3JTDB

Calcium-free scallop myosin regulatory domain with elc-d19a point mutation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Contractile protein
total genus 38
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB02
1CM4A 2ZN8A 1QLKA 4GFTA 4MZLA 4F0ZB 2Y1MA 2KFFA 1CFDA 3BUWB 3O4YA 3WNXB 4GAOA 2LUCA 4YI9A 4MSPA 1DJZA 1AHRA 3LLEA 1PALA 1D1OA 3VRNA 1A03A 1RWYA 5DKQA 1A2XA 1F70A 1AVSA 2MLEC 2KQYA 1KK8C 4HRHA 4I5LB 1PULA 4M2QA 1XA5A 2FOTA 2I7AA 2M7NA 1DGUA 1UHHA 1RK9A 2MHHA 4D1EA 1K93D 4MZJA 1YX8A 1IJ6A 1WRZA 2BCAA 2PMYA 4JWQA 2CBLA 1NX0A 1BOCA 1XO5A 2GGMA 4PHKA 3SG6A 3ZNIA 1AUIB 1WRLA 1BU3A 3ZWHA 4YI8A 3LK1A 2KI4C 2LMVA 1SCMB 2MRDA 4XYNA 4Q04A 5HLOA 2L4HA 1KK7Z 1XFVO 3EVUA 1EL4A 2K61A 4PHMA 1BJFA 1M39A 1IWQA 2LLTA 1NIWA 4HSZA 1PVAA 1QATA 4E68A 1ZACA 4JPZB 1NWDA 1K94A 2JXLA 1MQ1A 3PALA 1DT7B 3I5HC 1NX2A 2K7BA 2OS8C 2K7DA 1J7QA 2P6BB 5TNCA 5CSJA 5CSFA 1B47A 2L98A 4MRYA 4N1GA 2JRFA 1QJTA 2BBNA 2EGDA 2VRGA 2Y1NA 4NDDA 1EXRA 5KSZA 1G33A 1SR6B 1SYMA 1UHIA 3I5GB 4FTGA 4YBHB 4NDBA 1SK6D 2L4IA 2A4JA 3TDIA 1YVLA 4L9MA 4ZCUA 1YX7A 1DVIA 1IG5A 1XFYO 2LNKA 2PVBA 1QVIZ 2CXJA 2LVKA 3CLNA 4MLWA 4U8DA 1AJ5A 1NYAA 1ZFSA 2KFHA 1DF0A 1S5GZ 2WCFA 1E8AA 2KAXA 1L7ZA 5BPJA 3VGOA 2JTZA 5HYDA 1S26D 2ZKMX 3I5IC 2Q4UA 5D7FA 2WCBA 1LA3A 2LLSA 3PLFB 1JFJA 3VRRA 4NQGA 1OSAA 2M97A 2K7CA 2OTGC 4GBAA 5JJGA 3EKJA 4PHJA 4OVNF 3A4UB 1TOPA 1CM1A 4CFQA 4MEWA 3OX5A 1CNPA 3EK4A 5AFPA 1QLSA 2HETA 1TNWA 2BKIB 3VRQA 5J3XA 2JT8A 1EG4A 2LANA 1YUSA 4MZKA 1VRKA 2NXQA 1GGWA 3E3RA 1DJYA 1Y1UA 4XJKA 1L2OC 5IBWA 1F4OA 3RM1A 1Y6WA 3JTDB 4ICBA 5ER4X 1SL9A 2I18A 2KQ6A 5DKRA 3DVEA 1CDLA 3SG4A 1YVHA 1NP8A 1NCYA 4ORBB 2KBMA 3SG5A 1PRWA 1KFXS 3NXAA 5HKYA 3LK0A 1YRTB 1SY9A 1S6IA 5CSIA 1UUSA 2SASA 1PK0D 4MBEA 3SIBA 1CTRA 2QACA 2ZNEA 3FS7A 3KPXA 2MBXA 4MN0A 2NCOA 1WY9A 3GK1A 1YUUA 2ISDA 4ORCB 3SG2A 2M3WA 4GGFC 3FWCA 2MAZA 1X02A 3EVVA 1N65A 1DF0B 1NCZA 2GV5A 2K8MB 1AK8A 2LHIA 1CLLA 1K9PA 3PFVA 1IGVA 3BUXB 1W7JB 2BL0B 4P2YB 2L2EA 2WORA 2LM5A 4IL1A 2F8PA 1QIVA 2BCXA 2K2FA 2LV7A 3JVTC 4JQ0D 4OR9B 5AXIA 1K2HA 1KQMB 4TNCA 1KWOC 4GPLB 2KGBC 4PALA 3AKBA 4PE0A 1HQVA 1QX7A 1UHJA 1WLMA 1XFWO 1UHKA 2KBIA 3CR2A 3IQQA 3WHUB 5KTYA 3OP0A 4DUQA 1NSHA 1Y1XA 1F4QA 5KU1A 2KFGA 1IH0A 5DKNA 1EG3A 1OE9B 2M1UA 2BKHB 2H2KA 1OOJA 1RECA 3AAJA 5AANA 1FBVA 1F54A 2BCBA 3PSRA 1KFXL 2QPTA 2JOJA 1NX3A 4XJKB 1A75B 1MUXA 3NSOA 3PN7B 2Y4QA 2LVJA 3GK2A 1XVJA 3I5FB 1M31A 2F3YA 1C7VA 2EC6C 3VROA 3CR4X 3CTNA 1QASA 5GQQC 2ZN9A 2CTNA 1JWDA 1CLMA 1ALVA 1NCXA 2L5XB 3TZ1A 1YR5A 2HF5A 3CWGA 4QJ3B 2COLB 1U5IA 3GK4X 1J1EA 2LMTA 3I5GC 3KEVA 1A29A 1M46A 1MXLC 4DIRA 1W7IB 1WDCC 2NZ0A 5D69A 4MVFA 1YTZC 3NSIA 3KF9A 1RROA 3KO0A 1KK8B 4C0JA 5I2OA 3FIAA 4MRXA 2I94A 3IF7A 4I5KA 3BOWB 2F2PA 2O5GA 5G08A 4AOMA 2GGZA 3BUNB 4DS7A 2H61C 2KYCA 2JNXA 2KI4B 3GOFA 3TUYC 2K2AA 1JC2A 2AAOA 5HKZA 2MJWB 2LC5A 1KK7Y 3SIAA 1AP4A 1CB1A 2MLFC 3VRPA 1SPYA 1GGZA 4N5XA 1NX1A 4OV2A 3HCMA 2SCPA 1MHOA 3I5HB 1F55A 2OS8B 1B7TZ 1HT9A 1BT6A 2K0JA 1SBJA 1K90D 1YUTA 4CPVA 4NDCA 1WLZA 1JUOA 3DVKA 1KSMA 2G2BA 2BE6A 1BR1B 1NUBA 2LHLA 1QX5B 1S6JA 1A75A 1JFKA 2KI6D 1H8BA 2F3ZA 4QJ4B 3NSLA 5F6TA 1CFFA 1K96A 4I5JA 1S3PA 1CKKA 1J1DA 4P5OE 1S5GY 1H4BA 2K7OA 5AERA 3I5IB 1U5IB 4AQJA 1JF2A 1Q80A 4M2PA 2LAPA 2LP2A 1TNPA 2WCEA 4UPGA 3EK7A 2OTGB 2KSPA 3SG3A 5K89A 1C7WA 3TDUA 1S1EA 2L51A 1MXEA 3EKHA 4PE1A 1LINA 3EK8A 3CS1A 4ZCVA 2KDHA 1J7RA 1K9KA 2M7LA 2JT0A 2HPSA 1K8UA 3BOWA 1OZOA 4QJ5B 1CDPA 2WOSA 1JBAA 4BY4A 4PHNA 2BECA 1TRFA 2B1UA 1BLQA 1BMOA 1N0YA 4ORAB 1GQMA 1TCFA 1B8LA 4AQIA 2LCPA 5CPVA 1XFXO 1TNQA 4FQOA 4DRWA 2M29A 1CMFA 1EH2A 3HX4A 3OB2B 3QRXA 4PDZA 4YGAA 4YGDB 1XK4C 1B8CA 4C0KA 5I2QA 2M49B 2IS9A 4GNKB 2JC2A 4BY5A 1DGVA 3KHEA 4WRIA 4PE4A 1BG1A 2PSRA 3CR5X 1SCMC 3A8RA 1OZSA 1SW8A 1Y1AA 3EVRA 1BF5A 4OKHA 2LMUA 1G4YR 5AEQA 2EHBA 2L50A 4YRUA 2JTTA 2OPOA 1RFJA 2KAVA 1YRUB 3CZTX 4A4BA 1F8HA 1EJ3A 3AKAA 1IQ3A 1M63B 1YURA 1UWOA 1MWNA 3BUOB 2LP3A 4A4CA 2JPTA 2ZNDA 3SJSA 3JVTB 2H61A 1TIZA 4HREE 3D10A 1DJIA 1KWOB 2JNFA 4HRGA 2NCPA 1WRKA 4YGBB 5B8IB 1K9UA 3CGAA 1UP5A 3ICBA 3NSKA 2L0PA 3OHMB 1JSAA 1AJ4A 1OMVA 3BQ3A 1SR6C 4CIDA 1KFUS 2LVVA 3M0WA 1IJ5A 1FF1A 5PALA 1QS7A 3DF0B 4YGCB 1TN4A 1QX2A 5I2LA 1IQ5A 3TS5C 3DD4A 2WC8A 3OX6A 1SL7A 2NLNA 1ZOTB 1F71A 1J55A 1RJVA 3LL8B 1TNXA 2ZRSA 4CLNA 1K95A 2LLUA 2WNDA 2R2IA 1R2UA 1KQVA 3IQOA 1QV0A 3D0YA 1JF0A 1V1FA 4I5NB 3WXAA 4PE7A 1LA0A 2Y5IA 1DMOA 2ZFDA 2EC6B 5I8NA 2TN4A 1M45A 1OMRA 3O2PA 2HQWA 3LCPC 2AMIA 2CNPA 2CCMA 4GUKA 2LVIA 4C0LA 1KSOA 1S36A 1NPQA 2F33A 2FCDA 1ZUZA 3BUMB 4YGEB 1B1GA 4M2OA 2AUCA 2D8NA 3SG7A 1WDCB 1SMGA 1CDNA 2BBMA 1MF8B 1N2DA 3JTDC 2LE9B 4WQ2A 3TDZA 1IRJA 3BYAA 1SRAA 5CSNA 1CLBA 3MSEB 1V1GA 1B4CA 2O60A 1XFUO 1KFUL 3DVMA 2E6WA 3O6BA 1OMDA 5HLVA 2BE4A 2KNEA 2PRUA 2JULA 1FW4A 2KOTA 4GGFA 1PSRA 4GGNA 2I2RE 1QVIY 1CFCA 1QXPA 1DJWA 1LKJA 2LUXA 1GJYA 1DJGA 1FPWA 3TUYB 2JQ6A 2M1KB 4OCIA 2M0RA 2JT3A 1C07A 1Y0VH 1ALWA 1R6PA 2F2OA 1SNLA 1DJXA 1QIWA 2Q91A 4DCKA 1XFZO 4R1EA 1FI5A 2DOQA 1ZMZA 2M8UA 5ER5A 2KAYA 1XYDA 2JWWA 3RLZA 1KCYA 3C1VA 3PM8A 1PSBA 4PCWA 3H4SE 2FCEA 1SL8A 1XK4A 1B8RA 1ODBA 2PALA 1SCVA 3K21A 4ETOA 1LXFC 1UHNA 1B7TY 3DF0A 2FJUB 1LVCD 1J7PA 2BL0C 1SKTA 2M9GA 1FI6A 2MA2A 1DTLA 2JXCA 3PATA 5JOLA 1BR4B 1KQMC 2RGIA 2JU0A 4CFRA 2JZIA 1PVBA 3TS5B 3D0YB 1QTXA 1UURA 2G9BA 2CT9A 1CFPA 2KI6C 1TCOB 1L2OB 1CMGA 2PASA 2E30A 3O78A 3AAKA 1S6CA 4WQ3A 5FYXA 2KYFA 3OB1B 1CDMA 1G8IA 1A4PA 1DJHA 1IKUA 2V53A 3DVJA 5HKWA 4N1FA 4USLA 3BXKA 3PN7C 1TTXA 1QV1A 1OQPA 3WHTB 3I5FC 1B9AA 2KHNA 3F45A 2HQ8A 1RTP1 1J7OA 1MR8A 2ZRTA 1BODA 3FWBA 2KGRA
chains in the Genus database with same CATH superfamily
1CM4A 3L47A 2ZN8A 1QLKA 4GFTA 4INXA 4MZLA 2Y1MA 2KFFA 4F0ZB 1CFDA 3BUWB 3O4YA 3WNXB 4GAOA 2LUCA 1C3ZA 2H8VA 4MSPA 4YI9A 1DJZA 1AHRA 3LLEA 1PALA 1D1OA 3VRNA 1A03A 3N7HA 1RWYA 2KLDA 2QEHA 5DKQA 1A2XA 3PM2A 1F70A 1AVSA 2MLEC 2KQYA 1KK8C 4HRHA 4I5LB 1PULA 4M2QA 1XA5A 2FOTA 2I7AA 2M7NA 1DGUA 1UHHA 1RK9A 2MHHA 4D1EA 1K93D 4MZJA 3BFBA 1YX8A 1IJ6A 1WRZA 2BCAA 2PMYA 4JWQA 2CBLA 1NX0A 1BOCA 1GM0A 1XO5A 2GGMA 4PHKA 3SG6A 3ZNIA 1AUIB 1ORGA 1WRLA 1BU3A 1P28A 3ZWHA 4YI8A 1OW4A 3LK1A 2KI4C 2LMVA 1SCMB 2MRDA 4XYNA 4Q04A 5HLOA 1K2HA 2L4HA 1KK7Z 1XFVO 3EVUA 1EL4A 2K61A 3D74A 1BJFA 1M39A 4PHMA 1IWQA 2LLTA 1NIWA 4HSZA 1PVAA 1QATA 1OOGA 4E68A 1ZACA 4JPZB 1NWDA 1K94A 2JXLA 2BAPA 1MQ1A 3PALA 1DT7B 3I5HC 1NX2A 2K7BA 2OS8C 2K7DA 1J7QA 2P6BB 5TNCA 5CSJA 5CSFA 1B47A 2L98A 4MRYA 4N1GA 2JRFA 5EL2A 1QJTA 2BBNA 2EGDA 2VRGA 2Y1NA 4NDDA 1EXRA 3FE8A 5KSZA 1G33A 1SR6B 1SYMA 1UHIA 3I5GB 4FTGA 4YBHB 4NDBA 1SK6D 3RZSA 4INWA 2L4IA 2A4JA 3TDIA 1YVLA 4L9MA 4OZDA 5FI2A 4ZCUA 1YX7A 1DVIA 1IG5A 1XFYO 2LNKA 2PVBA 1QVIZ 2CXJA 2LVKA 3CLNA 4MLWA 4U8DA 1AJ5A 1NYAA 1ZFSA 2KFHA 2ERBA 1DF0A 1S5GZ 2WCFA 1E8AA 2KAXA 1L7ZA 5BPJA 3VGOA 2JTZA 5HYDA 1S26D 2ZKMX 3I5IC 2Q4UA 4JD9A 5D7FA 2WCBA 3EG5B 1LA3A 2LLSA 3PLFB 1JFJA 3VRRA 4NQGA 1OSAA 2M97A 2K7CA 2OTGC 4GBAA 5JJGA 3EKJA 4PHJA 4OVNF 3A4UB 1TOPA 1CM1A 4CFQA 4MEWA 3OX5A 1CNPA 3S0DA 3EK4A 5AFPA 1QLSA 4FQTA 2HETA 1TNWA 2BKIB 3VRQA 5J3XA 2JT8A 1EG4A 2LANA 1YUSA 4MZKA 1VRKA 2NXQA 1GGWA 3FE6A 3E3RA 1DJYA 1Y1UA 4XJKA 1L2OC 5IBWA 1F4OA 3RM1A 1Y6WA 3JTDB 4ICBA 5ER4X 1SL9A 2I18A 2KQ6A 5DKRA 3DVEA 1CDLA 3SG4A 1YVHA 1NP8A 1NCYA 4ORBB 2KBMA 3SG5A 1PRWA 1KFXS 3B86A 3NXAA 1Z2CB 3LK0A 1YRTB 1SY9A 5HKYA 1S6IA 5CSIA 1UUSA 2SASA 3V2LA 1PK0D 3NGVA 4MBEA 3SIBA 1CTRA 2QACA 2ZNEA 3FS7A 3KPXA 2MBXA 4MN0A 2NCOA 1WY9A 3GK1A 1YUUA 2ISDA 4ORCB 3SG2A 2M3WA 3CDNA 3OGNA 3R1PA 4GGFC 3FWCA 2MAZA 1X02A 3EVVA 1N65A 1DF0B 1NCZA 1TUJA 1XFRA 2GV5A 2K8MB 2LHIA 1CLLA 1K9PA 2GTEA 1AK8A 3PFVA 1IGVA 3BUXB 1W7JB 2BL0B 2QEVA 2L2EA 2PQLA 2LM5A 2WORA 2F8PA 1QIVA 2BCXA 2K2FA 2LV7A 3JVTC 4IL1A 4JQ0D 4OR9B 5AXIA 1KQMB 4TNCA 1KWOC 4GPLB 2KGBC 4PALA 3AKBA 4PE0A 1HQVA 1QX7A 1UHJA 1WLMA 1XFWO 1UHKA 2KBIA 3CR2A 3IQQA 3WHUB 5KTYA 3OP0A 4DUQA 1NSHA 1Y1XA 1F4QA 5KU1A 1DC1A 2YGUA 2KFGA 1IH0A 5DKNA 3O4XA 1EG3A 1OE9B 2M1UA 3DXLA 2BKHB 2H2KA 1OOJA 1RECA 3AAJA 4PT1A 5AANA 1FBVA 1F54A 2BCBA 3PSRA 1KFXL 2QPTA 3D78A 2JOJA 1NX3A 2WC6A 4XJKB 1A75B 1MUXA 3NSOA 3PN7B 2Y4QA 2QEOA 2LVJA 1DELA 1DEKA 1XVJA 2WCLA 3B7AA 3GK2A 3I5FB 1M31A 2F3YA 1C7VA 2EC6C 3VROA 3CR4X 3CTNA 1QASA 5GQQC 2ZN9A 2CTNA 1JWDA 1CLMA 1ALVA 1NCXA 2L5XB 3NHIA 3L4AA 3TZ1A 1YR5A 2HF5A 3CWGA 4QJ3B 2COLB 1U5IA 3GK4X 1J1EA 2LMTA 3I5GC 3KEVA 1A29A 1M46A 1MXLC 2WC5A 4DIRA 1W7IB 1WDCC 2WCMA 1OOIX 2NZ0A 5D69A 4MVFA 1YTZC 3NSIA 3KF9A 1RROA 3KO0A 1KK8B 4C0JA 5I2OA 3FIAA 3CZ2A 4MRXA 2I94A 2JPOA 3IF7A 4I5KA 3BOWB 2F2PA 2O5GA 5G08A 3PJIA 4AOMA 2GGZA 3BUNB 4DS7A 2H61C 2KYCA 2JNXA 2KI4B 3GOFA 3R72A 3TUYC 2K2AA 1JC2A 2AAOA 5HKZA 2MJWB 2LC5A 1KK7Y 3SIAA 1AP4A 1CB1A 2MLFC 2QEBA 3VRPA 1SPYA 1GGZA 4N5XA 1NX1A 4OV2A 3HCMA 2SCPA 1MHOA 3I5HB 1F55A 2OS8B 1B7TZ 1HT9A 1BT6A 2K0JA 1SBJA 3OBVA 2BNXA 1K90D 1YUTA 4CPVA 2QDIA 4NDCA 1WLZA 1JUOA 3DVKA 1KSMA 3DZTA 2G2BA 2BE6A 1BR1B 1NUBA 1TWOA 2LHLA 1QX5B 1S6JA 1A75A 1JFKA 2KI6D 1H8BA 2F3ZA 4QJ4B 3NSLA 5F6TA 1CFFA 1K96A 4I5JA 1S3PA 1CKKA 1J1DA 1T14A 1S5GY 4P5OE 1H4BA 3S0EA 2K7OA 5AERA 3D73A 3I5IB 1U5IB 4AQJA 1JF2A 1Q80A 4M2PA 2LAPA 2WCKA 1IIOA 2LP2A 1TNPA 2WCEA 4UPGA 3EK7A 2OTGB 2KSPA 3SG3A 5K89A 1C7WA 3TDUA 1S1EA 2L51A 1MXEA 3EKHA 4PE1A 1LINA 3EK8A 3CS1A 4ZCVA 2KDHA 3CYZA 1J7RA 1K9KA 2M7LA 2JT0A 3K1EA 2HPSA 1K8UA 3B6XA 3BOWA 1OZOA 4QJ5B 3D75A 3IVTA 1CDPA 2WOSA 1JBAA 4BY4A 4PHNA 2BECA 1TRFA 2B1UA 1BLQA 1BMOA 1N0YA 4ORAB 1GQMA 1TCFA 1B8LA 4AQIA 2LCPA 5CPVA 3UNWA 1XFXO 1TNQA 4FQOA 4DRWA 2M29A 1CMFA 1EH2A 3HX4A 3OB2B 3QRXA 4PDZA 4YGAA 4YGDB 1XK4C 1B8CA 4C0KA 5I2QA 2M49B 2IS9A 4GNKB 3BFHA 2JC2A 3DY9A 4BY5A 4KYNA 1DGVA 3KHEA 4F7FA 3SS3A 4WRIA 3S0BA 4PE4A 1BG1A 2PSRA 3CR5X 1SCMC 3A8RA 1OZSA 1SW8A 1Y1AA 3EVRA 1BF5A 1W9ZA 4OKHA 2LMUA 1G4YR 2FJYA 3L4LA 5AEQA 2EHBA 2K60A 2L50A 4YRUA 2JTTA 2OPOA 1RFJA 2KAVA 3SS5A 1YRUB 3CZTX 4A4BA 1F8HA 2P71A 1EJ3A 3AKAA 1IQ3A 1M63B 1YURA 1UWOA 1MWNA 3R1OA 3BUOB 3S0AA 2LP3A 4A4CA 2JPTA 2ZNDA 3SJSA 3JVTB 2H61A 1TIZA 4HREE 3D10A 1DJIA 1KWOB 2JNFA 4HRGA 2NCPA 1WRKA 4YGBB 5B8IB 1K9UA 3CGAA 1UP5A 3ICBA 3NSKA 2L0PA 3OHMB 1JSAA 1AJ4A 1OMVA 3BQ3A 1SR6C 1TUZA 4CIDA 1C3YA 1KFUS 2LVVA 3M0WA 1IJ5A 1OOFA 3R1VA 1FF1A 5PALA 1QS7A 3DF0B 4YGCB 1TN4A 3FE9A 1QX2A 5I2LA 1IQ5A 3TS5C 3DD4A 2WC8A 3OX6A 1SL7A 2NLNA 1ZOTB 5DICA 1F71A 1J55A 1RJVA 3QMEA 3LL8B 1TNXA 2ZRSA 4CLNA 1K95A 1QWVA 2LLUA 2WNDA 2R2IA 1R2UA 3D77A 5FI7A 1KQVA 3IQOA 1QV0A 3D0YA 1JF0A 1V1FA 4I5NB 5D3OA 3WXAA 4PE7A 1LA0A 2Y5IA 1DMOA 2ZFDA 2EC6B 3CZ1A 2TN4A 1M45A 5I8NA 1OMRA 3O2PA 2HQWA 3LCPC 2AMIA 2CNPA 3S0FA 2CCMA 3Q8IA 2LVIA 4GUKA 4C0LA 1KSOA 1S36A 1NPQA 2F33A 2FCDA 1ZUZA 3UO9A 3BUMB 4YGEB 1B1GA 3BJHA 4M2OA 2AUCA 2D8NA 3SG7A 1WDCB 1SMGA 2PYQA 1CDNA 2BBMA 1MF8B 1N2DA 3JTDC 2LE9B 4P2YB 4WQ2A 1IRJA 3BYAA 1SRAA 5CSNA 3TDZA 3MSEB 1V1GA 1CLBA 1B4CA 2O60A 1XFUO 1KFUL 3DVMA 2E6WA 2L5YA 2WCHA 3O6BA 1OMDA 5HLVA 2BE4A 2KNEA 2PRUA 3SS4A 2JULA 1FW4A 2KOTA 4GGFA 1PSRA 4GGNA 2I2RE 1QVIY 1CFCA 1QXPA 1DJWA 1LKJA 2LUXA 1GJYA 1DJGA 1FPWA 3TUYB 1Z4HA 2JQ6A 2M1KB 2M0RA 2JT3A 4OCIA 1C07A 1Y0VH 1ALWA 1R6PA 2F2OA 1SNLA 1FI5A 1OOHA 1DJXA 1QIWA 2Q91A 4DCKA 1XFZO 4R1EA 2P70A 1DQEA 2DOQA 1ZMZA 2M8UA 5ER5A 2KAYA 1XYDA 2JWWA 3RLZA 1KCYA 3C1VA 3BFAA 3PM8A 1PSBA 4PCWA 3H4SE 2FCEA 1SL8A 1XK4A 1B8RA 1ODBA 2PALA 1SCVA 2WCJA 3K21A 1LXFC 4ETOA 1UHNA 1B7TY 3DF0A 2FJUB 1LVCD 1J7PA 2BL0C 1SKTA 2M9GA 1FI6A 2MA2A 5I94A 1DTLA 2JXCA 3PATA 5JOLA 1BR4B 1KQMC 2RGIA 2JU0A 4CFRA 3B87A 2JZIA 1PVBA 2KPHA 4JKTA 3TS5B 3D0YB 1QTXA 1UURA 2G9BA 2CT9A 3D76A 1CFPA 2KI6C 1TCOB 1L2OB 3DYEA 1CMGA 2PASA 2E30A 3O78A 3AAKA 3NHTA 1S6CA 4WQ3A 5FYXA 2KYFA 3VB1A 3OB1B 1CDMA 5FI6A 1G8IA 1SSEB 1A4PA 1DJHA 1IKUA 2V53A 3DVJA 5HKWA 4N1FA 3CABA 1LS8A 4USLA 3BXKA 3PN7C 1TTXA 1QV1A 4IJ7A 1OQPA 3WHTB 3I5FC 1B9AA 2KHNA 3CZ0A 3F45A 2HQ8A 3B88A 1RTP1 1J7OA 2KLEA 1MR8A 2ZRTA 5HL1A 1BODA 3FWBA 2L2CA 2KGRA 3S0GA
chains in the Genus database with same CATH topology
1CM4A 2ZN8A 1QLKA 4GFTA 4MZLA 4F0ZB 2Y1MA 2KFFA 1CFDA 3BUWB 3O4YA 3WNXB 4GAOA 2LUCA 4YI9A 4MSPA 1DJZA 1AHRA 3LLEA 1PALA 1D1OA 3VRNA 1A03A 1RWYA 5DKQA 1A2XA 1F70A 1AVSA 2MLEC 2KQYA 1KK8C 4HRHA 4I5LB 1PULA 4M2QA 1XA5A 2FOTA 2I7AA 2M7NA 1DGUA 1UHHA 1RK9A 2MHHA 4D1EA 1K93D 4MZJA 1YX8A 1IJ6A 1WRZA 2BCAA 2PMYA 4JWQA 2CBLA 1NX0A 1BOCA 1XO5A 2GGMA 4PHKA 3SG6A 3ZNIA 1AUIB 1WRLA 1BU3A 3ZWHA 4YI8A 3LK1A 2KI4C 2LMVA 1SCMB 2MRDA 4XYNA 4Q04A 5HLOA 2L4HA 1KK7Z 1XFVO 3EVUA 1EL4A 2K61A 4PHMA 1BJFA 1M39A 1IWQA 2LLTA 1NIWA 4HSZA 1PVAA 1QATA 4E68A 1ZACA 4JPZB 1NWDA 1K94A 2JXLA 1MQ1A 3PALA 1DT7B 3I5HC 1NX2A 2K7BA 2OS8C 2K7DA 1J7QA 2P6BB 5TNCA 5CSJA 5CSFA 1B47A 2L98A 4MRYA 4N1GA 2JRFA 1QJTA 2BBNA 2EGDA 2VRGA 2Y1NA 4NDDA 1EXRA 5KSZA 1G33A 1SR6B 1SYMA 1UHIA 3I5GB 4FTGA 4YBHB 4NDBA 1SK6D 2L4IA 2A4JA 3TDIA 1YVLA 4L9MA 4ZCUA 1YX7A 1DVIA 1IG5A 1XFYO 2LNKA 2PVBA 1QVIZ 2CXJA 2LVKA 3CLNA 4MLWA 4U8DA 1AJ5A 1NYAA 1ZFSA 2KFHA 1DF0A 1S5GZ 2WCFA 1E8AA 2KAXA 1L7ZA 5BPJA 3VGOA 2JTZA 5HYDA 1S26D 2ZKMX 3I5IC 2Q4UA 5D7FA 2WCBA 1LA3A 2LLSA 3PLFB 1JFJA 3VRRA 4NQGA 1OSAA 2M97A 2K7CA 2OTGC 4GBAA 5JJGA 3EKJA 4PHJA 4OVNF 3A4UB 1TOPA 1CM1A 4CFQA 4MEWA 3OX5A 1CNPA 3EK4A 5AFPA 1QLSA 2HETA 1TNWA 2BKIB 3VRQA 5J3XA 2JT8A 1EG4A 2LANA 1YUSA 4MZKA 1VRKA 2NXQA 1GGWA 3E3RA 1DJYA 1Y1UA 4XJKA 1L2OC 5IBWA 1F4OA 3RM1A 1Y6WA 3JTDB 4ICBA 5ER4X 1SL9A 2I18A 2KQ6A 5DKRA 3DVEA 1CDLA 3SG4A 1YVHA 1NP8A 1NCYA 4ORBB 2KBMA 3SG5A 1PRWA 1KFXS 3NXAA 5HKYA 3LK0A 1YRTB 1SY9A 1S6IA 5CSIA 1UUSA 2SASA 1PK0D 4MBEA 3SIBA 1CTRA 2QACA 2ZNEA 3FS7A 3KPXA 2MBXA 4MN0A 2NCOA 1WY9A 3GK1A 1YUUA 2ISDA 4ORCB 3SG2A 2M3WA 4GGFC 3FWCA 2MAZA 1X02A 3EVVA 1N65A 1DF0B 1NCZA 2GV5A 2K8MB 1AK8A 2LHIA 1CLLA 1K9PA 3PFVA 1IGVA 3BUXB 1W7JB 2BL0B 4P2YB 2L2EA 2WORA 2LM5A 4IL1A 2F8PA 1QIVA 2BCXA 2K2FA 2LV7A 3JVTC 4JQ0D 4OR9B 5AXIA 1K2HA 1KQMB 4TNCA 1KWOC 4GPLB 2KGBC 4PALA 3AKBA 4PE0A 1HQVA 1QX7A 1UHJA 1WLMA 1XFWO 1UHKA 2KBIA 3CR2A 3IQQA 3WHUB 5KTYA 3OP0A 4DUQA 1NSHA 1Y1XA 1F4QA 5KU1A 2KFGA 1IH0A 5DKNA 1EG3A 1OE9B 2M1UA 2BKHB 2H2KA 1OOJA 1RECA 3AAJA 5AANA 1FBVA 1F54A 2BCBA 3PSRA 1KFXL 2QPTA 2JOJA 1NX3A 4XJKB 1A75B 1MUXA 3NSOA 3PN7B 2Y4QA 2LVJA 3GK2A 1XVJA 3I5FB 1M31A 2F3YA 1C7VA 2EC6C 3VROA 3CR4X 3CTNA 1QASA 5GQQC 2ZN9A 2CTNA 1JWDA 1CLMA 1ALVA 1NCXA 2L5XB 3TZ1A 1YR5A 2HF5A 3CWGA 4QJ3B 2COLB 1U5IA 3GK4X 1J1EA 2LMTA 3I5GC 3KEVA 1A29A 1M46A 1MXLC 4DIRA 1W7IB 1WDCC 2NZ0A 5D69A 4MVFA 1YTZC 3NSIA 3KF9A 1RROA 3KO0A 1KK8B 4C0JA 5I2OA 3FIAA 4MRXA 2I94A 3IF7A 4I5KA 3BOWB 2F2PA 2O5GA 5G08A 4AOMA 2GGZA 3BUNB 4DS7A 2H61C 2KYCA 2JNXA 2KI4B 3GOFA 3TUYC 2K2AA 1JC2A 2AAOA 5HKZA 2MJWB 2LC5A 1KK7Y 3SIAA 1AP4A 1CB1A 2MLFC 3VRPA 1SPYA 1GGZA 4N5XA 1NX1A 4OV2A 3HCMA 2SCPA 1MHOA 3I5HB 1F55A 2OS8B 1B7TZ 1HT9A 1BT6A 2K0JA 1SBJA 1K90D 1YUTA 4CPVA 4NDCA 1WLZA 1JUOA 3DVKA 1KSMA 2G2BA 2BE6A 1BR1B 1NUBA 2LHLA 1QX5B 1S6JA 1A75A 1JFKA 2KI6D 1H8BA 2F3ZA 4QJ4B 3NSLA 5F6TA 1CFFA 1K96A 4I5JA 1S3PA 1CKKA 1J1DA 4P5OE 1S5GY 1H4BA 2K7OA 5AERA 3I5IB 1U5IB 4AQJA 1JF2A 1Q80A 4M2PA 2LAPA 2LP2A 1TNPA 2WCEA 4UPGA 3EK7A 2OTGB 2KSPA 3SG3A 5K89A 1C7WA 3TDUA 1S1EA 2L51A 1MXEA 3EKHA 4PE1A 1LINA 3EK8A 3CS1A 4ZCVA 2KDHA 1J7RA 1K9KA 2M7LA 2JT0A 2HPSA 1K8UA 3BOWA 1OZOA 4QJ5B 1CDPA 2WOSA 1JBAA 4BY4A 4PHNA 2BECA 1TRFA 2B1UA 1BLQA 1BMOA 1N0YA 4ORAB 1GQMA 1TCFA 1B8LA 4AQIA 2LCPA 5CPVA 1XFXO 1TNQA 4FQOA 4DRWA 2M29A 1CMFA 1EH2A 3HX4A 3OB2B 3QRXA 4PDZA 4YGAA 4YGDB 1XK4C 1B8CA 4C0KA 5I2QA 2M49B 2IS9A 4GNKB 2JC2A 4BY5A 1DGVA 3KHEA 4WRIA 4PE4A 1BG1A 2PSRA 3CR5X 1SCMC 3A8RA 1OZSA 1SW8A 1Y1AA 3EVRA 1BF5A 4OKHA 2LMUA 1G4YR 5AEQA 2EHBA 2L50A 4YRUA 2JTTA 2OPOA 1RFJA 2KAVA 1YRUB 3CZTX 4A4BA 1F8HA 1EJ3A 3AKAA 1IQ3A 1M63B 1YURA 1UWOA 1MWNA 3BUOB 2LP3A 4A4CA 2JPTA 2ZNDA 3SJSA 3JVTB 2H61A 1TIZA 4HREE 3D10A 1DJIA 1KWOB 2JNFA 4HRGA 2NCPA 1WRKA 4YGBB 5B8IB 1K9UA 3CGAA 1UP5A 3ICBA 3NSKA 2L0PA 3OHMB 1JSAA 1AJ4A 1OMVA 3BQ3A 1SR6C 4CIDA 1KFUS 2LVVA 3M0WA 1IJ5A 1FF1A 5PALA 1QS7A 3DF0B 4YGCB 1TN4A 1QX2A 5I2LA 1IQ5A 3TS5C 3DD4A 2WC8A 3OX6A 1SL7A 2NLNA 1ZOTB 1F71A 1J55A 1RJVA 3LL8B 1TNXA 2ZRSA 4CLNA 1K95A 2LLUA 2WNDA 2R2IA 1R2UA 1KQVA 3IQOA 1QV0A 3D0YA 1JF0A 1V1FA 4I5NB 3WXAA 4PE7A 1LA0A 2Y5IA 1DMOA 2ZFDA 2EC6B 5I8NA 2TN4A 1M45A 1OMRA 3O2PA 2HQWA 3LCPC 2AMIA 2CNPA 2CCMA 4GUKA 2LVIA 4C0LA 1KSOA 1S36A 1NPQA 2F33A 2FCDA 1ZUZA 3BUMB 4YGEB 1B1GA 4M2OA 2AUCA 2D8NA 3SG7A 1WDCB 1SMGA 1CDNA 2BBMA 1MF8B 1N2DA 3JTDC 2LE9B 4WQ2A 3TDZA 1IRJA 3BYAA 1SRAA 5CSNA 1CLBA 3MSEB 1V1GA 1B4CA 2O60A 1XFUO 1KFUL 3DVMA 2E6WA 3O6BA 1OMDA 5HLVA 2BE4A 2KNEA 2PRUA 2JULA 1FW4A 2KOTA 4GGFA 1PSRA 4GGNA 2I2RE 1QVIY 1CFCA 1QXPA 1DJWA 1LKJA 2LUXA 1GJYA 1DJGA 1FPWA 3TUYB 2JQ6A 2M1KB 4OCIA 2M0RA 2JT3A 1C07A 1Y0VH 1ALWA 1R6PA 2F2OA 1SNLA 1DJXA 1QIWA 2Q91A 4DCKA 1XFZO 4R1EA 1FI5A 2DOQA 1ZMZA 2M8UA 5ER5A 2KAYA 1XYDA 2JWWA 3RLZA 1KCYA 3C1VA 3PM8A 1PSBA 4PCWA 3H4SE 2FCEA 1SL8A 1XK4A 1B8RA 1ODBA 2PALA 1SCVA 3K21A 4ETOA 1LXFC 1UHNA 1B7TY 3DF0A 2FJUB 1LVCD 1J7PA 2BL0C 1SKTA 2M9GA 1FI6A 2MA2A 1DTLA 2JXCA 3PATA 5JOLA 1BR4B 1KQMC 2RGIA 2JU0A 4CFRA 2JZIA 1PVBA 3TS5B 3D0YB 1QTXA 1UURA 2G9BA 2CT9A 1CFPA 2KI6C 1TCOB 1L2OB 1CMGA 2PASA 2E30A 3O78A 3AAKA 1S6CA 4WQ3A 5FYXA 2KYFA 3OB1B 1CDMA 1G8IA 1A4PA 1DJHA 1IKUA 2V53A 3DVJA 5HKWA 4N1FA 4USLA 3BXKA 3PN7C 1TTXA 1QV1A 1OQPA 3WHTB 3I5FC 1B9AA 2KHNA 3F45A 2HQ8A 1RTP1 1J7OA 1MR8A 2ZRTA 1BODA 3FWBA 2KGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM4 A;  2ZN8 A;  1QLK A;  4GFT A;  4MZL A;  4F0Z B;  2Y1M A;  2KFF A;  1CFD A;  3BUW B;  3O4Y A;  3WNX B;  4GAO A;  2LUC A;  4YI9 A;  4MSP A;  1DJZ A;  1AHR A;  3LLE A;  1PAL A;  1D1O A;  3VRN A;  1A03 A;  1RWY A;  5DKQ A;  1A2X A;  1F70 A;  1AVS A;  2MLE C;  2KQY A;  1KK8 C;  4HRH A;  4I5L B;  1PUL A;  4M2Q A;  1XA5 A;  2FOT A;  2I7A A;  2M7N A;  1DGU A;  1UHH A;  1RK9 A;  2MHH A;  4D1E A;  1K93 D;  4MZJ A;  1YX8 A;  1IJ6 A;  1WRZ A;  2BCA A;  2PMY A;  4JWQ A;  2CBL A;  1NX0 A;  1BOC A;  1XO5 A;  2GGM A;  4PHK A;  3SG6 A;  3ZNI A;  1AUI B;  1WRL A;  1BU3 A;  3ZWH A;  4YI8 A;  3LK1 A;  2KI4 C;  2LMV A;  1SCM B;  2MRD A;  4XYN A;  4Q04 A;  5HLO A;  2L4H A;  1KK7 Z;  1XFV O;  3EVU A;  1EL4 A;  2K61 A;  4PHM A;  1BJF A;  1M39 A;  1IWQ A;  2LLT A;  1NIW A;  4HSZ A;  1PVA A;  1QAT A;  4E68 A;  1ZAC A;  4JPZ B;  1NWD A;  1K94 A;  2JXL A;  1MQ1 A;  3PAL A;  1DT7 B;  3I5H C;  1NX2 A;  2K7B A;  2OS8 C;  2K7D A;  1J7Q A;  2P6B B;  5TNC A;  5CSJ A;  5CSF A;  1B47 A;  2L98 A;  4MRY A;  4N1G A;  2JRF A;  1QJT A;  2BBN A;  2EGD A;  2VRG A;  2Y1N A;  4NDD A;  1EXR A;  5KSZ A;  1G33 A;  1SR6 B;  1SYM A;  1UHI A;  3I5G B;  4FTG A;  4YBH B;  4NDB A;  1SK6 D;  2L4I A;  2A4J A;  3TDI A;  1YVL A;  4L9M A;  4ZCU A;  1YX7 A;  1DVI A;  1IG5 A;  1XFY O;  2LNK A;  2PVB A;  1QVI Z;  2CXJ A;  2LVK A;  3CLN A;  4MLW A;  4U8D A;  1AJ5 A;  1NYA A;  1ZFS A;  2KFH A;  1DF0 A;  1S5G Z;  2WCF A;  1E8A A;  2KAX A;  1L7Z A;  5BPJ A;  3VGO A;  2JTZ A;  5HYD A;  1S26 D;  2ZKM X;  3I5I C;  2Q4U A;  5D7F A;  2WCB A;  1LA3 A;  2LLS A;  3PLF B;  1JFJ A;  3VRR A;  4NQG A;  1OSA A;  2M97 A;  2K7C A;  2OTG C;  4GBA A;  5JJG A;  3EKJ A;  4PHJ A;  4OVN F;  3A4U B;  1TOP A;  1CM1 A;  4CFQ A;  4MEW A;  3OX5 A;  1CNP A;  3EK4 A;  5AFP A;  1QLS A;  2HET A;  1TNW A;  2BKI B;  3VRQ A;  5J3X A;  2JT8 A;  1EG4 A;  2LAN A;  1YUS A;  4MZK A;  1VRK A;  2NXQ A;  1GGW A;  3E3R A;  1DJY A;  1Y1U A;  4XJK A;  1L2O C;  5IBW A;  1F4O A;  3RM1 A;  1Y6W A;  3JTD B;  4ICB A;  5ER4 X;  1SL9 A;  2I18 A;  2KQ6 A;  5DKR A;  3DVE A;  1CDL A;  3SG4 A;  1YVH A;  1NP8 A;  1NCY A;  4ORB B;  2KBM A;  3SG5 A;  1PRW A;  1KFX S;  3NXA A;  5HKY A;  3LK0 A;  1YRT B;  1SY9 A;  1S6I A;  5CSI A;  1UUS A;  2SAS A;  1PK0 D;  4MBE A;  3SIB A;  1CTR A;  2QAC A;  2ZNE A;  3FS7 A;  3KPX A;  2MBX A;  4MN0 A;  2NCO A;  1WY9 A;  3GK1 A;  1YUU A;  2ISD A;  4ORC B;  3SG2 A;  2M3W A;  4GGF C;  3FWC A;  2MAZ A;  1X02 A;  3EVV A;  1N65 A;  1DF0 B;  1NCZ A;  2GV5 A;  2K8M B;  1AK8 A;  2LHI A;  1CLL A;  1K9P A;  3PFV A;  1IGV A;  3BUX B;  1W7J B;  2BL0 B;  4P2Y B;  2L2E A;  2WOR A;  2LM5 A;  4IL1 A;  2F8P A;  1QIV A;  2BCX A;  2K2F A;  2LV7 A;  3JVT C;  4JQ0 D;  4OR9 B;  5AXI A;  1K2H A;  1KQM B;  4TNC A;  1KWO C;  4GPL B;  2KGB C;  4PAL A;  3AKB A;  4PE0 A;  1HQV A;  1QX7 A;  1UHJ A;  1WLM A;  1XFW O;  1UHK A;  2KBI A;  3CR2 A;  3IQQ A;  3WHU B;  5KTY A;  3OP0 A;  4DUQ A;  1NSH A;  1Y1X A;  1F4Q A;  5KU1 A;  2KFG A;  1IH0 A;  5DKN A;  1EG3 A;  1OE9 B;  2M1U A;  2BKH B;  2H2K A;  1OOJ A;  1REC A;  3AAJ A;  5AAN A;  1FBV A;  1F54 A;  2BCB A;  3PSR A;  1KFX L;  2QPT A;  2JOJ A;  1NX3 A;  4XJK B;  1A75 B;  1MUX A;  3NSO A;  3PN7 B;  2Y4Q A;  2LVJ A;  3GK2 A;  1XVJ A;  3I5F B;  1M31 A;  2F3Y A;  1C7V A;  2EC6 C;  3VRO A;  3CR4 X;  3CTN A;  1QAS A;  5GQQ C;  2ZN9 A;  2CTN A;  1JWD A;  1CLM A;  1ALV A;  1NCX A;  2L5X B;  3TZ1 A;  1YR5 A;  2HF5 A;  3CWG A;  4QJ3 B;  2COL B;  1U5I A;  3GK4 X;  1J1E A;  2LMT A;  3I5G C;  3KEV A;  1A29 A;  1M46 A;  1MXL C;  4DIR A;  1W7I B;  1WDC C;  2NZ0 A;  5D69 A;  4MVF A;  1YTZ C;  3NSI A;  3KF9 A;  1RRO A;  3KO0 A;  1KK8 B;  4C0J A;  5I2O A;  3FIA A;  4MRX A;  2I94 A;  3IF7 A;  4I5K A;  3BOW B;  2F2P A;  2O5G A;  5G08 A;  4AOM A;  2GGZ A;  3BUN B;  4DS7 A;  2H61 C;  2KYC A;  2JNX A;  2KI4 B;  3GOF A;  3TUY C;  2K2A A;  1JC2 A;  2AAO A;  5HKZ A;  2MJW B;  2LC5 A;  1KK7 Y;  3SIA A;  1AP4 A;  1CB1 A;  2MLF C;  3VRP A;  1SPY A;  1GGZ A;  4N5X A;  1NX1 A;  4OV2 A;  3HCM A;  2SCP A;  1MHO A;  3I5H B;  1F55 A;  2OS8 B;  1B7T Z;  1HT9 A;  1BT6 A;  2K0J A;  1SBJ A;  1K90 D;  1YUT A;  4CPV A;  4NDC A;  1WLZ A;  1JUO A;  3DVK A;  1KSM A;  2G2B A;  2BE6 A;  1BR1 B;  1NUB A;  2LHL A;  1QX5 B;  1S6J A;  1A75 A;  1JFK A;  2KI6 D;  1H8B A;  2F3Z A;  4QJ4 B;  3NSL A;  5F6T A;  1CFF A;  1K96 A;  4I5J A;  1S3P A;  1CKK A;  1J1D A;  4P5O E;  1S5G Y;  1H4B A;  2K7O A;  5AER A;  3I5I B;  1U5I B;  4AQJ A;  1JF2 A;  1Q80 A;  4M2P A;  2LAP A;  2LP2 A;  1TNP A;  2WCE A;  4UPG A;  3EK7 A;  2OTG B;  2KSP A;  3SG3 A;  5K89 A;  1C7W A;  3TDU A;  1S1E A;  2L51 A;  1MXE A;  3EKH A;  4PE1 A;  1LIN A;  3EK8 A;  3CS1 A;  4ZCV A;  2KDH A;  1J7R A;  1K9K A;  2M7L A;  2JT0 A;  2HPS A;  1K8U A;  3BOW A;  1OZO A;  4QJ5 B;  1CDP A;  2WOS A;  1JBA A;  4BY4 A;  4PHN A;  2BEC A;  1TRF A;  2B1U A;  1BLQ A;  1BMO A;  1N0Y A;  4ORA B;  1GQM A;  1TCF A;  1B8L A;  4AQI A;  2LCP A;  5CPV A;  1XFX O;  1TNQ A;  4FQO A;  4DRW A;  2M29 A;  1CMF A;  1EH2 A;  3HX4 A;  3OB2 B;  3QRX A;  4PDZ A;  4YGA A;  4YGD B;  1XK4 C;  1B8C A;  4C0K A;  5I2Q A;  2M49 B;  2IS9 A;  4GNK B;  2JC2 A;  4BY5 A;  1DGV A;  3KHE A;  4WRI A;  4PE4 A;  1BG1 A;  2PSR A;  3CR5 X;  1SCM C;  3A8R A;  1OZS A;  1SW8 A;  1Y1A A;  3EVR A;  1BF5 A;  4OKH A;  2LMU A;  1G4Y R;  5AEQ A;  2EHB A;  2L50 A;  4YRU A;  2JTT A;  2OPO A;  1RFJ A;  2KAV A;  1YRU B;  3CZT X;  4A4B A;  1F8H A;  1EJ3 A;  3AKA A;  1IQ3 A;  1M63 B;  1YUR A;  1UWO A;  1MWN A;  3BUO B;  2LP3 A;  4A4C A;  2JPT A;  2ZND A;  3SJS A;  3JVT B;  2H61 A;  1TIZ A;  4HRE E;  3D10 A;  1DJI A;  1KWO B;  2JNF A;  4HRG A;  2NCP A;  1WRK A;  4YGB B;  5B8I B;  1K9U A;  3CGA A;  1UP5 A;  3ICB A;  3NSK A;  2L0P A;  3OHM B;  1JSA A;  1AJ4 A;  1OMV A;  3BQ3 A;  1SR6 C;  4CID A;  1KFU S;  2LVV A;  3M0W A;  1IJ5 A;  1FF1 A;  5PAL A;  1QS7 A;  3DF0 B;  4YGC B;  1TN4 A;  1QX2 A;  5I2L A;  1IQ5 A;  3TS5 C;  3DD4 A;  2WC8 A;  3OX6 A;  1SL7 A;  2NLN A;  1ZOT B;  1F71 A;  1J55 A;  1RJV A;  3LL8 B;  1TNX A;  2ZRS A;  4CLN A;  1K95 A;  2LLU A;  2WND A;  2R2I A;  1R2U A;  1KQV A;  3IQO A;  1QV0 A;  3D0Y A;  1JF0 A;  1V1F A;  4I5N B;  3WXA A;  4PE7 A;  1LA0 A;  2Y5I A;  1DMO A;  2ZFD A;  2EC6 B;  5I8N A;  2TN4 A;  1M45 A;  1OMR A;  3O2P A;  2HQW A;  3LCP C;  2AMI A;  2CNP A;  2CCM A;  4GUK A;  2LVI A;  4C0L A;  1KSO A;  1S36 A;  1NPQ A;  2F33 A;  2FCD A;  1ZUZ A;  3BUM B;  4YGE B;  1B1G A;  4M2O A;  2AUC A;  2D8N A;  3SG7 A;  1WDC B;  1SMG A;  1CDN A;  2BBM A;  1MF8 B;  1N2D A;  3JTD C;  2LE9 B;  4WQ2 A;  3TDZ A;  1IRJ A;  3BYA A;  1SRA A;  5CSN A;  1CLB A;  3MSE B;  1V1G A;  1B4C A;  2O60 A;  1XFU O;  1KFU L;  3DVM A;  2E6W A;  3O6B A;  1OMD A;  5HLV A;  2BE4 A;  2KNE A;  2PRU A;  2JUL A;  1FW4 A;  2KOT A;  4GGF A;  1PSR A;  4GGN A;  2I2R E;  1QVI Y;  1CFC A;  1QXP A;  1DJW A;  1LKJ A;  2LUX A;  1GJY A;  1DJG A;  1FPW A;  3TUY B;  2JQ6 A;  2M1K B;  4OCI A;  2M0R A;  2JT3 A;  1C07 A;  1Y0V H;  1ALW A;  1R6P A;  2F2O A;  1SNL A;  1DJX A;  1QIW A;  2Q91 A;  4DCK A;  1XFZ O;  4R1E A;  1FI5 A;  2DOQ A;  1ZMZ A;  2M8U A;  5ER5 A;  2KAY A;  1XYD A;  2JWW A;  3RLZ A;  1KCY A;  3C1V A;  3PM8 A;  1PSB A;  4PCW A;  3H4S E;  2FCE A;  1SL8 A;  1XK4 A;  1B8R A;  1ODB A;  2PAL A;  1SCV A;  3K21 A;  4ETO A;  1LXF C;  1UHN A;  1B7T Y;  3DF0 A;  2FJU B;  1LVC D;  1J7P A;  2BL0 C;  1SKT A;  2M9G A;  1FI6 A;  2MA2 A;  1DTL A;  2JXC A;  3PAT A;  5JOL A;  1BR4 B;  1KQM C;  2RGI A;  2JU0 A;  4CFR A;  2JZI A;  1PVB A;  3TS5 B;  3D0Y B;  1QTX A;  1UUR A;  2G9B A;  2CT9 A;  1CFP A;  2KI6 C;  1TCO B;  1L2O B;  1CMG A;  2PAS A;  2E30 A;  3O78 A;  3AAK A;  1S6C A;  4WQ3 A;  5FYX A;  2KYF A;  3OB1 B;  1CDM A;  1G8I A;  1A4P A;  1DJH A;  1IKU A;  2V53 A;  3DVJ A;  5HKW A;  4N1F A;  4USL A;  3BXK A;  3PN7 C;  1TTX A;  1QV1 A;  1OQP A;  3WHT B;  3I5F C;  1B9A A;  2KHN A;  3F45 A;  2HQ8 A;  1RTP 1;  1J7O A;  1MR8 A;  2ZRT A;  1BOD A;  3FWB A;  2KGR A; 
#chains in the Genus database with same CATH topology
 1CM4 A;  3L47 A;  2ZN8 A;  1QLK A;  4GFT A;  4INX A;  4MZL A;  2Y1M A;  2KFF A;  4F0Z B;  1CFD A;  3BUW B;  3O4Y A;  3WNX B;  4GAO A;  2LUC A;  1C3Z A;  2H8V A;  4MSP A;  4YI9 A;  1DJZ A;  1AHR A;  3LLE A;  1PAL A;  1D1O A;  3VRN A;  1A03 A;  3N7H A;  1RWY A;  2KLD A;  2QEH A;  5DKQ A;  1A2X A;  3PM2 A;  1F70 A;  1AVS A;  2MLE C;  2KQY A;  1KK8 C;  4HRH A;  4I5L B;  1PUL A;  4M2Q A;  1XA5 A;  2FOT A;  2I7A A;  2M7N A;  1DGU A;  1UHH A;  1RK9 A;  2MHH A;  4D1E A;  1K93 D;  4MZJ A;  3BFB A;  1YX8 A;  1IJ6 A;  1WRZ A;  2BCA A;  2PMY A;  4JWQ A;  2CBL A;  1NX0 A;  1BOC A;  1GM0 A;  1XO5 A;  2GGM A;  4PHK A;  3SG6 A;  3ZNI A;  1AUI B;  1ORG A;  1WRL A;  1BU3 A;  1P28 A;  3ZWH A;  4YI8 A;  1OW4 A;  3LK1 A;  2KI4 C;  2LMV A;  1SCM B;  2MRD A;  4XYN A;  4Q04 A;  5HLO A;  1K2H A;  2L4H A;  1KK7 Z;  1XFV O;  3EVU A;  1EL4 A;  2K61 A;  3D74 A;  1BJF A;  1M39 A;  4PHM A;  1IWQ A;  2LLT A;  1NIW A;  4HSZ A;  1PVA A;  1QAT A;  1OOG A;  4E68 A;  1ZAC A;  4JPZ B;  1NWD A;  1K94 A;  2JXL A;  2BAP A;  1MQ1 A;  3PAL A;  1DT7 B;  3I5H C;  1NX2 A;  2K7B A;  2OS8 C;  2K7D A;  1J7Q A;  2P6B B;  5TNC A;  5CSJ A;  5CSF A;  1B47 A;  2L98 A;  4MRY A;  4N1G A;  2JRF A;  5EL2 A;  1QJT A;  2BBN A;  2EGD A;  2VRG A;  2Y1N A;  4NDD A;  1EXR A;  3FE8 A;  5KSZ A;  1G33 A;  1SR6 B;  1SYM A;  1UHI A;  3I5G B;  4FTG A;  4YBH B;  4NDB A;  1SK6 D;  3RZS A;  4INW A;  2L4I A;  2A4J A;  3TDI A;  1YVL A;  4L9M A;  4OZD A;  5FI2 A;  4ZCU A;  1YX7 A;  1DVI A;  1IG5 A;  1XFY O;  2LNK A;  2PVB A;  1QVI Z;  2CXJ A;  2LVK A;  3CLN A;  4MLW A;  4U8D A;  1AJ5 A;  1NYA A;  1ZFS A;  2KFH A;  2ERB A;  1DF0 A;  1S5G Z;  2WCF A;  1E8A A;  2KAX A;  1L7Z A;  5BPJ A;  3VGO A;  2JTZ A;  5HYD A;  1S26 D;  2ZKM X;  3I5I C;  2Q4U A;  4JD9 A;  5D7F A;  2WCB A;  3EG5 B;  1LA3 A;  2LLS A;  3PLF B;  1JFJ A;  3VRR A;  4NQG A;  1OSA A;  2M97 A;  2K7C A;  2OTG C;  4GBA A;  5JJG A;  3EKJ A;  4PHJ A;  4OVN F;  3A4U B;  1TOP A;  1CM1 A;  4CFQ A;  4MEW A;  3OX5 A;  1CNP A;  3S0D A;  3EK4 A;  5AFP A;  1QLS A;  4FQT A;  2HET A;  1TNW A;  2BKI B;  3VRQ A;  5J3X A;  2JT8 A;  1EG4 A;  2LAN A;  1YUS A;  4MZK A;  1VRK A;  2NXQ A;  1GGW A;  3FE6 A;  3E3R A;  1DJY A;  1Y1U A;  4XJK A;  1L2O C;  5IBW A;  1F4O A;  3RM1 A;  1Y6W A;  3JTD B;  4ICB A;  5ER4 X;  1SL9 A;  2I18 A;  2KQ6 A;  5DKR A;  3DVE A;  1CDL A;  3SG4 A;  1YVH A;  1NP8 A;  1NCY A;  4ORB B;  2KBM A;  3SG5 A;  1PRW A;  1KFX S;  3B86 A;  3NXA A;  1Z2C B;  3LK0 A;  1YRT B;  1SY9 A;  5HKY A;  1S6I A;  5CSI A;  1UUS A;  2SAS A;  3V2L A;  1PK0 D;  3NGV A;  4MBE A;  3SIB A;  1CTR A;  2QAC A;  2ZNE A;  3FS7 A;  3KPX A;  2MBX A;  4MN0 A;  2NCO A;  1WY9 A;  3GK1 A;  1YUU A;  2ISD A;  4ORC B;  3SG2 A;  2M3W A;  3CDN A;  3OGN A;  3R1P A;  4GGF C;  3FWC A;  2MAZ A;  1X02 A;  3EVV A;  1N65 A;  1DF0 B;  1NCZ A;  1TUJ A;  1XFR A;  2GV5 A;  2K8M B;  2LHI A;  1CLL A;  1K9P A;  2GTE A;  1AK8 A;  3PFV A;  1IGV A;  3BUX B;  1W7J B;  2BL0 B;  2QEV A;  2L2E A;  2PQL A;  2LM5 A;  2WOR A;  2F8P A;  1QIV A;  2BCX A;  2K2F A;  2LV7 A;  3JVT C;  4IL1 A;  4JQ0 D;  4OR9 B;  5AXI A;  1KQM B;  4TNC A;  1KWO C;  4GPL B;  2KGB C;  4PAL A;  3AKB A;  4PE0 A;  1HQV A;  1QX7 A;  1UHJ A;  1WLM A;  1XFW O;  1UHK A;  2KBI A;  3CR2 A;  3IQQ A;  3WHU B;  5KTY A;  3OP0 A;  4DUQ A;  1NSH A;  1Y1X A;  1F4Q A;  5KU1 A;  1DC1 A;  2YGU A;  2KFG A;  1IH0 A;  5DKN A;  3O4X A;  1EG3 A;  1OE9 B;  2M1U A;  3DXL A;  2BKH B;  2H2K A;  1OOJ A;  1REC A;  3AAJ A;  4PT1 A;  5AAN A;  1FBV A;  1F54 A;  2BCB A;  3PSR A;  1KFX L;  2QPT A;  3D78 A;  2JOJ A;  1NX3 A;  2WC6 A;  4XJK B;  1A75 B;  1MUX A;  3NSO A;  3PN7 B;  2Y4Q A;  2QEO A;  2LVJ A;  1DEL A;  1DEK A;  1XVJ A;  2WCL A;  3B7A A;  3GK2 A;  3I5F B;  1M31 A;  2F3Y A;  1C7V A;  2EC6 C;  3VRO A;  3CR4 X;  3CTN A;  1QAS A;  5GQQ C;  2ZN9 A;  2CTN A;  1JWD A;  1CLM A;  1ALV A;  1NCX A;  2L5X B;  3NHI A;  3L4A A;  3TZ1 A;  1YR5 A;  2HF5 A;  3CWG A;  4QJ3 B;  2COL B;  1U5I A;  3GK4 X;  1J1E A;  2LMT A;  3I5G C;  3KEV A;  1A29 A;  1M46 A;  1MXL C;  2WC5 A;  4DIR A;  1W7I B;  1WDC C;  2WCM A;  1OOI X;  2NZ0 A;  5D69 A;  4MVF A;  1YTZ C;  3NSI A;  3KF9 A;  1RRO A;  3KO0 A;  1KK8 B;  4C0J A;  5I2O A;  3FIA A;  3CZ2 A;  4MRX A;  2I94 A;  2JPO A;  3IF7 A;  4I5K A;  3BOW B;  2F2P A;  2O5G A;  5G08 A;  3PJI A;  4AOM A;  2GGZ A;  3BUN B;  4DS7 A;  2H61 C;  2KYC A;  2JNX A;  2KI4 B;  3GOF A;  3R72 A;  3TUY C;  2K2A A;  1JC2 A;  2AAO A;  5HKZ A;  2MJW B;  2LC5 A;  1KK7 Y;  3SIA A;  1AP4 A;  1CB1 A;  2MLF C;  2QEB A;  3VRP A;  1SPY A;  1GGZ A;  4N5X A;  1NX1 A;  4OV2 A;  3HCM A;  2SCP A;  1MHO A;  3I5H B;  1F55 A;  2OS8 B;  1B7T Z;  1HT9 A;  1BT6 A;  2K0J A;  1SBJ A;  3OBV A;  2BNX A;  1K90 D;  1YUT A;  4CPV A;  2QDI A;  4NDC A;  1WLZ A;  1JUO A;  3DVK A;  1KSM A;  3DZT A;  2G2B A;  2BE6 A;  1BR1 B;  1NUB A;  1TWO A;  2LHL A;  1QX5 B;  1S6J A;  1A75 A;  1JFK A;  2KI6 D;  1H8B A;  2F3Z A;  4QJ4 B;  3NSL A;  5F6T A;  1CFF A;  1K96 A;  4I5J A;  1S3P A;  1CKK A;  1J1D A;  1T14 A;  1S5G Y;  4P5O E;  1H4B A;  3S0E A;  2K7O A;  5AER A;  3D73 A;  3I5I B;  1U5I B;  4AQJ A;  1JF2 A;  1Q80 A;  4M2P A;  2LAP A;  2WCK A;  1IIO A;  2LP2 A;  1TNP A;  2WCE A;  4UPG A;  3EK7 A;  2OTG B;  2KSP A;  3SG3 A;  5K89 A;  1C7W A;  3TDU A;  1S1E A;  2L51 A;  1MXE A;  3EKH A;  4PE1 A;  1LIN A;  3EK8 A;  3CS1 A;  4ZCV A;  2KDH A;  3CYZ A;  1J7R A;  1K9K A;  2M7L A;  2JT0 A;  3K1E A;  2HPS A;  1K8U A;  3B6X A;  3BOW A;  1OZO A;  4QJ5 B;  3D75 A;  3IVT A;  1CDP A;  2WOS A;  1JBA A;  4BY4 A;  4PHN A;  2BEC A;  1TRF A;  2B1U A;  1BLQ A;  1BMO A;  1N0Y A;  4ORA B;  1GQM A;  1TCF A;  1B8L A;  4AQI A;  2LCP A;  5CPV A;  3UNW A;  1XFX O;  1TNQ A;  4FQO A;  4DRW A;  2M29 A;  1CMF A;  1EH2 A;  3HX4 A;  3OB2 B;  3QRX A;  4PDZ A;  4YGA A;  4YGD B;  1XK4 C;  1B8C A;  4C0K A;  5I2Q A;  2M49 B;  2IS9 A;  4GNK B;  3BFH A;  2JC2 A;  3DY9 A;  4BY5 A;  4KYN A;  1DGV A;  3KHE A;  4F7F A;  3SS3 A;  4WRI A;  3S0B A;  4PE4 A;  1BG1 A;  2PSR A;  3CR5 X;  1SCM C;  3A8R A;  1OZS A;  1SW8 A;  1Y1A A;  3EVR A;  1BF5 A;  1W9Z A;  4OKH A;  2LMU A;  1G4Y R;  2FJY A;  3L4L A;  5AEQ A;  2EHB A;  2K60 A;  2L50 A;  4YRU A;  2JTT A;  2OPO A;  1RFJ A;  2KAV A;  3SS5 A;  1YRU B;  3CZT X;  4A4B A;  1F8H A;  2P71 A;  1EJ3 A;  3AKA A;  1IQ3 A;  1M63 B;  1YUR A;  1UWO A;  1MWN A;  3R1O A;  3BUO B;  3S0A A;  2LP3 A;  4A4C A;  2JPT A;  2ZND A;  3SJS A;  3JVT B;  2H61 A;  1TIZ A;  4HRE E;  3D10 A;  1DJI A;  1KWO B;  2JNF A;  4HRG A;  2NCP A;  1WRK A;  4YGB B;  5B8I B;  1K9U A;  3CGA A;  1UP5 A;  3ICB A;  3NSK A;  2L0P A;  3OHM B;  1JSA A;  1AJ4 A;  1OMV A;  3BQ3 A;  1SR6 C;  1TUZ A;  4CID A;  1C3Y A;  1KFU S;  2LVV A;  3M0W A;  1IJ5 A;  1OOF A;  3R1V A;  1FF1 A;  5PAL A;  1QS7 A;  3DF0 B;  4YGC B;  1TN4 A;  3FE9 A;  1QX2 A;  5I2L A;  1IQ5 A;  3TS5 C;  3DD4 A;  2WC8 A;  3OX6 A;  1SL7 A;  2NLN A;  1ZOT B;  5DIC A;  1F71 A;  1J55 A;  1RJV A;  3QME A;  3LL8 B;  1TNX A;  2ZRS A;  4CLN A;  1K95 A;  1QWV A;  2LLU A;  2WND A;  2R2I A;  1R2U A;  3D77 A;  5FI7 A;  1KQV A;  3IQO A;  1QV0 A;  3D0Y A;  1JF0 A;  1V1F A;  4I5N B;  5D3O A;  3WXA A;  4PE7 A;  1LA0 A;  2Y5I A;  1DMO A;  2ZFD A;  2EC6 B;  3CZ1 A;  2TN4 A;  1M45 A;  5I8N A;  1OMR A;  3O2P A;  2HQW A;  3LCP C;  2AMI A;  2CNP A;  3S0F A;  2CCM A;  3Q8I A;  2LVI A;  4GUK A;  4C0L A;  1KSO A;  1S36 A;  1NPQ A;  2F33 A;  2FCD A;  1ZUZ A;  3UO9 A;  3BUM B;  4YGE B;  1B1G A;  3BJH A;  4M2O A;  2AUC A;  2D8N A;  3SG7 A;  1WDC B;  1SMG A;  2PYQ A;  1CDN A;  2BBM A;  1MF8 B;  1N2D A;  3JTD C;  2LE9 B;  4P2Y B;  4WQ2 A;  1IRJ A;  3BYA A;  1SRA A;  5CSN A;  3TDZ A;  3MSE B;  1V1G A;  1CLB A;  1B4C A;  2O60 A;  1XFU O;  1KFU L;  3DVM A;  2E6W A;  2L5Y A;  2WCH A;  3O6B A;  1OMD A;  5HLV A;  2BE4 A;  2KNE A;  2PRU A;  3SS4 A;  2JUL A;  1FW4 A;  2KOT A;  4GGF A;  1PSR A;  4GGN A;  2I2R E;  1QVI Y;  1CFC A;  1QXP A;  1DJW A;  1LKJ A;  2LUX A;  1GJY A;  1DJG A;  1FPW A;  3TUY B;  1Z4H A;  2JQ6 A;  2M1K B;  2M0R A;  2JT3 A;  4OCI A;  1C07 A;  1Y0V H;  1ALW A;  1R6P A;  2F2O A;  1SNL A;  1FI5 A;  1OOH A;  1DJX A;  1QIW A;  2Q91 A;  4DCK A;  1XFZ O;  4R1E A;  2P70 A;  1DQE A;  2DOQ A;  1ZMZ A;  2M8U A;  5ER5 A;  2KAY A;  1XYD A;  2JWW A;  3RLZ A;  1KCY A;  3C1V A;  3BFA A;  3PM8 A;  1PSB A;  4PCW A;  3H4S E;  2FCE A;  1SL8 A;  1XK4 A;  1B8R A;  1ODB A;  2PAL A;  1SCV A;  2WCJ A;  3K21 A;  1LXF C;  4ETO A;  1UHN A;  1B7T Y;  3DF0 A;  2FJU B;  1LVC D;  1J7P A;  2BL0 C;  1SKT A;  2M9G A;  1FI6 A;  2MA2 A;  5I94 A;  1DTL A;  2JXC A;  3PAT A;  5JOL A;  1BR4 B;  1KQM C;  2RGI A;  2JU0 A;  4CFR A;  3B87 A;  2JZI A;  1PVB A;  2KPH A;  4JKT A;  3TS5 B;  3D0Y B;  1QTX A;  1UUR A;  2G9B A;  2CT9 A;  3D76 A;  1CFP A;  2KI6 C;  1TCO B;  1L2O B;  3DYE A;  1CMG A;  2PAS A;  2E30 A;  3O78 A;  3AAK A;  3NHT A;  1S6C A;  4WQ3 A;  5FYX A;  2KYF A;  3VB1 A;  3OB1 B;  1CDM A;  5FI6 A;  1G8I A;  1SSE B;  1A4P A;  1DJH A;  1IKU A;  2V53 A;  3DVJ A;  5HKW A;  4N1F A;  3CAB A;  1LS8 A;  4USL A;  3BXK A;  3PN7 C;  1TTX A;  1QV1 A;  4IJ7 A;  1OQP A;  3WHT B;  3I5F C;  1B9A A;  2KHN A;  3CZ0 A;  3F45 A;  2HQ8 A;  3B88 A;  1RTP 1;  1J7O A;  2KLE A;  1MR8 A;  2ZRT A;  5HL1 A;  1BOD A;  3FWB A;  2L2C A;  2KGR A;  3S0G A; 
#chains in the Genus database with same CATH homology
 1CM4 A;  2ZN8 A;  1QLK A;  4GFT A;  4MZL A;  4F0Z B;  2Y1M A;  2KFF A;  1CFD A;  3BUW B;  3O4Y A;  3WNX B;  4GAO A;  2LUC A;  4YI9 A;  4MSP A;  1DJZ A;  1AHR A;  3LLE A;  1PAL A;  1D1O A;  3VRN A;  1A03 A;  1RWY A;  5DKQ A;  1A2X A;  1F70 A;  1AVS A;  2MLE C;  2KQY A;  1KK8 C;  4HRH A;  4I5L B;  1PUL A;  4M2Q A;  1XA5 A;  2FOT A;  2I7A A;  2M7N A;  1DGU A;  1UHH A;  1RK9 A;  2MHH A;  4D1E A;  1K93 D;  4MZJ A;  1YX8 A;  1IJ6 A;  1WRZ A;  2BCA A;  2PMY A;  4JWQ A;  2CBL A;  1NX0 A;  1BOC A;  1XO5 A;  2GGM A;  4PHK A;  3SG6 A;  3ZNI A;  1AUI B;  1WRL A;  1BU3 A;  3ZWH A;  4YI8 A;  3LK1 A;  2KI4 C;  2LMV A;  1SCM B;  2MRD A;  4XYN A;  4Q04 A;  5HLO A;  2L4H A;  1KK7 Z;  1XFV O;  3EVU A;  1EL4 A;  2K61 A;  4PHM A;  1BJF A;  1M39 A;  1IWQ A;  2LLT A;  1NIW A;  4HSZ A;  1PVA A;  1QAT A;  4E68 A;  1ZAC A;  4JPZ B;  1NWD A;  1K94 A;  2JXL A;  1MQ1 A;  3PAL A;  1DT7 B;  3I5H C;  1NX2 A;  2K7B A;  2OS8 C;  2K7D A;  1J7Q A;  2P6B B;  5TNC A;  5CSJ A;  5CSF A;  1B47 A;  2L98 A;  4MRY A;  4N1G A;  2JRF A;  1QJT A;  2BBN A;  2EGD A;  2VRG A;  2Y1N A;  4NDD A;  1EXR A;  5KSZ A;  1G33 A;  1SR6 B;  1SYM A;  1UHI A;  3I5G B;  4FTG A;  4YBH B;  4NDB A;  1SK6 D;  2L4I A;  2A4J A;  3TDI A;  1YVL A;  4L9M A;  4ZCU A;  1YX7 A;  1DVI A;  1IG5 A;  1XFY O;  2LNK A;  2PVB A;  1QVI Z;  2CXJ A;  2LVK A;  3CLN A;  4MLW A;  4U8D A;  1AJ5 A;  1NYA A;  1ZFS A;  2KFH A;  1DF0 A;  1S5G Z;  2WCF A;  1E8A A;  2KAX A;  1L7Z A;  5BPJ A;  3VGO A;  2JTZ A;  5HYD A;  1S26 D;  2ZKM X;  3I5I C;  2Q4U A;  5D7F A;  2WCB A;  1LA3 A;  2LLS A;  3PLF B;  1JFJ A;  3VRR A;  4NQG A;  1OSA A;  2M97 A;  2K7C A;  2OTG C;  4GBA A;  5JJG A;  3EKJ A;  4PHJ A;  4OVN F;  3A4U B;  1TOP A;  1CM1 A;  4CFQ A;  4MEW A;  3OX5 A;  1CNP A;  3EK4 A;  5AFP A;  1QLS A;  2HET A;  1TNW A;  2BKI B;  3VRQ A;  5J3X A;  2JT8 A;  1EG4 A;  2LAN A;  1YUS A;  4MZK A;  1VRK A;  2NXQ A;  1GGW A;  3E3R A;  1DJY A;  1Y1U A;  4XJK A;  1L2O C;  5IBW A;  1F4O A;  3RM1 A;  1Y6W A;  3JTD B;  4ICB A;  5ER4 X;  1SL9 A;  2I18 A;  2KQ6 A;  5DKR A;  3DVE A;  1CDL A;  3SG4 A;  1YVH A;  1NP8 A;  1NCY A;  4ORB B;  2KBM A;  3SG5 A;  1PRW A;  1KFX S;  3NXA A;  5HKY A;  3LK0 A;  1YRT B;  1SY9 A;  1S6I A;  5CSI A;  1UUS A;  2SAS A;  1PK0 D;  4MBE A;  3SIB A;  1CTR A;  2QAC A;  2ZNE A;  3FS7 A;  3KPX A;  2MBX A;  4MN0 A;  2NCO A;  1WY9 A;  3GK1 A;  1YUU A;  2ISD A;  4ORC B;  3SG2 A;  2M3W A;  4GGF C;  3FWC A;  2MAZ A;  1X02 A;  3EVV A;  1N65 A;  1DF0 B;  1NCZ A;  2GV5 A;  2K8M B;  1AK8 A;  2LHI A;  1CLL A;  1K9P A;  3PFV A;  1IGV A;  3BUX B;  1W7J B;  2BL0 B;  4P2Y B;  2L2E A;  2WOR A;  2LM5 A;  4IL1 A;  2F8P A;  1QIV A;  2BCX A;  2K2F A;  2LV7 A;  3JVT C;  4JQ0 D;  4OR9 B;  5AXI A;  1K2H A;  1KQM B;  4TNC A;  1KWO C;  4GPL B;  2KGB C;  4PAL A;  3AKB A;  4PE0 A;  1HQV A;  1QX7 A;  1UHJ A;  1WLM A;  1XFW O;  1UHK A;  2KBI A;  3CR2 A;  3IQQ A;  3WHU B;  5KTY A;  3OP0 A;  4DUQ A;  1NSH A;  1Y1X A;  1F4Q A;  5KU1 A;  2KFG A;  1IH0 A;  5DKN A;  1EG3 A;  1OE9 B;  2M1U A;  2BKH B;  2H2K A;  1OOJ A;  1REC A;  3AAJ A;  5AAN A;  1FBV A;  1F54 A;  2BCB A;  3PSR A;  1KFX L;  2QPT A;  2JOJ A;  1NX3 A;  4XJK B;  1A75 B;  1MUX A;  3NSO A;  3PN7 B;  2Y4Q A;  2LVJ A;  3GK2 A;  1XVJ A;  3I5F B;  1M31 A;  2F3Y A;  1C7V A;  2EC6 C;  3VRO A;  3CR4 X;  3CTN A;  1QAS A;  5GQQ C;  2ZN9 A;  2CTN A;  1JWD A;  1CLM A;  1ALV A;  1NCX A;  2L5X B;  3TZ1 A;  1YR5 A;  2HF5 A;  3CWG A;  4QJ3 B;  2COL B;  1U5I A;  3GK4 X;  1J1E A;  2LMT A;  3I5G C;  3KEV A;  1A29 A;  1M46 A;  1MXL C;  4DIR A;  1W7I B;  1WDC C;  2NZ0 A;  5D69 A;  4MVF A;  1YTZ C;  3NSI A;  3KF9 A;  1RRO A;  3KO0 A;  1KK8 B;  4C0J A;  5I2O A;  3FIA A;  4MRX A;  2I94 A;  3IF7 A;  4I5K A;  3BOW B;  2F2P A;  2O5G A;  5G08 A;  4AOM A;  2GGZ A;  3BUN B;  4DS7 A;  2H61 C;  2KYC A;  2JNX A;  2KI4 B;  3GOF A;  3TUY C;  2K2A A;  1JC2 A;  2AAO A;  5HKZ A;  2MJW B;  2LC5 A;  1KK7 Y;  3SIA A;  1AP4 A;  1CB1 A;  2MLF C;  3VRP A;  1SPY A;  1GGZ A;  4N5X A;  1NX1 A;  4OV2 A;  3HCM A;  2SCP A;  1MHO A;  3I5H B;  1F55 A;  2OS8 B;  1B7T Z;  1HT9 A;  1BT6 A;  2K0J A;  1SBJ A;  1K90 D;  1YUT A;  4CPV A;  4NDC A;  1WLZ A;  1JUO A;  3DVK A;  1KSM A;  2G2B A;  2BE6 A;  1BR1 B;  1NUB A;  2LHL A;  1QX5 B;  1S6J A;  1A75 A;  1JFK A;  2KI6 D;  1H8B A;  2F3Z A;  4QJ4 B;  3NSL A;  5F6T A;  1CFF A;  1K96 A;  4I5J A;  1S3P A;  1CKK A;  1J1D A;  4P5O E;  1S5G Y;  1H4B A;  2K7O A;  5AER A;  3I5I B;  1U5I B;  4AQJ A;  1JF2 A;  1Q80 A;  4M2P A;  2LAP A;  2LP2 A;  1TNP A;  2WCE A;  4UPG A;  3EK7 A;  2OTG B;  2KSP A;  3SG3 A;  5K89 A;  1C7W A;  3TDU A;  1S1E A;  2L51 A;  1MXE A;  3EKH A;  4PE1 A;  1LIN A;  3EK8 A;  3CS1 A;  4ZCV A;  2KDH A;  1J7R A;  1K9K A;  2M7L A;  2JT0 A;  2HPS A;  1K8U A;  3BOW A;  1OZO A;  4QJ5 B;  1CDP A;  2WOS A;  1JBA A;  4BY4 A;  4PHN A;  2BEC A;  1TRF A;  2B1U A;  1BLQ A;  1BMO A;  1N0Y A;  4ORA B;  1GQM A;  1TCF A;  1B8L A;  4AQI A;  2LCP A;  5CPV A;  1XFX O;  1TNQ A;  4FQO A;  4DRW A;  2M29 A;  1CMF A;  1EH2 A;  3HX4 A;  3OB2 B;  3QRX A;  4PDZ A;  4YGA A;  4YGD B;  1XK4 C;  1B8C A;  4C0K A;  5I2Q A;  2M49 B;  2IS9 A;  4GNK B;  2JC2 A;  4BY5 A;  1DGV A;  3KHE A;  4WRI A;  4PE4 A;  1BG1 A;  2PSR A;  3CR5 X;  1SCM C;  3A8R A;  1OZS A;  1SW8 A;  1Y1A A;  3EVR A;  1BF5 A;  4OKH A;  2LMU A;  1G4Y R;  5AEQ A;  2EHB A;  2L50 A;  4YRU A;  2JTT A;  2OPO A;  1RFJ A;  2KAV A;  1YRU B;  3CZT X;  4A4B A;  1F8H A;  1EJ3 A;  3AKA A;  1IQ3 A;  1M63 B;  1YUR A;  1UWO A;  1MWN A;  3BUO B;  2LP3 A;  4A4C A;  2JPT A;  2ZND A;  3SJS A;  3JVT B;  2H61 A;  1TIZ A;  4HRE E;  3D10 A;  1DJI A;  1KWO B;  2JNF A;  4HRG A;  2NCP A;  1WRK A;  4YGB B;  5B8I B;  1K9U A;  3CGA A;  1UP5 A;  3ICB A;  3NSK A;  2L0P A;  3OHM B;  1JSA A;  1AJ4 A;  1OMV A;  3BQ3 A;  1SR6 C;  4CID A;  1KFU S;  2LVV A;  3M0W A;  1IJ5 A;  1FF1 A;  5PAL A;  1QS7 A;  3DF0 B;  4YGC B;  1TN4 A;  1QX2 A;  5I2L A;  1IQ5 A;  3TS5 C;  3DD4 A;  2WC8 A;  3OX6 A;  1SL7 A;  2NLN A;  1ZOT B;  1F71 A;  1J55 A;  1RJV A;  3LL8 B;  1TNX A;  2ZRS A;  4CLN A;  1K95 A;  2LLU A;  2WND A;  2R2I A;  1R2U A;  1KQV A;  3IQO A;  1QV0 A;  3D0Y A;  1JF0 A;  1V1F A;  4I5N B;  3WXA A;  4PE7 A;  1LA0 A;  2Y5I A;  1DMO A;  2ZFD A;  2EC6 B;  5I8N A;  2TN4 A;  1M45 A;  1OMR A;  3O2P A;  2HQW A;  3LCP C;  2AMI A;  2CNP A;  2CCM A;  4GUK A;  2LVI A;  4C0L A;  1KSO A;  1S36 A;  1NPQ A;  2F33 A;  2FCD A;  1ZUZ A;  3BUM B;  4YGE B;  1B1G A;  4M2O A;  2AUC A;  2D8N A;  3SG7 A;  1WDC B;  1SMG A;  1CDN A;  2BBM A;  1MF8 B;  1N2D A;  3JTD C;  2LE9 B;  4WQ2 A;  3TDZ A;  1IRJ A;  3BYA A;  1SRA A;  5CSN A;  1CLB A;  3MSE B;  1V1G A;  1B4C A;  2O60 A;  1XFU O;  1KFU L;  3DVM A;  2E6W A;  3O6B A;  1OMD A;  5HLV A;  2BE4 A;  2KNE A;  2PRU A;  2JUL A;  1FW4 A;  2KOT A;  4GGF A;  1PSR A;  4GGN A;  2I2R E;  1QVI Y;  1CFC A;  1QXP A;  1DJW A;  1LKJ A;  2LUX A;  1GJY A;  1DJG A;  1FPW A;  3TUY B;  2JQ6 A;  2M1K B;  4OCI A;  2M0R A;  2JT3 A;  1C07 A;  1Y0V H;  1ALW A;  1R6P A;  2F2O A;  1SNL A;  1DJX A;  1QIW A;  2Q91 A;  4DCK A;  1XFZ O;  4R1E A;  1FI5 A;  2DOQ A;  1ZMZ A;  2M8U A;  5ER5 A;  2KAY A;  1XYD A;  2JWW A;  3RLZ A;  1KCY A;  3C1V A;  3PM8 A;  1PSB A;  4PCW A;  3H4S E;  2FCE A;  1SL8 A;  1XK4 A;  1B8R A;  1ODB A;  2PAL A;  1SCV A;  3K21 A;  4ETO A;  1LXF C;  1UHN A;  1B7T Y;  3DF0 A;  2FJU B;  1LVC D;  1J7P A;  2BL0 C;  1SKT A;  2M9G A;  1FI6 A;  2MA2 A;  1DTL A;  2JXC A;  3PAT A;  5JOL A;  1BR4 B;  1KQM C;  2RGI A;  2JU0 A;  4CFR A;  2JZI A;  1PVB A;  3TS5 B;  3D0Y B;  1QTX A;  1UUR A;  2G9B A;  2CT9 A;  1CFP A;  2KI6 C;  1TCO B;  1L2O B;  1CMG A;  2PAS A;  2E30 A;  3O78 A;  3AAK A;  1S6C A;  4WQ3 A;  5FYX A;  2KYF A;  3OB1 B;  1CDM A;  1G8I A;  1A4P A;  1DJH A;  1IKU A;  2V53 A;  3DVJ A;  5HKW A;  4N1F A;  4USL A;  3BXK A;  3PN7 C;  1TTX A;  1QV1 A;  1OQP A;  3WHT B;  3I5F C;  1B9A A;  2KHN A;  3F45 A;  2HQ8 A;  1RTP 1;  1J7O A;  1MR8 A;  2ZRT A;  1BOD A;  3FWB A;  2KGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...