3JTDB

Calcium-free scallop myosin regulatory domain with elc-d19a point mutation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated adductor muscle
total genus 38
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB02
1YX7A 2MRDA 4ZCVA 1YUSA 5HLVA 1AVSA 2KI6C 4AOMA 1TNWA 1JC2A 3AAJA 3HX4A 1SK6D 2KYCA 2OS8C 1ZACA 1OSAA 4ORCB 3BOWB 1ZFSA 1FI5A 1HT9A 2ZNDA 1DGUA 2BKIB 3BUXB 3SG2A 4U8DA 1BU3A 1CM4A 1TCOB 2L50A 1JFJA 3NSKA 4PHJA 1N65A 5HYDA 1CKKA 3JVTB 1AUIB 2M1KB 1OMDA 2LLUA 2WOSA 2FCDA 3GK2A 3F45A 1BT6A 2JC2A 3O78A 4HSZA 4YBHB 1TCFA 1AJ5A 2IS9A 2R2IA 4YRUA 3CWGA 1U5IA 1YUUA 1CMFA 1B7TZ 2WORA 2F2OA 2BE4A 1UUSA 4NDCA 4A4BA 1SCVA 1GGWA 1B8LA 4PHNA 2KSPA 3GOFA 1AK8A 3DF0A 3PM8A 4Q04A 5I2LA 3SG7A 1YURA 4AQJA 3H4SE 1A29A 4NQGA 4WQ3A 1LA3A 1PVAA 2JTTA 2M3WA 3AAKA 1SR6B 3VRPA 4C0JA 2ZN8A 2KGBC 1K9PA 1KK8C 3O6BA 2ZN9A 3VROA 4YGBB 1UWOA 2L4IA 1QV0A 1DJYA 4PHKA 1MXEA 2KI4C 3D0YB 4JWQA 5IBWA 5JJGA 1NX1A 4N1GA 1ODBA 1G4YR 1RWYA 1DJXA 1DF0A 1PSRA 1KQMB 2BE6A 4XJKB 5ER4X 3TDIA 2JNXA 1W7IB 1J7RA 1SYMA 2Q91A 1G8IA 1R2UA 2RGIA 1S6JA 2KHNA 4HRGA 3VRRA 3WXAA 3NXAA 3TDZA 4QJ5B 1CFDA 1QASA 2P6BB 5DKRA 1TTXA 2G2BA 1BMOA 3BUOB 4N1FA 1DF0B 3BYAA 4GGFC 5DKQA 2LHLA 1EXRA 2QPTA 2JRFA 4DS7A 3A4UB 1NYAA 1LVCD 1CFCA 3AKAA 1CTRA 2CNPA 3FWCA 2K2AA 3EKHA 1FBVA 1Y1UA 1QTXA 1L2OC 1SCMB 1HQVA 2F3ZA 3K21A 3OB2B 4MEWA 1H4BA 1JWDA 5I2QA 3BUWB 2PSRA 3BXKA 1DJWA 2JULA 1XK4C 3JVTC 1BOCA 1UHKA 4E68A 5HKWA 1K9UA 2EC6C 1DJHA 1EH2A 4MZJA 1DJGA 1OOJA 2KFGA 1YVHA 3DF0B 3JTDC 1KFXL 5F6TA 4P5OE 4IL1A 1Y6WA 5BPJA 1K9KA 1A75B 1KWOB 1GJYA 1NCYA 2LUXA 3EK8A 1CFFA 2D8NA 2I94A 3I5IC 4DIRA 4C0LA 1J1EA 1SBJA 4TNCA 2O5GA 1BLQA 2AAOA 1S5GY 1BR1B 1MQ1A 3TDUA 2BBMA 1VRKA 2JPTA 2BECA 2KAXA 5HKZA 2JTZA 2BCAA 3D0YA 1YRTB 1SR6C 3OB1B 2HF5A 2ZNEA 3EVRA 2HETA 1DTLA 1WLZA 1B8CA 2K7BA 1LA0A 4ETOA 5AERA 1BJFA 1C07A 3NSIA 4CPVA 2Y1MA 1M31A 2WCEA 3PATA 3KF9A 1OMVA 2M97A 3PSRA 4ZCUA 1AP4A 2JXLA 4F0ZB 3CS1A 3DVMA 2L51A 1V1FA 3I5GC 1XFWO 2COLB 3BUMB 5AXIA 2F8PA 1DJZA 5ER5A 2M9GA 3SG6A 1NX0A 2JT8A 1GGZA 1K8UA 1TNQA 3CR2A 5PALA 5HKYA 1NPQA 3I5HB 4I5KA 2KBIA 2OPOA 2WCFA 2I18A 2SCPA 1BR4B 1QLSA 4GGFA 5KTYA 2LVJA 1UHNA 3SIBA 2JT0A 2ISDA 1KK7Y 5CSFA 1SKTA 2FOTA 1QATA 2AUCA 3I5FB 3LK0A 1JF2A 3SG5A 2M49B 5AANA 5CSNA 1NIWA 2MA2A 1R6PA 3E3RA 4P2YB 2F33A 4YGDB 2M8UA 1L2OB 1SCMC 2B1UA 3TUYC 4I5JA 2MLFC 2JQ6A 3LCPC 1BODA 2LM5A 2BCBA 1AHRA 1KFUL 1SRAA 1B7TY 4HRHA 3SG3A 1IJ5A 2L5XB 3EVUA 1U5IB 4ORBB 2EC6B 3M0WA 1EJ3A 1CB1A 1F4OA 2KOTA 3BOWA 2KAYA 1QJTA 2Q4UA 3KEVA 4N5XA 3WHTB 4CFQA 5FYXA 1B8RA 1K2HA 2LMUA 4MRYA 1ZOTB 2LVKA 1OQPA 4DRWA 2KYFA 2FCEA 1BG1A 4MRXA 3PLFB 1Y1XA 2G9BA 2HPSA 1DGVA 3PN7B 1WRKA 2CXJA 1PRWA 1WRLA 2GV5A 2PMYA 2GGZA 4CIDA 1F8HA 3CR5X 3DVKA 1NUBA 4QJ4B 1J55A 1TN4A 4PDZA 3VRQA 1A75A 1NCXA 1OZSA 1WDCB 2M1UA 2KAVA 4CLNA 1IKUA 2EGDA 1OZOA 1YRUB 2I2RE 2OTGC 3TZ1A 1C7VA 4XYNA 1UHIA 4MZLA 3CZTX 1KK8B 1K90D 1PSBA 1CDMA 2I7AA 1NX2A 2LC5A 1PULA 1QV1A 3IF7A 2LLSA 4XJKA 2KI4B 4USLA 3DVJA 3SG4A 4A4CA 1RECA 3WNXB 2BL0C 1UHJA 4YGCB 2HQ8A 1IJ6A 4GNKB 4OCIA 1FW4A 2E30A 2KBMA 1KCYA 1KQMC 1TOPA 1KFXS 2DOQA 2LNKA 1F71A 1NX3A 1CLLA 4L9MA 1LINA 3FS7A 1Q80A 2PALA 1CDPA 3OHMB 1TIZA 2MBXA 4MVFA 1NCZA 1MR8A 1WRZA 4GAOA 3BUNB 2KFFA 5GQQC 3OX5A 1S6IA 4AQIA 4QJ3B 3TUYB 2ZFDA 1F70A 1KQVA 1NP8A 3FIAA 1JUOA 2LANA 2ZRTA 3VGOA 4ICBA 2KFHA 3OX6A 5HLOA 1J7PA 2NCOA 4D1EA 4M2QA 3RM1A 3TS5C 1DT7B 1D1OA 2L2EA 3GK1A 3HCMA 3JTDB 4JQ0D 2NLNA 2TN4A 1QX7A 4CFRA 2LP2A 2KQYA 2LP3A 3I5IB 2BCXA 3SIAA 4I5NB 3D10A 5AEQA 3KO0A 1B4CA 4OR9B 2KQ6A 3CLNA 2WCBA 1QVIY 2MAZA 1PVBA 1K94A 4R1EA 4PE0A 1YX8A 2LLTA 1TNPA 1W7JB 1KSMA 1WDCC 2L0PA 1SMGA 1SPYA 2EHBA 1S36A 1S1EA 2NCPA 2OTGB 1OMRA 1TRFA 1YUTA 2L4HA 4OKHA 1CM1A 1DMOA 1XVJA 1X02A 2M0RA 1K95A 1QX5B 2LAPA 2ZRSA 4OV2A 1IRJA 2HQWA 1M39A 1KFUS 2LCPA 3PFVA 1QXPA 4GGNA 1MUXA 1RROA 2BL0B 3I5GB 2WNDA 1XA5A 2VRGA 4GPLB 4PALA 4M2OA 2ZKMX 1RTP1 2K8MB 3ZWHA 3IQOA 1QIVA 3MSEB 1RFJA 3NSLA 1UP5A 1B9AA 2JXCA 1M45A 2H61C 1Y0VH 1CDNA 4FQOA 1A4PA 4MZKA 1J7QA 2FJUB 1IH0A 4C0KA 1JBAA 1KK7Z 4DUQA 1FPWA 1G33A 1SY9A 1NWDA 2MJWB 3OP0A 2F2PA 3EK7A 2H2KA 3EVVA 2SASA 4BY5A 2JOJA 1XFUO 1CDLA 3I5FC 5I2OA 1K93D 3EKJA 2PASA 1ZMZA 1SNLA 1MF8B 4PCWA 4NDDA 1CLMA 1UHHA 4PHMA 2JNFA 1EG4A 3KPXA 2LMVA 1F54A 1EG3A 1N0YA 4FTGA 1F55A 1XK4A 2M7LA 5D69A 2Y1NA 1SW8A 2LUCA 1E8AA 3O2PA 4ORAB 1XYDA 3AKBA 2CTNA 5D7FA 2WC8A 5I8NA 2M29A 1MXLC 1IQ3A 4HREE 3TS5B 1DJIA 3CR4X 2CT9A 5KSZA 4DCKA 4I5LB 5KU1A 1KSOA 3A8RA 2PVBA 1XFYO 3CGAA 3C1VA 2L98A 1BF5A 5DKNA 1GQMA 2LVVA 4WRIA 3DVEA 1EL4A 2KNEA 1YTZC 1S6CA 4PE4A 1MWNA 2KI6D 1K96A 1WY9A 3PN7C 2JWWA 1SL8A 1A2XA 1YVLA 2K7CA 2M7NA 5J3XA 3LLEA 1CMGA 4UPGA 1MHOA 3CTNA 2OS8B 1H8BA 3BQ3A 1J7OA 4MSPA 2K61A 1B1GA 1QVIZ 3NSOA 1FI6A 2CBLA 2JZIA 3EK4A 2O60A 3PALA 1QS7A 2LV7A 2KGRA 2F3YA 1IG5A 1F4QA 1UURA 1FF1A 4YGEB 5B8IB 5TNCA 2LVIA 1ZUZA 4WQ2A 5K89A 3DD4A 3ZNIA 3ICBA 4GBAA 1CNPA 1AJ4A 4JPZB 1XO5A 2H61A 1JF0A 2GGMA 2MLEC 1KWOC 3IQQA 1JFKA 1XFVO 5CSJA 1SL9A 4MBEA 1YR5A 3VRNA 2K7DA 2V53A 3WHUB 1S26D 2A4JA 2E6WA 4GFTA 4MN0A 1QIWA 1A03A 1TNXA 1M46A 1SL7A 2QACA 4YI8A 1IGVA 1IWQA 2KDHA 1B47A 2NXQA 4M2PA 3RLZA 1CLBA 3FWBA 1S5GZ 4YGAA 4OVNF 5CPVA 3KHEA 1L7ZA 1PALA 1DVIA 1C7WA 4GUKA 4MLWA 1PK0D 2Y5IA 3SJSA 2BBNA 2JU0A 2CCMA 2LMTA 5JOLA 1CFPA 1V1GA 5AFPA 2JT3A 1S3PA 1XFZO 3LL8B 1WLMA 5G08A 1ALWA 1J1DA 1QX2A 4BY4A 1IQ5A 2Y4QA 4NDBA 4PE7A 2LE9B 2AMIA 2LHIA 1Y1AA 2PRUA 2BKHB 5CSIA 2MHHA 1LKJA 1N2DA 2K7OA 1NSHA 3GK4X 4PE1A 1RK9A 1XFXO 2K0JA 1JSAA 1ALVA 1RJVA 3O4YA 3I5HC 2K2FA 1QLKA 4YI9A 2NZ0A 1OE9B 3QRXA 3LK1A 1LXFC 1M63B
chains in the Genus database with same CATH superfamily
1YX7A 2MRDA 4ZCVA 1YUSA 5HLVA 1AVSA 2KI6C 4AOMA 1TNWA 1JC2A 3AAJA 3HX4A 1SK6D 2KYCA 3CZ1A 2OS8C 1ZACA 1OSAA 4ORCB 3BOWB 1ZFSA 1FI5A 3DZTA 1HT9A 3Q8IA 5DICA 2ZNDA 1DGUA 2BKIB 3BUXB 3SG2A 4U8DA 1BU3A 1CM4A 1TCOB 2L50A 2FJYA 1JFJA 3NSKA 4PHJA 1N65A 5EL2A 5HYDA 2L2CA 1CKKA 3JVTB 1AUIB 2M1KB 1OMDA 2LLUA 2WOSA 2FCDA 3GK2A 3F45A 1BT6A 2JC2A 3O78A 4HSZA 1TWOA 4YBHB 1TCFA 1AJ5A 2IS9A 2R2IA 4YRUA 3CWGA 1U5IA 1YUUA 1CMFA 1B7TZ 2QEHA 2WORA 2F2OA 2BE4A 1UUSA 4NDCA 4A4BA 1SCVA 1GGWA 3RZSA 1B8LA 4PHNA 2KSPA 3GOFA 3QMEA 1AK8A 3DF0A 3PM8A 4Q04A 5I2LA 3SG7A 3CZ2A 3S0AA 1YURA 4AQJA 3H4SE 1A29A 4NQGA 3CYZA 4WQ3A 1LA3A 3BFAA 1PVAA 2JTTA 2M3WA 3AAKA 3R72A 1SR6B 3VRPA 4C0JA 2ZN8A 2KGBC 1K9PA 1KK8C 3O6BA 2ZN9A 3VROA 4YGBB 1UWOA 2L4IA 3CABA 1QV0A 1DJYA 3PJIA 4PHKA 1MXEA 2KI4C 3D0YB 4JWQA 5IBWA 5JJGA 1OOHA 1NX1A 4N1GA 1ODBA 1G4YR 1RWYA 1DJXA 1DF0A 1PSRA 1KQMB 2BE6A 4XJKB 5ER4X 2WCKA 2JNXA 3TDIA 1W7IB 2YGUA 1J7RA 1SYMA 2Q91A 1G8IA 1R2UA 2RGIA 1S6JA 2KHNA 4HRGA 3VRRA 3WXAA 3NXAA 3TDZA 4QJ5B 1CFDA 1QASA 2P6BB 3DYEA 5DKRA 1TTXA 2G2BA 1BMOA 3BUOB 3B6XA 1DF0B 4N1FA 3BYAA 4GGFC 5DKQA 2LHLA 1EXRA 2QPTA 2JRFA 4DS7A 3A4UB 1NYAA 1LVCD 1CFCA 3S0FA 3AKAA 1CTRA 2CNPA 3FWCA 2K2AA 3EKHA 1Y1UA 1FBVA 2P71A 1QTXA 2PQLA 1L2OC 1SCMB 1HQVA 2F3ZA 1Z2CB 2QDIA 3K21A 3OB2B 4MEWA 1H4BA 1JWDA 5I2QA 3BUWB 2PSRA 3BXKA 3D75A 3S0DA 1DJWA 2JULA 1XK4C 3JVTC 1BOCA 1UHKA 4E68A 5HKWA 1TUZA 1K9UA 2JPOA 2EC6C 1DJHA 1EH2A 4MZJA 1DJGA 1OOJA 2KFGA 1YVHA 3DF0B 3JTDC 1KFXL 5F6TA 4P5OE 4IL1A 1Y6WA 5BPJA 1K9KA 1A75B 1KWOB 1GJYA 1NCYA 2LUXA 3EK8A 3FE6A 1CFFA 2D8NA 2I94A 3I5IC 4INXA 4DIRA 4C0LA 1J1EA 1SBJA 1C3YA 4TNCA 2O5GA 1BLQA 2AAOA 1S5GY 1BR1B 1MQ1A 3N7HA 3TDUA 2BBMA 4FQTA 4JD9A 1VRKA 2JPTA 2BECA 2KAXA 5HKZA 3UO9A 2JTZA 2BCAA 3D0YA 1YRTB 3B7AA 1SR6C 3OB1B 2HF5A 2ZNEA 3EVRA 2GTEA 1DTLA 1WLZA 1B8CA 2HETA 1LA0A 2K7BA 4ETOA 1BJFA 5AERA 3NSIA 4CPVA 1C07A 2Y1MA 1M31A 2WCEA 3PATA 3K1EA 3KF9A 1OMVA 2M97A 3PSRA 4ZCUA 3D73A 1AP4A 2JXLA 4F0ZB 2QEOA 3CS1A 3DVMA 3R1OA 2L51A 1V1FA 3I5GC 1LS8A 1OOIX 1XFWO 2COLB 3BUMB 3D77A 2F8PA 5AXIA 1DJZA 5ER5A 2M9GA 3OGNA 3SG6A 1NX0A 2JT8A 1GGZA 1K8UA 1TNQA 3CR2A 5PALA 5HKYA 1NPQA 3I5HB 2WCMA 4I5KA 1Z4HA 2KBIA 2OPOA 2WCFA 2I18A 2SCPA 1BR4B 1QLSA 4GGFA 5KTYA 2LVJA 1UHNA 3SIBA 2JT0A 2ISDA 1KK7Y 5CSFA 1SKTA 2ERBA 2FOTA 1QATA 2AUCA 3I5FB 4PT1A 3LK0A 1JF2A 3SG5A 2M49B 5AANA 5CSNA 1NIWA 2MA2A 5FI6A 2PYQA 1R6PA 3E3RA 4P2YB 2F33A 4YGDB 2M8UA 1L2OB 1SCMC 2B1UA 3TUYC 4I5JA 2MLFC 2JQ6A 3LCPC 1OOFA 2LM5A 1BODA 2BCBA 1AHRA 1KFUL 1SRAA 1B7TY 4HRHA 3SG3A 1IJ5A 2L5XB 3EVUA 1U5IB 4ORBB 2EC6B 3M0WA 1EJ3A 1CB1A 1F4OA 2KOTA 3BOWA 2KAYA 1QJTA 2Q4UA 3KEVA 4N5XA 3WHTB 4CFQA 5FYXA 1B8RA 1K2HA 2LMUA 4MRYA 1ZOTB 2LVKA 1OQPA 4DRWA 2KYFA 2FCEA 1BG1A 4MRXA 3PLFB 1Y1XA 2G9BA 2HPSA 1DGVA 3PN7B 1WRKA 2CXJA 1PRWA 1WRLA 2GV5A 2PMYA 2GGZA 4CIDA 1F8HA 3CZ0A 3CR5X 3BJHA 3DVKA 1NUBA 4QJ4B 1J55A 1TN4A 4PDZA 3VRQA 3OBVA 1A75A 1NCXA 1OZSA 1WDCB 2M1UA 2KAVA 3L4AA 4CLNA 2EGDA 1IKUA 1OZOA 1YRUB 2I2RE 2WCJA 2OTGC 3NHTA 3TZ1A 1C7VA 4XYNA 1UHIA 4MZLA 3SS3A 3CZTX 1KK8B 1K90D 4INWA 1PSBA 1CDMA 2I7AA 1NX2A 2LC5A 1PULA 1QV1A 3IF7A 3CDNA 1DC1A 3PM2A 2LLSA 4XJKA 2KI4B 4KYNA 3DVJA 4USLA 3SG4A 4A4CA 1RECA 3WNXB 3BFHA 2BL0C 1UHJA 4YGCB 2HQ8A 1IJ6A 4GNKB 4OCIA 1FW4A 4JKTA 2E30A 2KBMA 1KCYA 1KQMC 1TOPA 1KFXS 2DOQA 2LNKA 1F71A 1NX3A 1CLLA 4L9MA 2KPHA 1GM0A 1LINA 3FS7A 1Q80A 2PALA 1CDPA 3BFBA 1TIZA 2QEBA 3OHMB 2MBXA 4MVFA 1NCZA 1MR8A 3UNWA 3B87A 1WRZA 4GAOA 3BUNB 2KFFA 5GQQC 3OX5A 1S6IA 4AQIA 4QJ3B 3TUYB 2ZFDA 1F70A 1KQVA 1NP8A 3FIAA 1OW4A 1JUOA 2LANA 2ZRTA 3VGOA 4ICBA 3B88A 2KFHA 3OX6A 5HLOA 1J7PA 2NCOA 4D1EA 4M2QA 3RM1A 3TS5C 1DT7B 1D1OA 2L2EA 3GK1A 3HCMA 3JTDB 4JQ0D 2NLNA 2BAPA 2TN4A 1QX7A 4CFRA 2LP2A 2KQYA 3S0EA 5FI7A 2LP3A 3I5IB 2BCXA 3SIAA 4I5NB 3D10A 5AEQA 3KO0A 1B4CA 4OR9B 2KQ6A 3CLNA 2WCBA 1QVIY 2WC5A 2MAZA 3DY9A 3EG5B 1PVBA 5FI2A 1K94A 4R1EA 4PE0A 1YX8A 2LLTA 1TNPA 1W7JB 1KSMA 1WDCC 2L0PA 3IVTA 1SMGA 1SPYA 2EHBA 1S36A 3D74A 1S1EA 2NCPA 2OTGB 1OMRA 1TRFA 1YUTA 1W9ZA 2L4HA 4OKHA 1CM1A 1DMOA 4F7FA 1XVJA 1X02A 2KLEA 2M0RA 1K95A 1QX5B 3S0GA 2LAPA 1DEKA 2ZRSA 4OV2A 1IRJA 2HQWA 1M39A 1KFUS 2LCPA 3PFVA 1QXPA 4GGNA 3SS5A 1MUXA 1RROA 2BL0B 3I5GB 3NGVA 2WNDA 1XA5A 2VRGA 4GPLB 4PALA 4M2OA 2ZKMX 1RTP1 2K8MB 3ZWHA 3IQOA 1QIVA 3MSEB 1RFJA 3NSLA 1T14A 1B9AA 1UP5A 2JXCA 3S0BA 1M45A 2H61C 1Y0VH 1CDNA 4FQOA 1A4PA 4MZKA 1J7QA 2FJUB 3D78A 1IH0A 2H8VA 4C0KA 1JBAA 1KK7Z 4DUQA 1FPWA 1G33A 1SY9A 1NWDA 5D3OA 2MJWB 3OP0A 2F2PA 3EK7A 2H2KA 3EVVA 2SASA 2P70A 4BY5A 2JOJA 1XFUO 1CDLA 2L5YA 3I5FC 5I2OA 1K93D 3EKJA 2PASA 1ZMZA 1SNLA 1MF8B 4PCWA 4NDDA 1CLMA 1UHHA 4PHMA 2JNFA 1C3ZA 1EG4A 2LMVA 3KPXA 1EG3A 3L4LA 1N0YA 1F54A 4FTGA 1F55A 1XK4A 2M7LA 5D69A 2Y1NA 1SW8A 2LUCA 1E8AA 3O2PA 4ORAB 1XYDA 2QEVA 3AKBA 2CTNA 1TUJA 5D7FA 2WC8A 4IJ7A 5I8NA 2M29A 1MXLC 1IQ3A 4HREE 3B86A 3TS5B 1DJIA 3CR4X 2CT9A 3FE9A 5KSZA 4DCKA 3R1VA 4I5LB 5KU1A 1KSOA 3A8RA 2PVBA 1XFYO 3CGAA 3C1VA 2L98A 1BF5A 5DKNA 1GQMA 2LVVA 1IIOA 4WRIA 3DVEA 1DQEA 1EL4A 2KNEA 1YTZC 1S6CA 4PE4A 1MWNA 2KI6D 1K96A 1WY9A 3PN7C 2JWWA 1SL8A 1A2XA 1YVLA 2K7CA 2M7NA 5J3XA 3DXLA 2K60A 3LLEA 1OOGA 3L47A 4UPGA 1CMGA 1MHOA 2KLDA 2OS8B 3CTNA 1H8BA 3BQ3A 1J7OA 4MSPA 3VB1A 2K61A 1B1GA 1QVIZ 3FE8A 3NSOA 1FI6A 2CBLA 2JZIA 3EK4A 2O60A 3PALA 1QS7A 3NHIA 2LV7A 2KGRA 2F3YA 1IG5A 1F4QA 1UURA 1ORGA 1FF1A 4YGEB 5B8IB 5TNCA 2LVIA 1ZUZA 4WQ2A 5K89A 3DD4A 3ZNIA 1DELA 3ICBA 4GBAA 1CNPA 1AJ4A 4JPZB 1XO5A 2H61A 1JF0A 2GGMA 2MLEC 2BNXA 1KWOC 3IQQA 1JFKA 1XFVO 5CSJA 1SL9A 4MBEA 1YR5A 3VRNA 4OZDA 2K7DA 5I94A 2V53A 3WHUB 1S26D 3V2LA 2A4JA 2E6WA 4GFTA 4MN0A 1QIWA 1A03A 1TNXA 1M46A 1QWVA 1SL7A 2QACA 1IGVA 4YI8A 1IWQA 2WC6A 2KDHA 1B47A 2NXQA 4M2PA 3RLZA 1CLBA 3O4XA 3D76A 1S5GZ 3FWBA 4YGAA 4OVNF 5CPVA 3KHEA 1L7ZA 1PALA 1DVIA 1C7WA 4GUKA 4MLWA 1PK0D 2Y5IA 3SJSA 2BBNA 2JU0A 2CCMA 2LMTA 5JOLA 1CFPA 1V1GA 5AFPA 2JT3A 1S3PA 1XFZO 1XFRA 1WLMA 3LL8B 5G08A 1ALWA 1J1DA 1QX2A 1P28A 1IQ5A 2Y4QA 4NDBA 4PE7A 4BY4A 2LE9B 2AMIA 2LHIA 1Y1AA 2PRUA 2BKHB 5CSIA 5HL1A 2MHHA 1LKJA 1N2DA 2K7OA 1NSHA 3GK4X 1SSEB 4PE1A 1RK9A 1XFXO 2K0JA 2WCLA 3SS4A 1JSAA 1ALVA 1RJVA 3LK1A 3I5HC 3O4YA 3R1PA 2K2FA 1QLKA 4YI9A 2NZ0A 1OE9B 3QRXA 2WCHA 1LXFC 1M63B
chains in the Genus database with same CATH topology
1YX7A 2MRDA 4ZCVA 1YUSA 5HLVA 1AVSA 2KI6C 4AOMA 1TNWA 1JC2A 3AAJA 3HX4A 1SK6D 2KYCA 2OS8C 1ZACA 1OSAA 4ORCB 3BOWB 1ZFSA 1FI5A 1HT9A 2ZNDA 1DGUA 2BKIB 3BUXB 3SG2A 4U8DA 1BU3A 1CM4A 1TCOB 2L50A 1JFJA 3NSKA 4PHJA 1N65A 5HYDA 1CKKA 3JVTB 1AUIB 2M1KB 1OMDA 2LLUA 2WOSA 2FCDA 3GK2A 3F45A 1BT6A 2JC2A 3O78A 4HSZA 4YBHB 1TCFA 1AJ5A 2IS9A 2R2IA 4YRUA 3CWGA 1U5IA 1YUUA 1CMFA 1B7TZ 2WORA 2F2OA 2BE4A 1UUSA 4NDCA 4A4BA 1SCVA 1GGWA 1B8LA 4PHNA 2KSPA 3GOFA 1AK8A 3DF0A 3PM8A 4Q04A 5I2LA 3SG7A 1YURA 4AQJA 3H4SE 1A29A 4NQGA 4WQ3A 1LA3A 1PVAA 2JTTA 2M3WA 3AAKA 1SR6B 3VRPA 4C0JA 2ZN8A 2KGBC 1K9PA 1KK8C 3O6BA 2ZN9A 3VROA 4YGBB 1UWOA 2L4IA 1QV0A 1DJYA 4PHKA 1MXEA 2KI4C 3D0YB 4JWQA 5IBWA 5JJGA 1NX1A 4N1GA 1ODBA 1G4YR 1RWYA 1DJXA 1DF0A 1PSRA 1KQMB 2BE6A 4XJKB 5ER4X 3TDIA 2JNXA 1W7IB 1J7RA 1SYMA 2Q91A 1G8IA 1R2UA 2RGIA 1S6JA 2KHNA 4HRGA 3VRRA 3WXAA 3NXAA 3TDZA 4QJ5B 1CFDA 1QASA 2P6BB 5DKRA 1TTXA 2G2BA 1BMOA 3BUOB 4N1FA 1DF0B 3BYAA 4GGFC 5DKQA 2LHLA 1EXRA 2QPTA 2JRFA 4DS7A 3A4UB 1NYAA 1LVCD 1CFCA 3AKAA 1CTRA 2CNPA 3FWCA 2K2AA 3EKHA 1FBVA 1Y1UA 1QTXA 1L2OC 1SCMB 1HQVA 2F3ZA 3K21A 3OB2B 4MEWA 1H4BA 1JWDA 5I2QA 3BUWB 2PSRA 3BXKA 1DJWA 2JULA 1XK4C 3JVTC 1BOCA 1UHKA 4E68A 5HKWA 1K9UA 2EC6C 1DJHA 1EH2A 4MZJA 1DJGA 1OOJA 2KFGA 1YVHA 3DF0B 3JTDC 1KFXL 5F6TA 4P5OE 4IL1A 1Y6WA 5BPJA 1K9KA 1A75B 1KWOB 1GJYA 1NCYA 2LUXA 3EK8A 1CFFA 2D8NA 2I94A 3I5IC 4DIRA 4C0LA 1J1EA 1SBJA 4TNCA 2O5GA 1BLQA 2AAOA 1S5GY 1BR1B 1MQ1A 3TDUA 2BBMA 1VRKA 2JPTA 2BECA 2KAXA 5HKZA 2JTZA 2BCAA 3D0YA 1YRTB 1SR6C 3OB1B 2HF5A 2ZNEA 3EVRA 2HETA 1DTLA 1WLZA 1B8CA 2K7BA 1LA0A 4ETOA 5AERA 1BJFA 1C07A 3NSIA 4CPVA 2Y1MA 1M31A 2WCEA 3PATA 3KF9A 1OMVA 2M97A 3PSRA 4ZCUA 1AP4A 2JXLA 4F0ZB 3CS1A 3DVMA 2L51A 1V1FA 3I5GC 1XFWO 2COLB 3BUMB 5AXIA 2F8PA 1DJZA 5ER5A 2M9GA 3SG6A 1NX0A 2JT8A 1GGZA 1K8UA 1TNQA 3CR2A 5PALA 5HKYA 1NPQA 3I5HB 4I5KA 2KBIA 2OPOA 2WCFA 2I18A 2SCPA 1BR4B 1QLSA 4GGFA 5KTYA 2LVJA 1UHNA 3SIBA 2JT0A 2ISDA 1KK7Y 5CSFA 1SKTA 2FOTA 1QATA 2AUCA 3I5FB 3LK0A 1JF2A 3SG5A 2M49B 5AANA 5CSNA 1NIWA 2MA2A 1R6PA 3E3RA 4P2YB 2F33A 4YGDB 2M8UA 1L2OB 1SCMC 2B1UA 3TUYC 4I5JA 2MLFC 2JQ6A 3LCPC 1BODA 2LM5A 2BCBA 1AHRA 1KFUL 1SRAA 1B7TY 4HRHA 3SG3A 1IJ5A 2L5XB 3EVUA 1U5IB 4ORBB 2EC6B 3M0WA 1EJ3A 1CB1A 1F4OA 2KOTA 3BOWA 2KAYA 1QJTA 2Q4UA 3KEVA 4N5XA 3WHTB 4CFQA 5FYXA 1B8RA 1K2HA 2LMUA 4MRYA 1ZOTB 2LVKA 1OQPA 4DRWA 2KYFA 2FCEA 1BG1A 4MRXA 3PLFB 1Y1XA 2G9BA 2HPSA 1DGVA 3PN7B 1WRKA 2CXJA 1PRWA 1WRLA 2GV5A 2PMYA 2GGZA 4CIDA 1F8HA 3CR5X 3DVKA 1NUBA 4QJ4B 1J55A 1TN4A 4PDZA 3VRQA 1A75A 1NCXA 1OZSA 1WDCB 2M1UA 2KAVA 4CLNA 1IKUA 2EGDA 1OZOA 1YRUB 2I2RE 2OTGC 3TZ1A 1C7VA 4XYNA 1UHIA 4MZLA 3CZTX 1KK8B 1K90D 1PSBA 1CDMA 2I7AA 1NX2A 2LC5A 1PULA 1QV1A 3IF7A 2LLSA 4XJKA 2KI4B 4USLA 3DVJA 3SG4A 4A4CA 1RECA 3WNXB 2BL0C 1UHJA 4YGCB 2HQ8A 1IJ6A 4GNKB 4OCIA 1FW4A 2E30A 2KBMA 1KCYA 1KQMC 1TOPA 1KFXS 2DOQA 2LNKA 1F71A 1NX3A 1CLLA 4L9MA 1LINA 3FS7A 1Q80A 2PALA 1CDPA 3OHMB 1TIZA 2MBXA 4MVFA 1NCZA 1MR8A 1WRZA 4GAOA 3BUNB 2KFFA 5GQQC 3OX5A 1S6IA 4AQIA 4QJ3B 3TUYB 2ZFDA 1F70A 1KQVA 1NP8A 3FIAA 1JUOA 2LANA 2ZRTA 3VGOA 4ICBA 2KFHA 3OX6A 5HLOA 1J7PA 2NCOA 4D1EA 4M2QA 3RM1A 3TS5C 1DT7B 1D1OA 2L2EA 3GK1A 3HCMA 3JTDB 4JQ0D 2NLNA 2TN4A 1QX7A 4CFRA 2LP2A 2KQYA 2LP3A 3I5IB 2BCXA 3SIAA 4I5NB 3D10A 5AEQA 3KO0A 1B4CA 4OR9B 2KQ6A 3CLNA 2WCBA 1QVIY 2MAZA 1PVBA 1K94A 4R1EA 4PE0A 1YX8A 2LLTA 1TNPA 1W7JB 1KSMA 1WDCC 2L0PA 1SMGA 1SPYA 2EHBA 1S36A 1S1EA 2NCPA 2OTGB 1OMRA 1TRFA 1YUTA 2L4HA 4OKHA 1CM1A 1DMOA 1XVJA 1X02A 2M0RA 1K95A 1QX5B 2LAPA 2ZRSA 4OV2A 1IRJA 2HQWA 1M39A 1KFUS 2LCPA 3PFVA 1QXPA 4GGNA 1MUXA 1RROA 2BL0B 3I5GB 2WNDA 1XA5A 2VRGA 4GPLB 4PALA 4M2OA 2ZKMX 1RTP1 2K8MB 3ZWHA 3IQOA 1QIVA 3MSEB 1RFJA 3NSLA 1UP5A 1B9AA 2JXCA 1M45A 2H61C 1Y0VH 1CDNA 4FQOA 1A4PA 4MZKA 1J7QA 2FJUB 1IH0A 4C0KA 1JBAA 1KK7Z 4DUQA 1FPWA 1G33A 1SY9A 1NWDA 2MJWB 3OP0A 2F2PA 3EK7A 2H2KA 3EVVA 2SASA 4BY5A 2JOJA 1XFUO 1CDLA 3I5FC 5I2OA 1K93D 3EKJA 2PASA 1ZMZA 1SNLA 1MF8B 4PCWA 4NDDA 1CLMA 1UHHA 4PHMA 2JNFA 1EG4A 3KPXA 2LMVA 1F54A 1EG3A 1N0YA 4FTGA 1F55A 1XK4A 2M7LA 5D69A 2Y1NA 1SW8A 2LUCA 1E8AA 3O2PA 4ORAB 1XYDA 3AKBA 2CTNA 5D7FA 2WC8A 5I8NA 2M29A 1MXLC 1IQ3A 4HREE 3TS5B 1DJIA 3CR4X 2CT9A 5KSZA 4DCKA 4I5LB 5KU1A 1KSOA 3A8RA 2PVBA 1XFYO 3CGAA 3C1VA 2L98A 1BF5A 5DKNA 1GQMA 2LVVA 4WRIA 3DVEA 1EL4A 2KNEA 1YTZC 1S6CA 4PE4A 1MWNA 2KI6D 1K96A 1WY9A 3PN7C 2JWWA 1SL8A 1A2XA 1YVLA 2K7CA 2M7NA 5J3XA 3LLEA 1CMGA 4UPGA 1MHOA 3CTNA 2OS8B 1H8BA 3BQ3A 1J7OA 4MSPA 2K61A 1B1GA 1QVIZ 3NSOA 1FI6A 2CBLA 2JZIA 3EK4A 2O60A 3PALA 1QS7A 2LV7A 2KGRA 2F3YA 1IG5A 1F4QA 1UURA 1FF1A 4YGEB 5B8IB 5TNCA 2LVIA 1ZUZA 4WQ2A 5K89A 3DD4A 3ZNIA 3ICBA 4GBAA 1CNPA 1AJ4A 4JPZB 1XO5A 2H61A 1JF0A 2GGMA 2MLEC 1KWOC 3IQQA 1JFKA 1XFVO 5CSJA 1SL9A 4MBEA 1YR5A 3VRNA 2K7DA 2V53A 3WHUB 1S26D 2A4JA 2E6WA 4GFTA 4MN0A 1QIWA 1A03A 1TNXA 1M46A 1SL7A 2QACA 4YI8A 1IGVA 1IWQA 2KDHA 1B47A 2NXQA 4M2PA 3RLZA 1CLBA 3FWBA 1S5GZ 4YGAA 4OVNF 5CPVA 3KHEA 1L7ZA 1PALA 1DVIA 1C7WA 4GUKA 4MLWA 1PK0D 2Y5IA 3SJSA 2BBNA 2JU0A 2CCMA 2LMTA 5JOLA 1CFPA 1V1GA 5AFPA 2JT3A 1S3PA 1XFZO 3LL8B 1WLMA 5G08A 1ALWA 1J1DA 1QX2A 4BY4A 1IQ5A 2Y4QA 4NDBA 4PE7A 2LE9B 2AMIA 2LHIA 1Y1AA 2PRUA 2BKHB 5CSIA 2MHHA 1LKJA 1N2DA 2K7OA 1NSHA 3GK4X 4PE1A 1RK9A 1XFXO 2K0JA 1JSAA 1ALVA 1RJVA 3O4YA 3I5HC 2K2FA 1QLKA 4YI9A 2NZ0A 1OE9B 3QRXA 3LK1A 1LXFC 1M63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX7 A;  2MRD A;  4ZCV A;  1YUS A;  5HLV A;  1AVS A;  2KI6 C;  4AOM A;  1TNW A;  1JC2 A;  3AAJ A;  3HX4 A;  1SK6 D;  2KYC A;  2OS8 C;  1ZAC A;  1OSA A;  4ORC B;  3BOW B;  1ZFS A;  1FI5 A;  1HT9 A;  2ZND A;  1DGU A;  2BKI B;  3BUX B;  3SG2 A;  4U8D A;  1BU3 A;  1CM4 A;  1TCO B;  2L50 A;  1JFJ A;  3NSK A;  4PHJ A;  1N65 A;  5HYD A;  1CKK A;  3JVT B;  1AUI B;  2M1K B;  1OMD A;  2LLU A;  2WOS A;  2FCD A;  3GK2 A;  3F45 A;  1BT6 A;  2JC2 A;  3O78 A;  4HSZ A;  4YBH B;  1TCF A;  1AJ5 A;  2IS9 A;  2R2I A;  4YRU A;  3CWG A;  1U5I A;  1YUU A;  1CMF A;  1B7T Z;  2WOR A;  2F2O A;  2BE4 A;  1UUS A;  4NDC A;  4A4B A;  1SCV A;  1GGW A;  1B8L A;  4PHN A;  2KSP A;  3GOF A;  1AK8 A;  3DF0 A;  3PM8 A;  4Q04 A;  5I2L A;  3SG7 A;  1YUR A;  4AQJ A;  3H4S E;  1A29 A;  4NQG A;  4WQ3 A;  1LA3 A;  1PVA A;  2JTT A;  2M3W A;  3AAK A;  1SR6 B;  3VRP A;  4C0J A;  2ZN8 A;  2KGB C;  1K9P A;  1KK8 C;  3O6B A;  2ZN9 A;  3VRO A;  4YGB B;  1UWO A;  2L4I A;  1QV0 A;  1DJY A;  4PHK A;  1MXE A;  2KI4 C;  3D0Y B;  4JWQ A;  5IBW A;  5JJG A;  1NX1 A;  4N1G A;  1ODB A;  1G4Y R;  1RWY A;  1DJX A;  1DF0 A;  1PSR A;  1KQM B;  2BE6 A;  4XJK B;  5ER4 X;  3TDI A;  2JNX A;  1W7I B;  1J7R A;  1SYM A;  2Q91 A;  1G8I A;  1R2U A;  2RGI A;  1S6J A;  2KHN A;  4HRG A;  3VRR A;  3WXA A;  3NXA A;  3TDZ A;  4QJ5 B;  1CFD A;  1QAS A;  2P6B B;  5DKR A;  1TTX A;  2G2B A;  1BMO A;  3BUO B;  4N1F A;  1DF0 B;  3BYA A;  4GGF C;  5DKQ A;  2LHL A;  1EXR A;  2QPT A;  2JRF A;  4DS7 A;  3A4U B;  1NYA A;  1LVC D;  1CFC A;  3AKA A;  1CTR A;  2CNP A;  3FWC A;  2K2A A;  3EKH A;  1FBV A;  1Y1U A;  1QTX A;  1L2O C;  1SCM B;  1HQV A;  2F3Z A;  3K21 A;  3OB2 B;  4MEW A;  1H4B A;  1JWD A;  5I2Q A;  3BUW B;  2PSR A;  3BXK A;  1DJW A;  2JUL A;  1XK4 C;  3JVT C;  1BOC A;  1UHK A;  4E68 A;  5HKW A;  1K9U A;  2EC6 C;  1DJH A;  1EH2 A;  4MZJ A;  1DJG A;  1OOJ A;  2KFG A;  1YVH A;  3DF0 B;  3JTD C;  1KFX L;  5F6T A;  4P5O E;  4IL1 A;  1Y6W A;  5BPJ A;  1K9K A;  1A75 B;  1KWO B;  1GJY A;  1NCY A;  2LUX A;  3EK8 A;  1CFF A;  2D8N A;  2I94 A;  3I5I C;  4DIR A;  4C0L A;  1J1E A;  1SBJ A;  4TNC A;  2O5G A;  1BLQ A;  2AAO A;  1S5G Y;  1BR1 B;  1MQ1 A;  3TDU A;  2BBM A;  1VRK A;  2JPT A;  2BEC A;  2KAX A;  5HKZ A;  2JTZ A;  2BCA A;  3D0Y A;  1YRT B;  1SR6 C;  3OB1 B;  2HF5 A;  2ZNE A;  3EVR A;  2HET A;  1DTL A;  1WLZ A;  1B8C A;  2K7B A;  1LA0 A;  4ETO A;  5AER A;  1BJF A;  1C07 A;  3NSI A;  4CPV A;  2Y1M A;  1M31 A;  2WCE A;  3PAT A;  3KF9 A;  1OMV A;  2M97 A;  3PSR A;  4ZCU A;  1AP4 A;  2JXL A;  4F0Z B;  3CS1 A;  3DVM A;  2L51 A;  1V1F A;  3I5G C;  1XFW O;  2COL B;  3BUM B;  5AXI A;  2F8P A;  1DJZ A;  5ER5 A;  2M9G A;  3SG6 A;  1NX0 A;  2JT8 A;  1GGZ A;  1K8U A;  1TNQ A;  3CR2 A;  5PAL A;  5HKY A;  1NPQ A;  3I5H B;  4I5K A;  2KBI A;  2OPO A;  2WCF A;  2I18 A;  2SCP A;  1BR4 B;  1QLS A;  4GGF A;  5KTY A;  2LVJ A;  1UHN A;  3SIB A;  2JT0 A;  2ISD A;  1KK7 Y;  5CSF A;  1SKT A;  2FOT A;  1QAT A;  2AUC A;  3I5F B;  3LK0 A;  1JF2 A;  3SG5 A;  2M49 B;  5AAN A;  5CSN A;  1NIW A;  2MA2 A;  1R6P A;  3E3R A;  4P2Y B;  2F33 A;  4YGD B;  2M8U A;  1L2O B;  1SCM C;  2B1U A;  3TUY C;  4I5J A;  2MLF C;  2JQ6 A;  3LCP C;  1BOD A;  2LM5 A;  2BCB A;  1AHR A;  1KFU L;  1SRA A;  1B7T Y;  4HRH A;  3SG3 A;  1IJ5 A;  2L5X B;  3EVU A;  1U5I B;  4ORB B;  2EC6 B;  3M0W A;  1EJ3 A;  1CB1 A;  1F4O A;  2KOT A;  3BOW A;  2KAY A;  1QJT A;  2Q4U A;  3KEV A;  4N5X A;  3WHT B;  4CFQ A;  5FYX A;  1B8R A;  1K2H A;  2LMU A;  4MRY A;  1ZOT B;  2LVK A;  1OQP A;  4DRW A;  2KYF A;  2FCE A;  1BG1 A;  4MRX A;  3PLF B;  1Y1X A;  2G9B A;  2HPS A;  1DGV A;  3PN7 B;  1WRK A;  2CXJ A;  1PRW A;  1WRL A;  2GV5 A;  2PMY A;  2GGZ A;  4CID A;  1F8H A;  3CR5 X;  3DVK A;  1NUB A;  4QJ4 B;  1J55 A;  1TN4 A;  4PDZ A;  3VRQ A;  1A75 A;  1NCX A;  1OZS A;  1WDC B;  2M1U A;  2KAV A;  4CLN A;  1IKU A;  2EGD A;  1OZO A;  1YRU B;  2I2R E;  2OTG C;  3TZ1 A;  1C7V A;  4XYN A;  1UHI A;  4MZL A;  3CZT X;  1KK8 B;  1K90 D;  1PSB A;  1CDM A;  2I7A A;  1NX2 A;  2LC5 A;  1PUL A;  1QV1 A;  3IF7 A;  2LLS A;  4XJK A;  2KI4 B;  4USL A;  3DVJ A;  3SG4 A;  4A4C A;  1REC A;  3WNX B;  2BL0 C;  1UHJ A;  4YGC B;  2HQ8 A;  1IJ6 A;  4GNK B;  4OCI A;  1FW4 A;  2E30 A;  2KBM A;  1KCY A;  1KQM C;  1TOP A;  1KFX S;  2DOQ A;  2LNK A;  1F71 A;  1NX3 A;  1CLL A;  4L9M A;  1LIN A;  3FS7 A;  1Q80 A;  2PAL A;  1CDP A;  3OHM B;  1TIZ A;  2MBX A;  4MVF A;  1NCZ A;  1MR8 A;  1WRZ A;  4GAO A;  3BUN B;  2KFF A;  5GQQ C;  3OX5 A;  1S6I A;  4AQI A;  4QJ3 B;  3TUY B;  2ZFD A;  1F70 A;  1KQV A;  1NP8 A;  3FIA A;  1JUO A;  2LAN A;  2ZRT A;  3VGO A;  4ICB A;  2KFH A;  3OX6 A;  5HLO A;  1J7P A;  2NCO A;  4D1E A;  4M2Q A;  3RM1 A;  3TS5 C;  1DT7 B;  1D1O A;  2L2E A;  3GK1 A;  3HCM A;  3JTD B;  4JQ0 D;  2NLN A;  2TN4 A;  1QX7 A;  4CFR A;  2LP2 A;  2KQY A;  2LP3 A;  3I5I B;  2BCX A;  3SIA A;  4I5N B;  3D10 A;  5AEQ A;  3KO0 A;  1B4C A;  4OR9 B;  2KQ6 A;  3CLN A;  2WCB A;  1QVI Y;  2MAZ A;  1PVB A;  1K94 A;  4R1E A;  4PE0 A;  1YX8 A;  2LLT A;  1TNP A;  1W7J B;  1KSM A;  1WDC C;  2L0P A;  1SMG A;  1SPY A;  2EHB A;  1S36 A;  1S1E A;  2NCP A;  2OTG B;  1OMR A;  1TRF A;  1YUT A;  2L4H A;  4OKH A;  1CM1 A;  1DMO A;  1XVJ A;  1X02 A;  2M0R A;  1K95 A;  1QX5 B;  2LAP A;  2ZRS A;  4OV2 A;  1IRJ A;  2HQW A;  1M39 A;  1KFU S;  2LCP A;  3PFV A;  1QXP A;  4GGN A;  1MUX A;  1RRO A;  2BL0 B;  3I5G B;  2WND A;  1XA5 A;  2VRG A;  4GPL B;  4PAL A;  4M2O A;  2ZKM X;  1RTP 1;  2K8M B;  3ZWH A;  3IQO A;  1QIV A;  3MSE B;  1RFJ A;  3NSL A;  1UP5 A;  1B9A A;  2JXC A;  1M45 A;  2H61 C;  1Y0V H;  1CDN A;  4FQO A;  1A4P A;  4MZK A;  1J7Q A;  2FJU B;  1IH0 A;  4C0K A;  1JBA A;  1KK7 Z;  4DUQ A;  1FPW A;  1G33 A;  1SY9 A;  1NWD A;  2MJW B;  3OP0 A;  2F2P A;  3EK7 A;  2H2K A;  3EVV A;  2SAS A;  4BY5 A;  2JOJ A;  1XFU O;  1CDL A;  3I5F C;  5I2O A;  1K93 D;  3EKJ A;  2PAS A;  1ZMZ A;  1SNL A;  1MF8 B;  4PCW A;  4NDD A;  1CLM A;  1UHH A;  4PHM A;  2JNF A;  1EG4 A;  3KPX A;  2LMV A;  1F54 A;  1EG3 A;  1N0Y A;  4FTG A;  1F55 A;  1XK4 A;  2M7L A;  5D69 A;  2Y1N A;  1SW8 A;  2LUC A;  1E8A A;  3O2P A;  4ORA B;  1XYD A;  3AKB A;  2CTN A;  5D7F A;  2WC8 A;  5I8N A;  2M29 A;  1MXL C;  1IQ3 A;  4HRE E;  3TS5 B;  1DJI A;  3CR4 X;  2CT9 A;  5KSZ A;  4DCK A;  4I5L B;  5KU1 A;  1KSO A;  3A8R A;  2PVB A;  1XFY O;  3CGA A;  3C1V A;  2L98 A;  1BF5 A;  5DKN A;  1GQM A;  2LVV A;  4WRI A;  3DVE A;  1EL4 A;  2KNE A;  1YTZ C;  1S6C A;  4PE4 A;  1MWN A;  2KI6 D;  1K96 A;  1WY9 A;  3PN7 C;  2JWW A;  1SL8 A;  1A2X A;  1YVL A;  2K7C A;  2M7N A;  5J3X A;  3LLE A;  1CMG A;  4UPG A;  1MHO A;  3CTN A;  2OS8 B;  1H8B A;  3BQ3 A;  1J7O A;  4MSP A;  2K61 A;  1B1G A;  1QVI Z;  3NSO A;  1FI6 A;  2CBL A;  2JZI A;  3EK4 A;  2O60 A;  3PAL A;  1QS7 A;  2LV7 A;  2KGR A;  2F3Y A;  1IG5 A;  1F4Q A;  1UUR A;  1FF1 A;  4YGE B;  5B8I B;  5TNC A;  2LVI A;  1ZUZ A;  4WQ2 A;  5K89 A;  3DD4 A;  3ZNI A;  3ICB A;  4GBA A;  1CNP A;  1AJ4 A;  4JPZ B;  1XO5 A;  2H61 A;  1JF0 A;  2GGM A;  2MLE C;  1KWO C;  3IQQ A;  1JFK A;  1XFV O;  5CSJ A;  1SL9 A;  4MBE A;  1YR5 A;  3VRN A;  2K7D A;  2V53 A;  3WHU B;  1S26 D;  2A4J A;  2E6W A;  4GFT A;  4MN0 A;  1QIW A;  1A03 A;  1TNX A;  1M46 A;  1SL7 A;  2QAC A;  4YI8 A;  1IGV A;  1IWQ A;  2KDH A;  1B47 A;  2NXQ A;  4M2P A;  3RLZ A;  1CLB A;  3FWB A;  1S5G Z;  4YGA A;  4OVN F;  5CPV A;  3KHE A;  1L7Z A;  1PAL A;  1DVI A;  1C7W A;  4GUK A;  4MLW A;  1PK0 D;  2Y5I A;  3SJS A;  2BBN A;  2JU0 A;  2CCM A;  2LMT A;  5JOL A;  1CFP A;  1V1G A;  5AFP A;  2JT3 A;  1S3P A;  1XFZ O;  3LL8 B;  1WLM A;  5G08 A;  1ALW A;  1J1D A;  1QX2 A;  4BY4 A;  1IQ5 A;  2Y4Q A;  4NDB A;  4PE7 A;  2LE9 B;  2AMI A;  2LHI A;  1Y1A A;  2PRU A;  2BKH B;  5CSI A;  2MHH A;  1LKJ A;  1N2D A;  2K7O A;  1NSH A;  3GK4 X;  4PE1 A;  1RK9 A;  1XFX O;  2K0J A;  1JSA A;  1ALV A;  1RJV A;  3O4Y A;  3I5H C;  2K2F A;  1QLK A;  4YI9 A;  2NZ0 A;  1OE9 B;  3QRX A;  3LK1 A;  1LXF C;  1M63 B; 
#chains in the Genus database with same CATH topology
 1YX7 A;  2MRD A;  4ZCV A;  1YUS A;  5HLV A;  1AVS A;  2KI6 C;  4AOM A;  1TNW A;  1JC2 A;  3AAJ A;  3HX4 A;  1SK6 D;  2KYC A;  3CZ1 A;  2OS8 C;  1ZAC A;  1OSA A;  4ORC B;  3BOW B;  1ZFS A;  1FI5 A;  3DZT A;  1HT9 A;  3Q8I A;  5DIC A;  2ZND A;  1DGU A;  2BKI B;  3BUX B;  3SG2 A;  4U8D A;  1BU3 A;  1CM4 A;  1TCO B;  2L50 A;  2FJY A;  1JFJ A;  3NSK A;  4PHJ A;  1N65 A;  5EL2 A;  5HYD A;  2L2C A;  1CKK A;  3JVT B;  1AUI B;  2M1K B;  1OMD A;  2LLU A;  2WOS A;  2FCD A;  3GK2 A;  3F45 A;  1BT6 A;  2JC2 A;  3O78 A;  4HSZ A;  1TWO A;  4YBH B;  1TCF A;  1AJ5 A;  2IS9 A;  2R2I A;  4YRU A;  3CWG A;  1U5I A;  1YUU A;  1CMF A;  1B7T Z;  2QEH A;  2WOR A;  2F2O A;  2BE4 A;  1UUS A;  4NDC A;  4A4B A;  1SCV A;  1GGW A;  3RZS A;  1B8L A;  4PHN A;  2KSP A;  3GOF A;  3QME A;  1AK8 A;  3DF0 A;  3PM8 A;  4Q04 A;  5I2L A;  3SG7 A;  3CZ2 A;  3S0A A;  1YUR A;  4AQJ A;  3H4S E;  1A29 A;  4NQG A;  3CYZ A;  4WQ3 A;  1LA3 A;  3BFA A;  1PVA A;  2JTT A;  2M3W A;  3AAK A;  3R72 A;  1SR6 B;  3VRP A;  4C0J A;  2ZN8 A;  2KGB C;  1K9P A;  1KK8 C;  3O6B A;  2ZN9 A;  3VRO A;  4YGB B;  1UWO A;  2L4I A;  3CAB A;  1QV0 A;  1DJY A;  3PJI A;  4PHK A;  1MXE A;  2KI4 C;  3D0Y B;  4JWQ A;  5IBW A;  5JJG A;  1OOH A;  1NX1 A;  4N1G A;  1ODB A;  1G4Y R;  1RWY A;  1DJX A;  1DF0 A;  1PSR A;  1KQM B;  2BE6 A;  4XJK B;  5ER4 X;  2WCK A;  2JNX A;  3TDI A;  1W7I B;  2YGU A;  1J7R A;  1SYM A;  2Q91 A;  1G8I A;  1R2U A;  2RGI A;  1S6J A;  2KHN A;  4HRG A;  3VRR A;  3WXA A;  3NXA A;  3TDZ A;  4QJ5 B;  1CFD A;  1QAS A;  2P6B B;  3DYE A;  5DKR A;  1TTX A;  2G2B A;  1BMO A;  3BUO B;  3B6X A;  1DF0 B;  4N1F A;  3BYA A;  4GGF C;  5DKQ A;  2LHL A;  1EXR A;  2QPT A;  2JRF A;  4DS7 A;  3A4U B;  1NYA A;  1LVC D;  1CFC A;  3S0F A;  3AKA A;  1CTR A;  2CNP A;  3FWC A;  2K2A A;  3EKH A;  1Y1U A;  1FBV A;  2P71 A;  1QTX A;  2PQL A;  1L2O C;  1SCM B;  1HQV A;  2F3Z A;  1Z2C B;  2QDI A;  3K21 A;  3OB2 B;  4MEW A;  1H4B A;  1JWD A;  5I2Q A;  3BUW B;  2PSR A;  3BXK A;  3D75 A;  3S0D A;  1DJW A;  2JUL A;  1XK4 C;  3JVT C;  1BOC A;  1UHK A;  4E68 A;  5HKW A;  1TUZ A;  1K9U A;  2JPO A;  2EC6 C;  1DJH A;  1EH2 A;  4MZJ A;  1DJG A;  1OOJ A;  2KFG A;  1YVH A;  3DF0 B;  3JTD C;  1KFX L;  5F6T A;  4P5O E;  4IL1 A;  1Y6W A;  5BPJ A;  1K9K A;  1A75 B;  1KWO B;  1GJY A;  1NCY A;  2LUX A;  3EK8 A;  3FE6 A;  1CFF A;  2D8N A;  2I94 A;  3I5I C;  4INX A;  4DIR A;  4C0L A;  1J1E A;  1SBJ A;  1C3Y A;  4TNC A;  2O5G A;  1BLQ A;  2AAO A;  1S5G Y;  1BR1 B;  1MQ1 A;  3N7H A;  3TDU A;  2BBM A;  4FQT A;  4JD9 A;  1VRK A;  2JPT A;  2BEC A;  2KAX A;  5HKZ A;  3UO9 A;  2JTZ A;  2BCA A;  3D0Y A;  1YRT B;  3B7A A;  1SR6 C;  3OB1 B;  2HF5 A;  2ZNE A;  3EVR A;  2GTE A;  1DTL A;  1WLZ A;  1B8C A;  2HET A;  1LA0 A;  2K7B A;  4ETO A;  1BJF A;  5AER A;  3NSI A;  4CPV A;  1C07 A;  2Y1M A;  1M31 A;  2WCE A;  3PAT A;  3K1E A;  3KF9 A;  1OMV A;  2M97 A;  3PSR A;  4ZCU A;  3D73 A;  1AP4 A;  2JXL A;  4F0Z B;  2QEO A;  3CS1 A;  3DVM A;  3R1O A;  2L51 A;  1V1F A;  3I5G C;  1LS8 A;  1OOI X;  1XFW O;  2COL B;  3BUM B;  3D77 A;  2F8P A;  5AXI A;  1DJZ A;  5ER5 A;  2M9G A;  3OGN A;  3SG6 A;  1NX0 A;  2JT8 A;  1GGZ A;  1K8U A;  1TNQ A;  3CR2 A;  5PAL A;  5HKY A;  1NPQ A;  3I5H B;  2WCM A;  4I5K A;  1Z4H A;  2KBI A;  2OPO A;  2WCF A;  2I18 A;  2SCP A;  1BR4 B;  1QLS A;  4GGF A;  5KTY A;  2LVJ A;  1UHN A;  3SIB A;  2JT0 A;  2ISD A;  1KK7 Y;  5CSF A;  1SKT A;  2ERB A;  2FOT A;  1QAT A;  2AUC A;  3I5F B;  4PT1 A;  3LK0 A;  1JF2 A;  3SG5 A;  2M49 B;  5AAN A;  5CSN A;  1NIW A;  2MA2 A;  5FI6 A;  2PYQ A;  1R6P A;  3E3R A;  4P2Y B;  2F33 A;  4YGD B;  2M8U A;  1L2O B;  1SCM C;  2B1U A;  3TUY C;  4I5J A;  2MLF C;  2JQ6 A;  3LCP C;  1OOF A;  2LM5 A;  1BOD A;  2BCB A;  1AHR A;  1KFU L;  1SRA A;  1B7T Y;  4HRH A;  3SG3 A;  1IJ5 A;  2L5X B;  3EVU A;  1U5I B;  4ORB B;  2EC6 B;  3M0W A;  1EJ3 A;  1CB1 A;  1F4O A;  2KOT A;  3BOW A;  2KAY A;  1QJT A;  2Q4U A;  3KEV A;  4N5X A;  3WHT B;  4CFQ A;  5FYX A;  1B8R A;  1K2H A;  2LMU A;  4MRY A;  1ZOT B;  2LVK A;  1OQP A;  4DRW A;  2KYF A;  2FCE A;  1BG1 A;  4MRX A;  3PLF B;  1Y1X A;  2G9B A;  2HPS A;  1DGV A;  3PN7 B;  1WRK A;  2CXJ A;  1PRW A;  1WRL A;  2GV5 A;  2PMY A;  2GGZ A;  4CID A;  1F8H A;  3CZ0 A;  3CR5 X;  3BJH A;  3DVK A;  1NUB A;  4QJ4 B;  1J55 A;  1TN4 A;  4PDZ A;  3VRQ A;  3OBV A;  1A75 A;  1NCX A;  1OZS A;  1WDC B;  2M1U A;  2KAV A;  3L4A A;  4CLN A;  2EGD A;  1IKU A;  1OZO A;  1YRU B;  2I2R E;  2WCJ A;  2OTG C;  3NHT A;  3TZ1 A;  1C7V A;  4XYN A;  1UHI A;  4MZL A;  3SS3 A;  3CZT X;  1KK8 B;  1K90 D;  4INW A;  1PSB A;  1CDM A;  2I7A A;  1NX2 A;  2LC5 A;  1PUL A;  1QV1 A;  3IF7 A;  3CDN A;  1DC1 A;  3PM2 A;  2LLS A;  4XJK A;  2KI4 B;  4KYN A;  3DVJ A;  4USL A;  3SG4 A;  4A4C A;  1REC A;  3WNX B;  3BFH A;  2BL0 C;  1UHJ A;  4YGC B;  2HQ8 A;  1IJ6 A;  4GNK B;  4OCI A;  1FW4 A;  4JKT A;  2E30 A;  2KBM A;  1KCY A;  1KQM C;  1TOP A;  1KFX S;  2DOQ A;  2LNK A;  1F71 A;  1NX3 A;  1CLL A;  4L9M A;  2KPH A;  1GM0 A;  1LIN A;  3FS7 A;  1Q80 A;  2PAL A;  1CDP A;  3BFB A;  1TIZ A;  2QEB A;  3OHM B;  2MBX A;  4MVF A;  1NCZ A;  1MR8 A;  3UNW A;  3B87 A;  1WRZ A;  4GAO A;  3BUN B;  2KFF A;  5GQQ C;  3OX5 A;  1S6I A;  4AQI A;  4QJ3 B;  3TUY B;  2ZFD A;  1F70 A;  1KQV A;  1NP8 A;  3FIA A;  1OW4 A;  1JUO A;  2LAN A;  2ZRT A;  3VGO A;  4ICB A;  3B88 A;  2KFH A;  3OX6 A;  5HLO A;  1J7P A;  2NCO A;  4D1E A;  4M2Q A;  3RM1 A;  3TS5 C;  1DT7 B;  1D1O A;  2L2E A;  3GK1 A;  3HCM A;  3JTD B;  4JQ0 D;  2NLN A;  2BAP A;  2TN4 A;  1QX7 A;  4CFR A;  2LP2 A;  2KQY A;  3S0E A;  5FI7 A;  2LP3 A;  3I5I B;  2BCX A;  3SIA A;  4I5N B;  3D10 A;  5AEQ A;  3KO0 A;  1B4C A;  4OR9 B;  2KQ6 A;  3CLN A;  2WCB A;  1QVI Y;  2WC5 A;  2MAZ A;  3DY9 A;  3EG5 B;  1PVB A;  5FI2 A;  1K94 A;  4R1E A;  4PE0 A;  1YX8 A;  2LLT A;  1TNP A;  1W7J B;  1KSM A;  1WDC C;  2L0P A;  3IVT A;  1SMG A;  1SPY A;  2EHB A;  1S36 A;  3D74 A;  1S1E A;  2NCP A;  2OTG B;  1OMR A;  1TRF A;  1YUT A;  1W9Z A;  2L4H A;  4OKH A;  1CM1 A;  1DMO A;  4F7F A;  1XVJ A;  1X02 A;  2KLE A;  2M0R A;  1K95 A;  1QX5 B;  3S0G A;  2LAP A;  1DEK A;  2ZRS A;  4OV2 A;  1IRJ A;  2HQW A;  1M39 A;  1KFU S;  2LCP A;  3PFV A;  1QXP A;  4GGN A;  3SS5 A;  1MUX A;  1RRO A;  2BL0 B;  3I5G B;  3NGV A;  2WND A;  1XA5 A;  2VRG A;  4GPL B;  4PAL A;  4M2O A;  2ZKM X;  1RTP 1;  2K8M B;  3ZWH A;  3IQO A;  1QIV A;  3MSE B;  1RFJ A;  3NSL A;  1T14 A;  1B9A A;  1UP5 A;  2JXC A;  3S0B A;  1M45 A;  2H61 C;  1Y0V H;  1CDN A;  4FQO A;  1A4P A;  4MZK A;  1J7Q A;  2FJU B;  3D78 A;  1IH0 A;  2H8V A;  4C0K A;  1JBA A;  1KK7 Z;  4DUQ A;  1FPW A;  1G33 A;  1SY9 A;  1NWD A;  5D3O A;  2MJW B;  3OP0 A;  2F2P A;  3EK7 A;  2H2K A;  3EVV A;  2SAS A;  2P70 A;  4BY5 A;  2JOJ A;  1XFU O;  1CDL A;  2L5Y A;  3I5F C;  5I2O A;  1K93 D;  3EKJ A;  2PAS A;  1ZMZ A;  1SNL A;  1MF8 B;  4PCW A;  4NDD A;  1CLM A;  1UHH A;  4PHM A;  2JNF A;  1C3Z A;  1EG4 A;  2LMV A;  3KPX A;  1EG3 A;  3L4L A;  1N0Y A;  1F54 A;  4FTG A;  1F55 A;  1XK4 A;  2M7L A;  5D69 A;  2Y1N A;  1SW8 A;  2LUC A;  1E8A A;  3O2P A;  4ORA B;  1XYD A;  2QEV A;  3AKB A;  2CTN A;  1TUJ A;  5D7F A;  2WC8 A;  4IJ7 A;  5I8N A;  2M29 A;  1MXL C;  1IQ3 A;  4HRE E;  3B86 A;  3TS5 B;  1DJI A;  3CR4 X;  2CT9 A;  3FE9 A;  5KSZ A;  4DCK A;  3R1V A;  4I5L B;  5KU1 A;  1KSO A;  3A8R A;  2PVB A;  1XFY O;  3CGA A;  3C1V A;  2L98 A;  1BF5 A;  5DKN A;  1GQM A;  2LVV A;  1IIO A;  4WRI A;  3DVE A;  1DQE A;  1EL4 A;  2KNE A;  1YTZ C;  1S6C A;  4PE4 A;  1MWN A;  2KI6 D;  1K96 A;  1WY9 A;  3PN7 C;  2JWW A;  1SL8 A;  1A2X A;  1YVL A;  2K7C A;  2M7N A;  5J3X A;  3DXL A;  2K60 A;  3LLE A;  1OOG A;  3L47 A;  4UPG A;  1CMG A;  1MHO A;  2KLD A;  2OS8 B;  3CTN A;  1H8B A;  3BQ3 A;  1J7O A;  4MSP A;  3VB1 A;  2K61 A;  1B1G A;  1QVI Z;  3FE8 A;  3NSO A;  1FI6 A;  2CBL A;  2JZI A;  3EK4 A;  2O60 A;  3PAL A;  1QS7 A;  3NHI A;  2LV7 A;  2KGR A;  2F3Y A;  1IG5 A;  1F4Q A;  1UUR A;  1ORG A;  1FF1 A;  4YGE B;  5B8I B;  5TNC A;  2LVI A;  1ZUZ A;  4WQ2 A;  5K89 A;  3DD4 A;  3ZNI A;  1DEL A;  3ICB A;  4GBA A;  1CNP A;  1AJ4 A;  4JPZ B;  1XO5 A;  2H61 A;  1JF0 A;  2GGM A;  2MLE C;  2BNX A;  1KWO C;  3IQQ A;  1JFK A;  1XFV O;  5CSJ A;  1SL9 A;  4MBE A;  1YR5 A;  3VRN A;  4OZD A;  2K7D A;  5I94 A;  2V53 A;  3WHU B;  1S26 D;  3V2L A;  2A4J A;  2E6W A;  4GFT A;  4MN0 A;  1QIW A;  1A03 A;  1TNX A;  1M46 A;  1QWV A;  1SL7 A;  2QAC A;  1IGV A;  4YI8 A;  1IWQ A;  2WC6 A;  2KDH A;  1B47 A;  2NXQ A;  4M2P A;  3RLZ A;  1CLB A;  3O4X A;  3D76 A;  1S5G Z;  3FWB A;  4YGA A;  4OVN F;  5CPV A;  3KHE A;  1L7Z A;  1PAL A;  1DVI A;  1C7W A;  4GUK A;  4MLW A;  1PK0 D;  2Y5I A;  3SJS A;  2BBN A;  2JU0 A;  2CCM A;  2LMT A;  5JOL A;  1CFP A;  1V1G A;  5AFP A;  2JT3 A;  1S3P A;  1XFZ O;  1XFR A;  1WLM A;  3LL8 B;  5G08 A;  1ALW A;  1J1D A;  1QX2 A;  1P28 A;  1IQ5 A;  2Y4Q A;  4NDB A;  4PE7 A;  4BY4 A;  2LE9 B;  2AMI A;  2LHI A;  1Y1A A;  2PRU A;  2BKH B;  5CSI A;  5HL1 A;  2MHH A;  1LKJ A;  1N2D A;  2K7O A;  1NSH A;  3GK4 X;  1SSE B;  4PE1 A;  1RK9 A;  1XFX O;  2K0J A;  2WCL A;  3SS4 A;  1JSA A;  1ALV A;  1RJV A;  3LK1 A;  3I5H C;  3O4Y A;  3R1P A;  2K2F A;  1QLK A;  4YI9 A;  2NZ0 A;  1OE9 B;  3QRX A;  2WCH A;  1LXF C;  1M63 B; 
#chains in the Genus database with same CATH homology
 1YX7 A;  2MRD A;  4ZCV A;  1YUS A;  5HLV A;  1AVS A;  2KI6 C;  4AOM A;  1TNW A;  1JC2 A;  3AAJ A;  3HX4 A;  1SK6 D;  2KYC A;  2OS8 C;  1ZAC A;  1OSA A;  4ORC B;  3BOW B;  1ZFS A;  1FI5 A;  1HT9 A;  2ZND A;  1DGU A;  2BKI B;  3BUX B;  3SG2 A;  4U8D A;  1BU3 A;  1CM4 A;  1TCO B;  2L50 A;  1JFJ A;  3NSK A;  4PHJ A;  1N65 A;  5HYD A;  1CKK A;  3JVT B;  1AUI B;  2M1K B;  1OMD A;  2LLU A;  2WOS A;  2FCD A;  3GK2 A;  3F45 A;  1BT6 A;  2JC2 A;  3O78 A;  4HSZ A;  4YBH B;  1TCF A;  1AJ5 A;  2IS9 A;  2R2I A;  4YRU A;  3CWG A;  1U5I A;  1YUU A;  1CMF A;  1B7T Z;  2WOR A;  2F2O A;  2BE4 A;  1UUS A;  4NDC A;  4A4B A;  1SCV A;  1GGW A;  1B8L A;  4PHN A;  2KSP A;  3GOF A;  1AK8 A;  3DF0 A;  3PM8 A;  4Q04 A;  5I2L A;  3SG7 A;  1YUR A;  4AQJ A;  3H4S E;  1A29 A;  4NQG A;  4WQ3 A;  1LA3 A;  1PVA A;  2JTT A;  2M3W A;  3AAK A;  1SR6 B;  3VRP A;  4C0J A;  2ZN8 A;  2KGB C;  1K9P A;  1KK8 C;  3O6B A;  2ZN9 A;  3VRO A;  4YGB B;  1UWO A;  2L4I A;  1QV0 A;  1DJY A;  4PHK A;  1MXE A;  2KI4 C;  3D0Y B;  4JWQ A;  5IBW A;  5JJG A;  1NX1 A;  4N1G A;  1ODB A;  1G4Y R;  1RWY A;  1DJX A;  1DF0 A;  1PSR A;  1KQM B;  2BE6 A;  4XJK B;  5ER4 X;  3TDI A;  2JNX A;  1W7I B;  1J7R A;  1SYM A;  2Q91 A;  1G8I A;  1R2U A;  2RGI A;  1S6J A;  2KHN A;  4HRG A;  3VRR A;  3WXA A;  3NXA A;  3TDZ A;  4QJ5 B;  1CFD A;  1QAS A;  2P6B B;  5DKR A;  1TTX A;  2G2B A;  1BMO A;  3BUO B;  4N1F A;  1DF0 B;  3BYA A;  4GGF C;  5DKQ A;  2LHL A;  1EXR A;  2QPT A;  2JRF A;  4DS7 A;  3A4U B;  1NYA A;  1LVC D;  1CFC A;  3AKA A;  1CTR A;  2CNP A;  3FWC A;  2K2A A;  3EKH A;  1FBV A;  1Y1U A;  1QTX A;  1L2O C;  1SCM B;  1HQV A;  2F3Z A;  3K21 A;  3OB2 B;  4MEW A;  1H4B A;  1JWD A;  5I2Q A;  3BUW B;  2PSR A;  3BXK A;  1DJW A;  2JUL A;  1XK4 C;  3JVT C;  1BOC A;  1UHK A;  4E68 A;  5HKW A;  1K9U A;  2EC6 C;  1DJH A;  1EH2 A;  4MZJ A;  1DJG A;  1OOJ A;  2KFG A;  1YVH A;  3DF0 B;  3JTD C;  1KFX L;  5F6T A;  4P5O E;  4IL1 A;  1Y6W A;  5BPJ A;  1K9K A;  1A75 B;  1KWO B;  1GJY A;  1NCY A;  2LUX A;  3EK8 A;  1CFF A;  2D8N A;  2I94 A;  3I5I C;  4DIR A;  4C0L A;  1J1E A;  1SBJ A;  4TNC A;  2O5G A;  1BLQ A;  2AAO A;  1S5G Y;  1BR1 B;  1MQ1 A;  3TDU A;  2BBM A;  1VRK A;  2JPT A;  2BEC A;  2KAX A;  5HKZ A;  2JTZ A;  2BCA A;  3D0Y A;  1YRT B;  1SR6 C;  3OB1 B;  2HF5 A;  2ZNE A;  3EVR A;  2HET A;  1DTL A;  1WLZ A;  1B8C A;  2K7B A;  1LA0 A;  4ETO A;  5AER A;  1BJF A;  1C07 A;  3NSI A;  4CPV A;  2Y1M A;  1M31 A;  2WCE A;  3PAT A;  3KF9 A;  1OMV A;  2M97 A;  3PSR A;  4ZCU A;  1AP4 A;  2JXL A;  4F0Z B;  3CS1 A;  3DVM A;  2L51 A;  1V1F A;  3I5G C;  1XFW O;  2COL B;  3BUM B;  5AXI A;  2F8P A;  1DJZ A;  5ER5 A;  2M9G A;  3SG6 A;  1NX0 A;  2JT8 A;  1GGZ A;  1K8U A;  1TNQ A;  3CR2 A;  5PAL A;  5HKY A;  1NPQ A;  3I5H B;  4I5K A;  2KBI A;  2OPO A;  2WCF A;  2I18 A;  2SCP A;  1BR4 B;  1QLS A;  4GGF A;  5KTY A;  2LVJ A;  1UHN A;  3SIB A;  2JT0 A;  2ISD A;  1KK7 Y;  5CSF A;  1SKT A;  2FOT A;  1QAT A;  2AUC A;  3I5F B;  3LK0 A;  1JF2 A;  3SG5 A;  2M49 B;  5AAN A;  5CSN A;  1NIW A;  2MA2 A;  1R6P A;  3E3R A;  4P2Y B;  2F33 A;  4YGD B;  2M8U A;  1L2O B;  1SCM C;  2B1U A;  3TUY C;  4I5J A;  2MLF C;  2JQ6 A;  3LCP C;  1BOD A;  2LM5 A;  2BCB A;  1AHR A;  1KFU L;  1SRA A;  1B7T Y;  4HRH A;  3SG3 A;  1IJ5 A;  2L5X B;  3EVU A;  1U5I B;  4ORB B;  2EC6 B;  3M0W A;  1EJ3 A;  1CB1 A;  1F4O A;  2KOT A;  3BOW A;  2KAY A;  1QJT A;  2Q4U A;  3KEV A;  4N5X A;  3WHT B;  4CFQ A;  5FYX A;  1B8R A;  1K2H A;  2LMU A;  4MRY A;  1ZOT B;  2LVK A;  1OQP A;  4DRW A;  2KYF A;  2FCE A;  1BG1 A;  4MRX A;  3PLF B;  1Y1X A;  2G9B A;  2HPS A;  1DGV A;  3PN7 B;  1WRK A;  2CXJ A;  1PRW A;  1WRL A;  2GV5 A;  2PMY A;  2GGZ A;  4CID A;  1F8H A;  3CR5 X;  3DVK A;  1NUB A;  4QJ4 B;  1J55 A;  1TN4 A;  4PDZ A;  3VRQ A;  1A75 A;  1NCX A;  1OZS A;  1WDC B;  2M1U A;  2KAV A;  4CLN A;  1IKU A;  2EGD A;  1OZO A;  1YRU B;  2I2R E;  2OTG C;  3TZ1 A;  1C7V A;  4XYN A;  1UHI A;  4MZL A;  3CZT X;  1KK8 B;  1K90 D;  1PSB A;  1CDM A;  2I7A A;  1NX2 A;  2LC5 A;  1PUL A;  1QV1 A;  3IF7 A;  2LLS A;  4XJK A;  2KI4 B;  4USL A;  3DVJ A;  3SG4 A;  4A4C A;  1REC A;  3WNX B;  2BL0 C;  1UHJ A;  4YGC B;  2HQ8 A;  1IJ6 A;  4GNK B;  4OCI A;  1FW4 A;  2E30 A;  2KBM A;  1KCY A;  1KQM C;  1TOP A;  1KFX S;  2DOQ A;  2LNK A;  1F71 A;  1NX3 A;  1CLL A;  4L9M A;  1LIN A;  3FS7 A;  1Q80 A;  2PAL A;  1CDP A;  3OHM B;  1TIZ A;  2MBX A;  4MVF A;  1NCZ A;  1MR8 A;  1WRZ A;  4GAO A;  3BUN B;  2KFF A;  5GQQ C;  3OX5 A;  1S6I A;  4AQI A;  4QJ3 B;  3TUY B;  2ZFD A;  1F70 A;  1KQV A;  1NP8 A;  3FIA A;  1JUO A;  2LAN A;  2ZRT A;  3VGO A;  4ICB A;  2KFH A;  3OX6 A;  5HLO A;  1J7P A;  2NCO A;  4D1E A;  4M2Q A;  3RM1 A;  3TS5 C;  1DT7 B;  1D1O A;  2L2E A;  3GK1 A;  3HCM A;  3JTD B;  4JQ0 D;  2NLN A;  2TN4 A;  1QX7 A;  4CFR A;  2LP2 A;  2KQY A;  2LP3 A;  3I5I B;  2BCX A;  3SIA A;  4I5N B;  3D10 A;  5AEQ A;  3KO0 A;  1B4C A;  4OR9 B;  2KQ6 A;  3CLN A;  2WCB A;  1QVI Y;  2MAZ A;  1PVB A;  1K94 A;  4R1E A;  4PE0 A;  1YX8 A;  2LLT A;  1TNP A;  1W7J B;  1KSM A;  1WDC C;  2L0P A;  1SMG A;  1SPY A;  2EHB A;  1S36 A;  1S1E A;  2NCP A;  2OTG B;  1OMR A;  1TRF A;  1YUT A;  2L4H A;  4OKH A;  1CM1 A;  1DMO A;  1XVJ A;  1X02 A;  2M0R A;  1K95 A;  1QX5 B;  2LAP A;  2ZRS A;  4OV2 A;  1IRJ A;  2HQW A;  1M39 A;  1KFU S;  2LCP A;  3PFV A;  1QXP A;  4GGN A;  1MUX A;  1RRO A;  2BL0 B;  3I5G B;  2WND A;  1XA5 A;  2VRG A;  4GPL B;  4PAL A;  4M2O A;  2ZKM X;  1RTP 1;  2K8M B;  3ZWH A;  3IQO A;  1QIV A;  3MSE B;  1RFJ A;  3NSL A;  1UP5 A;  1B9A A;  2JXC A;  1M45 A;  2H61 C;  1Y0V H;  1CDN A;  4FQO A;  1A4P A;  4MZK A;  1J7Q A;  2FJU B;  1IH0 A;  4C0K A;  1JBA A;  1KK7 Z;  4DUQ A;  1FPW A;  1G33 A;  1SY9 A;  1NWD A;  2MJW B;  3OP0 A;  2F2P A;  3EK7 A;  2H2K A;  3EVV A;  2SAS A;  4BY5 A;  2JOJ A;  1XFU O;  1CDL A;  3I5F C;  5I2O A;  1K93 D;  3EKJ A;  2PAS A;  1ZMZ A;  1SNL A;  1MF8 B;  4PCW A;  4NDD A;  1CLM A;  1UHH A;  4PHM A;  2JNF A;  1EG4 A;  3KPX A;  2LMV A;  1F54 A;  1EG3 A;  1N0Y A;  4FTG A;  1F55 A;  1XK4 A;  2M7L A;  5D69 A;  2Y1N A;  1SW8 A;  2LUC A;  1E8A A;  3O2P A;  4ORA B;  1XYD A;  3AKB A;  2CTN A;  5D7F A;  2WC8 A;  5I8N A;  2M29 A;  1MXL C;  1IQ3 A;  4HRE E;  3TS5 B;  1DJI A;  3CR4 X;  2CT9 A;  5KSZ A;  4DCK A;  4I5L B;  5KU1 A;  1KSO A;  3A8R A;  2PVB A;  1XFY O;  3CGA A;  3C1V A;  2L98 A;  1BF5 A;  5DKN A;  1GQM A;  2LVV A;  4WRI A;  3DVE A;  1EL4 A;  2KNE A;  1YTZ C;  1S6C A;  4PE4 A;  1MWN A;  2KI6 D;  1K96 A;  1WY9 A;  3PN7 C;  2JWW A;  1SL8 A;  1A2X A;  1YVL A;  2K7C A;  2M7N A;  5J3X A;  3LLE A;  1CMG A;  4UPG A;  1MHO A;  3CTN A;  2OS8 B;  1H8B A;  3BQ3 A;  1J7O A;  4MSP A;  2K61 A;  1B1G A;  1QVI Z;  3NSO A;  1FI6 A;  2CBL A;  2JZI A;  3EK4 A;  2O60 A;  3PAL A;  1QS7 A;  2LV7 A;  2KGR A;  2F3Y A;  1IG5 A;  1F4Q A;  1UUR A;  1FF1 A;  4YGE B;  5B8I B;  5TNC A;  2LVI A;  1ZUZ A;  4WQ2 A;  5K89 A;  3DD4 A;  3ZNI A;  3ICB A;  4GBA A;  1CNP A;  1AJ4 A;  4JPZ B;  1XO5 A;  2H61 A;  1JF0 A;  2GGM A;  2MLE C;  1KWO C;  3IQQ A;  1JFK A;  1XFV O;  5CSJ A;  1SL9 A;  4MBE A;  1YR5 A;  3VRN A;  2K7D A;  2V53 A;  3WHU B;  1S26 D;  2A4J A;  2E6W A;  4GFT A;  4MN0 A;  1QIW A;  1A03 A;  1TNX A;  1M46 A;  1SL7 A;  2QAC A;  4YI8 A;  1IGV A;  1IWQ A;  2KDH A;  1B47 A;  2NXQ A;  4M2P A;  3RLZ A;  1CLB A;  3FWB A;  1S5G Z;  4YGA A;  4OVN F;  5CPV A;  3KHE A;  1L7Z A;  1PAL A;  1DVI A;  1C7W A;  4GUK A;  4MLW A;  1PK0 D;  2Y5I A;  3SJS A;  2BBN A;  2JU0 A;  2CCM A;  2LMT A;  5JOL A;  1CFP A;  1V1G A;  5AFP A;  2JT3 A;  1S3P A;  1XFZ O;  3LL8 B;  1WLM A;  5G08 A;  1ALW A;  1J1D A;  1QX2 A;  4BY4 A;  1IQ5 A;  2Y4Q A;  4NDB A;  4PE7 A;  2LE9 B;  2AMI A;  2LHI A;  1Y1A A;  2PRU A;  2BKH B;  5CSI A;  2MHH A;  1LKJ A;  1N2D A;  2K7O A;  1NSH A;  3GK4 X;  4PE1 A;  1RK9 A;  1XFX O;  2K0J A;  1JSA A;  1ALV A;  1RJV A;  3O4Y A;  3I5H C;  2K2F A;  1QLK A;  4YI9 A;  2NZ0 A;  1OE9 B;  3QRX A;  3LK1 A;  1LXF C;  1M63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...