1AUI B;  4CLN A;  5FYX A;  2Y1M A;  3NXA A;  2F3Y A;  1REC A;  1SRA A;  2JZI A;  4GAO A;  1RRO A;  4GUK A;  3F45 A;  1B4C A;  2WCB A;  1Q80 A;  4WQ3 A;  5PAL A;  3CR2 A;  3EK8 A;  1ZOT B;  3EVV A;  2K7B A;  1MR8 A;  1IJ5 A;  3WHT B;  2A4J A;  1F4O A;  3IQQ A;  1CLL A;  5HYD A;  1LXF C;  1QX2 A;  1CM4 A;  5I2O A;  1KK7 Y;  2JU0 A;  2MRD A;  3SG4 A;  1XFX O;  1XK4 C;  1SPY A;  2K61 A;  3D10 A;  3EKH A;  1D1O A;  4YGD B;  1K8U A;  3CS1 A;  4I5K A;  5CPV A;  3JTD C;  4E68 A;  5KTY A;  4MZL A;  3OP0 A;  1M45 A;  2COL B;  4IL1 A;  1JFK A;  2PMY A;  3EK7 A;  1NCY A;  2LVK A;  2FJU B;  1YRU B;  2EGD A;  2VRG A;  3O4Y A;  1QTX A;  1WDC B;  1GGZ A;  1QVI Z;  1NCX A;  1YX8 A;  2M3W A;  5AER A;  3DVJ A;  1XK4 A;  1DTL A;  2HPS A;  2SAS A;  2I7A A;  2V53 A;  1FBV A;  1K9P A;  1NYA A;  1UHN A;  1S3P A;  2CXJ A;  4D1E A;  4NQG A;  3HX4 A;  1QIV A;  2K2F A;  2JUL A;  5CSN A;  5JOL A;  1MXE A;  2KSP A;  1B7T Z;  5J3X A;  4CPV A;  1DMO A;  2ZKM X;  3OB1 B;  3KEV A;  1RTP 1;  1XFW O;  1KFU L;  2KNE A;  4FTG A;  1TOP A;  2R2I A;  1AJ4 A;  4P2Y B;  1OMD A;  2K7O A;  1WRK A;  2HET A;  2LMV A;  1SY9 A;  1C7V A;  2M97 A;  3BUX B;  2MLF C;  2LAP A;  1B1G A;  3AKA A;  2BL0 B;  4A4C A;  1K93 D;  4M2P A;  1SW8 A;  5JJG A;  4GFT A;  4I5J A;  1B47 A;  2FCD A;  1IQ3 A;  1TN4 A;  1DGU A;  2GV5 A;  3I5F B;  1IGV A;  1MUX A;  1NP8 A;  1QIW A;  2MBX A;  1CNP A;  4NDD A;  2M0R A;  1C07 A;  3AAK A;  2JT3 A;  4MZK A;  2Q4U A;  5TNC A;  2AAO A;  3BXK A;  1BOD A;  3BUN B;  3EK4 A;  3KO0 A;  4GGF C;  3I5H C;  2HQ8 A;  3PM8 A;  4QJ3 B;  1FF1 A;  3FWC A;  1YVH A;  2KFG A;  1EJ3 A;  1NIW A;  1QLS A;  1X02 A;  2LM5 A;  1MXL C;  1PVB A;  4JQ0 D;  2AMI A;  2P6B B;  2CCM A;  1TIZ A;  1XFZ O;  1PAL A;  5AAN A;  1H4B A;  1S26 D;  3BUW B;  1TNQ A;  3LLE A;  5I2Q A;  1K9K A;  2WOS A;  1OZO A;  4N5X A;  4U8D A;  1LIN A;  1DGV A;  1JF0 A;  2KBI A;  5HKY A;  1DJX A;  1S36 A;  3D0Y A;  3NSI A;  1KK8 C;  3CR5 X;  2K8M B;  2K0J A;  1S6C A;  1PRW A;  2LMU A;  2JNF A;  1IQ5 A;  3NSK A;  3TS5 C;  1LA3 A;  1OMR A;  4P5O E;  1WLM A;  4MZJ A;  3BOW A;  4HRH A;  5G08 A;  1PK0 D;  2H61 C;  2G9B A;  1A03 A;  5DKR A;  2G2B A;  3SJS A;  1LA0 A;  3I5H B;  4PE4 A;  3D0Y B;  4C0J A;  2KFF A;  1J55 A;  5ER5 A;  1RWY A;  1SCM B;  1NX2 A;  3GOF A;  3ICB A;  2Y1N A;  2ZRS A;  4YI8 A;  1F4Q A;  1G33 A;  2JTT A;  2KAY A;  3BOW B;  1F55 A;  1AK8 A;  1WY9 A;  1XVJ A;  2LUX A;  2JPT A;  3M0W A;  2H61 A;  1WDC C;  2PAS A;  3IQO A;  4QJ4 B;  1JSA A;  4PHM A;  1DVI A;  4MEW A;  3BUM B;  2JXC A;  2L51 A;  4WQ2 A;  1KK8 B;  5D69 A;  1S5G Y;  1JWD A;  1KQM B;  4MLW A;  2ISD A;  1R2U A;  1ZMZ A;  4GGN A;  1TNW A;  3VGO A;  4CFR A;  4MRX A;  1Y1X A;  1KFX S;  4N1F A;  3TS5 B;  1OQP A;  4CID A;  4TNC A;  3O2P A;  1CDL A;  3OX5 A;  3SG7 A;  1QX7 A;  2LLU A;  1SYM A;  3DVE A;  4PAL A;  4YGA A;  2LVJ A;  1ALW A;  2Q91 A;  1C7W A;  5CSI A;  5HLV A;  4USL A;  2ZN8 A;  1JBA A;  1N2D A;  1L2O B;  1NWD A;  1SL7 A;  3PAT A;  3TUY C;  5B8I B;  1IWQ A;  1A29 A;  5DKQ A;  2OS8 C;  3OX6 A;  1OOJ A;  2LUC A;  4YBH B;  1OMV A;  2BE6 A;  2M1K B;  1BJF A;  2BL0 C;  1CLM A;  1EL4 A;  2K7D A;  3BUO B;  4JPZ B;  4OKH A;  4ORA B;  1TNX A;  1PSR A;  1A75 A;  2JTZ A;  2ZND A;  1JFJ A;  1SL9 A;  2I94 A;  1HT9 A;  3I5F C;  1YRT B;  4HRG A;  4PE1 A;  4PHN A;  2KGR A;  3GK4 X;  5GQQ C;  1J7P A;  1XO5 A;  3FIA A;  2WCE A;  4ZCU A;  3VRO A;  1F8H A;  1EXR A;  1KK7 Z;  1YR5 A;  1Y0V H;  3EKJ A;  3GK2 A;  1AVS A;  5I2L A;  1JC2 A;  1A75 B;  1XA5 A;  3KPX A;  1K90 D;  1MHO A;  2L0P A;  4MBE A;  3KHE A;  3TUY B;  5HLO A;  5KSZ A;  1UHI A;  1K95 A;  4DUQ A;  1DJZ A;  1W7J B;  1J1D A;  2KYF A;  2L2E A;  3K21 A;  2B1U A;  2OS8 B;  2IS9 A;  4A4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...