2JXCA

Structure of the eps15-eh2 stonin2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
b'PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor substrate 15
publication title Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/protein binding
total genus 32
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxcA00
2GGZA 1Y1XA 2M0RA 1ZUZA 4I5LB 4R1EA 2MLEC 3M0WA 3GOFA 1KFUL 3CR4X 2Y1NA 4GGFC 1CFFA 2L4HA 1KK8C 2MA2A 2E30A 2F2PA 2K8MB 5ER4X 1J55A 1UURA 2FCDA 5KSZA 1OMVA 2WNDA 1F8HA 4JPZB 1ALVA 1ZOTB 1B7TY 3NSKA 2JT3A 1TCOB 4FTGA 1XFWO 4Q04A 3AKBA 3I5IB 1YTZC 1YUTA 2HF5A 2Y4QA 4YGCB 3SG4A 4C0JA 3AAJA 3JVTC 1JFKA 1KK7Z 2JZIA 2K61A 1MXEA 1OZSA 5AERA 3OX5A 2JQ6A 1BMOA 1AUIB 2MLFC 2ZNEA 4MSPA 1CMGA 3OB1B 1SPYA 2Q91A 1S36A 1UHKA 2LV7A 1QTXA 2KFFA 4GPLB 2KYFA 1WDCC 5D69A 1LKJA 5HYDA 3PM8A 5CSIA 2LVVA 3EK4A 1PSRA 1S6CA 3DF0B 4P5OE 1FI6A 1S26D 1IH0A 4MBEA 4CFRA 3CGAA 1MR8A 3NSIA 1DJXA 5HLOA 2AAOA 1JF0A 1Y1UA 1DJGA 1QIWA 1UHIA 4NQGA 2DOQA 2BL0C 2KI4B 1UWOA 1SL7A 1DVIA 2ZKMX 3K21A 4GUKA 4HSZA 2SASA 1M45A 1RECA 3SG6A 3WXAA 2JRFA 3KHEA 4WQ2A 4I5KA 1SY9A 4OCIA 1AP4A 1XVJA 2H61A 1LXFC 3CS1A 1UHJA 1AJ4A 4PE7A 4UPGA 4PHKA 1CTRA 4WQ3A 1PVBA 2NCPA 3VRPA 1Y6WA 1A75A 2JNXA 4BY5A 2HETA 3MSEB 3FIAA 1YX8A 1K94A 3I5GC 3EVRA 2K2FA 2LC5A 2M97A 3IQQA 4DIRA 2OPOA 1EL4A 1CLMA 2L5XB 1LINA 4YBHB 1EJ3A 1Y0VH 2BCAA 2IS9A 1N0YA 4PE4A 1R6PA 4MN0A 4HREE 2ZRTA 2M1KB 4NDDA 5HKZA 4ORAB 2KFHA 3CTNA 2K7CA 3D0YA 1Q80A 2BBMA 2EC6C 3LK1A 1CDLA 5TNCA 2LMTA 3VRQA 2KHNA 2JT0A 1FI5A 1U5IB 5HLVA 1DJHA 2H61C 3OB2B 1QV0A 1KQMC 1BU3A 2G2BA 1QV1A 1CDPA 1OZOA 3I5HC 2CXJA 4MRXA 2LVJA 2I2RE 3WNXB 4I5NB 1LA3A 5I2LA 1UP5A 2GV5A 2KGRA 2ZNDA 4QJ5B 3FWCA 1NX1A 1VRKA 1UHHA 2NLNA 1C7WA 3A8RA 4FQOA 1IRJA 2LANA 4USLA 2V53A 5KTYA 1KWOB 3SG7A 2LUXA 3O4YA 4YGDB 5HKYA 2JU0A 3SJSA 2MJWB 5D7FA 1EG4A 4A4CA 1F55A 2CNPA 4NDBA 3HX4A 4ETOA 2JNFA 1NUBA 3PATA 1DT7B 1CM4A 3EKJA 3NXAA 1J1DA 1DJIA 3KEVA 1KQVA 3LK0A 1NX3A 1KCYA 2LMUA 2JXLA 1QX5B 3AAKA 1AJ5A 1BJFA 1AK8A 2L0PA 3BUMB 4GGNA 1SRAA 4DCKA 5J3XA 1UHNA 4AOMA 1CFDA 4WRIA 1TNXA 4N1FA 5JOLA 1JWDA 2KAXA 2I94A 4YGEB 3TS5C 1DTLA 1XFVO 1BODA 4CIDA 1B1GA 2OTGC 1BOCA 1QX7A 1ZACA 3TUYB 4C0KA 3SG3A 1F71A 1SL8A 2AUCA 3GK4X 4PDZA 1OQPA 2RGIA 4DRWA 2QACA 2PALA 2GGMA 3H4SE 5FYXA 1S5GY 1H8BA 3OHMB 3PN7C 1ALWA 1J7QA 1S6JA 1A2XA 1CKKA 2BCXA 1MUXA 2CT9A 1M39A 1SK6D 1XFZO 1FF1A 1RK9A 2K7OA 1TNPA 4XJKA 1K96A 2K2AA 3I5FB 2F33A 1GGZA 2JWWA 2LLUA 2K7BA 1SCVA 2BE4A 2WOSA 1TRFA 1FBVA 3IF7A 3QRXA 1G33A 1QVIY 1SNLA 2WCEA 2COLB 1EH2A 3I5GB 1K90D 1FPWA 2D8NA 1J7RA 2R2IA 1YURA 1XK4A 1ZFSA 4GBAA 1F4OA 2LP2A 1IKUA 1J7OA 1K2HA 4PHNA 4ORBB 2M8UA 3PLFB 2F8PA 3DF0A 4E68A 3TDZA 4A4BA 1PALA 1SBJA 4YI9A 2FCEA 2PASA 1MWNA 1NX2A 1TTXA 3KF9A 1IJ6A 1CB1A 1PVAA 2HPSA 3IQOA 3BOWA 3EK7A 1TNQA 2LE9B 3SIAA 2ZRSA 1DF0B 1Y1AA 1YUUA 1S3PA 1YVLA 2MHHA 3ZWHA 1B7TZ 1IJ5A 3I5IC 1TIZA 2QPTA 3BQ3A 1W7JB 2MRDA 4OVNF 5BPJA 2EHBA 1LVCD 2JXCA 1RTP1 3BXKA 3KO0A 1NPQA 3JTDB 3EVVA 4C0LA 1S6IA 3PFVA 3LL8B 4DS7A 2L51A 3FWBA 4PHJA 2JULA 2LLSA 4BY4A 1K9PA 1NX0A 2KI6D 1B8CA 1EG3A 1QJTA 1SCMC 2KI6C 1WRZA 1JSAA 1XK4C 4IL1A 2P6BB 4PE0A 5CSJA 5G08A 4F0ZB 1JC2A 5JJGA 2FJUB 3TDIA 4QJ4B 1B8LA 1K9KA 1RROA 1YX7A 5KU1A 4MEWA 1XYDA 2CBLA 1K8UA 1V1FA 3F45A 3EVUA 2H2KA 1IWQA 3D0YB 4M2OA 1OOJA 3WHTB 1WRLA 1B9AA 4TNCA 5ER5A 2ISDA 5AXIA 4OV2A 2KDHA 2WCFA 2Q4UA 1ODBA 2OS8C 5AEQA 1OMDA 4CPVA 1D1OA 4U8DA 1J7PA 3ZNIA 2M7LA 1SKTA 1SL9A 1S1EA 1U5IA 2K0JA 1B8RA 1G4YR 3D10A 3RM1A 1TN4A 1KK8B 3KPXA 1GJYA 2A4JA 3O6BA 1ZMZA 1DGVA 1KSOA 1SR6C 1TOPA 3VRNA 1MHOA 4GNKB 1XO5A 2KGBC 2OTGB 3CZTX 4N1GA 1B47A 1KFUS 3DVEA 4YGAA 1OSAA 1KFXL 1NYAA 2KQYA 2KBIA 1H4BA 4AQJA 2Y1MA 5CSFA 5GQQC 1DJZA 4I5JA 4PCWA 5CSNA 1EXRA 1KK7Y 2LHIA 3JVTB 4AQIA 3AKAA 3PN7B 2JPTA 3PALA 1RFJA 4MLWA 2LM5A 1R2UA 2F2OA 2MAZA 2F3ZA 2LVKA 1CNPA 3GK1A 4HRGA 1FW4A 2KQ6A 1K9UA 1WDCB 2MBXA 1N65A 1BLQA 2WCBA 1IGVA 4GFTA 3CWGA 2KNEA 2EGDA 3O2PA 1BF5A 4YRUA 2G9BA 1KSMA 1B4CA 2NCOA 2JT8A 2JTTA 3BUXB 4HRHA 1SYMA 1CFPA 1BR4B 1QATA 2BL0B 3SG2A 3CR2A 5I8NA 1QX2A 1BG1A 3E3RA 1CLLA 1KWOC 2PMYA 4N5XA 1BT6A 4DUQA 1NCZA 2LCPA 1YUSA 3GK2A 4QJ3B 3WHUB 2I7AA 5DKNA 3PSRA 3C1VA 2ZN8A 2FOTA 1QLSA 2M3WA 3EK8A 3VGOA 1UUSA 2I18A 1TCFA 1M63B 2E6WA 2O5GA 4NDCA 4ORCB 1L2OC 4XJKB 3BUNB 3BUWB 1JFJA 4P2YB 1PRWA 4YI8A 1CDMA 3BUOB 2LMVA 1CLBA 2PRUA 1QXPA 1DGUA 1RWYA 1SCMB 1W7IB 3NSLA 4MZLA 2KSPA 1OMRA 1F70A 2BECA 3OX6A 1XFXO 1IG5A 2BE6A 3CLNA 3CR5X 4GAOA 4L9MA 1J1EA 1M31A 2M9GA 2BBNA 1F4QA 4MZKA 2B1UA 2M1UA 2O60A 2HQ8A 3TUYC 2EC6B 1K95A 1WLMA 1CDNA 1L7ZA 2L2EA 4OKHA 5F6TA 3NSOA 3RLZA 3BOWB 1KQMB 5AANA 1S5GZ 2SCPA 1YR5A 3I5HB 3SG5A 3LLEA 1A75B 2JTZA 2OS8B 4M2PA 2LHLA 1HQVA 1OE9B 1DF0A 2LVIA 1BR1B 1AHRA 1NWDA 1YRTB 1SW8A 1CM1A 2BKHB 2LNKA 3ICBA 1IQ5A 2KAVA 3I5FC 1WY9A 1YRUB 1LA0A 1SR6B 5PALA 2F3YA 1A29A 1QASA 2PVBA 1GGWA 1XFUO 2KFGA 1SMGA 2KBMA 1E8AA 3HCMA 5DKQA 1MF8B 1QVIZ 3FS7A 1CFCA 4YGBB 2KAYA 2LAPA 5IBWA 1NCYA 1C7VA 4PE1A 1NCXA 4XYNA 3VROA 3SIBA 4OR9B 2KI4C 2K7DA 3OP0A 2KOTA 5CPVA 1AVSA 4CLNA 2L4IA 2BCBA 1X02A 1KFXS 2WORA 3LCPC 1CMFA 2BKIB 4ZCUA 2Y5IA 3VRRA 2VRGA 5AFPA 2LLTA 4PALA 4CFQA 3O78A 5K89A 5I2QA 4D1EA 2PSRA 1A03A 5HKWA 3TS5B 4MZJA 1NIWA 1WLZA 2CTNA 1C07A 2ZFDA 1WRKA 2ZN9A 4MRYA 1QIVA 1A4PA 2JOJA 1N2DA 1PSBA 3DD4A 1YVHA 1IQ3A 4MVFA 2NZ0A 4PHMA 3JTDC 1GQMA 2KYCA 4GGFA 3BYAA 3DVKA 1MXLC 3TZ1A 5I2OA 4JWQA 1QS7A 1K93D 1TNWA 3DVJA 4M2QA 3DVMA 1DMOA 2AMIA 4ZCVA 1PULA 2HQWA 2NXQA 2TN4A 1QLKA 2M7NA 2LP3A 1DJWA 1DJYA 1XA5A 3A4UB 1F54A 3TDUA 1JUOA 4ICBA 1PK0D 1NP8A 5B8IB 1MQ1A 1HT9A 2LUCA 2WC8A 1G8IA 1RJVA 2CCMA 1XFYO 1M46A 1NSHA 1JBAA 1V1GA 2JC2A 2L98A 2M49B 1L2OB 1JF2A 5DKRA 2M29A 2L50A 3EKHA 4JQ0D
chains in the Genus database with same CATH superfamily
2GGZA 1Y1XA 2M0RA 1ZUZA 4I5LB 4R1EA 2MLEC 3M0WA 3GOFA 1KFUL 3CR4X 3QMEA 2Y1NA 4GGFC 1CFFA 2L4HA 3CYZA 1KK8C 2MA2A 3S0GA 2E30A 2F2PA 2K8MB 2WCMA 3DYEA 5ER4X 1J55A 1UURA 2FCDA 5KSZA 1OMVA 2WNDA 1F8HA 4JPZB 1ALVA 1ZOTB 5D3OA 1B7TY 3NSKA 2JT3A 1TCOB 4FTGA 1XFWO 4Q04A 3AKBA 3I5IB 1YTZC 1YUTA 2HF5A 2Y4QA 4YGCB 3SG4A 4C0JA 3AAJA 1C3ZA 3JVTC 1JFKA 1KK7Z 2JZIA 2K61A 1MXEA 1OZSA 5AERA 3OX5A 2JQ6A 1BMOA 1AUIB 2MLFC 2ZNEA 4MSPA 1CMGA 3OB1B 1SPYA 3BFAA 2Q91A 1S36A 1UHKA 2LV7A 1QTXA 2K60A 2KFFA 2KYFA 4GPLB 1WDCC 5D69A 1LKJA 5HYDA 3PM8A 5CSIA 2LVVA 3EK4A 1PSRA 1S6CA 3DF0B 4P5OE 1FI6A 1S26D 4JD9A 1IH0A 4MBEA 2WCHA 4CFRA 3CGAA 1MR8A 3NSIA 3R72A 1DJXA 5HLOA 2AAOA 3VB1A 1JF0A 1Y1UA 1DJGA 1QIWA 1TWOA 1UHIA 3D73A 4NQGA 2DOQA 2BL0C 2KI4B 1UWOA 1SL7A 3FE6A 1DVIA 1QWVA 2ZKMX 3K21A 4GUKA 4OZDA 3SS3A 4HSZA 2SASA 1M45A 1RECA 3SG6A 3WXAA 2JRFA 3KHEA 4WQ2A 4I5KA 1SY9A 4OCIA 1AP4A 5DICA 1DEKA 5FI6A 1XVJA 2H61A 1LXFC 3CS1A 1UHJA 1AJ4A 2FJYA 4PE7A 4UPGA 4PHKA 1CTRA 1W9ZA 2KLDA 1PVBA 2NCPA 4WQ3A 3VRPA 1Y6WA 1A75A 2JNXA 4BY5A 2HETA 3MSEB 3FIAA 1YX8A 3FE9A 1K94A 3I5GC 3EVRA 2K2FA 2LC5A 2M97A 3IQQA 4DIRA 2OPOA 1EL4A 1CLMA 2L5XB 1LINA 4PT1A 4YBHB 1EJ3A 1Y0VH 2BCAA 2IS9A 1N0YA 2GTEA 2L2CA 4PE4A 1R6PA 5FI7A 4MN0A 4HREE 2ZRTA 2M1KB 4NDDA 2WCLA 5HKZA 4ORAB 2KFHA 3CTNA 2K7CA 3D0YA 1Q80A 3CABA 2BBMA 2EC6C 3LK1A 1CDLA 5TNCA 2LMTA 3VRQA 2KHNA 2JT0A 1FI5A 1U5IB 5HLVA 3S0AA 1DJHA 2H61C 3OB2B 1QV0A 1KQMC 1BU3A 2G2BA 1QV1A 1CDPA 1OZOA 3I5HC 2CXJA 4MRXA 2LVJA 2I2RE 3WNXB 5HL1A 2WCKA 4I5NB 1LA3A 5I2LA 1UP5A 2GV5A 2JPOA 2KGRA 2ZNDA 4QJ5B 3FWCA 1NX1A 1VRKA 1UHHA 2NLNA 1C7WA 2KLEA 3A8RA 4FQOA 1IRJA 2LANA 4USLA 2V53A 3B87A 5KTYA 1KWOB 3SG7A 2LUXA 3UO9A 3S0EA 3O4YA 4YGDB 5HKYA 2JU0A 5I94A 3SJSA 2MJWB 5D7FA 1EG4A 4A4CA 1F55A 2CNPA 4NDBA 3HX4A 4ETOA 2JNFA 1NUBA 3PATA 1DT7B 1CM4A 3EKJA 3NXAA 1J1DA 1DJIA 3KEVA 3DZTA 1KQVA 3LK0A 1NX3A 1KCYA 2LMUA 2JXLA 1QX5B 2QEHA 1TUZA 1AJ5A 1BJFA 3AAKA 1AK8A 2L0PA 2BNXA 3BUMB 4GGNA 3SS5A 1SRAA 4DCKA 5J3XA 1UHNA 4AOMA 1XFRA 1CFDA 4WRIA 1TNXA 4N1FA 5JOLA 1JWDA 2KAXA 2I94A 3IVTA 3L4LA 4YGEB 3TS5C 1DTLA 1XFVO 3R1OA 4CIDA 1B1GA 1BODA 2QEBA 2OTGC 1BOCA 1QX7A 1ZACA 3TUYB 4C0KA 3SG3A 1F71A 1SL8A 2AUCA 3GK4X 4PDZA 1OOHA 1OQPA 2RGIA 4DRWA 2QACA 2PALA 2GGMA 3H4SE 3S0DA 5FYXA 1S5GY 3PJIA 1H8BA 3OHMB 3PN7C 1ALWA 1J7QA 1S6JA 1T14A 1A2XA 1CKKA 2BCXA 1MUXA 2QEVA 2CT9A 1M39A 1SK6D 1XFZO 1FF1A 3R1VA 1RK9A 3L47A 3CZ1A 2K7OA 3D75A 1TNPA 4XJKA 1K96A 2K2AA 3I5FB 2F33A 1GGZA 2ERBA 2JWWA 2LLUA 2K7BA 1SCVA 2BE4A 2WOSA 1TRFA 1FBVA 3IF7A 3QRXA 1G33A 1QVIY 1SNLA 2WCEA 2COLB 1EH2A 3I5GB 1K90D 1FPWA 2D8NA 1J7RA 2R2IA 1YURA 3BJHA 1XK4A 1ZFSA 4GBAA 1F4OA 2LP2A 4IJ7A 1IKUA 1J7OA 1K2HA 4PHNA 2P70A 1OOGA 4ORBB 2M8UA 3PLFB 2F8PA 3DF0A 4E68A 3TDZA 4A4BA 1PALA 1SBJA 4YI9A 2FCEA 2PASA 3NHIA 1MWNA 1NX2A 1TTXA 3KF9A 1IJ6A 1CB1A 1PVAA 2HPSA 3IQOA 3BOWA 3EK7A 1TNQA 2LE9B 3SIAA 1OW4A 1DF0B 1Y1AA 1YUUA 1S3PA 1YVLA 2MHHA 2ZRSA 3BFBA 3ZWHA 3NHTA 1B7TZ 1IJ5A 3I5IC 1TIZA 2QPTA 3BQ3A 1W7JB 2PQLA 2MRDA 4OVNF 5BPJA 2EHBA 1LVCD 2JXCA 1RTP1 3BXKA 3KO0A 1NPQA 3JTDB 3EVVA 4C0LA 3Q8IA 1S6IA 3PFVA 3LL8B 4DS7A 2L51A 3FWBA 4PHJA 2JULA 2LLSA 4BY4A 1K9PA 1NX0A 2KI6D 1B8CA 1EG3A 1QJTA 1SCMC 2KI6C 1WRZA 1JSAA 1XK4C 4IL1A 2P6BB 4PE0A 5CSJA 5G08A 4F0ZB 3CZ2A 1JC2A 3L4AA 5JJGA 2FJUB 3TDIA 4QJ4B 1B8LA 1K9KA 1RROA 1YX7A 5KU1A 4MEWA 1XYDA 2CBLA 3CDNA 1K8UA 1V1FA 3F45A 3EVUA 2H2KA 1IWQA 3D0YB 4M2OA 1OOJA 3WHTB 1WRLA 1B9AA 4TNCA 5ER5A 2ISDA 5AXIA 4OV2A 2KDHA 2WCFA 2Q4UA 1ODBA 2OS8C 5AEQA 1OMDA 4CPVA 1D1OA 4U8DA 3DY9A 1J7PA 3ZNIA 2M7LA 1SKTA 1SL9A 1S1EA 1U5IA 2K0JA 1B8RA 1G4YR 3D10A 3RM1A 1TN4A 1KK8B 3KPXA 1GJYA 2A4JA 2WC6A 3O6BA 1ZMZA 1DGVA 3B86A 1KSOA 1SR6C 1TOPA 3VRNA 1MHOA 4GNKB 1XO5A 2KGBC 2OTGB 3CZTX 4N1GA 1B47A 1KFUS 3DVEA 3EG5B 4YGAA 1OSAA 3D76A 1KFXL 1NYAA 4INXA 2KQYA 3B7AA 2KBIA 1H4BA 4AQJA 2Y1MA 5CSFA 5GQQC 1DJZA 4I5JA 4PCWA 5CSNA 2KPHA 1EXRA 1KK7Y 2LHIA 3JVTB 4AQIA 3AKAA 3S0FA 3PN7B 2JPTA 3PALA 1DELA 1SSEB 1RFJA 4MLWA 1OOIX 2LM5A 1R2UA 2F2OA 2MAZA 2F3ZA 2LVKA 1CNPA 3GK1A 1DC1A 4HRGA 1GM0A 1FW4A 2KQ6A 1K9UA 1WDCB 2MBXA 1N65A 1BLQA 2WCBA 1IGVA 4GFTA 3CWGA 2KNEA 2EGDA 3O2PA 1BF5A 4YRUA 2G9BA 2H8VA 1KSMA 1B4CA 2NCOA 2JT8A 2JTTA 3BUXB 4HRHA 1SYMA 1CFPA 1TUJA 1BR4B 3B88A 1QATA 2BL0B 3SG2A 3CR2A 5I8NA 1QX2A 2L5YA 1BG1A 3E3RA 4KYNA 3RZSA 1DQEA 1CLLA 5FI2A 1KWOC 2PMYA 4N5XA 1BT6A 4DUQA 1NCZA 2LCPA 1YUSA 3GK2A 4QJ3B 3WHUB 2I7AA 5DKNA 3PSRA 3SS4A 3C1VA 2ZN8A 2FOTA 1QLSA 2PYQA 2M3WA 3EK8A 3VGOA 1UUSA 2I18A 3B6XA 1TCFA 1M63B 2E6WA 2O5GA 4NDCA 4ORCB 1L2OC 4XJKB 3BUNB 3BUWB 1JFJA 4P2YB 1PRWA 4YI8A 1CDMA 3OBVA 3BUOB 2LMVA 1CLBA 2PRUA 1QXPA 1DGUA 1RWYA 1SCMB 1W7IB 3NSLA 4MZLA 1C3YA 2KSPA 1OMRA 1F70A 1IIOA 2BECA 3OX6A 1XFXO 1IG5A 2BE6A 3CLNA 3CR5X 4GAOA 4L9MA 1J1EA 1M31A 2M9GA 2BBNA 1F4QA 3D78A 4MZKA 2B1UA 2M1UA 2O60A 1ORGA 2HQ8A 3TUYC 2EC6B 1K95A 1WLMA 1CDNA 1L7ZA 2L2EA 4OKHA 5F6TA 3NSOA 3RLZA 3BOWB 1KQMB 3O4XA 5AANA 1S5GZ 2SCPA 1YR5A 2WCJA 3I5HB 3SG5A 3LLEA 1A75B 2JTZA 2OS8B 4M2PA 2LHLA 1HQVA 1OE9B 1DF0A 2LVIA 5EL2A 1Z2CB 1BR1B 1AHRA 1NWDA 2P71A 1YRTB 1SW8A 3FE8A 3D74A 1CM1A 3D77A 2BKHB 2LNKA 3ICBA 1IQ5A 2KAVA 3BFHA 3I5FC 1WY9A 1YRUB 1LA0A 1SR6B 5PALA 2F3YA 1A29A 1QASA 1LS8A 2PVBA 4INWA 1GGWA 1XFUO 2KFGA 1SMGA 2KBMA 1E8AA 3HCMA 5DKQA 1MF8B 1QVIZ 3FS7A 1CFCA 4YGBB 2KAYA 2LAPA 5IBWA 1NCYA 1OOFA 2BAPA 1C7VA 4PE1A 1NCXA 4XYNA 3VROA 3SIBA 1P28A 4OR9B 2KI4C 2K7DA 3OP0A 2KOTA 5CPVA 1AVSA 4CLNA 2L4IA 2BCBA 4FQTA 1X02A 1KFXS 2WORA 3LCPC 1CMFA 2BKIB 4ZCUA 2Y5IA 3VRRA 2VRGA 5AFPA 2LLTA 4PALA 4CFQA 3O78A 5K89A 2WC5A 5I2QA 4D1EA 2PSRA 3R1PA 5HKWA 3TS5B 1A03A 4JKTA 4MZJA 1NIWA 1WLZA 2CTNA 3N7HA 2ZFDA 1C07A 1WRKA 2ZN9A 4MRYA 1QIVA 1A4PA 2JOJA 1N2DA 1PSBA 3DD4A 1YVHA 1IQ3A 4MVFA 4F7FA 2NZ0A 4PHMA 3JTDC 1GQMA 2KYCA 3S0BA 4GGFA 3BYAA 3DVKA 1MXLC 3TZ1A 5I2OA 4JWQA 1QS7A 3PM2A 1K93D 3V2LA 1TNWA 2YGUA 3DVJA 3DVMA 4M2QA 1DMOA 2AMIA 4ZCVA 1PULA 2HQWA 2NXQA 2QEOA 2TN4A 3K1EA 3OGNA 1QLKA 2M7NA 2LP3A 1DJWA 1DJYA 1XA5A 3A4UB 1F54A 3DXLA 3TDUA 1JUOA 4ICBA 1PK0D 1NP8A 3NGVA 5B8IB 1Z4HA 1MQ1A 2QDIA 1HT9A 2LUCA 2WC8A 1G8IA 1RJVA 2CCMA 1XFYO 1M46A 1NSHA 1JBAA 1V1GA 2JC2A 2L98A 3CZ0A 2M49B 1L2OB 1JF2A 5DKRA 2M29A 3UNWA 2L50A 3EKHA 4JQ0D
chains in the Genus database with same CATH topology
2GGZA 1Y1XA 2M0RA 1ZUZA 4I5LB 4R1EA 2MLEC 3M0WA 3GOFA 1KFUL 3CR4X 2Y1NA 4GGFC 1CFFA 2L4HA 1KK8C 2MA2A 2E30A 2F2PA 2K8MB 5ER4X 1J55A 1UURA 2FCDA 5KSZA 1OMVA 2WNDA 1F8HA 4JPZB 1ALVA 1ZOTB 1B7TY 3NSKA 2JT3A 1TCOB 4FTGA 1XFWO 4Q04A 3AKBA 3I5IB 1YTZC 1YUTA 2HF5A 2Y4QA 4YGCB 3SG4A 4C0JA 3AAJA 3JVTC 1JFKA 1KK7Z 2JZIA 2K61A 1MXEA 1OZSA 5AERA 3OX5A 2JQ6A 1BMOA 1AUIB 2MLFC 2ZNEA 4MSPA 1CMGA 3OB1B 1SPYA 2Q91A 1S36A 1UHKA 2LV7A 1QTXA 2KFFA 4GPLB 2KYFA 1WDCC 5D69A 1LKJA 5HYDA 3PM8A 5CSIA 2LVVA 3EK4A 1PSRA 1S6CA 3DF0B 4P5OE 1FI6A 1S26D 1IH0A 4MBEA 4CFRA 3CGAA 1MR8A 3NSIA 1DJXA 5HLOA 2AAOA 1JF0A 1Y1UA 1DJGA 1QIWA 1UHIA 4NQGA 2DOQA 2BL0C 2KI4B 1UWOA 1SL7A 1DVIA 2ZKMX 3K21A 4GUKA 4HSZA 2SASA 1M45A 1RECA 3SG6A 3WXAA 2JRFA 3KHEA 4WQ2A 4I5KA 1SY9A 4OCIA 1AP4A 1XVJA 2H61A 1LXFC 3CS1A 1UHJA 1AJ4A 4PE7A 4UPGA 4PHKA 1CTRA 4WQ3A 1PVBA 2NCPA 3VRPA 1Y6WA 1A75A 2JNXA 4BY5A 2HETA 3MSEB 3FIAA 1YX8A 1K94A 3I5GC 3EVRA 2K2FA 2LC5A 2M97A 3IQQA 4DIRA 2OPOA 1EL4A 1CLMA 2L5XB 1LINA 4YBHB 1EJ3A 1Y0VH 2BCAA 2IS9A 1N0YA 4PE4A 1R6PA 4MN0A 4HREE 2ZRTA 2M1KB 4NDDA 5HKZA 4ORAB 2KFHA 3CTNA 2K7CA 3D0YA 1Q80A 2BBMA 2EC6C 3LK1A 1CDLA 5TNCA 2LMTA 3VRQA 2KHNA 2JT0A 1FI5A 1U5IB 5HLVA 1DJHA 2H61C 3OB2B 1QV0A 1KQMC 1BU3A 2G2BA 1QV1A 1CDPA 1OZOA 3I5HC 2CXJA 4MRXA 2LVJA 2I2RE 3WNXB 4I5NB 1LA3A 5I2LA 1UP5A 2GV5A 2KGRA 2ZNDA 4QJ5B 3FWCA 1NX1A 1VRKA 1UHHA 2NLNA 1C7WA 3A8RA 4FQOA 1IRJA 2LANA 4USLA 2V53A 5KTYA 1KWOB 3SG7A 2LUXA 3O4YA 4YGDB 5HKYA 2JU0A 3SJSA 2MJWB 5D7FA 1EG4A 4A4CA 1F55A 2CNPA 4NDBA 3HX4A 4ETOA 2JNFA 1NUBA 3PATA 1DT7B 1CM4A 3EKJA 3NXAA 1J1DA 1DJIA 3KEVA 1KQVA 3LK0A 1NX3A 1KCYA 2LMUA 2JXLA 1QX5B 3AAKA 1AJ5A 1BJFA 1AK8A 2L0PA 3BUMB 4GGNA 1SRAA 4DCKA 5J3XA 1UHNA 4AOMA 1CFDA 4WRIA 1TNXA 4N1FA 5JOLA 1JWDA 2KAXA 2I94A 4YGEB 3TS5C 1DTLA 1XFVO 1BODA 4CIDA 1B1GA 2OTGC 1BOCA 1QX7A 1ZACA 3TUYB 4C0KA 3SG3A 1F71A 1SL8A 2AUCA 3GK4X 4PDZA 1OQPA 2RGIA 4DRWA 2QACA 2PALA 2GGMA 3H4SE 5FYXA 1S5GY 1H8BA 3OHMB 3PN7C 1ALWA 1J7QA 1S6JA 1A2XA 1CKKA 2BCXA 1MUXA 2CT9A 1M39A 1SK6D 1XFZO 1FF1A 1RK9A 2K7OA 1TNPA 4XJKA 1K96A 2K2AA 3I5FB 2F33A 1GGZA 2JWWA 2LLUA 2K7BA 1SCVA 2BE4A 2WOSA 1TRFA 1FBVA 3IF7A 3QRXA 1G33A 1QVIY 1SNLA 2WCEA 2COLB 1EH2A 3I5GB 1K90D 1FPWA 2D8NA 1J7RA 2R2IA 1YURA 1XK4A 1ZFSA 4GBAA 1F4OA 2LP2A 1IKUA 1J7OA 1K2HA 4PHNA 4ORBB 2M8UA 3PLFB 2F8PA 3DF0A 4E68A 3TDZA 4A4BA 1PALA 1SBJA 4YI9A 2FCEA 2PASA 1MWNA 1NX2A 1TTXA 3KF9A 1IJ6A 1CB1A 1PVAA 2HPSA 3IQOA 3BOWA 3EK7A 1TNQA 2LE9B 3SIAA 2ZRSA 1DF0B 1Y1AA 1YUUA 1S3PA 1YVLA 2MHHA 3ZWHA 1B7TZ 1IJ5A 3I5IC 1TIZA 2QPTA 3BQ3A 1W7JB 2MRDA 4OVNF 5BPJA 2EHBA 1LVCD 2JXCA 1RTP1 3BXKA 3KO0A 1NPQA 3JTDB 3EVVA 4C0LA 1S6IA 3PFVA 3LL8B 4DS7A 2L51A 3FWBA 4PHJA 2JULA 2LLSA 4BY4A 1K9PA 1NX0A 2KI6D 1B8CA 1EG3A 1QJTA 1SCMC 2KI6C 1WRZA 1JSAA 1XK4C 4IL1A 2P6BB 4PE0A 5CSJA 5G08A 4F0ZB 1JC2A 5JJGA 2FJUB 3TDIA 4QJ4B 1B8LA 1K9KA 1RROA 1YX7A 5KU1A 4MEWA 1XYDA 2CBLA 1K8UA 1V1FA 3F45A 3EVUA 2H2KA 1IWQA 3D0YB 4M2OA 1OOJA 3WHTB 1WRLA 1B9AA 4TNCA 5ER5A 2ISDA 5AXIA 4OV2A 2KDHA 2WCFA 2Q4UA 1ODBA 2OS8C 5AEQA 1OMDA 4CPVA 1D1OA 4U8DA 1J7PA 3ZNIA 2M7LA 1SKTA 1SL9A 1S1EA 1U5IA 2K0JA 1B8RA 1G4YR 3D10A 3RM1A 1TN4A 1KK8B 3KPXA 1GJYA 2A4JA 3O6BA 1ZMZA 1DGVA 1KSOA 1SR6C 1TOPA 3VRNA 1MHOA 4GNKB 1XO5A 2KGBC 2OTGB 3CZTX 4N1GA 1B47A 1KFUS 3DVEA 4YGAA 1OSAA 1KFXL 1NYAA 2KQYA 2KBIA 1H4BA 4AQJA 2Y1MA 5CSFA 5GQQC 1DJZA 4I5JA 4PCWA 5CSNA 1EXRA 1KK7Y 2LHIA 3JVTB 4AQIA 3AKAA 3PN7B 2JPTA 3PALA 1RFJA 4MLWA 2LM5A 1R2UA 2F2OA 2MAZA 2F3ZA 2LVKA 1CNPA 3GK1A 4HRGA 1FW4A 2KQ6A 1K9UA 1WDCB 2MBXA 1N65A 1BLQA 2WCBA 1IGVA 4GFTA 3CWGA 2KNEA 2EGDA 3O2PA 1BF5A 4YRUA 2G9BA 1KSMA 1B4CA 2NCOA 2JT8A 2JTTA 3BUXB 4HRHA 1SYMA 1CFPA 1BR4B 1QATA 2BL0B 3SG2A 3CR2A 5I8NA 1QX2A 1BG1A 3E3RA 1CLLA 1KWOC 2PMYA 4N5XA 1BT6A 4DUQA 1NCZA 2LCPA 1YUSA 3GK2A 4QJ3B 3WHUB 2I7AA 5DKNA 3PSRA 3C1VA 2ZN8A 2FOTA 1QLSA 2M3WA 3EK8A 3VGOA 1UUSA 2I18A 1TCFA 1M63B 2E6WA 2O5GA 4NDCA 4ORCB 1L2OC 4XJKB 3BUNB 3BUWB 1JFJA 4P2YB 1PRWA 4YI8A 1CDMA 3BUOB 2LMVA 1CLBA 2PRUA 1QXPA 1DGUA 1RWYA 1SCMB 1W7IB 3NSLA 4MZLA 2KSPA 1OMRA 1F70A 2BECA 3OX6A 1XFXO 1IG5A 2BE6A 3CLNA 3CR5X 4GAOA 4L9MA 1J1EA 1M31A 2M9GA 2BBNA 1F4QA 4MZKA 2B1UA 2M1UA 2O60A 2HQ8A 3TUYC 2EC6B 1K95A 1WLMA 1CDNA 1L7ZA 2L2EA 4OKHA 5F6TA 3NSOA 3RLZA 3BOWB 1KQMB 5AANA 1S5GZ 2SCPA 1YR5A 3I5HB 3SG5A 3LLEA 1A75B 2JTZA 2OS8B 4M2PA 2LHLA 1HQVA 1OE9B 1DF0A 2LVIA 1BR1B 1AHRA 1NWDA 1YRTB 1SW8A 1CM1A 2BKHB 2LNKA 3ICBA 1IQ5A 2KAVA 3I5FC 1WY9A 1YRUB 1LA0A 1SR6B 5PALA 2F3YA 1A29A 1QASA 2PVBA 1GGWA 1XFUO 2KFGA 1SMGA 2KBMA 1E8AA 3HCMA 5DKQA 1MF8B 1QVIZ 3FS7A 1CFCA 4YGBB 2KAYA 2LAPA 5IBWA 1NCYA 1C7VA 4PE1A 1NCXA 4XYNA 3VROA 3SIBA 4OR9B 2KI4C 2K7DA 3OP0A 2KOTA 5CPVA 1AVSA 4CLNA 2L4IA 2BCBA 1X02A 1KFXS 2WORA 3LCPC 1CMFA 2BKIB 4ZCUA 2Y5IA 3VRRA 2VRGA 5AFPA 2LLTA 4PALA 4CFQA 3O78A 5K89A 5I2QA 4D1EA 2PSRA 1A03A 5HKWA 3TS5B 4MZJA 1NIWA 1WLZA 2CTNA 1C07A 2ZFDA 1WRKA 2ZN9A 4MRYA 1QIVA 1A4PA 2JOJA 1N2DA 1PSBA 3DD4A 1YVHA 1IQ3A 4MVFA 2NZ0A 4PHMA 3JTDC 1GQMA 2KYCA 4GGFA 3BYAA 3DVKA 1MXLC 3TZ1A 5I2OA 4JWQA 1QS7A 1K93D 1TNWA 3DVJA 4M2QA 3DVMA 1DMOA 2AMIA 4ZCVA 1PULA 2HQWA 2NXQA 2TN4A 1QLKA 2M7NA 2LP3A 1DJWA 1DJYA 1XA5A 3A4UB 1F54A 3TDUA 1JUOA 4ICBA 1PK0D 1NP8A 5B8IB 1MQ1A 1HT9A 2LUCA 2WC8A 1G8IA 1RJVA 2CCMA 1XFYO 1M46A 1NSHA 1JBAA 1V1GA 2JC2A 2L98A 2M49B 1L2OB 1JF2A 5DKRA 2M29A 2L50A 3EKHA 4JQ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGZ A;  1Y1X A;  2M0R A;  1ZUZ A;  4I5L B;  4R1E A;  2MLE C;  3M0W A;  3GOF A;  1KFU L;  3CR4 X;  2Y1N A;  4GGF C;  1CFF A;  2L4H A;  1KK8 C;  2MA2 A;  2E30 A;  2F2P A;  2K8M B;  5ER4 X;  1J55 A;  1UUR A;  2FCD A;  5KSZ A;  1OMV A;  2WND A;  1F8H A;  4JPZ B;  1ALV A;  1ZOT B;  1B7T Y;  3NSK A;  2JT3 A;  1TCO B;  4FTG A;  1XFW O;  4Q04 A;  3AKB A;  3I5I B;  1YTZ C;  1YUT A;  2HF5 A;  2Y4Q A;  4YGC B;  3SG4 A;  4C0J A;  3AAJ A;  3JVT C;  1JFK A;  1KK7 Z;  2JZI A;  2K61 A;  1MXE A;  1OZS A;  5AER A;  3OX5 A;  2JQ6 A;  1BMO A;  1AUI B;  2MLF C;  2ZNE A;  4MSP A;  1CMG A;  3OB1 B;  1SPY A;  2Q91 A;  1S36 A;  1UHK A;  2LV7 A;  1QTX A;  2KFF A;  4GPL B;  2KYF A;  1WDC C;  5D69 A;  1LKJ A;  5HYD A;  3PM8 A;  5CSI A;  2LVV A;  3EK4 A;  1PSR A;  1S6C A;  3DF0 B;  4P5O E;  1FI6 A;  1S26 D;  1IH0 A;  4MBE A;  4CFR A;  3CGA A;  1MR8 A;  3NSI A;  1DJX A;  5HLO A;  2AAO A;  1JF0 A;  1Y1U A;  1DJG A;  1QIW A;  1UHI A;  4NQG A;  2DOQ A;  2BL0 C;  2KI4 B;  1UWO A;  1SL7 A;  1DVI A;  2ZKM X;  3K21 A;  4GUK A;  4HSZ A;  2SAS A;  1M45 A;  1REC A;  3SG6 A;  3WXA A;  2JRF A;  3KHE A;  4WQ2 A;  4I5K A;  1SY9 A;  4OCI A;  1AP4 A;  1XVJ A;  2H61 A;  1LXF C;  3CS1 A;  1UHJ A;  1AJ4 A;  4PE7 A;  4UPG A;  4PHK A;  1CTR A;  4WQ3 A;  1PVB A;  2NCP A;  3VRP A;  1Y6W A;  1A75 A;  2JNX A;  4BY5 A;  2HET A;  3MSE B;  3FIA A;  1YX8 A;  1K94 A;  3I5G C;  3EVR A;  2K2F A;  2LC5 A;  2M97 A;  3IQQ A;  4DIR A;  2OPO A;  1EL4 A;  1CLM A;  2L5X B;  1LIN A;  4YBH B;  1EJ3 A;  1Y0V H;  2BCA A;  2IS9 A;  1N0Y A;  4PE4 A;  1R6P A;  4MN0 A;  4HRE E;  2ZRT A;  2M1K B;  4NDD A;  5HKZ A;  4ORA B;  2KFH A;  3CTN A;  2K7C A;  3D0Y A;  1Q80 A;  2BBM A;  2EC6 C;  3LK1 A;  1CDL A;  5TNC A;  2LMT A;  3VRQ A;  2KHN A;  2JT0 A;  1FI5 A;  1U5I B;  5HLV A;  1DJH A;  2H61 C;  3OB2 B;  1QV0 A;  1KQM C;  1BU3 A;  2G2B A;  1QV1 A;  1CDP A;  1OZO A;  3I5H C;  2CXJ A;  4MRX A;  2LVJ A;  2I2R E;  3WNX B;  4I5N B;  1LA3 A;  5I2L A;  1UP5 A;  2GV5 A;  2KGR A;  2ZND A;  4QJ5 B;  3FWC A;  1NX1 A;  1VRK A;  1UHH A;  2NLN A;  1C7W A;  3A8R A;  4FQO A;  1IRJ A;  2LAN A;  4USL A;  2V53 A;  5KTY A;  1KWO B;  3SG7 A;  2LUX A;  3O4Y A;  4YGD B;  5HKY A;  2JU0 A;  3SJS A;  2MJW B;  5D7F A;  1EG4 A;  4A4C A;  1F55 A;  2CNP A;  4NDB A;  3HX4 A;  4ETO A;  2JNF A;  1NUB A;  3PAT A;  1DT7 B;  1CM4 A;  3EKJ A;  3NXA A;  1J1D A;  1DJI A;  3KEV A;  1KQV A;  3LK0 A;  1NX3 A;  1KCY A;  2LMU A;  2JXL A;  1QX5 B;  3AAK A;  1AJ5 A;  1BJF A;  1AK8 A;  2L0P A;  3BUM B;  4GGN A;  1SRA A;  4DCK A;  5J3X A;  1UHN A;  4AOM A;  1CFD A;  4WRI A;  1TNX A;  4N1F A;  5JOL A;  1JWD A;  2KAX A;  2I94 A;  4YGE B;  3TS5 C;  1DTL A;  1XFV O;  1BOD A;  4CID A;  1B1G A;  2OTG C;  1BOC A;  1QX7 A;  1ZAC A;  3TUY B;  4C0K A;  3SG3 A;  1F71 A;  1SL8 A;  2AUC A;  3GK4 X;  4PDZ A;  1OQP A;  2RGI A;  4DRW A;  2QAC A;  2PAL A;  2GGM A;  3H4S E;  5FYX A;  1S5G Y;  1H8B A;  3OHM B;  3PN7 C;  1ALW A;  1J7Q A;  1S6J A;  1A2X A;  1CKK A;  2BCX A;  1MUX A;  2CT9 A;  1M39 A;  1SK6 D;  1XFZ O;  1FF1 A;  1RK9 A;  2K7O A;  1TNP A;  4XJK A;  1K96 A;  2K2A A;  3I5F B;  2F33 A;  1GGZ A;  2JWW A;  2LLU A;  2K7B A;  1SCV A;  2BE4 A;  2WOS A;  1TRF A;  1FBV A;  3IF7 A;  3QRX A;  1G33 A;  1QVI Y;  1SNL A;  2WCE A;  2COL B;  1EH2 A;  3I5G B;  1K90 D;  1FPW A;  2D8N A;  1J7R A;  2R2I A;  1YUR A;  1XK4 A;  1ZFS A;  4GBA A;  1F4O A;  2LP2 A;  1IKU A;  1J7O A;  1K2H A;  4PHN A;  4ORB B;  2M8U A;  3PLF B;  2F8P A;  3DF0 A;  4E68 A;  3TDZ A;  4A4B A;  1PAL A;  1SBJ A;  4YI9 A;  2FCE A;  2PAS A;  1MWN A;  1NX2 A;  1TTX A;  3KF9 A;  1IJ6 A;  1CB1 A;  1PVA A;  2HPS A;  3IQO A;  3BOW A;  3EK7 A;  1TNQ A;  2LE9 B;  3SIA A;  2ZRS A;  1DF0 B;  1Y1A A;  1YUU A;  1S3P A;  1YVL A;  2MHH A;  3ZWH A;  1B7T Z;  1IJ5 A;  3I5I C;  1TIZ A;  2QPT A;  3BQ3 A;  1W7J B;  2MRD A;  4OVN F;  5BPJ A;  2EHB A;  1LVC D;  2JXC A;  1RTP 1;  3BXK A;  3KO0 A;  1NPQ A;  3JTD B;  3EVV A;  4C0L A;  1S6I A;  3PFV A;  3LL8 B;  4DS7 A;  2L51 A;  3FWB A;  4PHJ A;  2JUL A;  2LLS A;  4BY4 A;  1K9P A;  1NX0 A;  2KI6 D;  1B8C A;  1EG3 A;  1QJT A;  1SCM C;  2KI6 C;  1WRZ A;  1JSA A;  1XK4 C;  4IL1 A;  2P6B B;  4PE0 A;  5CSJ A;  5G08 A;  4F0Z B;  1JC2 A;  5JJG A;  2FJU B;  3TDI A;  4QJ4 B;  1B8L A;  1K9K A;  1RRO A;  1YX7 A;  5KU1 A;  4MEW A;  1XYD A;  2CBL A;  1K8U A;  1V1F A;  3F45 A;  3EVU A;  2H2K A;  1IWQ A;  3D0Y B;  4M2O A;  1OOJ A;  3WHT B;  1WRL A;  1B9A A;  4TNC A;  5ER5 A;  2ISD A;  5AXI A;  4OV2 A;  2KDH A;  2WCF A;  2Q4U A;  1ODB A;  2OS8 C;  5AEQ A;  1OMD A;  4CPV A;  1D1O A;  4U8D A;  1J7P A;  3ZNI A;  2M7L A;  1SKT A;  1SL9 A;  1S1E A;  1U5I A;  2K0J A;  1B8R A;  1G4Y R;  3D10 A;  3RM1 A;  1TN4 A;  1KK8 B;  3KPX A;  1GJY A;  2A4J A;  3O6B A;  1ZMZ A;  1DGV A;  1KSO A;  1SR6 C;  1TOP A;  3VRN A;  1MHO A;  4GNK B;  1XO5 A;  2KGB C;  2OTG B;  3CZT X;  4N1G A;  1B47 A;  1KFU S;  3DVE A;  4YGA A;  1OSA A;  1KFX L;  1NYA A;  2KQY A;  2KBI A;  1H4B A;  4AQJ A;  2Y1M A;  5CSF A;  5GQQ C;  1DJZ A;  4I5J A;  4PCW A;  5CSN A;  1EXR A;  1KK7 Y;  2LHI A;  3JVT B;  4AQI A;  3AKA A;  3PN7 B;  2JPT A;  3PAL A;  1RFJ A;  4MLW A;  2LM5 A;  1R2U A;  2F2O A;  2MAZ A;  2F3Z A;  2LVK A;  1CNP A;  3GK1 A;  4HRG A;  1FW4 A;  2KQ6 A;  1K9U A;  1WDC B;  2MBX A;  1N65 A;  1BLQ A;  2WCB A;  1IGV A;  4GFT A;  3CWG A;  2KNE A;  2EGD A;  3O2P A;  1BF5 A;  4YRU A;  2G9B A;  1KSM A;  1B4C A;  2NCO A;  2JT8 A;  2JTT A;  3BUX B;  4HRH A;  1SYM A;  1CFP A;  1BR4 B;  1QAT A;  2BL0 B;  3SG2 A;  3CR2 A;  5I8N A;  1QX2 A;  1BG1 A;  3E3R A;  1CLL A;  1KWO C;  2PMY A;  4N5X A;  1BT6 A;  4DUQ A;  1NCZ A;  2LCP A;  1YUS A;  3GK2 A;  4QJ3 B;  3WHU B;  2I7A A;  5DKN A;  3PSR A;  3C1V A;  2ZN8 A;  2FOT A;  1QLS A;  2M3W A;  3EK8 A;  3VGO A;  1UUS A;  2I18 A;  1TCF A;  1M63 B;  2E6W A;  2O5G A;  4NDC A;  4ORC B;  1L2O C;  4XJK B;  3BUN B;  3BUW B;  1JFJ A;  4P2Y B;  1PRW A;  4YI8 A;  1CDM A;  3BUO B;  2LMV A;  1CLB A;  2PRU A;  1QXP A;  1DGU A;  1RWY A;  1SCM B;  1W7I B;  3NSL A;  4MZL A;  2KSP A;  1OMR A;  1F70 A;  2BEC A;  3OX6 A;  1XFX O;  1IG5 A;  2BE6 A;  3CLN A;  3CR5 X;  4GAO A;  4L9M A;  1J1E A;  1M31 A;  2M9G A;  2BBN A;  1F4Q A;  4MZK A;  2B1U A;  2M1U A;  2O60 A;  2HQ8 A;  3TUY C;  2EC6 B;  1K95 A;  1WLM A;  1CDN A;  1L7Z A;  2L2E A;  4OKH A;  5F6T A;  3NSO A;  3RLZ A;  3BOW B;  1KQM B;  5AAN A;  1S5G Z;  2SCP A;  1YR5 A;  3I5H B;  3SG5 A;  3LLE A;  1A75 B;  2JTZ A;  2OS8 B;  4M2P A;  2LHL A;  1HQV A;  1OE9 B;  1DF0 A;  2LVI A;  1BR1 B;  1AHR A;  1NWD A;  1YRT B;  1SW8 A;  1CM1 A;  2BKH B;  2LNK A;  3ICB A;  1IQ5 A;  2KAV A;  3I5F C;  1WY9 A;  1YRU B;  1LA0 A;  1SR6 B;  5PAL A;  2F3Y A;  1A29 A;  1QAS A;  2PVB A;  1GGW A;  1XFU O;  2KFG A;  1SMG A;  2KBM A;  1E8A A;  3HCM A;  5DKQ A;  1MF8 B;  1QVI Z;  3FS7 A;  1CFC A;  4YGB B;  2KAY A;  2LAP A;  5IBW A;  1NCY A;  1C7V A;  4PE1 A;  1NCX A;  4XYN A;  3VRO A;  3SIB A;  4OR9 B;  2KI4 C;  2K7D A;  3OP0 A;  2KOT A;  5CPV A;  1AVS A;  4CLN A;  2L4I A;  2BCB A;  1X02 A;  1KFX S;  2WOR A;  3LCP C;  1CMF A;  2BKI B;  4ZCU A;  2Y5I A;  3VRR A;  2VRG A;  5AFP A;  2LLT A;  4PAL A;  4CFQ A;  3O78 A;  5K89 A;  5I2Q A;  4D1E A;  2PSR A;  1A03 A;  5HKW A;  3TS5 B;  4MZJ A;  1NIW A;  1WLZ A;  2CTN A;  1C07 A;  2ZFD A;  1WRK A;  2ZN9 A;  4MRY A;  1QIV A;  1A4P A;  2JOJ A;  1N2D A;  1PSB A;  3DD4 A;  1YVH A;  1IQ3 A;  4MVF A;  2NZ0 A;  4PHM A;  3JTD C;  1GQM A;  2KYC A;  4GGF A;  3BYA A;  3DVK A;  1MXL C;  3TZ1 A;  5I2O A;  4JWQ A;  1QS7 A;  1K93 D;  1TNW A;  3DVJ A;  4M2Q A;  3DVM A;  1DMO A;  2AMI A;  4ZCV A;  1PUL A;  2HQW A;  2NXQ A;  2TN4 A;  1QLK A;  2M7N A;  2LP3 A;  1DJW A;  1DJY A;  1XA5 A;  3A4U B;  1F54 A;  3TDU A;  1JUO A;  4ICB A;  1PK0 D;  1NP8 A;  5B8I B;  1MQ1 A;  1HT9 A;  2LUC A;  2WC8 A;  1G8I A;  1RJV A;  2CCM A;  1XFY O;  1M46 A;  1NSH A;  1JBA A;  1V1G A;  2JC2 A;  2L98 A;  2M49 B;  1L2O B;  1JF2 A;  5DKR A;  2M29 A;  2L50 A;  3EKH A;  4JQ0 D; 
#chains in the Genus database with same CATH topology
 2GGZ A;  1Y1X A;  2M0R A;  1ZUZ A;  4I5L B;  4R1E A;  2MLE C;  3M0W A;  3GOF A;  1KFU L;  3CR4 X;  3QME A;  2Y1N A;  4GGF C;  1CFF A;  2L4H A;  3CYZ A;  1KK8 C;  2MA2 A;  3S0G A;  2E30 A;  2F2P A;  2K8M B;  2WCM A;  3DYE A;  5ER4 X;  1J55 A;  1UUR A;  2FCD A;  5KSZ A;  1OMV A;  2WND A;  1F8H A;  4JPZ B;  1ALV A;  1ZOT B;  5D3O A;  1B7T Y;  3NSK A;  2JT3 A;  1TCO B;  4FTG A;  1XFW O;  4Q04 A;  3AKB A;  3I5I B;  1YTZ C;  1YUT A;  2HF5 A;  2Y4Q A;  4YGC B;  3SG4 A;  4C0J A;  3AAJ A;  1C3Z A;  3JVT C;  1JFK A;  1KK7 Z;  2JZI A;  2K61 A;  1MXE A;  1OZS A;  5AER A;  3OX5 A;  2JQ6 A;  1BMO A;  1AUI B;  2MLF C;  2ZNE A;  4MSP A;  1CMG A;  3OB1 B;  1SPY A;  3BFA A;  2Q91 A;  1S36 A;  1UHK A;  2LV7 A;  1QTX A;  2K60 A;  2KFF A;  2KYF A;  4GPL B;  1WDC C;  5D69 A;  1LKJ A;  5HYD A;  3PM8 A;  5CSI A;  2LVV A;  3EK4 A;  1PSR A;  1S6C A;  3DF0 B;  4P5O E;  1FI6 A;  1S26 D;  4JD9 A;  1IH0 A;  4MBE A;  2WCH A;  4CFR A;  3CGA A;  1MR8 A;  3NSI A;  3R72 A;  1DJX A;  5HLO A;  2AAO A;  3VB1 A;  1JF0 A;  1Y1U A;  1DJG A;  1QIW A;  1TWO A;  1UHI A;  3D73 A;  4NQG A;  2DOQ A;  2BL0 C;  2KI4 B;  1UWO A;  1SL7 A;  3FE6 A;  1DVI A;  1QWV A;  2ZKM X;  3K21 A;  4GUK A;  4OZD A;  3SS3 A;  4HSZ A;  2SAS A;  1M45 A;  1REC A;  3SG6 A;  3WXA A;  2JRF A;  3KHE A;  4WQ2 A;  4I5K A;  1SY9 A;  4OCI A;  1AP4 A;  5DIC A;  1DEK A;  5FI6 A;  1XVJ A;  2H61 A;  1LXF C;  3CS1 A;  1UHJ A;  1AJ4 A;  2FJY A;  4PE7 A;  4UPG A;  4PHK A;  1CTR A;  1W9Z A;  2KLD A;  1PVB A;  2NCP A;  4WQ3 A;  3VRP A;  1Y6W A;  1A75 A;  2JNX A;  4BY5 A;  2HET A;  3MSE B;  3FIA A;  1YX8 A;  3FE9 A;  1K94 A;  3I5G C;  3EVR A;  2K2F A;  2LC5 A;  2M97 A;  3IQQ A;  4DIR A;  2OPO A;  1EL4 A;  1CLM A;  2L5X B;  1LIN A;  4PT1 A;  4YBH B;  1EJ3 A;  1Y0V H;  2BCA A;  2IS9 A;  1N0Y A;  2GTE A;  2L2C A;  4PE4 A;  1R6P A;  5FI7 A;  4MN0 A;  4HRE E;  2ZRT A;  2M1K B;  4NDD A;  2WCL A;  5HKZ A;  4ORA B;  2KFH A;  3CTN A;  2K7C A;  3D0Y A;  1Q80 A;  3CAB A;  2BBM A;  2EC6 C;  3LK1 A;  1CDL A;  5TNC A;  2LMT A;  3VRQ A;  2KHN A;  2JT0 A;  1FI5 A;  1U5I B;  5HLV A;  3S0A A;  1DJH A;  2H61 C;  3OB2 B;  1QV0 A;  1KQM C;  1BU3 A;  2G2B A;  1QV1 A;  1CDP A;  1OZO A;  3I5H C;  2CXJ A;  4MRX A;  2LVJ A;  2I2R E;  3WNX B;  5HL1 A;  2WCK A;  4I5N B;  1LA3 A;  5I2L A;  1UP5 A;  2GV5 A;  2JPO A;  2KGR A;  2ZND A;  4QJ5 B;  3FWC A;  1NX1 A;  1VRK A;  1UHH A;  2NLN A;  1C7W A;  2KLE A;  3A8R A;  4FQO A;  1IRJ A;  2LAN A;  4USL A;  2V53 A;  3B87 A;  5KTY A;  1KWO B;  3SG7 A;  2LUX A;  3UO9 A;  3S0E A;  3O4Y A;  4YGD B;  5HKY A;  2JU0 A;  5I94 A;  3SJS A;  2MJW B;  5D7F A;  1EG4 A;  4A4C A;  1F55 A;  2CNP A;  4NDB A;  3HX4 A;  4ETO A;  2JNF A;  1NUB A;  3PAT A;  1DT7 B;  1CM4 A;  3EKJ A;  3NXA A;  1J1D A;  1DJI A;  3KEV A;  3DZT A;  1KQV A;  3LK0 A;  1NX3 A;  1KCY A;  2LMU A;  2JXL A;  1QX5 B;  2QEH A;  1TUZ A;  1AJ5 A;  1BJF A;  3AAK A;  1AK8 A;  2L0P A;  2BNX A;  3BUM B;  4GGN A;  3SS5 A;  1SRA A;  4DCK A;  5J3X A;  1UHN A;  4AOM A;  1XFR A;  1CFD A;  4WRI A;  1TNX A;  4N1F A;  5JOL A;  1JWD A;  2KAX A;  2I94 A;  3IVT A;  3L4L A;  4YGE B;  3TS5 C;  1DTL A;  1XFV O;  3R1O A;  4CID A;  1B1G A;  1BOD A;  2QEB A;  2OTG C;  1BOC A;  1QX7 A;  1ZAC A;  3TUY B;  4C0K A;  3SG3 A;  1F71 A;  1SL8 A;  2AUC A;  3GK4 X;  4PDZ A;  1OOH A;  1OQP A;  2RGI A;  4DRW A;  2QAC A;  2PAL A;  2GGM A;  3H4S E;  3S0D A;  5FYX A;  1S5G Y;  3PJI A;  1H8B A;  3OHM B;  3PN7 C;  1ALW A;  1J7Q A;  1S6J A;  1T14 A;  1A2X A;  1CKK A;  2BCX A;  1MUX A;  2QEV A;  2CT9 A;  1M39 A;  1SK6 D;  1XFZ O;  1FF1 A;  3R1V A;  1RK9 A;  3L47 A;  3CZ1 A;  2K7O A;  3D75 A;  1TNP A;  4XJK A;  1K96 A;  2K2A A;  3I5F B;  2F33 A;  1GGZ A;  2ERB A;  2JWW A;  2LLU A;  2K7B A;  1SCV A;  2BE4 A;  2WOS A;  1TRF A;  1FBV A;  3IF7 A;  3QRX A;  1G33 A;  1QVI Y;  1SNL A;  2WCE A;  2COL B;  1EH2 A;  3I5G B;  1K90 D;  1FPW A;  2D8N A;  1J7R A;  2R2I A;  1YUR A;  3BJH A;  1XK4 A;  1ZFS A;  4GBA A;  1F4O A;  2LP2 A;  4IJ7 A;  1IKU A;  1J7O A;  1K2H A;  4PHN A;  2P70 A;  1OOG A;  4ORB B;  2M8U A;  3PLF B;  2F8P A;  3DF0 A;  4E68 A;  3TDZ A;  4A4B A;  1PAL A;  1SBJ A;  4YI9 A;  2FCE A;  2PAS A;  3NHI A;  1MWN A;  1NX2 A;  1TTX A;  3KF9 A;  1IJ6 A;  1CB1 A;  1PVA A;  2HPS A;  3IQO A;  3BOW A;  3EK7 A;  1TNQ A;  2LE9 B;  3SIA A;  1OW4 A;  1DF0 B;  1Y1A A;  1YUU A;  1S3P A;  1YVL A;  2MHH A;  2ZRS A;  3BFB A;  3ZWH A;  3NHT A;  1B7T Z;  1IJ5 A;  3I5I C;  1TIZ A;  2QPT A;  3BQ3 A;  1W7J B;  2PQL A;  2MRD A;  4OVN F;  5BPJ A;  2EHB A;  1LVC D;  2JXC A;  1RTP 1;  3BXK A;  3KO0 A;  1NPQ A;  3JTD B;  3EVV A;  4C0L A;  3Q8I A;  1S6I A;  3PFV A;  3LL8 B;  4DS7 A;  2L51 A;  3FWB A;  4PHJ A;  2JUL A;  2LLS A;  4BY4 A;  1K9P A;  1NX0 A;  2KI6 D;  1B8C A;  1EG3 A;  1QJT A;  1SCM C;  2KI6 C;  1WRZ A;  1JSA A;  1XK4 C;  4IL1 A;  2P6B B;  4PE0 A;  5CSJ A;  5G08 A;  4F0Z B;  3CZ2 A;  1JC2 A;  3L4A A;  5JJG A;  2FJU B;  3TDI A;  4QJ4 B;  1B8L A;  1K9K A;  1RRO A;  1YX7 A;  5KU1 A;  4MEW A;  1XYD A;  2CBL A;  3CDN A;  1K8U A;  1V1F A;  3F45 A;  3EVU A;  2H2K A;  1IWQ A;  3D0Y B;  4M2O A;  1OOJ A;  3WHT B;  1WRL A;  1B9A A;  4TNC A;  5ER5 A;  2ISD A;  5AXI A;  4OV2 A;  2KDH A;  2WCF A;  2Q4U A;  1ODB A;  2OS8 C;  5AEQ A;  1OMD A;  4CPV A;  1D1O A;  4U8D A;  3DY9 A;  1J7P A;  3ZNI A;  2M7L A;  1SKT A;  1SL9 A;  1S1E A;  1U5I A;  2K0J A;  1B8R A;  1G4Y R;  3D10 A;  3RM1 A;  1TN4 A;  1KK8 B;  3KPX A;  1GJY A;  2A4J A;  2WC6 A;  3O6B A;  1ZMZ A;  1DGV A;  3B86 A;  1KSO A;  1SR6 C;  1TOP A;  3VRN A;  1MHO A;  4GNK B;  1XO5 A;  2KGB C;  2OTG B;  3CZT X;  4N1G A;  1B47 A;  1KFU S;  3DVE A;  3EG5 B;  4YGA A;  1OSA A;  3D76 A;  1KFX L;  1NYA A;  4INX A;  2KQY A;  3B7A A;  2KBI A;  1H4B A;  4AQJ A;  2Y1M A;  5CSF A;  5GQQ C;  1DJZ A;  4I5J A;  4PCW A;  5CSN A;  2KPH A;  1EXR A;  1KK7 Y;  2LHI A;  3JVT B;  4AQI A;  3AKA A;  3S0F A;  3PN7 B;  2JPT A;  3PAL A;  1DEL A;  1SSE B;  1RFJ A;  4MLW A;  1OOI X;  2LM5 A;  1R2U A;  2F2O A;  2MAZ A;  2F3Z A;  2LVK A;  1CNP A;  3GK1 A;  1DC1 A;  4HRG A;  1GM0 A;  1FW4 A;  2KQ6 A;  1K9U A;  1WDC B;  2MBX A;  1N65 A;  1BLQ A;  2WCB A;  1IGV A;  4GFT A;  3CWG A;  2KNE A;  2EGD A;  3O2P A;  1BF5 A;  4YRU A;  2G9B A;  2H8V A;  1KSM A;  1B4C A;  2NCO A;  2JT8 A;  2JTT A;  3BUX B;  4HRH A;  1SYM A;  1CFP A;  1TUJ A;  1BR4 B;  3B88 A;  1QAT A;  2BL0 B;  3SG2 A;  3CR2 A;  5I8N A;  1QX2 A;  2L5Y A;  1BG1 A;  3E3R A;  4KYN A;  3RZS A;  1DQE A;  1CLL A;  5FI2 A;  1KWO C;  2PMY A;  4N5X A;  1BT6 A;  4DUQ A;  1NCZ A;  2LCP A;  1YUS A;  3GK2 A;  4QJ3 B;  3WHU B;  2I7A A;  5DKN A;  3PSR A;  3SS4 A;  3C1V A;  2ZN8 A;  2FOT A;  1QLS A;  2PYQ A;  2M3W A;  3EK8 A;  3VGO A;  1UUS A;  2I18 A;  3B6X A;  1TCF A;  1M63 B;  2E6W A;  2O5G A;  4NDC A;  4ORC B;  1L2O C;  4XJK B;  3BUN B;  3BUW B;  1JFJ A;  4P2Y B;  1PRW A;  4YI8 A;  1CDM A;  3OBV A;  3BUO B;  2LMV A;  1CLB A;  2PRU A;  1QXP A;  1DGU A;  1RWY A;  1SCM B;  1W7I B;  3NSL A;  4MZL A;  1C3Y A;  2KSP A;  1OMR A;  1F70 A;  1IIO A;  2BEC A;  3OX6 A;  1XFX O;  1IG5 A;  2BE6 A;  3CLN A;  3CR5 X;  4GAO A;  4L9M A;  1J1E A;  1M31 A;  2M9G A;  2BBN A;  1F4Q A;  3D78 A;  4MZK A;  2B1U A;  2M1U A;  2O60 A;  1ORG A;  2HQ8 A;  3TUY C;  2EC6 B;  1K95 A;  1WLM A;  1CDN A;  1L7Z A;  2L2E A;  4OKH A;  5F6T A;  3NSO A;  3RLZ A;  3BOW B;  1KQM B;  3O4X A;  5AAN A;  1S5G Z;  2SCP A;  1YR5 A;  2WCJ A;  3I5H B;  3SG5 A;  3LLE A;  1A75 B;  2JTZ A;  2OS8 B;  4M2P A;  2LHL A;  1HQV A;  1OE9 B;  1DF0 A;  2LVI A;  5EL2 A;  1Z2C B;  1BR1 B;  1AHR A;  1NWD A;  2P71 A;  1YRT B;  1SW8 A;  3FE8 A;  3D74 A;  1CM1 A;  3D77 A;  2BKH B;  2LNK A;  3ICB A;  1IQ5 A;  2KAV A;  3BFH A;  3I5F C;  1WY9 A;  1YRU B;  1LA0 A;  1SR6 B;  5PAL A;  2F3Y A;  1A29 A;  1QAS A;  1LS8 A;  2PVB A;  4INW A;  1GGW A;  1XFU O;  2KFG A;  1SMG A;  2KBM A;  1E8A A;  3HCM A;  5DKQ A;  1MF8 B;  1QVI Z;  3FS7 A;  1CFC A;  4YGB B;  2KAY A;  2LAP A;  5IBW A;  1NCY A;  1OOF A;  2BAP A;  1C7V A;  4PE1 A;  1NCX A;  4XYN A;  3VRO A;  3SIB A;  1P28 A;  4OR9 B;  2KI4 C;  2K7D A;  3OP0 A;  2KOT A;  5CPV A;  1AVS A;  4CLN A;  2L4I A;  2BCB A;  4FQT A;  1X02 A;  1KFX S;  2WOR A;  3LCP C;  1CMF A;  2BKI B;  4ZCU A;  2Y5I A;  3VRR A;  2VRG A;  5AFP A;  2LLT A;  4PAL A;  4CFQ A;  3O78 A;  5K89 A;  2WC5 A;  5I2Q A;  4D1E A;  2PSR A;  3R1P A;  5HKW A;  3TS5 B;  1A03 A;  4JKT A;  4MZJ A;  1NIW A;  1WLZ A;  2CTN A;  3N7H A;  2ZFD A;  1C07 A;  1WRK A;  2ZN9 A;  4MRY A;  1QIV A;  1A4P A;  2JOJ A;  1N2D A;  1PSB A;  3DD4 A;  1YVH A;  1IQ3 A;  4MVF A;  4F7F A;  2NZ0 A;  4PHM A;  3JTD C;  1GQM A;  2KYC A;  3S0B A;  4GGF A;  3BYA A;  3DVK A;  1MXL C;  3TZ1 A;  5I2O A;  4JWQ A;  1QS7 A;  3PM2 A;  1K93 D;  3V2L A;  1TNW A;  2YGU A;  3DVJ A;  3DVM A;  4M2Q A;  1DMO A;  2AMI A;  4ZCV A;  1PUL A;  2HQW A;  2NXQ A;  2QEO A;  2TN4 A;  3K1E A;  3OGN A;  1QLK A;  2M7N A;  2LP3 A;  1DJW A;  1DJY A;  1XA5 A;  3A4U B;  1F54 A;  3DXL A;  3TDU A;  1JUO A;  4ICB A;  1PK0 D;  1NP8 A;  3NGV A;  5B8I B;  1Z4H A;  1MQ1 A;  2QDI A;  1HT9 A;  2LUC A;  2WC8 A;  1G8I A;  1RJV A;  2CCM A;  1XFY O;  1M46 A;  1NSH A;  1JBA A;  1V1G A;  2JC2 A;  2L98 A;  3CZ0 A;  2M49 B;  1L2O B;  1JF2 A;  5DKR A;  2M29 A;  3UNW A;  2L50 A;  3EKH A;  4JQ0 D; 
#chains in the Genus database with same CATH homology
 2GGZ A;  1Y1X A;  2M0R A;  1ZUZ A;  4I5L B;  4R1E A;  2MLE C;  3M0W A;  3GOF A;  1KFU L;  3CR4 X;  2Y1N A;  4GGF C;  1CFF A;  2L4H A;  1KK8 C;  2MA2 A;  2E30 A;  2F2P A;  2K8M B;  5ER4 X;  1J55 A;  1UUR A;  2FCD A;  5KSZ A;  1OMV A;  2WND A;  1F8H A;  4JPZ B;  1ALV A;  1ZOT B;  1B7T Y;  3NSK A;  2JT3 A;  1TCO B;  4FTG A;  1XFW O;  4Q04 A;  3AKB A;  3I5I B;  1YTZ C;  1YUT A;  2HF5 A;  2Y4Q A;  4YGC B;  3SG4 A;  4C0J A;  3AAJ A;  3JVT C;  1JFK A;  1KK7 Z;  2JZI A;  2K61 A;  1MXE A;  1OZS A;  5AER A;  3OX5 A;  2JQ6 A;  1BMO A;  1AUI B;  2MLF C;  2ZNE A;  4MSP A;  1CMG A;  3OB1 B;  1SPY A;  2Q91 A;  1S36 A;  1UHK A;  2LV7 A;  1QTX A;  2KFF A;  4GPL B;  2KYF A;  1WDC C;  5D69 A;  1LKJ A;  5HYD A;  3PM8 A;  5CSI A;  2LVV A;  3EK4 A;  1PSR A;  1S6C A;  3DF0 B;  4P5O E;  1FI6 A;  1S26 D;  1IH0 A;  4MBE A;  4CFR A;  3CGA A;  1MR8 A;  3NSI A;  1DJX A;  5HLO A;  2AAO A;  1JF0 A;  1Y1U A;  1DJG A;  1QIW A;  1UHI A;  4NQG A;  2DOQ A;  2BL0 C;  2KI4 B;  1UWO A;  1SL7 A;  1DVI A;  2ZKM X;  3K21 A;  4GUK A;  4HSZ A;  2SAS A;  1M45 A;  1REC A;  3SG6 A;  3WXA A;  2JRF A;  3KHE A;  4WQ2 A;  4I5K A;  1SY9 A;  4OCI A;  1AP4 A;  1XVJ A;  2H61 A;  1LXF C;  3CS1 A;  1UHJ A;  1AJ4 A;  4PE7 A;  4UPG A;  4PHK A;  1CTR A;  4WQ3 A;  1PVB A;  2NCP A;  3VRP A;  1Y6W A;  1A75 A;  2JNX A;  4BY5 A;  2HET A;  3MSE B;  3FIA A;  1YX8 A;  1K94 A;  3I5G C;  3EVR A;  2K2F A;  2LC5 A;  2M97 A;  3IQQ A;  4DIR A;  2OPO A;  1EL4 A;  1CLM A;  2L5X B;  1LIN A;  4YBH B;  1EJ3 A;  1Y0V H;  2BCA A;  2IS9 A;  1N0Y A;  4PE4 A;  1R6P A;  4MN0 A;  4HRE E;  2ZRT A;  2M1K B;  4NDD A;  5HKZ A;  4ORA B;  2KFH A;  3CTN A;  2K7C A;  3D0Y A;  1Q80 A;  2BBM A;  2EC6 C;  3LK1 A;  1CDL A;  5TNC A;  2LMT A;  3VRQ A;  2KHN A;  2JT0 A;  1FI5 A;  1U5I B;  5HLV A;  1DJH A;  2H61 C;  3OB2 B;  1QV0 A;  1KQM C;  1BU3 A;  2G2B A;  1QV1 A;  1CDP A;  1OZO A;  3I5H C;  2CXJ A;  4MRX A;  2LVJ A;  2I2R E;  3WNX B;  4I5N B;  1LA3 A;  5I2L A;  1UP5 A;  2GV5 A;  2KGR A;  2ZND A;  4QJ5 B;  3FWC A;  1NX1 A;  1VRK A;  1UHH A;  2NLN A;  1C7W A;  3A8R A;  4FQO A;  1IRJ A;  2LAN A;  4USL A;  2V53 A;  5KTY A;  1KWO B;  3SG7 A;  2LUX A;  3O4Y A;  4YGD B;  5HKY A;  2JU0 A;  3SJS A;  2MJW B;  5D7F A;  1EG4 A;  4A4C A;  1F55 A;  2CNP A;  4NDB A;  3HX4 A;  4ETO A;  2JNF A;  1NUB A;  3PAT A;  1DT7 B;  1CM4 A;  3EKJ A;  3NXA A;  1J1D A;  1DJI A;  3KEV A;  1KQV A;  3LK0 A;  1NX3 A;  1KCY A;  2LMU A;  2JXL A;  1QX5 B;  3AAK A;  1AJ5 A;  1BJF A;  1AK8 A;  2L0P A;  3BUM B;  4GGN A;  1SRA A;  4DCK A;  5J3X A;  1UHN A;  4AOM A;  1CFD A;  4WRI A;  1TNX A;  4N1F A;  5JOL A;  1JWD A;  2KAX A;  2I94 A;  4YGE B;  3TS5 C;  1DTL A;  1XFV O;  1BOD A;  4CID A;  1B1G A;  2OTG C;  1BOC A;  1QX7 A;  1ZAC A;  3TUY B;  4C0K A;  3SG3 A;  1F71 A;  1SL8 A;  2AUC A;  3GK4 X;  4PDZ A;  1OQP A;  2RGI A;  4DRW A;  2QAC A;  2PAL A;  2GGM A;  3H4S E;  5FYX A;  1S5G Y;  1H8B A;  3OHM B;  3PN7 C;  1ALW A;  1J7Q A;  1S6J A;  1A2X A;  1CKK A;  2BCX A;  1MUX A;  2CT9 A;  1M39 A;  1SK6 D;  1XFZ O;  1FF1 A;  1RK9 A;  2K7O A;  1TNP A;  4XJK A;  1K96 A;  2K2A A;  3I5F B;  2F33 A;  1GGZ A;  2JWW A;  2LLU A;  2K7B A;  1SCV A;  2BE4 A;  2WOS A;  1TRF A;  1FBV A;  3IF7 A;  3QRX A;  1G33 A;  1QVI Y;  1SNL A;  2WCE A;  2COL B;  1EH2 A;  3I5G B;  1K90 D;  1FPW A;  2D8N A;  1J7R A;  2R2I A;  1YUR A;  1XK4 A;  1ZFS A;  4GBA A;  1F4O A;  2LP2 A;  1IKU A;  1J7O A;  1K2H A;  4PHN A;  4ORB B;  2M8U A;  3PLF B;  2F8P A;  3DF0 A;  4E68 A;  3TDZ A;  4A4B A;  1PAL A;  1SBJ A;  4YI9 A;  2FCE A;  2PAS A;  1MWN A;  1NX2 A;  1TTX A;  3KF9 A;  1IJ6 A;  1CB1 A;  1PVA A;  2HPS A;  3IQO A;  3BOW A;  3EK7 A;  1TNQ A;  2LE9 B;  3SIA A;  2ZRS A;  1DF0 B;  1Y1A A;  1YUU A;  1S3P A;  1YVL A;  2MHH A;  3ZWH A;  1B7T Z;  1IJ5 A;  3I5I C;  1TIZ A;  2QPT A;  3BQ3 A;  1W7J B;  2MRD A;  4OVN F;  5BPJ A;  2EHB A;  1LVC D;  2JXC A;  1RTP 1;  3BXK A;  3KO0 A;  1NPQ A;  3JTD B;  3EVV A;  4C0L A;  1S6I A;  3PFV A;  3LL8 B;  4DS7 A;  2L51 A;  3FWB A;  4PHJ A;  2JUL A;  2LLS A;  4BY4 A;  1K9P A;  1NX0 A;  2KI6 D;  1B8C A;  1EG3 A;  1QJT A;  1SCM C;  2KI6 C;  1WRZ A;  1JSA A;  1XK4 C;  4IL1 A;  2P6B B;  4PE0 A;  5CSJ A;  5G08 A;  4F0Z B;  1JC2 A;  5JJG A;  2FJU B;  3TDI A;  4QJ4 B;  1B8L A;  1K9K A;  1RRO A;  1YX7 A;  5KU1 A;  4MEW A;  1XYD A;  2CBL A;  1K8U A;  1V1F A;  3F45 A;  3EVU A;  2H2K A;  1IWQ A;  3D0Y B;  4M2O A;  1OOJ A;  3WHT B;  1WRL A;  1B9A A;  4TNC A;  5ER5 A;  2ISD A;  5AXI A;  4OV2 A;  2KDH A;  2WCF A;  2Q4U A;  1ODB A;  2OS8 C;  5AEQ A;  1OMD A;  4CPV A;  1D1O A;  4U8D A;  1J7P A;  3ZNI A;  2M7L A;  1SKT A;  1SL9 A;  1S1E A;  1U5I A;  2K0J A;  1B8R A;  1G4Y R;  3D10 A;  3RM1 A;  1TN4 A;  1KK8 B;  3KPX A;  1GJY A;  2A4J A;  3O6B A;  1ZMZ A;  1DGV A;  1KSO A;  1SR6 C;  1TOP A;  3VRN A;  1MHO A;  4GNK B;  1XO5 A;  2KGB C;  2OTG B;  3CZT X;  4N1G A;  1B47 A;  1KFU S;  3DVE A;  4YGA A;  1OSA A;  1KFX L;  1NYA A;  2KQY A;  2KBI A;  1H4B A;  4AQJ A;  2Y1M A;  5CSF A;  5GQQ C;  1DJZ A;  4I5J A;  4PCW A;  5CSN A;  1EXR A;  1KK7 Y;  2LHI A;  3JVT B;  4AQI A;  3AKA A;  3PN7 B;  2JPT A;  3PAL A;  1RFJ A;  4MLW A;  2LM5 A;  1R2U A;  2F2O A;  2MAZ A;  2F3Z A;  2LVK A;  1CNP A;  3GK1 A;  4HRG A;  1FW4 A;  2KQ6 A;  1K9U A;  1WDC B;  2MBX A;  1N65 A;  1BLQ A;  2WCB A;  1IGV A;  4GFT A;  3CWG A;  2KNE A;  2EGD A;  3O2P A;  1BF5 A;  4YRU A;  2G9B A;  1KSM A;  1B4C A;  2NCO A;  2JT8 A;  2JTT A;  3BUX B;  4HRH A;  1SYM A;  1CFP A;  1BR4 B;  1QAT A;  2BL0 B;  3SG2 A;  3CR2 A;  5I8N A;  1QX2 A;  1BG1 A;  3E3R A;  1CLL A;  1KWO C;  2PMY A;  4N5X A;  1BT6 A;  4DUQ A;  1NCZ A;  2LCP A;  1YUS A;  3GK2 A;  4QJ3 B;  3WHU B;  2I7A A;  5DKN A;  3PSR A;  3C1V A;  2ZN8 A;  2FOT A;  1QLS A;  2M3W A;  3EK8 A;  3VGO A;  1UUS A;  2I18 A;  1TCF A;  1M63 B;  2E6W A;  2O5G A;  4NDC A;  4ORC B;  1L2O C;  4XJK B;  3BUN B;  3BUW B;  1JFJ A;  4P2Y B;  1PRW A;  4YI8 A;  1CDM A;  3BUO B;  2LMV A;  1CLB A;  2PRU A;  1QXP A;  1DGU A;  1RWY A;  1SCM B;  1W7I B;  3NSL A;  4MZL A;  2KSP A;  1OMR A;  1F70 A;  2BEC A;  3OX6 A;  1XFX O;  1IG5 A;  2BE6 A;  3CLN A;  3CR5 X;  4GAO A;  4L9M A;  1J1E A;  1M31 A;  2M9G A;  2BBN A;  1F4Q A;  4MZK A;  2B1U A;  2M1U A;  2O60 A;  2HQ8 A;  3TUY C;  2EC6 B;  1K95 A;  1WLM A;  1CDN A;  1L7Z A;  2L2E A;  4OKH A;  5F6T A;  3NSO A;  3RLZ A;  3BOW B;  1KQM B;  5AAN A;  1S5G Z;  2SCP A;  1YR5 A;  3I5H B;  3SG5 A;  3LLE A;  1A75 B;  2JTZ A;  2OS8 B;  4M2P A;  2LHL A;  1HQV A;  1OE9 B;  1DF0 A;  2LVI A;  1BR1 B;  1AHR A;  1NWD A;  1YRT B;  1SW8 A;  1CM1 A;  2BKH B;  2LNK A;  3ICB A;  1IQ5 A;  2KAV A;  3I5F C;  1WY9 A;  1YRU B;  1LA0 A;  1SR6 B;  5PAL A;  2F3Y A;  1A29 A;  1QAS A;  2PVB A;  1GGW A;  1XFU O;  2KFG A;  1SMG A;  2KBM A;  1E8A A;  3HCM A;  5DKQ A;  1MF8 B;  1QVI Z;  3FS7 A;  1CFC A;  4YGB B;  2KAY A;  2LAP A;  5IBW A;  1NCY A;  1C7V A;  4PE1 A;  1NCX A;  4XYN A;  3VRO A;  3SIB A;  4OR9 B;  2KI4 C;  2K7D A;  3OP0 A;  2KOT A;  5CPV A;  1AVS A;  4CLN A;  2L4I A;  2BCB A;  1X02 A;  1KFX S;  2WOR A;  3LCP C;  1CMF A;  2BKI B;  4ZCU A;  2Y5I A;  3VRR A;  2VRG A;  5AFP A;  2LLT A;  4PAL A;  4CFQ A;  3O78 A;  5K89 A;  5I2Q A;  4D1E A;  2PSR A;  1A03 A;  5HKW A;  3TS5 B;  4MZJ A;  1NIW A;  1WLZ A;  2CTN A;  1C07 A;  2ZFD A;  1WRK A;  2ZN9 A;  4MRY A;  1QIV A;  1A4P A;  2JOJ A;  1N2D A;  1PSB A;  3DD4 A;  1YVH A;  1IQ3 A;  4MVF A;  2NZ0 A;  4PHM A;  3JTD C;  1GQM A;  2KYC A;  4GGF A;  3BYA A;  3DVK A;  1MXL C;  3TZ1 A;  5I2O A;  4JWQ A;  1QS7 A;  1K93 D;  1TNW A;  3DVJ A;  4M2Q A;  3DVM A;  1DMO A;  2AMI A;  4ZCV A;  1PUL A;  2HQW A;  2NXQ A;  2TN4 A;  1QLK A;  2M7N A;  2LP3 A;  1DJW A;  1DJY A;  1XA5 A;  3A4U B;  1F54 A;  3TDU A;  1JUO A;  4ICB A;  1PK0 D;  1NP8 A;  5B8I B;  1MQ1 A;  1HT9 A;  2LUC A;  2WC8 A;  1G8I A;  1RJV A;  2CCM A;  1XFY O;  1M46 A;  1NSH A;  1JBA A;  1V1G A;  2JC2 A;  2L98 A;  2M49 B;  1L2O B;  1JF2 A;  5DKR A;  2M29 A;  2L50 A;  3EKH A;  4JQ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...