3JTDB

Calcium-free scallop myosin regulatory domain with elc-d19a point mutation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Contractile protein
total genus 38
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB02
1CB1A 2KFGA 2KI6C 1QVIZ 3I5HB 1QJTA 2LLSA 2KAVA 1QATA 2JRFA 2JNXA 1FI6A 4A4BA 1DVIA 1NX0A 3LCPC 1GJYA 4N1FA 5JJGA 4XJKB 5ER4X 4XYNA 4I5KA 5J3XA 5G08A 1PSRA 3CR5X 1TNQA 3C1VA 5GQQC 1DJZA 2EC6C 3LLEA 2LLUA 1KK7Z 4HRHA 1MQ1A 3A4UB 2AAOA 1ODBA 1J7OA 1UHJA 1TNXA 1X02A 1NCXA 1NYAA 2COLB 2KAYA 2JULA 1QLSA 1NPQA 1CDMA 2WCEA 1U5IB 1F54A 5PALA 1TTXA 4PE0A 1GQMA 1BU3A 1XVJA 1CKKA 2ISDA 1AJ5A 3AAKA 1LA0A 1BMOA 3AKBA 3TDZA 4DS7A 4DUQA 3PN7C 1B8CA 1XFWO 3E3RA 1SRAA 4OV2A 2SASA 4MRYA 1QV1A 3EVVA 1Y6WA 3BUMB 4MN0A 2KAXA 1M31A 2HF5A 4PE4A 2KI4C 4A4CA 1V1GA 2BL0C 1UHHA 4MZJA 1S1EA 2EC6B 5D7FA 4ETOA 5I8NA 3FWBA 3GK4X 4NDBA 1PULA 4MZLA 4Q04A 3NSIA 2P6BB 1AUIB 3BOWA 4GGFA 2ZRTA 4WQ2A 4CFQA 1SCMC 2LE9B 2GGZA 1NUBA 1NX1A 2LHLA 4CLNA 1DF0A 4UPGA 2H61A 2D8NA 2MLEC 3M0WA 2B1UA 2BBMA 4GFTA 3VRNA 3I5GB 3EK4A 5CPVA 1BR1B 1B8RA 1J7RA 2LAPA 5HYDA 4BY5A 1F8HA 1IG5A 1W7JB 5KSZA 1FF1A 1WLZA 3EVUA 3VRRA 1H4BA 2BCBA 2CBLA 4FTGA 3PN7B 2KI6D 4ORAB 1NWDA 4P2YB 2JNFA 3CTNA 1JBAA 1ALVA 1B8LA 4BY4A 2KI4B 2JPTA 3PFVA 1SYMA 1LKJA 1CFCA 2WCBA 1DJGA 1KFXS 5KTYA 1KQMC 3NSKA 2HQWA 2L51A 3IQOA 2F33A 2FCEA 4MBEA 3EKJA 1A75B 1Y1AA 2LMTA 1PVBA 2A4JA 1TRFA 2LVKA 4PALA 4C0LA 4D1EA 1OMRA 2FJUB 1CM1A 1SCMB 4MEWA 2ZKMX 2CNPA 1OSAA 3BYAA 4PE7A 2KQYA 3EVRA 2HETA 1YUSA 2E6WA 2ZFDA 1CNPA 3CLNA 1JC2A 4PHNA 4GPLB 1M39A 1B9AA 4MRXA 3PATA 3CGAA 4QJ4B 4NDCA 4WQ3A 1XFZO 2MA2A 2LMUA 2VRGA 1QTXA 4DRWA 1C7VA 1K9PA 1KSMA 2KBIA 2ZNDA 2KSPA 2FOTA 1M45A 2BE4A 2M1KB 2OS8B 1BF5A 1J7QA 1S3PA 4XJKA 2I7AA 3AKAA 5FYXA 1LA3A 2JTTA 1AVSA 4OVNF 1NCYA 1IJ5A 4MLWA 1MXEA 1NIWA 2E30A 1Y0VH 1K94A 5DKQA 3WHUB 1OE9B 1QASA 4OR9B 2CTNA 2LLTA 2F2OA 3KF9A 2ZNEA 3NSLA 3RLZA 1SL7A 1IH0A 3JTDC 3LK1A 4GNKB 4IL1A 2JT3A 2PVBA 2Y1NA 2HPSA 2O5GA 4OCIA 3LL8B 4YBHB 1SL8A 1J1EA 1RWYA 2L0PA 1U5IA 2LUCA 5AXIA 3VROA 2KYFA 1YRUB 1IJ6A 2LM5A 3CWGA 1B1GA 1B4CA 3D10A 1S6CA 2Y1MA 2H2KA 2PALA 2K7DA 1XK4A 1KFUL 1NX2A 2KQ6A 2PSRA 1Y1UA 3SIBA 3TDIA 1K2HA 1EG4A 2K8MB 2JOJA 4MVFA 1EXRA 1S6IA 4PDZA 3CS1A 1YUTA 2AUCA 2M3WA 3NXAA 5JOLA 1HT9A 4YGAA 3MSEB 1YTZC 1F4QA 1J1DA 2ZN8A 3RM1A 3JTDB 2CT9A 1CLBA 4WRIA 1SK6D 3TDUA 2KGBC 1IGVA 2GGMA 2KBMA 1LVCD 3SG7A 4CFRA 1EL4A 1YRTB 3DVMA 3O6BA 2L4HA 2KGRA 2L98A 1ZMZA 2CXJA 1JF0A 1TCFA 1YUUA 1AHRA 1TIZA 1SPYA 4F0ZB 1GGZA 2M29A 1JFJA 4ORCB 1PK0D 3FS7A 3OX6A 1CM4A 4P5OE 1N0YA 3BXKA 2K0JA 1NCZA 4DIRA 1SKTA 4U8DA 3KEVA 2KFHA 2LHIA 1FI5A 1W7IB 1A75A 1S5GY 2JWWA 1QX7A 2KOTA 1RK9A 1OZSA 3O2PA 1EJ3A 4M2QA 4N5XA 1M46A 2JXCA 4JWQA 4YGDB 1PVAA 2K2AA 3KHEA 4PCWA 1J7PA 2BCAA 1CDLA 2QACA 3A8RA 1MF8B 1UUSA 1QX5B 4JPZB 3SIAA 2ZN9A 2K7BA 1N2DA 4GGFC 4R1EA 4PE1A 1CFFA 5CSJA 1WLMA 5ER5A 1AK8A 1QV0A 3O78A 1TNPA 4YGCB 2MAZA 2BL0B 1AJ4A 2EHBA 2M49B 2WORA 1SY9A 4NQGA 4YI9A 3D0YA 3SG5A 1BODA 3SG3A 2ZRSA 2I18A 3TS5C 1AP4A 2HQ8A 2PMYA 1DJXA 2IS9A 3VRQA 1CLLA 4YI8A 1BJFA 1S5GZ 1J55A 4YRUA 3SG6A 1XFVO 1QXPA 1JFKA 2NLNA 1MHOA 1YX7A 1S6JA 4HSZA 1KFXL 2LC5A 1K96A 5I2OA 1B47A 3KO0A 1KWOC 1IQ5A 2Y4QA 3WHTB 5AFPA 2BBNA 4CIDA 1IKUA 2EGDA 1MXLC 4I5LB 1RJVA 1F70A 3SG4A 3PM8A 1SCVA 3F45A 3O4YA 4GBAA 3BUXB 1DJHA 1LXFC 1OMDA 2JC2A 1RTP1 3QRXA 1DTLA 4MSPA 1CDPA 1KQMB 1WRZA 1SL9A 2FCDA 2MHHA 4PHJA 1QLKA 1UWOA 4GAOA 2WC8A 2JXLA 1BG1A 1K90D 1VRKA 2WNDA 3OHMB 1XFUO 3GOFA 1M63B 1A03A 1OOJA 1A4PA 3DD4A 1SMGA 1ZFSA 3SG2A 1DT7B 5KU1A 4AQIA 1NX3A 2Q4UA 3PALA 3GK2A 1R6PA 2LANA 1LINA 2M0RA 2JT8A 4HRGA 1Y1XA 1KWOB 1KSOA 4M2PA 5AEQA 4PHKA 2KHNA 1CLMA 1GGWA 3I5IC 3DF0B 4TNCA 4YGEB 1QIVA 3H4SE 2JZIA 1WY9A 2WCFA 1UHNA 1QS7A 3LK0A 3KPXA 5HKZA 4AQJA 1C7WA 2MJWB 1UURA 2M97A 1CFPA 4HREE 2M7NA 3WNXB 2F3YA 2G2BA 2K2FA 1XK4C 4PHMA 2LVJA 1TOPA 2M8UA 1YVHA 1JUOA 3TUYC 3DVKA 1RROA 3OB2B 2R2IA 1IRJA 2LVVA 2NCPA 3WXAA 4GGNA 4C0JA 2K61A 3EK8A 3CZTX 1R2UA 1QX2A 1NP8A 1PRWA 1F4OA 1TCOB 1ZACA 1V1FA 1SBJA 1FPWA 2L4IA 2NCOA 1JF2A 3I5IB 1G33A 1KK8C 2JQ6A 3JVTC 1XO5A 1ZOTB 2QPTA 1BR4B 2BCXA 2LVIA 3I5GC 5AANA 2JTZA 1K9UA 3IQQA 3IF7A 2GV5A 2LCPA 2K7CA 5F6TA 1Q80A 1XFYO 2LP2A 3EK7A 5HKWA 1C07A 5AERA 5CSIA 2NXQA 4USLA 1S26D 4QJ5B 2KNEA 3TUYB 1FW4A 1S36A 1XYDA 5K89A 1KQVA 1CFDA 2LNKA 2O60A 3CR4X 5IBWA 2MBXA 2K7OA 3HCMA 1EG3A 4QJ3B 4CPVA 1A2XA 3BUWB 2Y5IA 1KCYA 5D69A 1HQVA 1RFJA 4ICBA 1CDNA 1YURA 1DGVA 1UP5A 2H61C 1D1OA 1BOCA 1OZOA 2I2RE 4FQOA 1TN4A 1YVLA 1UHKA 1KK8B 2M1UA 2RGIA 3JVTB 2LP3A 1CTRA 4GUKA 1NSHA 1ALWA 1OMVA 2PRUA 1YX8A 1L2OC 1SR6C 2MLFC 3BUNB 4JQ0D 3TZ1A 2TN4A 2PASA 3BQ3A 2NZ0A 5I2QA 2L5XB 5CSFA 1H8BA 2F2PA 3HX4A 3OB1B 2BECA 1IWQA 2WOSA 1ZUZA 1K95A 1XFXO 1F71A 2KFFA 1PSBA 5HLOA 1RECA 2OS8C 3DVJA 1CMFA 1B7TY 2CCMA 4AOMA 5HKYA 3I5FC 1EH2A 2F3ZA 1MUXA 3OX5A 2MRDA 1TNWA 5DKNA 2Q91A 3BOWB 4YGBB 3NSOA 1G4YR 5TNCA 1QIWA 1XA5A 4NDDA 1MWNA 3ZWHA 2JT0A 1YR5A 3ICBA 1BT6A 1DF0B 1WDCC 2KYCA 3PLFB 5B8IB 2JU0A 1DGUA 1DMOA 2M9GA 1K93D 2OTGC 3DF0A 2KDHA 3EKHA 3VGOA 4I5NB 1WRKA 3ZNIA 1BLQA 1QVIY 3FIAA 5I2LA 2M7LA 1A29A 1L7ZA 1JWDA 4ORBB 1SNLA 1L2OB 1SR6B 3CR2A 5BPJA 2DOQA 3I5HC 3TS5B 1DJWA 2LUXA 3SJSA 1WRLA 1JSAA 2SCPA 1MR8A 1G8IA 2LMVA 2L50A 1PALA 3K21A 4M2OA 1K8UA 3PSRA 2BKHB 1SW8A 3AAJA 1F55A 3BUOB 4N1GA 4L9MA 4MZKA 4C0KA 1UHIA 2LV7A 3I5FB 5CSNA 2OPOA 2BE6A 2V53A 1B7TZ 3DVEA 1KK7Y 3FWCA 4E68A 1CMGA 1DJYA 3GK1A 3D0YB 5HLVA 2F8PA 4I5JA 1E8AA 2G9BA 2AMIA 1N65A 5DKRA 1DJIA 1KFUS 1FBVA 2L2EA 1IQ3A 1WDCB 2I94A 4OKHA 2OTGB 1OQPA 4ZCUA 1K9KA 3OP0A 4ZCVA 2BKIB 4DCKA 3VRPA
chains in the Genus database with same CATH superfamily
1CB1A 2KFGA 4FQTA 2KI6C 1QVIZ 3I5HB 1TUJA 2JPOA 1QJTA 2LLSA 2KAVA 2WCMA 3SS3A 1QATA 2JRFA 2JNXA 1FI6A 3B86A 4A4BA 1DVIA 1NX0A 5HL1A 3LCPC 1GJYA 4N1FA 4PT1A 5JJGA 4XJKB 5ER4X 5DICA 4XYNA 4I5KA 5J3XA 5G08A 1PSRA 1C3YA 3CR5X 1TNQA 3C1VA 5GQQC 1DJZA 2EC6C 2WC5A 3LLEA 2LLUA 1KK7Z 4HRHA 1MQ1A 3A4UB 2AAOA 1ODBA 1J7OA 1UHJA 1C3ZA 1TNXA 1X02A 1NCXA 1NYAA 2COLB 2KAYA 2JULA 1QLSA 1NPQA 1CDMA 2WCEA 1U5IB 1F54A 5PALA 3UNWA 1TTXA 4PE0A 2QEBA 1GQMA 1XFRA 1BU3A 1XVJA 1CKKA 2ISDA 1AJ5A 3AAKA 1LA0A 1BMOA 1DELA 3AKBA 3TDZA 4DS7A 4DUQA 3PN7C 1B8CA 1XFWO 3E3RA 1SRAA 4OV2A 2SASA 4MRYA 3S0EA 1QV1A 5D3OA 1DC1A 3EVVA 1Y6WA 3BUMB 4MN0A 2KAXA 3NGVA 1M31A 2HF5A 4PE4A 2KI4C 4A4CA 3OGNA 1V1GA 2BL0C 3PM2A 1UHHA 4MZJA 1S1EA 2EC6B 3QMEA 5D7FA 4ETOA 5I8NA 3FWBA 3GK4X 4NDBA 1PULA 4MZLA 4Q04A 3NSIA 2P6BB 1AUIB 3BOWA 4GGFA 2ZRTA 4WQ2A 4CFQA 1SCMC 2LE9B 2GGZA 1NUBA 1NX1A 2LHLA 4CLNA 1DF0A 4UPGA 2H61A 2D8NA 2MLEC 3M0WA 2B1UA 2BBMA 4GFTA 3VRNA 3I5GB 3EK4A 5CPVA 1BR1B 1B8RA 1J7RA 2LAPA 5HYDA 4BY5A 1F8HA 1IG5A 1W7JB 5KSZA 1FF1A 1WLZA 3EVUA 2QEHA 3VRRA 1H4BA 2BCBA 2CBLA 4FTGA 3RZSA 3PN7B 2KI6D 1OOGA 4ORAB 1NWDA 1DQEA 4P2YB 4OZDA 2JNFA 3S0GA 3CTNA 1JBAA 1ALVA 2P71A 3B7AA 1B8LA 4BY4A 2KI4B 3CZ2A 1TUZA 2JPTA 3PFVA 1SYMA 1LKJA 1CFCA 2WCBA 1DJGA 1KFXS 5KTYA 1OOIX 1KQMC 3NSKA 2HQWA 2L51A 3IQOA 2F33A 2FCEA 4MBEA 3EKJA 1A75B 1Y1AA 2LMTA 1PVBA 2A4JA 1TRFA 2LVKA 2QDIA 4PALA 4C0LA 4D1EA 1OMRA 2FJUB 4INWA 1QWVA 1CM1A 1SCMB 5EL2A 4MEWA 2ZKMX 2CNPA 1OSAA 3BYAA 4PE7A 2KQYA 2KLEA 2HETA 1YUSA 2E6WA 2ZFDA 3EVRA 3SS5A 3CLNA 1CNPA 4PHNA 1JC2A 4GPLB 1M39A 1B9AA 4MRXA 3PATA 5FI7A 3CGAA 4KYNA 4QJ4B 4NDCA 4WQ3A 1XFZO 2MA2A 2LMUA 2VRGA 1QTXA 4DRWA 1C7VA 1K9PA 1KSMA 2KBIA 2ZNDA 2KSPA 2FOTA 1M45A 2BE4A 2M1KB 2OS8B 1BF5A 1J7QA 1S3PA 3NHIA 4XJKA 2KPHA 2I7AA 3AKAA 5FYXA 1LA3A 2JTTA 1AVSA 4OVNF 1DEKA 1IJ5A 1NCYA 4MLWA 1MXEA 1NIWA 2E30A 1Y0VH 1K94A 5DKQA 3WHUB 3BFHA 1OE9B 1QASA 4OR9B 2CTNA 2LLTA 2F2OA 3KF9A 2BAPA 2ZNEA 3NSLA 3RLZA 1SL7A 3D75A 1IH0A 2ERBA 3JTDC 3LK1A 4GNKB 4IL1A 2JT3A 2PVBA 2Y1NA 2HPSA 2O5GA 3IVTA 4OCIA 3LL8B 4YBHB 1SL8A 1J1EA 1RWYA 2L0PA 3D73A 1U5IA 2LUCA 2WCLA 5AXIA 2KYFA 1YRUB 1IJ6A 2LM5A 3CWGA 3VROA 1B1GA 1B4CA 3D10A 1S6CA 2Y1MA 1OOFA 1OW4A 2H2KA 2PALA 2K7DA 1XK4A 1KFUL 1NX2A 2KQ6A 2PSRA 1Y1UA 3SIBA 3TDIA 1K2HA 1EG4A 2K8MB 2JOJA 3S0AA 4MVFA 1EXRA 1S6IA 3K1EA 4PDZA 3CS1A 1YUTA 1T14A 2AUCA 2M3WA 3NXAA 3DXLA 5JOLA 1HT9A 3CZ1A 4YGAA 3MSEB 1YTZC 1F4QA 1J1DA 2P70A 3PJIA 2ZN8A 3RM1A 3V2LA 3JTDB 2CT9A 1CLBA 4WRIA 1SK6D 3TDUA 2KGBC 1IGVA 2GGMA 2KBMA 1LVCD 3SG7A 4CFRA 1EL4A 1YRTB 3DVMA 3O6BA 2L4HA 2KGRA 2L98A 1ZMZA 3D78A 3UO9A 2CXJA 1JF0A 4INXA 1TCFA 1YUUA 1AHRA 1TIZA 3B6XA 1SPYA 4F0ZB 1GGZA 3Q8IA 2M29A 3D76A 5FI2A 1JFJA 4ORCB 1PK0D 3FS7A 3OX6A 1CM4A 4P5OE 1N0YA 3BXKA 2K0JA 1NCZA 4JD9A 4DIRA 1SKTA 4U8DA 3KEVA 2KFHA 3DZTA 2LHIA 1FI5A 1W7IB 1A75A 1S5GY 2JWWA 1QX7A 3L47A 2KOTA 1RK9A 1OZSA 3O2PA 1EJ3A 3BFAA 4M2QA 4N5XA 3SS4A 1M46A 2JXCA 3BJHA 4JWQA 4YGDB 1P28A 1PVAA 2K2AA 3KHEA 4PCWA 3FE9A 1J7PA 2BCAA 1CDLA 2QACA 3A8RA 1MF8B 1UUSA 1QX5B 4JPZB 3SIAA 2ZN9A 2K7BA 1N2DA 3BFBA 4GGFC 4PE1A 4R1EA 1CFFA 5CSJA 1WLMA 5ER5A 1AK8A 1LS8A 1QV0A 3O78A 1TNPA 4YGCB 2MAZA 2BL0B 1AJ4A 2EHBA 2M49B 2WORA 1SY9A 4NQGA 4YI9A 3D0YA 3SG5A 1BODA 3SG3A 2ZRSA 2I18A 3TS5C 1AP4A 2HQ8A 2PMYA 1DJXA 2IS9A 3VB1A 3VRQA 1CLLA 4YI8A 1BJFA 1S5GZ 1J55A 4YRUA 3SG6A 1XFVO 1QXPA 1JFKA 4F7FA 2NLNA 1MHOA 2H8VA 1YX7A 1S6JA 4HSZA 1KFXL 2LC5A 1K96A 5I2OA 1B47A 3KO0A 1KWOC 4JKTA 1IQ5A 2Y4QA 3WHTB 5AFPA 2BBNA 4CIDA 1IKUA 2EGDA 1MXLC 4I5LB 1RJVA 1F70A 3SG4A 3PM8A 1SCVA 2PYQA 3F45A 2L5YA 1W9ZA 3O4YA 4GBAA 3BUXB 1DJHA 1LXFC 3R1VA 1OMDA 2JC2A 1RTP1 3QRXA 1DTLA 4MSPA 1CDPA 1KQMB 2KLDA 1WRZA 1SL9A 2FCDA 2MHHA 4PHJA 1QLKA 1UWOA 3L4LA 4GAOA 2WC8A 2JXLA 1BG1A 1K90D 3D77A 1VRKA 2WNDA 3OHMB 1XFUO 3GOFA 1M63B 1A03A 1OOJA 2L2CA 1A4PA 3DD4A 1SMGA 1ZFSA 3SG2A 1DT7B 5KU1A 4AQIA 1NX3A 2Q4UA 5I94A 3PALA 3GK2A 1R6PA 2LANA 1LINA 2M0RA 2JT8A 4HRGA 1Y1XA 1KWOB 1KSOA 3D74A 4M2PA 5AEQA 4PHKA 2KHNA 3DY9A 1CLMA 1GGWA 3I5IC 3DF0B 4TNCA 4YGEB 1QIVA 3H4SE 2JZIA 1WY9A 2WCFA 1UHNA 1QS7A 3LK0A 3KPXA 5HKZA 4AQJA 1C7WA 2MJWB 2QEVA 1UURA 2M97A 1CFPA 4HREE 2M7NA 3NHTA 3WNXB 2F3YA 2G2BA 2K2FA 1XK4C 4PHMA 2LVJA 1TOPA 2M8UA 3OBVA 1YVHA 1JUOA 3TUYC 3DVKA 1RROA 3OB2B 3B88A 2R2IA 1IRJA 2LVVA 2NCPA 3WXAA 4GGNA 4C0JA 1IIOA 2K61A 3S0BA 3EK8A 3CZTX 1R2UA 1QX2A 1ORGA 1NP8A 1PRWA 1F4OA 1Z2CB 1TCOB 1ZACA 1V1FA 1SBJA 1FPWA 2L4IA 2NCOA 1JF2A 3I5IB 1G33A 1KK8C 2JQ6A 3JVTC 1XO5A 1ZOTB 2QPTA 1BR4B 2BCXA 2LVIA 3I5GC 3R1OA 5AANA 2JTZA 1K9UA 3IQQA 3IF7A 2GV5A 2WCKA 2LCPA 2K7CA 2WCJA 5F6TA 1Q80A 1XFYO 2LP2A 3EK7A 5HKWA 1C07A 3CABA 2PQLA 2NXQA 4USLA 5CSIA 3CDNA 1S26D 4QJ5B 5AERA 2KNEA 3TUYB 3S0FA 4IJ7A 1FW4A 1S36A 1XYDA 2GTEA 5K89A 1CFDA 1KQVA 2LNKA 2O60A 3B87A 3CR4X 5IBWA 2MBXA 2K7OA 3HCMA 1EG3A 3DYEA 4QJ3B 1A2XA 3BUWB 4CPVA 2Y5IA 1KCYA 5D69A 1HQVA 1RFJA 4ICBA 1CDNA 1YURA 1DGVA 1UP5A 3S0DA 2H61C 1D1OA 1BOCA 1OZOA 2I2RE 4FQOA 1TN4A 1YVLA 1UHKA 1KK8B 2M1UA 2RGIA 3EG5B 2LP3A 1CTRA 3JVTB 1NSHA 4GUKA 2WCHA 1ALWA 1OMVA 2PRUA 1YX8A 1L2OC 1SR6C 2MLFC 3BUNB 4JQ0D 3TZ1A 5B8IB 3CZ0A 2TN4A 2BNXA 2PASA 2NZ0A 3BQ3A 2L5XB 5CSFA 5I2QA 2F2PA 3HX4A 3OB1B 2BECA 1H8BA 1IWQA 2WOSA 1ZUZA 1K95A 1XFXO 1F71A 2KFFA 1PSBA 5HLOA 3L4AA 1RECA 1SSEB 2OS8C 3DVJA 1CMFA 1B7TY 2CCMA 3FE8A 4AOMA 5HKYA 3I5FC 1EH2A 2F3ZA 1MUXA 3OX5A 2WC6A 2K60A 2MRDA 1TNWA 1Z4HA 5DKNA 2Q91A 3BOWB 4YGBB 2FJYA 3NSOA 1G4YR 5TNCA 1QIWA 1XA5A 4NDDA 1MWNA 3ZWHA 2JT0A 1YR5A 3ICBA 1BT6A 1DF0B 1WDCC 2KYCA 3PLFB 3O4XA 1OOHA 2JU0A 1DGUA 1DMOA 2M9GA 1K93D 2OTGC 3DF0A 2KDHA 3EKHA 3VGOA 4I5NB 1WRKA 3ZNIA 1BLQA 1QVIY 1TWOA 3FIAA 5I2LA 2M7LA 1A29A 1L7ZA 1JWDA 4ORBB 1SNLA 1L2OB 1SR6B 3CR2A 5BPJA 2DOQA 3I5HC 5FI6A 1DJWA 2LUXA 2YGUA 3SJSA 3TS5B 3N7HA 1WRLA 3R1PA 1JSAA 2SCPA 1MR8A 1G8IA 2LMVA 2L50A 1PALA 3K21A 4M2OA 1K8UA 3PSRA 2BKHB 1SW8A 3AAJA 1F55A 3BUOB 4N1GA 4L9MA 4MZKA 4C0KA 1UHIA 2LV7A 1GM0A 3I5FB 5CSNA 2OPOA 2BE6A 2V53A 1B7TZ 3DVEA 1KK7Y 3FWCA 4E68A 3R72A 1CMGA 1DJYA 3GK1A 3D0YB 5HLVA 2F8PA 4I5JA 1E8AA 2G9BA 3CYZA 2AMIA 1N65A 5DKRA 1DJIA 1KFUS 1FBVA 2L2EA 1IQ3A 1WDCB 2I94A 4OKHA 2OTGB 1OQPA 2QEOA 4ZCUA 1K9KA 3OP0A 4ZCVA 3FE6A 2BKIB 4DCKA 3VRPA
chains in the Genus database with same CATH topology
1CB1A 2KFGA 2KI6C 1QVIZ 3I5HB 1QJTA 2LLSA 2KAVA 1QATA 2JRFA 2JNXA 1FI6A 4A4BA 1DVIA 1NX0A 3LCPC 1GJYA 4N1FA 5JJGA 4XJKB 5ER4X 4XYNA 4I5KA 5J3XA 5G08A 1PSRA 3CR5X 1TNQA 3C1VA 5GQQC 1DJZA 2EC6C 3LLEA 2LLUA 1KK7Z 4HRHA 1MQ1A 3A4UB 2AAOA 1ODBA 1J7OA 1UHJA 1TNXA 1X02A 1NCXA 1NYAA 2COLB 2KAYA 2JULA 1QLSA 1NPQA 1CDMA 2WCEA 1U5IB 1F54A 5PALA 1TTXA 4PE0A 1GQMA 1BU3A 1XVJA 1CKKA 2ISDA 1AJ5A 3AAKA 1LA0A 1BMOA 3AKBA 3TDZA 4DS7A 4DUQA 3PN7C 1B8CA 1XFWO 3E3RA 1SRAA 4OV2A 2SASA 4MRYA 1QV1A 3EVVA 1Y6WA 3BUMB 4MN0A 2KAXA 1M31A 2HF5A 4PE4A 2KI4C 4A4CA 1V1GA 2BL0C 1UHHA 4MZJA 1S1EA 2EC6B 5D7FA 4ETOA 5I8NA 3FWBA 3GK4X 4NDBA 1PULA 4MZLA 4Q04A 3NSIA 2P6BB 1AUIB 3BOWA 4GGFA 2ZRTA 4WQ2A 4CFQA 1SCMC 2LE9B 2GGZA 1NUBA 1NX1A 2LHLA 4CLNA 1DF0A 4UPGA 2H61A 2D8NA 2MLEC 3M0WA 2B1UA 2BBMA 4GFTA 3VRNA 3I5GB 3EK4A 5CPVA 1BR1B 1B8RA 1J7RA 2LAPA 5HYDA 4BY5A 1F8HA 1IG5A 1W7JB 5KSZA 1FF1A 1WLZA 3EVUA 3VRRA 1H4BA 2BCBA 2CBLA 4FTGA 3PN7B 2KI6D 4ORAB 1NWDA 4P2YB 2JNFA 3CTNA 1JBAA 1ALVA 1B8LA 4BY4A 2KI4B 2JPTA 3PFVA 1SYMA 1LKJA 1CFCA 2WCBA 1DJGA 1KFXS 5KTYA 1KQMC 3NSKA 2HQWA 2L51A 3IQOA 2F33A 2FCEA 4MBEA 3EKJA 1A75B 1Y1AA 2LMTA 1PVBA 2A4JA 1TRFA 2LVKA 4PALA 4C0LA 4D1EA 1OMRA 2FJUB 1CM1A 1SCMB 4MEWA 2ZKMX 2CNPA 1OSAA 3BYAA 4PE7A 2KQYA 3EVRA 2HETA 1YUSA 2E6WA 2ZFDA 1CNPA 3CLNA 1JC2A 4PHNA 4GPLB 1M39A 1B9AA 4MRXA 3PATA 3CGAA 4QJ4B 4NDCA 4WQ3A 1XFZO 2MA2A 2LMUA 2VRGA 1QTXA 4DRWA 1C7VA 1K9PA 1KSMA 2KBIA 2ZNDA 2KSPA 2FOTA 1M45A 2BE4A 2M1KB 2OS8B 1BF5A 1J7QA 1S3PA 4XJKA 2I7AA 3AKAA 5FYXA 1LA3A 2JTTA 1AVSA 4OVNF 1NCYA 1IJ5A 4MLWA 1MXEA 1NIWA 2E30A 1Y0VH 1K94A 5DKQA 3WHUB 1OE9B 1QASA 4OR9B 2CTNA 2LLTA 2F2OA 3KF9A 2ZNEA 3NSLA 3RLZA 1SL7A 1IH0A 3JTDC 3LK1A 4GNKB 4IL1A 2JT3A 2PVBA 2Y1NA 2HPSA 2O5GA 4OCIA 3LL8B 4YBHB 1SL8A 1J1EA 1RWYA 2L0PA 1U5IA 2LUCA 5AXIA 3VROA 2KYFA 1YRUB 1IJ6A 2LM5A 3CWGA 1B1GA 1B4CA 3D10A 1S6CA 2Y1MA 2H2KA 2PALA 2K7DA 1XK4A 1KFUL 1NX2A 2KQ6A 2PSRA 1Y1UA 3SIBA 3TDIA 1K2HA 1EG4A 2K8MB 2JOJA 4MVFA 1EXRA 1S6IA 4PDZA 3CS1A 1YUTA 2AUCA 2M3WA 3NXAA 5JOLA 1HT9A 4YGAA 3MSEB 1YTZC 1F4QA 1J1DA 2ZN8A 3RM1A 3JTDB 2CT9A 1CLBA 4WRIA 1SK6D 3TDUA 2KGBC 1IGVA 2GGMA 2KBMA 1LVCD 3SG7A 4CFRA 1EL4A 1YRTB 3DVMA 3O6BA 2L4HA 2KGRA 2L98A 1ZMZA 2CXJA 1JF0A 1TCFA 1YUUA 1AHRA 1TIZA 1SPYA 4F0ZB 1GGZA 2M29A 1JFJA 4ORCB 1PK0D 3FS7A 3OX6A 1CM4A 4P5OE 1N0YA 3BXKA 2K0JA 1NCZA 4DIRA 1SKTA 4U8DA 3KEVA 2KFHA 2LHIA 1FI5A 1W7IB 1A75A 1S5GY 2JWWA 1QX7A 2KOTA 1RK9A 1OZSA 3O2PA 1EJ3A 4M2QA 4N5XA 1M46A 2JXCA 4JWQA 4YGDB 1PVAA 2K2AA 3KHEA 4PCWA 1J7PA 2BCAA 1CDLA 2QACA 3A8RA 1MF8B 1UUSA 1QX5B 4JPZB 3SIAA 2ZN9A 2K7BA 1N2DA 4GGFC 4R1EA 4PE1A 1CFFA 5CSJA 1WLMA 5ER5A 1AK8A 1QV0A 3O78A 1TNPA 4YGCB 2MAZA 2BL0B 1AJ4A 2EHBA 2M49B 2WORA 1SY9A 4NQGA 4YI9A 3D0YA 3SG5A 1BODA 3SG3A 2ZRSA 2I18A 3TS5C 1AP4A 2HQ8A 2PMYA 1DJXA 2IS9A 3VRQA 1CLLA 4YI8A 1BJFA 1S5GZ 1J55A 4YRUA 3SG6A 1XFVO 1QXPA 1JFKA 2NLNA 1MHOA 1YX7A 1S6JA 4HSZA 1KFXL 2LC5A 1K96A 5I2OA 1B47A 3KO0A 1KWOC 1IQ5A 2Y4QA 3WHTB 5AFPA 2BBNA 4CIDA 1IKUA 2EGDA 1MXLC 4I5LB 1RJVA 1F70A 3SG4A 3PM8A 1SCVA 3F45A 3O4YA 4GBAA 3BUXB 1DJHA 1LXFC 1OMDA 2JC2A 1RTP1 3QRXA 1DTLA 4MSPA 1CDPA 1KQMB 1WRZA 1SL9A 2FCDA 2MHHA 4PHJA 1QLKA 1UWOA 4GAOA 2WC8A 2JXLA 1BG1A 1K90D 1VRKA 2WNDA 3OHMB 1XFUO 3GOFA 1M63B 1A03A 1OOJA 1A4PA 3DD4A 1SMGA 1ZFSA 3SG2A 1DT7B 5KU1A 4AQIA 1NX3A 2Q4UA 3PALA 3GK2A 1R6PA 2LANA 1LINA 2M0RA 2JT8A 4HRGA 1Y1XA 1KWOB 1KSOA 4M2PA 5AEQA 4PHKA 2KHNA 1CLMA 1GGWA 3I5IC 3DF0B 4TNCA 4YGEB 1QIVA 3H4SE 2JZIA 1WY9A 2WCFA 1UHNA 1QS7A 3LK0A 3KPXA 5HKZA 4AQJA 1C7WA 2MJWB 1UURA 2M97A 1CFPA 4HREE 2M7NA 3WNXB 2F3YA 2G2BA 2K2FA 1XK4C 4PHMA 2LVJA 1TOPA 2M8UA 1YVHA 1JUOA 3TUYC 3DVKA 1RROA 3OB2B 2R2IA 1IRJA 2LVVA 2NCPA 3WXAA 4GGNA 4C0JA 2K61A 3EK8A 3CZTX 1R2UA 1QX2A 1NP8A 1PRWA 1F4OA 1TCOB 1ZACA 1V1FA 1SBJA 1FPWA 2L4IA 2NCOA 1JF2A 3I5IB 1G33A 1KK8C 2JQ6A 3JVTC 1XO5A 1ZOTB 2QPTA 1BR4B 2BCXA 2LVIA 3I5GC 5AANA 2JTZA 1K9UA 3IQQA 3IF7A 2GV5A 2LCPA 2K7CA 5F6TA 1Q80A 1XFYO 2LP2A 3EK7A 5HKWA 1C07A 5AERA 5CSIA 2NXQA 4USLA 1S26D 4QJ5B 2KNEA 3TUYB 1FW4A 1S36A 1XYDA 5K89A 1KQVA 1CFDA 2LNKA 2O60A 3CR4X 5IBWA 2MBXA 2K7OA 3HCMA 1EG3A 4QJ3B 4CPVA 1A2XA 3BUWB 2Y5IA 1KCYA 5D69A 1HQVA 1RFJA 4ICBA 1CDNA 1YURA 1DGVA 1UP5A 2H61C 1D1OA 1BOCA 1OZOA 2I2RE 4FQOA 1TN4A 1YVLA 1UHKA 1KK8B 2M1UA 2RGIA 3JVTB 2LP3A 1CTRA 4GUKA 1NSHA 1ALWA 1OMVA 2PRUA 1YX8A 1L2OC 1SR6C 2MLFC 3BUNB 4JQ0D 3TZ1A 2TN4A 2PASA 3BQ3A 2NZ0A 5I2QA 2L5XB 5CSFA 1H8BA 2F2PA 3HX4A 3OB1B 2BECA 1IWQA 2WOSA 1ZUZA 1K95A 1XFXO 1F71A 2KFFA 1PSBA 5HLOA 1RECA 2OS8C 3DVJA 1CMFA 1B7TY 2CCMA 4AOMA 5HKYA 3I5FC 1EH2A 2F3ZA 1MUXA 3OX5A 2MRDA 1TNWA 5DKNA 2Q91A 3BOWB 4YGBB 3NSOA 1G4YR 5TNCA 1QIWA 1XA5A 4NDDA 1MWNA 3ZWHA 2JT0A 1YR5A 3ICBA 1BT6A 1DF0B 1WDCC 2KYCA 3PLFB 5B8IB 2JU0A 1DGUA 1DMOA 2M9GA 1K93D 2OTGC 3DF0A 2KDHA 3EKHA 3VGOA 4I5NB 1WRKA 3ZNIA 1BLQA 1QVIY 3FIAA 5I2LA 2M7LA 1A29A 1L7ZA 1JWDA 4ORBB 1SNLA 1L2OB 1SR6B 3CR2A 5BPJA 2DOQA 3I5HC 3TS5B 1DJWA 2LUXA 3SJSA 1WRLA 1JSAA 2SCPA 1MR8A 1G8IA 2LMVA 2L50A 1PALA 3K21A 4M2OA 1K8UA 3PSRA 2BKHB 1SW8A 3AAJA 1F55A 3BUOB 4N1GA 4L9MA 4MZKA 4C0KA 1UHIA 2LV7A 3I5FB 5CSNA 2OPOA 2BE6A 2V53A 1B7TZ 3DVEA 1KK7Y 3FWCA 4E68A 1CMGA 1DJYA 3GK1A 3D0YB 5HLVA 2F8PA 4I5JA 1E8AA 2G9BA 2AMIA 1N65A 5DKRA 1DJIA 1KFUS 1FBVA 2L2EA 1IQ3A 1WDCB 2I94A 4OKHA 2OTGB 1OQPA 4ZCUA 1K9KA 3OP0A 4ZCVA 2BKIB 4DCKA 3VRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB1 A;  2KFG A;  2KI6 C;  1QVI Z;  3I5H B;  1QJT A;  2LLS A;  2KAV A;  1QAT A;  2JRF A;  2JNX A;  1FI6 A;  4A4B A;  1DVI A;  1NX0 A;  3LCP C;  1GJY A;  4N1F A;  5JJG A;  4XJK B;  5ER4 X;  4XYN A;  4I5K A;  5J3X A;  5G08 A;  1PSR A;  3CR5 X;  1TNQ A;  3C1V A;  5GQQ C;  1DJZ A;  2EC6 C;  3LLE A;  2LLU A;  1KK7 Z;  4HRH A;  1MQ1 A;  3A4U B;  2AAO A;  1ODB A;  1J7O A;  1UHJ A;  1TNX A;  1X02 A;  1NCX A;  1NYA A;  2COL B;  2KAY A;  2JUL A;  1QLS A;  1NPQ A;  1CDM A;  2WCE A;  1U5I B;  1F54 A;  5PAL A;  1TTX A;  4PE0 A;  1GQM A;  1BU3 A;  1XVJ A;  1CKK A;  2ISD A;  1AJ5 A;  3AAK A;  1LA0 A;  1BMO A;  3AKB A;  3TDZ A;  4DS7 A;  4DUQ A;  3PN7 C;  1B8C A;  1XFW O;  3E3R A;  1SRA A;  4OV2 A;  2SAS A;  4MRY A;  1QV1 A;  3EVV A;  1Y6W A;  3BUM B;  4MN0 A;  2KAX A;  1M31 A;  2HF5 A;  4PE4 A;  2KI4 C;  4A4C A;  1V1G A;  2BL0 C;  1UHH A;  4MZJ A;  1S1E A;  2EC6 B;  5D7F A;  4ETO A;  5I8N A;  3FWB A;  3GK4 X;  4NDB A;  1PUL A;  4MZL A;  4Q04 A;  3NSI A;  2P6B B;  1AUI B;  3BOW A;  4GGF A;  2ZRT A;  4WQ2 A;  4CFQ A;  1SCM C;  2LE9 B;  2GGZ A;  1NUB A;  1NX1 A;  2LHL A;  4CLN A;  1DF0 A;  4UPG A;  2H61 A;  2D8N A;  2MLE C;  3M0W A;  2B1U A;  2BBM A;  4GFT A;  3VRN A;  3I5G B;  3EK4 A;  5CPV A;  1BR1 B;  1B8R A;  1J7R A;  2LAP A;  5HYD A;  4BY5 A;  1F8H A;  1IG5 A;  1W7J B;  5KSZ A;  1FF1 A;  1WLZ A;  3EVU A;  3VRR A;  1H4B A;  2BCB A;  2CBL A;  4FTG A;  3PN7 B;  2KI6 D;  4ORA B;  1NWD A;  4P2Y B;  2JNF A;  3CTN A;  1JBA A;  1ALV A;  1B8L A;  4BY4 A;  2KI4 B;  2JPT A;  3PFV A;  1SYM A;  1LKJ A;  1CFC A;  2WCB A;  1DJG A;  1KFX S;  5KTY A;  1KQM C;  3NSK A;  2HQW A;  2L51 A;  3IQO A;  2F33 A;  2FCE A;  4MBE A;  3EKJ A;  1A75 B;  1Y1A A;  2LMT A;  1PVB A;  2A4J A;  1TRF A;  2LVK A;  4PAL A;  4C0L A;  4D1E A;  1OMR A;  2FJU B;  1CM1 A;  1SCM B;  4MEW A;  2ZKM X;  2CNP A;  1OSA A;  3BYA A;  4PE7 A;  2KQY A;  3EVR A;  2HET A;  1YUS A;  2E6W A;  2ZFD A;  1CNP A;  3CLN A;  1JC2 A;  4PHN A;  4GPL B;  1M39 A;  1B9A A;  4MRX A;  3PAT A;  3CGA A;  4QJ4 B;  4NDC A;  4WQ3 A;  1XFZ O;  2MA2 A;  2LMU A;  2VRG A;  1QTX A;  4DRW A;  1C7V A;  1K9P A;  1KSM A;  2KBI A;  2ZND A;  2KSP A;  2FOT A;  1M45 A;  2BE4 A;  2M1K B;  2OS8 B;  1BF5 A;  1J7Q A;  1S3P A;  4XJK A;  2I7A A;  3AKA A;  5FYX A;  1LA3 A;  2JTT A;  1AVS A;  4OVN F;  1NCY A;  1IJ5 A;  4MLW A;  1MXE A;  1NIW A;  2E30 A;  1Y0V H;  1K94 A;  5DKQ A;  3WHU B;  1OE9 B;  1QAS A;  4OR9 B;  2CTN A;  2LLT A;  2F2O A;  3KF9 A;  2ZNE A;  3NSL A;  3RLZ A;  1SL7 A;  1IH0 A;  3JTD C;  3LK1 A;  4GNK B;  4IL1 A;  2JT3 A;  2PVB A;  2Y1N A;  2HPS A;  2O5G A;  4OCI A;  3LL8 B;  4YBH B;  1SL8 A;  1J1E A;  1RWY A;  2L0P A;  1U5I A;  2LUC A;  5AXI A;  3VRO A;  2KYF A;  1YRU B;  1IJ6 A;  2LM5 A;  3CWG A;  1B1G A;  1B4C A;  3D10 A;  1S6C A;  2Y1M A;  2H2K A;  2PAL A;  2K7D A;  1XK4 A;  1KFU L;  1NX2 A;  2KQ6 A;  2PSR A;  1Y1U A;  3SIB A;  3TDI A;  1K2H A;  1EG4 A;  2K8M B;  2JOJ A;  4MVF A;  1EXR A;  1S6I A;  4PDZ A;  3CS1 A;  1YUT A;  2AUC A;  2M3W A;  3NXA A;  5JOL A;  1HT9 A;  4YGA A;  3MSE B;  1YTZ C;  1F4Q A;  1J1D A;  2ZN8 A;  3RM1 A;  3JTD B;  2CT9 A;  1CLB A;  4WRI A;  1SK6 D;  3TDU A;  2KGB C;  1IGV A;  2GGM A;  2KBM A;  1LVC D;  3SG7 A;  4CFR A;  1EL4 A;  1YRT B;  3DVM A;  3O6B A;  2L4H A;  2KGR A;  2L98 A;  1ZMZ A;  2CXJ A;  1JF0 A;  1TCF A;  1YUU A;  1AHR A;  1TIZ A;  1SPY A;  4F0Z B;  1GGZ A;  2M29 A;  1JFJ A;  4ORC B;  1PK0 D;  3FS7 A;  3OX6 A;  1CM4 A;  4P5O E;  1N0Y A;  3BXK A;  2K0J A;  1NCZ A;  4DIR A;  1SKT A;  4U8D A;  3KEV A;  2KFH A;  2LHI A;  1FI5 A;  1W7I B;  1A75 A;  1S5G Y;  2JWW A;  1QX7 A;  2KOT A;  1RK9 A;  1OZS A;  3O2P A;  1EJ3 A;  4M2Q A;  4N5X A;  1M46 A;  2JXC A;  4JWQ A;  4YGD B;  1PVA A;  2K2A A;  3KHE A;  4PCW A;  1J7P A;  2BCA A;  1CDL A;  2QAC A;  3A8R A;  1MF8 B;  1UUS A;  1QX5 B;  4JPZ B;  3SIA A;  2ZN9 A;  2K7B A;  1N2D A;  4GGF C;  4R1E A;  4PE1 A;  1CFF A;  5CSJ A;  1WLM A;  5ER5 A;  1AK8 A;  1QV0 A;  3O78 A;  1TNP A;  4YGC B;  2MAZ A;  2BL0 B;  1AJ4 A;  2EHB A;  2M49 B;  2WOR A;  1SY9 A;  4NQG A;  4YI9 A;  3D0Y A;  3SG5 A;  1BOD A;  3SG3 A;  2ZRS A;  2I18 A;  3TS5 C;  1AP4 A;  2HQ8 A;  2PMY A;  1DJX A;  2IS9 A;  3VRQ A;  1CLL A;  4YI8 A;  1BJF A;  1S5G Z;  1J55 A;  4YRU A;  3SG6 A;  1XFV O;  1QXP A;  1JFK A;  2NLN A;  1MHO A;  1YX7 A;  1S6J A;  4HSZ A;  1KFX L;  2LC5 A;  1K96 A;  5I2O A;  1B47 A;  3KO0 A;  1KWO C;  1IQ5 A;  2Y4Q A;  3WHT B;  5AFP A;  2BBN A;  4CID A;  1IKU A;  2EGD A;  1MXL C;  4I5L B;  1RJV A;  1F70 A;  3SG4 A;  3PM8 A;  1SCV A;  3F45 A;  3O4Y A;  4GBA A;  3BUX B;  1DJH A;  1LXF C;  1OMD A;  2JC2 A;  1RTP 1;  3QRX A;  1DTL A;  4MSP A;  1CDP A;  1KQM B;  1WRZ A;  1SL9 A;  2FCD A;  2MHH A;  4PHJ A;  1QLK A;  1UWO A;  4GAO A;  2WC8 A;  2JXL A;  1BG1 A;  1K90 D;  1VRK A;  2WND A;  3OHM B;  1XFU O;  3GOF A;  1M63 B;  1A03 A;  1OOJ A;  1A4P A;  3DD4 A;  1SMG A;  1ZFS A;  3SG2 A;  1DT7 B;  5KU1 A;  4AQI A;  1NX3 A;  2Q4U A;  3PAL A;  3GK2 A;  1R6P A;  2LAN A;  1LIN A;  2M0R A;  2JT8 A;  4HRG A;  1Y1X A;  1KWO B;  1KSO A;  4M2P A;  5AEQ A;  4PHK A;  2KHN A;  1CLM A;  1GGW A;  3I5I C;  3DF0 B;  4TNC A;  4YGE B;  1QIV A;  3H4S E;  2JZI A;  1WY9 A;  2WCF A;  1UHN A;  1QS7 A;  3LK0 A;  3KPX A;  5HKZ A;  4AQJ A;  1C7W A;  2MJW B;  1UUR A;  2M97 A;  1CFP A;  4HRE E;  2M7N A;  3WNX B;  2F3Y A;  2G2B A;  2K2F A;  1XK4 C;  4PHM A;  2LVJ A;  1TOP A;  2M8U A;  1YVH A;  1JUO A;  3TUY C;  3DVK A;  1RRO A;  3OB2 B;  2R2I A;  1IRJ A;  2LVV A;  2NCP A;  3WXA A;  4GGN A;  4C0J A;  2K61 A;  3EK8 A;  3CZT X;  1R2U A;  1QX2 A;  1NP8 A;  1PRW A;  1F4O A;  1TCO B;  1ZAC A;  1V1F A;  1SBJ A;  1FPW A;  2L4I A;  2NCO A;  1JF2 A;  3I5I B;  1G33 A;  1KK8 C;  2JQ6 A;  3JVT C;  1XO5 A;  1ZOT B;  2QPT A;  1BR4 B;  2BCX A;  2LVI A;  3I5G C;  5AAN A;  2JTZ A;  1K9U A;  3IQQ A;  3IF7 A;  2GV5 A;  2LCP A;  2K7C A;  5F6T A;  1Q80 A;  1XFY O;  2LP2 A;  3EK7 A;  5HKW A;  1C07 A;  5AER A;  5CSI A;  2NXQ A;  4USL A;  1S26 D;  4QJ5 B;  2KNE A;  3TUY B;  1FW4 A;  1S36 A;  1XYD A;  5K89 A;  1KQV A;  1CFD A;  2LNK A;  2O60 A;  3CR4 X;  5IBW A;  2MBX A;  2K7O A;  3HCM A;  1EG3 A;  4QJ3 B;  4CPV A;  1A2X A;  3BUW B;  2Y5I A;  1KCY A;  5D69 A;  1HQV A;  1RFJ A;  4ICB A;  1CDN A;  1YUR A;  1DGV A;  1UP5 A;  2H61 C;  1D1O A;  1BOC A;  1OZO A;  2I2R E;  4FQO A;  1TN4 A;  1YVL A;  1UHK A;  1KK8 B;  2M1U A;  2RGI A;  3JVT B;  2LP3 A;  1CTR A;  4GUK A;  1NSH A;  1ALW A;  1OMV A;  2PRU A;  1YX8 A;  1L2O C;  1SR6 C;  2MLF C;  3BUN B;  4JQ0 D;  3TZ1 A;  2TN4 A;  2PAS A;  3BQ3 A;  2NZ0 A;  5I2Q A;  2L5X B;  5CSF A;  1H8B A;  2F2P A;  3HX4 A;  3OB1 B;  2BEC A;  1IWQ A;  2WOS A;  1ZUZ A;  1K95 A;  1XFX O;  1F71 A;  2KFF A;  1PSB A;  5HLO A;  1REC A;  2OS8 C;  3DVJ A;  1CMF A;  1B7T Y;  2CCM A;  4AOM A;  5HKY A;  3I5F C;  1EH2 A;  2F3Z A;  1MUX A;  3OX5 A;  2MRD A;  1TNW A;  5DKN A;  2Q91 A;  3BOW B;  4YGB B;  3NSO A;  1G4Y R;  5TNC A;  1QIW A;  1XA5 A;  4NDD A;  1MWN A;  3ZWH A;  2JT0 A;  1YR5 A;  3ICB A;  1BT6 A;  1DF0 B;  1WDC C;  2KYC A;  3PLF B;  5B8I B;  2JU0 A;  1DGU A;  1DMO A;  2M9G A;  1K93 D;  2OTG C;  3DF0 A;  2KDH A;  3EKH A;  3VGO A;  4I5N B;  1WRK A;  3ZNI A;  1BLQ A;  1QVI Y;  3FIA A;  5I2L A;  2M7L A;  1A29 A;  1L7Z A;  1JWD A;  4ORB B;  1SNL A;  1L2O B;  1SR6 B;  3CR2 A;  5BPJ A;  2DOQ A;  3I5H C;  3TS5 B;  1DJW A;  2LUX A;  3SJS A;  1WRL A;  1JSA A;  2SCP A;  1MR8 A;  1G8I A;  2LMV A;  2L50 A;  1PAL A;  3K21 A;  4M2O A;  1K8U A;  3PSR A;  2BKH B;  1SW8 A;  3AAJ A;  1F55 A;  3BUO B;  4N1G A;  4L9M A;  4MZK A;  4C0K A;  1UHI A;  2LV7 A;  3I5F B;  5CSN A;  2OPO A;  2BE6 A;  2V53 A;  1B7T Z;  3DVE A;  1KK7 Y;  3FWC A;  4E68 A;  1CMG A;  1DJY A;  3GK1 A;  3D0Y B;  5HLV A;  2F8P A;  4I5J A;  1E8A A;  2G9B A;  2AMI A;  1N65 A;  5DKR A;  1DJI A;  1KFU S;  1FBV A;  2L2E A;  1IQ3 A;  1WDC B;  2I94 A;  4OKH A;  2OTG B;  1OQP A;  4ZCU A;  1K9K A;  3OP0 A;  4ZCV A;  2BKI B;  4DCK A;  3VRP A; 
#chains in the Genus database with same CATH topology
 1CB1 A;  2KFG A;  4FQT A;  2KI6 C;  1QVI Z;  3I5H B;  1TUJ A;  2JPO A;  1QJT A;  2LLS A;  2KAV A;  2WCM A;  3SS3 A;  1QAT A;  2JRF A;  2JNX A;  1FI6 A;  3B86 A;  4A4B A;  1DVI A;  1NX0 A;  5HL1 A;  3LCP C;  1GJY A;  4N1F A;  4PT1 A;  5JJG A;  4XJK B;  5ER4 X;  5DIC A;  4XYN A;  4I5K A;  5J3X A;  5G08 A;  1PSR A;  1C3Y A;  3CR5 X;  1TNQ A;  3C1V A;  5GQQ C;  1DJZ A;  2EC6 C;  2WC5 A;  3LLE A;  2LLU A;  1KK7 Z;  4HRH A;  1MQ1 A;  3A4U B;  2AAO A;  1ODB A;  1J7O A;  1UHJ A;  1C3Z A;  1TNX A;  1X02 A;  1NCX A;  1NYA A;  2COL B;  2KAY A;  2JUL A;  1QLS A;  1NPQ A;  1CDM A;  2WCE A;  1U5I B;  1F54 A;  5PAL A;  3UNW A;  1TTX A;  4PE0 A;  2QEB A;  1GQM A;  1XFR A;  1BU3 A;  1XVJ A;  1CKK A;  2ISD A;  1AJ5 A;  3AAK A;  1LA0 A;  1BMO A;  1DEL A;  3AKB A;  3TDZ A;  4DS7 A;  4DUQ A;  3PN7 C;  1B8C A;  1XFW O;  3E3R A;  1SRA A;  4OV2 A;  2SAS A;  4MRY A;  3S0E A;  1QV1 A;  5D3O A;  1DC1 A;  3EVV A;  1Y6W A;  3BUM B;  4MN0 A;  2KAX A;  3NGV A;  1M31 A;  2HF5 A;  4PE4 A;  2KI4 C;  4A4C A;  3OGN A;  1V1G A;  2BL0 C;  3PM2 A;  1UHH A;  4MZJ A;  1S1E A;  2EC6 B;  3QME A;  5D7F A;  4ETO A;  5I8N A;  3FWB A;  3GK4 X;  4NDB A;  1PUL A;  4MZL A;  4Q04 A;  3NSI A;  2P6B B;  1AUI B;  3BOW A;  4GGF A;  2ZRT A;  4WQ2 A;  4CFQ A;  1SCM C;  2LE9 B;  2GGZ A;  1NUB A;  1NX1 A;  2LHL A;  4CLN A;  1DF0 A;  4UPG A;  2H61 A;  2D8N A;  2MLE C;  3M0W A;  2B1U A;  2BBM A;  4GFT A;  3VRN A;  3I5G B;  3EK4 A;  5CPV A;  1BR1 B;  1B8R A;  1J7R A;  2LAP A;  5HYD A;  4BY5 A;  1F8H A;  1IG5 A;  1W7J B;  5KSZ A;  1FF1 A;  1WLZ A;  3EVU A;  2QEH A;  3VRR A;  1H4B A;  2BCB A;  2CBL A;  4FTG A;  3RZS A;  3PN7 B;  2KI6 D;  1OOG A;  4ORA B;  1NWD A;  1DQE A;  4P2Y B;  4OZD A;  2JNF A;  3S0G A;  3CTN A;  1JBA A;  1ALV A;  2P71 A;  3B7A A;  1B8L A;  4BY4 A;  2KI4 B;  3CZ2 A;  1TUZ A;  2JPT A;  3PFV A;  1SYM A;  1LKJ A;  1CFC A;  2WCB A;  1DJG A;  1KFX S;  5KTY A;  1OOI X;  1KQM C;  3NSK A;  2HQW A;  2L51 A;  3IQO A;  2F33 A;  2FCE A;  4MBE A;  3EKJ A;  1A75 B;  1Y1A A;  2LMT A;  1PVB A;  2A4J A;  1TRF A;  2LVK A;  2QDI A;  4PAL A;  4C0L A;  4D1E A;  1OMR A;  2FJU B;  4INW A;  1QWV A;  1CM1 A;  1SCM B;  5EL2 A;  4MEW A;  2ZKM X;  2CNP A;  1OSA A;  3BYA A;  4PE7 A;  2KQY A;  2KLE A;  2HET A;  1YUS A;  2E6W A;  2ZFD A;  3EVR A;  3SS5 A;  3CLN A;  1CNP A;  4PHN A;  1JC2 A;  4GPL B;  1M39 A;  1B9A A;  4MRX A;  3PAT A;  5FI7 A;  3CGA A;  4KYN A;  4QJ4 B;  4NDC A;  4WQ3 A;  1XFZ O;  2MA2 A;  2LMU A;  2VRG A;  1QTX A;  4DRW A;  1C7V A;  1K9P A;  1KSM A;  2KBI A;  2ZND A;  2KSP A;  2FOT A;  1M45 A;  2BE4 A;  2M1K B;  2OS8 B;  1BF5 A;  1J7Q A;  1S3P A;  3NHI A;  4XJK A;  2KPH A;  2I7A A;  3AKA A;  5FYX A;  1LA3 A;  2JTT A;  1AVS A;  4OVN F;  1DEK A;  1IJ5 A;  1NCY A;  4MLW A;  1MXE A;  1NIW A;  2E30 A;  1Y0V H;  1K94 A;  5DKQ A;  3WHU B;  3BFH A;  1OE9 B;  1QAS A;  4OR9 B;  2CTN A;  2LLT A;  2F2O A;  3KF9 A;  2BAP A;  2ZNE A;  3NSL A;  3RLZ A;  1SL7 A;  3D75 A;  1IH0 A;  2ERB A;  3JTD C;  3LK1 A;  4GNK B;  4IL1 A;  2JT3 A;  2PVB A;  2Y1N A;  2HPS A;  2O5G A;  3IVT A;  4OCI A;  3LL8 B;  4YBH B;  1SL8 A;  1J1E A;  1RWY A;  2L0P A;  3D73 A;  1U5I A;  2LUC A;  2WCL A;  5AXI A;  2KYF A;  1YRU B;  1IJ6 A;  2LM5 A;  3CWG A;  3VRO A;  1B1G A;  1B4C A;  3D10 A;  1S6C A;  2Y1M A;  1OOF A;  1OW4 A;  2H2K A;  2PAL A;  2K7D A;  1XK4 A;  1KFU L;  1NX2 A;  2KQ6 A;  2PSR A;  1Y1U A;  3SIB A;  3TDI A;  1K2H A;  1EG4 A;  2K8M B;  2JOJ A;  3S0A A;  4MVF A;  1EXR A;  1S6I A;  3K1E A;  4PDZ A;  3CS1 A;  1YUT A;  1T14 A;  2AUC A;  2M3W A;  3NXA A;  3DXL A;  5JOL A;  1HT9 A;  3CZ1 A;  4YGA A;  3MSE B;  1YTZ C;  1F4Q A;  1J1D A;  2P70 A;  3PJI A;  2ZN8 A;  3RM1 A;  3V2L A;  3JTD B;  2CT9 A;  1CLB A;  4WRI A;  1SK6 D;  3TDU A;  2KGB C;  1IGV A;  2GGM A;  2KBM A;  1LVC D;  3SG7 A;  4CFR A;  1EL4 A;  1YRT B;  3DVM A;  3O6B A;  2L4H A;  2KGR A;  2L98 A;  1ZMZ A;  3D78 A;  3UO9 A;  2CXJ A;  1JF0 A;  4INX A;  1TCF A;  1YUU A;  1AHR A;  1TIZ A;  3B6X A;  1SPY A;  4F0Z B;  1GGZ A;  3Q8I A;  2M29 A;  3D76 A;  5FI2 A;  1JFJ A;  4ORC B;  1PK0 D;  3FS7 A;  3OX6 A;  1CM4 A;  4P5O E;  1N0Y A;  3BXK A;  2K0J A;  1NCZ A;  4JD9 A;  4DIR A;  1SKT A;  4U8D A;  3KEV A;  2KFH A;  3DZT A;  2LHI A;  1FI5 A;  1W7I B;  1A75 A;  1S5G Y;  2JWW A;  1QX7 A;  3L47 A;  2KOT A;  1RK9 A;  1OZS A;  3O2P A;  1EJ3 A;  3BFA A;  4M2Q A;  4N5X A;  3SS4 A;  1M46 A;  2JXC A;  3BJH A;  4JWQ A;  4YGD B;  1P28 A;  1PVA A;  2K2A A;  3KHE A;  4PCW A;  3FE9 A;  1J7P A;  2BCA A;  1CDL A;  2QAC A;  3A8R A;  1MF8 B;  1UUS A;  1QX5 B;  4JPZ B;  3SIA A;  2ZN9 A;  2K7B A;  1N2D A;  3BFB A;  4GGF C;  4PE1 A;  4R1E A;  1CFF A;  5CSJ A;  1WLM A;  5ER5 A;  1AK8 A;  1LS8 A;  1QV0 A;  3O78 A;  1TNP A;  4YGC B;  2MAZ A;  2BL0 B;  1AJ4 A;  2EHB A;  2M49 B;  2WOR A;  1SY9 A;  4NQG A;  4YI9 A;  3D0Y A;  3SG5 A;  1BOD A;  3SG3 A;  2ZRS A;  2I18 A;  3TS5 C;  1AP4 A;  2HQ8 A;  2PMY A;  1DJX A;  2IS9 A;  3VB1 A;  3VRQ A;  1CLL A;  4YI8 A;  1BJF A;  1S5G Z;  1J55 A;  4YRU A;  3SG6 A;  1XFV O;  1QXP A;  1JFK A;  4F7F A;  2NLN A;  1MHO A;  2H8V A;  1YX7 A;  1S6J A;  4HSZ A;  1KFX L;  2LC5 A;  1K96 A;  5I2O A;  1B47 A;  3KO0 A;  1KWO C;  4JKT A;  1IQ5 A;  2Y4Q A;  3WHT B;  5AFP A;  2BBN A;  4CID A;  1IKU A;  2EGD A;  1MXL C;  4I5L B;  1RJV A;  1F70 A;  3SG4 A;  3PM8 A;  1SCV A;  2PYQ A;  3F45 A;  2L5Y A;  1W9Z A;  3O4Y A;  4GBA A;  3BUX B;  1DJH A;  1LXF C;  3R1V A;  1OMD A;  2JC2 A;  1RTP 1;  3QRX A;  1DTL A;  4MSP A;  1CDP A;  1KQM B;  2KLD A;  1WRZ A;  1SL9 A;  2FCD A;  2MHH A;  4PHJ A;  1QLK A;  1UWO A;  3L4L A;  4GAO A;  2WC8 A;  2JXL A;  1BG1 A;  1K90 D;  3D77 A;  1VRK A;  2WND A;  3OHM B;  1XFU O;  3GOF A;  1M63 B;  1A03 A;  1OOJ A;  2L2C A;  1A4P A;  3DD4 A;  1SMG A;  1ZFS A;  3SG2 A;  1DT7 B;  5KU1 A;  4AQI A;  1NX3 A;  2Q4U A;  5I94 A;  3PAL A;  3GK2 A;  1R6P A;  2LAN A;  1LIN A;  2M0R A;  2JT8 A;  4HRG A;  1Y1X A;  1KWO B;  1KSO A;  3D74 A;  4M2P A;  5AEQ A;  4PHK A;  2KHN A;  3DY9 A;  1CLM A;  1GGW A;  3I5I C;  3DF0 B;  4TNC A;  4YGE B;  1QIV A;  3H4S E;  2JZI A;  1WY9 A;  2WCF A;  1UHN A;  1QS7 A;  3LK0 A;  3KPX A;  5HKZ A;  4AQJ A;  1C7W A;  2MJW B;  2QEV A;  1UUR A;  2M97 A;  1CFP A;  4HRE E;  2M7N A;  3NHT A;  3WNX B;  2F3Y A;  2G2B A;  2K2F A;  1XK4 C;  4PHM A;  2LVJ A;  1TOP A;  2M8U A;  3OBV A;  1YVH A;  1JUO A;  3TUY C;  3DVK A;  1RRO A;  3OB2 B;  3B88 A;  2R2I A;  1IRJ A;  2LVV A;  2NCP A;  3WXA A;  4GGN A;  4C0J A;  1IIO A;  2K61 A;  3S0B A;  3EK8 A;  3CZT X;  1R2U A;  1QX2 A;  1ORG A;  1NP8 A;  1PRW A;  1F4O A;  1Z2C B;  1TCO B;  1ZAC A;  1V1F A;  1SBJ A;  1FPW A;  2L4I A;  2NCO A;  1JF2 A;  3I5I B;  1G33 A;  1KK8 C;  2JQ6 A;  3JVT C;  1XO5 A;  1ZOT B;  2QPT A;  1BR4 B;  2BCX A;  2LVI A;  3I5G C;  3R1O A;  5AAN A;  2JTZ A;  1K9U A;  3IQQ A;  3IF7 A;  2GV5 A;  2WCK A;  2LCP A;  2K7C A;  2WCJ A;  5F6T A;  1Q80 A;  1XFY O;  2LP2 A;  3EK7 A;  5HKW A;  1C07 A;  3CAB A;  2PQL A;  2NXQ A;  4USL A;  5CSI A;  3CDN A;  1S26 D;  4QJ5 B;  5AER A;  2KNE A;  3TUY B;  3S0F A;  4IJ7 A;  1FW4 A;  1S36 A;  1XYD A;  2GTE A;  5K89 A;  1CFD A;  1KQV A;  2LNK A;  2O60 A;  3B87 A;  3CR4 X;  5IBW A;  2MBX A;  2K7O A;  3HCM A;  1EG3 A;  3DYE A;  4QJ3 B;  1A2X A;  3BUW B;  4CPV A;  2Y5I A;  1KCY A;  5D69 A;  1HQV A;  1RFJ A;  4ICB A;  1CDN A;  1YUR A;  1DGV A;  1UP5 A;  3S0D A;  2H61 C;  1D1O A;  1BOC A;  1OZO A;  2I2R E;  4FQO A;  1TN4 A;  1YVL A;  1UHK A;  1KK8 B;  2M1U A;  2RGI A;  3EG5 B;  2LP3 A;  1CTR A;  3JVT B;  1NSH A;  4GUK A;  2WCH A;  1ALW A;  1OMV A;  2PRU A;  1YX8 A;  1L2O C;  1SR6 C;  2MLF C;  3BUN B;  4JQ0 D;  3TZ1 A;  5B8I B;  3CZ0 A;  2TN4 A;  2BNX A;  2PAS A;  2NZ0 A;  3BQ3 A;  2L5X B;  5CSF A;  5I2Q A;  2F2P A;  3HX4 A;  3OB1 B;  2BEC A;  1H8B A;  1IWQ A;  2WOS A;  1ZUZ A;  1K95 A;  1XFX O;  1F71 A;  2KFF A;  1PSB A;  5HLO A;  3L4A A;  1REC A;  1SSE B;  2OS8 C;  3DVJ A;  1CMF A;  1B7T Y;  2CCM A;  3FE8 A;  4AOM A;  5HKY A;  3I5F C;  1EH2 A;  2F3Z A;  1MUX A;  3OX5 A;  2WC6 A;  2K60 A;  2MRD A;  1TNW A;  1Z4H A;  5DKN A;  2Q91 A;  3BOW B;  4YGB B;  2FJY A;  3NSO A;  1G4Y R;  5TNC A;  1QIW A;  1XA5 A;  4NDD A;  1MWN A;  3ZWH A;  2JT0 A;  1YR5 A;  3ICB A;  1BT6 A;  1DF0 B;  1WDC C;  2KYC A;  3PLF B;  3O4X A;  1OOH A;  2JU0 A;  1DGU A;  1DMO A;  2M9G A;  1K93 D;  2OTG C;  3DF0 A;  2KDH A;  3EKH A;  3VGO A;  4I5N B;  1WRK A;  3ZNI A;  1BLQ A;  1QVI Y;  1TWO A;  3FIA A;  5I2L A;  2M7L A;  1A29 A;  1L7Z A;  1JWD A;  4ORB B;  1SNL A;  1L2O B;  1SR6 B;  3CR2 A;  5BPJ A;  2DOQ A;  3I5H C;  5FI6 A;  1DJW A;  2LUX A;  2YGU A;  3SJS A;  3TS5 B;  3N7H A;  1WRL A;  3R1P A;  1JSA A;  2SCP A;  1MR8 A;  1G8I A;  2LMV A;  2L50 A;  1PAL A;  3K21 A;  4M2O A;  1K8U A;  3PSR A;  2BKH B;  1SW8 A;  3AAJ A;  1F55 A;  3BUO B;  4N1G A;  4L9M A;  4MZK A;  4C0K A;  1UHI A;  2LV7 A;  1GM0 A;  3I5F B;  5CSN A;  2OPO A;  2BE6 A;  2V53 A;  1B7T Z;  3DVE A;  1KK7 Y;  3FWC A;  4E68 A;  3R72 A;  1CMG A;  1DJY A;  3GK1 A;  3D0Y B;  5HLV A;  2F8P A;  4I5J A;  1E8A A;  2G9B A;  3CYZ A;  2AMI A;  1N65 A;  5DKR A;  1DJI A;  1KFU S;  1FBV A;  2L2E A;  1IQ3 A;  1WDC B;  2I94 A;  4OKH A;  2OTG B;  1OQP A;  2QEO A;  4ZCU A;  1K9K A;  3OP0 A;  4ZCV A;  3FE6 A;  2BKI B;  4DCK A;  3VRP A; 
#chains in the Genus database with same CATH homology
 1CB1 A;  2KFG A;  2KI6 C;  1QVI Z;  3I5H B;  1QJT A;  2LLS A;  2KAV A;  1QAT A;  2JRF A;  2JNX A;  1FI6 A;  4A4B A;  1DVI A;  1NX0 A;  3LCP C;  1GJY A;  4N1F A;  5JJG A;  4XJK B;  5ER4 X;  4XYN A;  4I5K A;  5J3X A;  5G08 A;  1PSR A;  3CR5 X;  1TNQ A;  3C1V A;  5GQQ C;  1DJZ A;  2EC6 C;  3LLE A;  2LLU A;  1KK7 Z;  4HRH A;  1MQ1 A;  3A4U B;  2AAO A;  1ODB A;  1J7O A;  1UHJ A;  1TNX A;  1X02 A;  1NCX A;  1NYA A;  2COL B;  2KAY A;  2JUL A;  1QLS A;  1NPQ A;  1CDM A;  2WCE A;  1U5I B;  1F54 A;  5PAL A;  1TTX A;  4PE0 A;  1GQM A;  1BU3 A;  1XVJ A;  1CKK A;  2ISD A;  1AJ5 A;  3AAK A;  1LA0 A;  1BMO A;  3AKB A;  3TDZ A;  4DS7 A;  4DUQ A;  3PN7 C;  1B8C A;  1XFW O;  3E3R A;  1SRA A;  4OV2 A;  2SAS A;  4MRY A;  1QV1 A;  3EVV A;  1Y6W A;  3BUM B;  4MN0 A;  2KAX A;  1M31 A;  2HF5 A;  4PE4 A;  2KI4 C;  4A4C A;  1V1G A;  2BL0 C;  1UHH A;  4MZJ A;  1S1E A;  2EC6 B;  5D7F A;  4ETO A;  5I8N A;  3FWB A;  3GK4 X;  4NDB A;  1PUL A;  4MZL A;  4Q04 A;  3NSI A;  2P6B B;  1AUI B;  3BOW A;  4GGF A;  2ZRT A;  4WQ2 A;  4CFQ A;  1SCM C;  2LE9 B;  2GGZ A;  1NUB A;  1NX1 A;  2LHL A;  4CLN A;  1DF0 A;  4UPG A;  2H61 A;  2D8N A;  2MLE C;  3M0W A;  2B1U A;  2BBM A;  4GFT A;  3VRN A;  3I5G B;  3EK4 A;  5CPV A;  1BR1 B;  1B8R A;  1J7R A;  2LAP A;  5HYD A;  4BY5 A;  1F8H A;  1IG5 A;  1W7J B;  5KSZ A;  1FF1 A;  1WLZ A;  3EVU A;  3VRR A;  1H4B A;  2BCB A;  2CBL A;  4FTG A;  3PN7 B;  2KI6 D;  4ORA B;  1NWD A;  4P2Y B;  2JNF A;  3CTN A;  1JBA A;  1ALV A;  1B8L A;  4BY4 A;  2KI4 B;  2JPT A;  3PFV A;  1SYM A;  1LKJ A;  1CFC A;  2WCB A;  1DJG A;  1KFX S;  5KTY A;  1KQM C;  3NSK A;  2HQW A;  2L51 A;  3IQO A;  2F33 A;  2FCE A;  4MBE A;  3EKJ A;  1A75 B;  1Y1A A;  2LMT A;  1PVB A;  2A4J A;  1TRF A;  2LVK A;  4PAL A;  4C0L A;  4D1E A;  1OMR A;  2FJU B;  1CM1 A;  1SCM B;  4MEW A;  2ZKM X;  2CNP A;  1OSA A;  3BYA A;  4PE7 A;  2KQY A;  3EVR A;  2HET A;  1YUS A;  2E6W A;  2ZFD A;  1CNP A;  3CLN A;  1JC2 A;  4PHN A;  4GPL B;  1M39 A;  1B9A A;  4MRX A;  3PAT A;  3CGA A;  4QJ4 B;  4NDC A;  4WQ3 A;  1XFZ O;  2MA2 A;  2LMU A;  2VRG A;  1QTX A;  4DRW A;  1C7V A;  1K9P A;  1KSM A;  2KBI A;  2ZND A;  2KSP A;  2FOT A;  1M45 A;  2BE4 A;  2M1K B;  2OS8 B;  1BF5 A;  1J7Q A;  1S3P A;  4XJK A;  2I7A A;  3AKA A;  5FYX A;  1LA3 A;  2JTT A;  1AVS A;  4OVN F;  1NCY A;  1IJ5 A;  4MLW A;  1MXE A;  1NIW A;  2E30 A;  1Y0V H;  1K94 A;  5DKQ A;  3WHU B;  1OE9 B;  1QAS A;  4OR9 B;  2CTN A;  2LLT A;  2F2O A;  3KF9 A;  2ZNE A;  3NSL A;  3RLZ A;  1SL7 A;  1IH0 A;  3JTD C;  3LK1 A;  4GNK B;  4IL1 A;  2JT3 A;  2PVB A;  2Y1N A;  2HPS A;  2O5G A;  4OCI A;  3LL8 B;  4YBH B;  1SL8 A;  1J1E A;  1RWY A;  2L0P A;  1U5I A;  2LUC A;  5AXI A;  3VRO A;  2KYF A;  1YRU B;  1IJ6 A;  2LM5 A;  3CWG A;  1B1G A;  1B4C A;  3D10 A;  1S6C A;  2Y1M A;  2H2K A;  2PAL A;  2K7D A;  1XK4 A;  1KFU L;  1NX2 A;  2KQ6 A;  2PSR A;  1Y1U A;  3SIB A;  3TDI A;  1K2H A;  1EG4 A;  2K8M B;  2JOJ A;  4MVF A;  1EXR A;  1S6I A;  4PDZ A;  3CS1 A;  1YUT A;  2AUC A;  2M3W A;  3NXA A;  5JOL A;  1HT9 A;  4YGA A;  3MSE B;  1YTZ C;  1F4Q A;  1J1D A;  2ZN8 A;  3RM1 A;  3JTD B;  2CT9 A;  1CLB A;  4WRI A;  1SK6 D;  3TDU A;  2KGB C;  1IGV A;  2GGM A;  2KBM A;  1LVC D;  3SG7 A;  4CFR A;  1EL4 A;  1YRT B;  3DVM A;  3O6B A;  2L4H A;  2KGR A;  2L98 A;  1ZMZ A;  2CXJ A;  1JF0 A;  1TCF A;  1YUU A;  1AHR A;  1TIZ A;  1SPY A;  4F0Z B;  1GGZ A;  2M29 A;  1JFJ A;  4ORC B;  1PK0 D;  3FS7 A;  3OX6 A;  1CM4 A;  4P5O E;  1N0Y A;  3BXK A;  2K0J A;  1NCZ A;  4DIR A;  1SKT A;  4U8D A;  3KEV A;  2KFH A;  2LHI A;  1FI5 A;  1W7I B;  1A75 A;  1S5G Y;  2JWW A;  1QX7 A;  2KOT A;  1RK9 A;  1OZS A;  3O2P A;  1EJ3 A;  4M2Q A;  4N5X A;  1M46 A;  2JXC A;  4JWQ A;  4YGD B;  1PVA A;  2K2A A;  3KHE A;  4PCW A;  1J7P A;  2BCA A;  1CDL A;  2QAC A;  3A8R A;  1MF8 B;  1UUS A;  1QX5 B;  4JPZ B;  3SIA A;  2ZN9 A;  2K7B A;  1N2D A;  4GGF C;  4R1E A;  4PE1 A;  1CFF A;  5CSJ A;  1WLM A;  5ER5 A;  1AK8 A;  1QV0 A;  3O78 A;  1TNP A;  4YGC B;  2MAZ A;  2BL0 B;  1AJ4 A;  2EHB A;  2M49 B;  2WOR A;  1SY9 A;  4NQG A;  4YI9 A;  3D0Y A;  3SG5 A;  1BOD A;  3SG3 A;  2ZRS A;  2I18 A;  3TS5 C;  1AP4 A;  2HQ8 A;  2PMY A;  1DJX A;  2IS9 A;  3VRQ A;  1CLL A;  4YI8 A;  1BJF A;  1S5G Z;  1J55 A;  4YRU A;  3SG6 A;  1XFV O;  1QXP A;  1JFK A;  2NLN A;  1MHO A;  1YX7 A;  1S6J A;  4HSZ A;  1KFX L;  2LC5 A;  1K96 A;  5I2O A;  1B47 A;  3KO0 A;  1KWO C;  1IQ5 A;  2Y4Q A;  3WHT B;  5AFP A;  2BBN A;  4CID A;  1IKU A;  2EGD A;  1MXL C;  4I5L B;  1RJV A;  1F70 A;  3SG4 A;  3PM8 A;  1SCV A;  3F45 A;  3O4Y A;  4GBA A;  3BUX B;  1DJH A;  1LXF C;  1OMD A;  2JC2 A;  1RTP 1;  3QRX A;  1DTL A;  4MSP A;  1CDP A;  1KQM B;  1WRZ A;  1SL9 A;  2FCD A;  2MHH A;  4PHJ A;  1QLK A;  1UWO A;  4GAO A;  2WC8 A;  2JXL A;  1BG1 A;  1K90 D;  1VRK A;  2WND A;  3OHM B;  1XFU O;  3GOF A;  1M63 B;  1A03 A;  1OOJ A;  1A4P A;  3DD4 A;  1SMG A;  1ZFS A;  3SG2 A;  1DT7 B;  5KU1 A;  4AQI A;  1NX3 A;  2Q4U A;  3PAL A;  3GK2 A;  1R6P A;  2LAN A;  1LIN A;  2M0R A;  2JT8 A;  4HRG A;  1Y1X A;  1KWO B;  1KSO A;  4M2P A;  5AEQ A;  4PHK A;  2KHN A;  1CLM A;  1GGW A;  3I5I C;  3DF0 B;  4TNC A;  4YGE B;  1QIV A;  3H4S E;  2JZI A;  1WY9 A;  2WCF A;  1UHN A;  1QS7 A;  3LK0 A;  3KPX A;  5HKZ A;  4AQJ A;  1C7W A;  2MJW B;  1UUR A;  2M97 A;  1CFP A;  4HRE E;  2M7N A;  3WNX B;  2F3Y A;  2G2B A;  2K2F A;  1XK4 C;  4PHM A;  2LVJ A;  1TOP A;  2M8U A;  1YVH A;  1JUO A;  3TUY C;  3DVK A;  1RRO A;  3OB2 B;  2R2I A;  1IRJ A;  2LVV A;  2NCP A;  3WXA A;  4GGN A;  4C0J A;  2K61 A;  3EK8 A;  3CZT X;  1R2U A;  1QX2 A;  1NP8 A;  1PRW A;  1F4O A;  1TCO B;  1ZAC A;  1V1F A;  1SBJ A;  1FPW A;  2L4I A;  2NCO A;  1JF2 A;  3I5I B;  1G33 A;  1KK8 C;  2JQ6 A;  3JVT C;  1XO5 A;  1ZOT B;  2QPT A;  1BR4 B;  2BCX A;  2LVI A;  3I5G C;  5AAN A;  2JTZ A;  1K9U A;  3IQQ A;  3IF7 A;  2GV5 A;  2LCP A;  2K7C A;  5F6T A;  1Q80 A;  1XFY O;  2LP2 A;  3EK7 A;  5HKW A;  1C07 A;  5AER A;  5CSI A;  2NXQ A;  4USL A;  1S26 D;  4QJ5 B;  2KNE A;  3TUY B;  1FW4 A;  1S36 A;  1XYD A;  5K89 A;  1KQV A;  1CFD A;  2LNK A;  2O60 A;  3CR4 X;  5IBW A;  2MBX A;  2K7O A;  3HCM A;  1EG3 A;  4QJ3 B;  4CPV A;  1A2X A;  3BUW B;  2Y5I A;  1KCY A;  5D69 A;  1HQV A;  1RFJ A;  4ICB A;  1CDN A;  1YUR A;  1DGV A;  1UP5 A;  2H61 C;  1D1O A;  1BOC A;  1OZO A;  2I2R E;  4FQO A;  1TN4 A;  1YVL A;  1UHK A;  1KK8 B;  2M1U A;  2RGI A;  3JVT B;  2LP3 A;  1CTR A;  4GUK A;  1NSH A;  1ALW A;  1OMV A;  2PRU A;  1YX8 A;  1L2O C;  1SR6 C;  2MLF C;  3BUN B;  4JQ0 D;  3TZ1 A;  2TN4 A;  2PAS A;  3BQ3 A;  2NZ0 A;  5I2Q A;  2L5X B;  5CSF A;  1H8B A;  2F2P A;  3HX4 A;  3OB1 B;  2BEC A;  1IWQ A;  2WOS A;  1ZUZ A;  1K95 A;  1XFX O;  1F71 A;  2KFF A;  1PSB A;  5HLO A;  1REC A;  2OS8 C;  3DVJ A;  1CMF A;  1B7T Y;  2CCM A;  4AOM A;  5HKY A;  3I5F C;  1EH2 A;  2F3Z A;  1MUX A;  3OX5 A;  2MRD A;  1TNW A;  5DKN A;  2Q91 A;  3BOW B;  4YGB B;  3NSO A;  1G4Y R;  5TNC A;  1QIW A;  1XA5 A;  4NDD A;  1MWN A;  3ZWH A;  2JT0 A;  1YR5 A;  3ICB A;  1BT6 A;  1DF0 B;  1WDC C;  2KYC A;  3PLF B;  5B8I B;  2JU0 A;  1DGU A;  1DMO A;  2M9G A;  1K93 D;  2OTG C;  3DF0 A;  2KDH A;  3EKH A;  3VGO A;  4I5N B;  1WRK A;  3ZNI A;  1BLQ A;  1QVI Y;  3FIA A;  5I2L A;  2M7L A;  1A29 A;  1L7Z A;  1JWD A;  4ORB B;  1SNL A;  1L2O B;  1SR6 B;  3CR2 A;  5BPJ A;  2DOQ A;  3I5H C;  3TS5 B;  1DJW A;  2LUX A;  3SJS A;  1WRL A;  1JSA A;  2SCP A;  1MR8 A;  1G8I A;  2LMV A;  2L50 A;  1PAL A;  3K21 A;  4M2O A;  1K8U A;  3PSR A;  2BKH B;  1SW8 A;  3AAJ A;  1F55 A;  3BUO B;  4N1G A;  4L9M A;  4MZK A;  4C0K A;  1UHI A;  2LV7 A;  3I5F B;  5CSN A;  2OPO A;  2BE6 A;  2V53 A;  1B7T Z;  3DVE A;  1KK7 Y;  3FWC A;  4E68 A;  1CMG A;  1DJY A;  3GK1 A;  3D0Y B;  5HLV A;  2F8P A;  4I5J A;  1E8A A;  2G9B A;  2AMI A;  1N65 A;  5DKR A;  1DJI A;  1KFU S;  1FBV A;  2L2E A;  1IQ3 A;  1WDC B;  2I94 A;  4OKH A;  2OTG B;  1OQP A;  4ZCU A;  1K9K A;  3OP0 A;  4ZCV A;  2BKI B;  4DCK A;  3VRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...