3JTDB

Calcium-free scallop myosin regulatory domain with elc-d19a point mutation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
source organism Argopecten irradians
total genus 38
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdB02
1M31A 3BQ3A 3PALA 3O2PA 1K9UA 2MAZA 3GK2A 1S6CA 1OZSA 4YRUA 1BODA 3NSIA 3TDIA 2MA2A 2KAYA 1YX7A 1RROA 2K7DA 5ER5A 4ZCUA 1TIZA 1QJTA 2KI4C 4A4BA 1QIWA 2JXCA 3VRRA 5CSIA 5CSNA 1WRKA 3I5HB 1JFKA 4U8DA 4M2PA 2H2KA 2ZNEA 4CFQA 4PALA 1CDMA 1D1OA 1R6PA 1S1EA 2KQYA 4D1EA 1DTLA 2CCMA 2F2OA 3OB2B 5D7FA 3A4UB 1WLZA 2PALA 2Y4QA 4DRWA 4DS7A 1IH0A 2NCOA 1UHJA 2K2FA 3O78A 4Q04A 1KK7Z 3NSOA 1KSMA 2KFFA 1EG3A 2JT0A 1N65A 1SL8A 1M46A 3BYAA 2I18A 2BECA 2H61A 2I94A 1N0YA 1KK8C 1OQPA 4PE0A 4CIDA 3I5FC 2LHIA 1CFPA 1IGVA 4GFTA 2AMIA 1LXFC 2KAVA 1H4BA 3LCPC 2CTNA 1ZUZA 1EL4A 3SG2A 1CLMA 1FW4A 2ZNDA 3M0WA 3SG6A 1Q80A 1F4QA 1OMRA 4WQ3A 1MR8A 3RM1A 3DVMA 1CMGA 3PM8A 4ORBB 1EJ3A 1MUXA 4MZLA 3SG3A 1A29A 1GJYA 1KK7Y 1CDNA 2M49B 1DF0B 1RTP1 1XFVO 2KYFA 5FYXA 4MZJA 1B8CA 1IQ5A 2L4HA 1XYDA 1JFJA 4E68A 2G2BA 2I2RE 3OHMB 3PATA 2HPSA 1S36A 3MSEB 3PN7C 3LK1A 1CB1A 1WDCC 2KYCA 5AEQA 3PFVA 5HLVA 4UPGA 1KSOA 1PRWA 1YRUB 1S6JA 1SR6C 4YGAA 2QPTA 2TN4A 2V53A 1DJZA 1PVBA 1PALA 4PE7A 1C7WA 2F3YA 1DMOA 2LLSA 3DVEA 1S5GZ 3BUXB 1GQMA 3WNXB 4ETOA 3VRPA 2M3WA 4WRIA 5HLOA 2M0RA 2M8UA 2WC8A 2WNDA 3TS5C 2I7AA 3SIAA 2LVIA 1MHOA 2KI6C 2NZ0A 1CFFA 5HKZA 2GGZA 1F4OA 4HRGA 4AQIA 4YI8A 1YVHA 1LA0A 1SCVA 1TNWA 4TNCA 1DGVA 5D69A 2BBMA 4CLNA 1TCOB 3LK0A 2L98A 1F71A 1B4CA 5ER4X 2L51A 2KBMA 1HQVA 4OCIA 1UHHA 4I5NB 4NDCA 2BKHB 4N1GA 1A2XA 1KFXL 1UURA 4C0LA 2GV5A 3GK4X 1WRLA 3BOWB 3CS1A 1W7IB 1NWDA 4MLWA 1S5GY 1DJHA 1N2DA 1ZOTB 3I5HC 3EVVA 3WXAA 3BUNB 2LANA 1A03A 2F2PA 2GGMA 4PE1A 4FTGA 1EG4A 1IG5A 1XA5A 2M29A 4MSPA 4YGBB 3QRXA 1JSAA 4IL1A 1CFCA 2ZN8A 3OX6A 2Q91A 2MRDA 2AUCA 2NCPA 1QXPA 2L0PA 2E30A 4BY4A 4AQJA 1B47A 2LVVA 3VRNA 3I5IB 4ICBA 3SG7A 3NSKA 2BKIB 1OSAA 3BUOB 3LLEA 1A4PA 2LC5A 3ZWHA 4YGEB 4P5OE 4MRXA 4QJ4B 2VRGA 1LVCD 3GK1A 2HF5A 3OP0A 3TDZA 2MLEC 2L4IA 1SY9A 2WCFA 1JC2A 1F54A 3O6BA 2JRFA 2FCEA 2FCDA 2F8PA 1WRZA 4ZCVA 1K95A 3BOWA 1IWQA 4MBEA 1U5IB 1IJ5A 1QASA 3TUYB 2L2EA 3A8RA 5HKWA 1QV1A 1LA3A 1CDPA 1R2UA 1XK4A 2Y5IA 4MEWA 2JXLA 5HYDA 2LMUA 1CNPA 4PHJA 2G9BA 2KDHA 2M1UA 1CMFA 3DVJA 4JWQA 1CTRA 3DF0A 1L7ZA 3CLNA 3JVTB 1RWYA 3EK7A 1OMVA 3D0YB 1A75B 1Y1UA 1MXLC 1F55A 1QIVA 1ZMZA 4M2QA 1BJFA 1NPQA 2K0JA 1MF8B 1K90D 2NLNA 3CR5X 1NX1A 1PULA 2A4JA 1FI5A 2EC6B 4M2OA 1E8AA 1RK9A 1BU3A 2JOJA 1YX8A 2KFGA 5CSJA 3VRQA 1C7VA 4BY5A 1L2OB 1YRTB 2JNXA 2KGBC 3JTDB 1KQMB 4OVNF 3BUMB 2LE9B 5DKQA 1PVAA 3WHTB 1DJXA 1X02A 1QX5B 1WY9A 2K7CA 4I5KA 1PSRA 1PSBA 2MHHA 1MWNA 2SASA 1NX3A 4MZKA 3VGOA 1CLLA 1HT9A 5F6TA 1QLKA 1SK6D 4GUKA 1SPYA 2L5XB 1ODBA 1Y6WA 4A4CA 3I5GB 1QTXA 5K89A 1KWOB 2R2IA 1F8HA 1DVIA 2CXJA 4GBAA 1J7RA 4OR9B 1GGWA 4OKHA 1KCYA 3HCMA 2KQ6A 3CZTX 3AAKA 3PLFB 2NXQA 1TCFA 2JQ6A 3D10A 1KFUS 1IQ3A 1NSHA 3F45A 4GPLB 1LINA 3BXKA 1FBVA 1K94A 4I5LB 1AHRA 2QACA 3EK4A 3FIAA 1J1DA 3PSRA 2JTTA 1G33A 2LHLA 1BLQA 1SMGA 2LM5A 2CT9A 3LL8B 2ZRTA 1PK0D 4NDDA 1YUTA 1XK4C 4CFRA 3C1VA 1G4YR 4PCWA 2DOQA 1NX2A 1SKTA 2Y1NA 1BR4B 5JJGA 1TOPA 1YURA 1IRJA 5AFPA 1BF5A 1QV0A 2KFHA 1H8BA 1K93D 2FJUB 1J7PA 1UHNA 1C07A 1SRAA 2CBLA 2KNEA 1DGUA 1DF0A 4XJKB 3AKBA 1XVJA 2KAXA 5KU1A 2LMVA 4DIRA 4F0ZB 2WORA 2MLFC 3KF9A 1DJYA 1NUBA 1SL7A 3I5IC 4HSZA 2BL0B 2LP3A 3SJSA 4I5JA 5G08A 1M45A 2OTGB 3KO0A 4GGNA 5AANA 1YR5A 4PHKA 1J1EA 1UP5A 4PHMA 1KQVA 1IKUA 1SYMA 5DKNA 1JBAA 2JTZA 5CSFA 1OZOA 3FWBA 4ORAB 5AERA 1SCMB 1J7QA 2M97A 1J55A 1YUSA 2BCAA 2BCBA 4XYNA 3SG4A 1YVLA 3SG5A 5KSZA 2KI6D 2PRUA 5GQQC 1B9AA 1YUUA 5J3XA 4DUQA 3TUYC 1NX0A 4GNKB 3O4YA 3OX5A 2HETA 5BPJA 2ZN9A 4P2YB 1V1GA 1S26D 1S6IA 1RJVA 2OS8B 2AAOA 2Y1MA 5B8IB 4YI9A 3JVTC 2PASA 3OB1B 1SNLA 4DCKA 3H4SE 1W7JB 1EH2A 4MVFA 1QLSA 3EVRA 4XJKA 3EKJA 1QVIZ 5JOLA 3EVUA 2BE6A 2EC6C 2L50A 3IQQA 1AUIB 1ZFSA 1J7OA 1V1FA 1L2OC 4AOMA 1IJ6A 1TNPA 2LLUA 4GGFA 4OV2A 3JTDC 5I8NA 2PMYA 1KQMC 1WLMA 1NCYA 2JT3A 2EHBA 5TNCA 2COLB 1EXRA 2ZKMX 1FPWA 2P6BB 2JT8A 1TRFA 1K9KA 1CDLA 1BOCA 1SBJA 3HX4A 1XO5A 4YBHB 1AVSA 2BCXA 4CPVA 1XFXO 2M1KB 3I5GC 5DKRA 1KWOC 4QJ5B 4MRYA 1QVIY 1TN4A 1YTZC 1MQ1A 2RGIA 1OE9B 3E3RA 3FS7A 2ISDA 2KI4B 4JQ0D 2F3ZA 1B8RA 2JU0A 2KOTA 3DVKA 1VRKA 3NXAA 2LVJA 3EK8A 4NQGA 1K2HA 1BR1B 1Y1XA 3TDUA 2JC2A 3TZ1A 2MJWB 1DT7B 2PVBA 2LMTA 4USLA 1M63B 1SW8A 1U5IA 4C0KA 1NCZA 1OOJA 2O60A 1XFWO 1K8UA 3CR2A 1S3PA 2BBNA 3KEVA 1JF2A 1Y1AA 3DD4A 4YGDB 2LAPA 1CM1A 1JWDA 4HREE 2WCBA 2IS9A 1NP8A 3BUWB 1QATA 4PDZA 2JNFA 1LKJA 1JUOA 4ORCB 1SL9A 2ZRSA 2LV7A 2JPTA 1ALVA 3D0YA 1A75A 1AJ5A 1UHIA 2JULA 1ALWA 1ZACA 5I2QA 3RLZA 1KK8B 2B1UA 2LLTA 2LUCA 1DJWA 2LVKA 2BL0C 2WCEA 1BT6A 1CFDA 1NYAA 3I5FB 5AXIA 3SIBA 2OPOA 4PE4A 3VROA 2OTGC 4N5XA 4GGFC 2K7BA 3AAJA 3IQOA 2MBXA 1KFUL 1BMOA 1G8IA 5I2LA 1CKKA 3EKHA 3WHUB 1CM4A 1QS7A 2HQWA 1NIWA 2JWWA 2O5GA 3GOFA 1FF1A 1FI6A 1M39A 2KGRA 1SCMC 1DJIA 4R1EA 2D8NA 3FWCA 1BG1A 2M7NA 4JPZB 3CGAA 2FOTA 1B7TZ 5PALA 5IBWA 2HQ8A 1RECA 4C0JA 4MN0A 1NCXA 1KFXS 3CTNA 1XFUO 2BE4A 4N1FA 1JF0A 2OS8C 3IF7A 2F33A 2LUXA 1B8LA 3KPXA 3K21A 3PN7B 2K61A 5KTYA 1WDCB 4NDBA 4L9MA 1XFZO 2K7OA 1SR6B 1TTXA 1AP4A 1GGZA 2H61C 1UWOA 2WOSA 5CPVA 2LP2A 1F70A 4GAOA 2JZIA 3CWGA 3ZNIA 1B1GA 1XFYO 2K8MB 2LCPA 4FQOA 2KHNA 3NSLA 1B7TY 3ICBA 1UHKA 3TS5B 2ZFDA 3AKAA 1K9PA 2E6WA 1K96A 2SCPA 4PHNA 2CNPA 2PSRA 1AJ4A 3CR4X 2LNKA 4YGCB 2M7LA 1MXEA 4WQ2A 1CLBA 5HKYA 1DJGA 2M9GA 2K2AA 1QX7A 1UUSA 4QJ3B 1Y0VH 4HRHA 1OMDA 1RFJA 1AK8A 2KBIA 1TNXA 1QX2A 3DF0B 2Q4UA 3KHEA 2EGDA 1TNQA 5I2OA 2KSPA
chains in the Genus database with same CATH superfamily
1M31A 3BQ3A 3PALA 3O2PA 1K9UA 2WC6A 2MAZA 3GK2A 1S6CA 1OZSA 4YRUA 1BODA 3NSIA 3TDIA 2MA2A 2KAYA 1YX7A 1RROA 2K7DA 5ER5A 1P28A 4ZCUA 1TIZA 1QJTA 2KI4C 4A4BA 1QIWA 2JXCA 3VRRA 5CSIA 5CSNA 1WRKA 3I5HB 1JFKA 2KLEA 4U8DA 2P71A 5DICA 4M2PA 2H2KA 2ZNEA 4CFQA 4PALA 3IVTA 1CDMA 1D1OA 1R6PA 1S1EA 2KQYA 4D1EA 1DTLA 2CCMA 2F2OA 2KPHA 3OB2B 5D7FA 3A4UB 1WLZA 2PALA 2Y4QA 4DRWA 2BNXA 4DS7A 1W9ZA 3R1PA 1IH0A 2NCOA 3DYEA 3UO9A 1UHJA 2K2FA 3O78A 4Q04A 1KK7Z 3NSOA 1KSMA 2KFFA 4FQTA 1EG3A 2JT0A 3S0EA 2H8VA 1N65A 1SL8A 1M46A 3BYAA 2I18A 2BECA 2H61A 2I94A 1N0YA 1KK8C 1OQPA 2PYQA 3BFAA 4PE0A 4CIDA 1DC1A 3I5FC 2LHIA 1CFPA 1IGVA 4GFTA 2AMIA 1LXFC 2KAVA 1H4BA 3LCPC 2CTNA 1ZUZA 1EL4A 3SG2A 1CLMA 1FW4A 5FI7A 1LS8A 2ZNDA 3M0WA 3BFHA 3SG6A 1Q80A 1F4QA 1OMRA 4WQ3A 1MR8A 3RM1A 3DVMA 1CMGA 3PM8A 4ORBB 1EJ3A 1MUXA 4MZLA 3SG3A 1A29A 2WC5A 1GJYA 1KK7Y 1CDNA 2M49B 1DF0B 1XFRA 1RTP1 1XFVO 2KYFA 5FYXA 3S0DA 4MZJA 3S0GA 3OBVA 1B8CA 1IQ5A 2L4HA 2WCJA 1XYDA 1JFJA 4E68A 3S0AA 2G2BA 2I2RE 3OHMB 3PATA 2HPSA 1S36A 3MSEB 3PN7C 3LK1A 1CB1A 1WDCC 2KYCA 5AEQA 3PFVA 1DEKA 5HLVA 3K1EA 4UPGA 1KSOA 1PRWA 1YRUB 1S6JA 1SR6C 5FI6A 3CZ2A 2QPTA 2TN4A 4YGAA 3D75A 2V53A 1DJZA 1PVBA 1PALA 4PE7A 1C7WA 2F3YA 3SS4A 1DMOA 1OOIX 2LLSA 1S5GZ 3DVEA 3BUXB 1GQMA 3WNXB 4ETOA 3VRPA 2M3WA 4WRIA 3D73A 5HLOA 2M0RA 2M8UA 2WC8A 2WNDA 3TS5C 2I7AA 3SIAA 2LVIA 1MHOA 2KI6C 2NZ0A 3RZSA 1CFFA 5HKZA 2GGZA 1F4OA 4HRGA 4AQIA 4YI8A 2L2CA 1YVHA 1LA0A 1SCVA 1TNWA 4TNCA 1DGVA 5D69A 2BBMA 4CLNA 1TCOB 3LK0A 2L98A 1F71A 1B4CA 5ER4X 2L51A 2KBMA 1HQVA 4OCIA 1UHHA 4I5NB 4NDCA 2BKHB 4N1GA 1A2XA 1KFXL 1UURA 4C0LA 2GV5A 3GK4X 1WRLA 3BOWB 3CS1A 1W7IB 1NWDA 4MLWA 1S5GY 1DJHA 1N2DA 1ZOTB 3O4XA 3I5HC 3EVVA 3WXAA 3BUNB 2LANA 1A03A 2F2PA 2GGMA 4PE1A 4FTGA 1EG4A 1IG5A 1XA5A 2M29A 4MSPA 4YGBB 3QRXA 1JSAA 4IL1A 2L5YA 1CFCA 2ZN8A 3OX6A 2Q91A 2MRDA 2AUCA 2NCPA 1QXPA 3CR5X 2L0PA 2E30A 4BY4A 4F7FA 4AQJA 4OZDA 1B47A 2LVVA 3VRNA 3V2LA 3I5IB 4ICBA 3SG7A 3NSKA 2BKIB 2QEVA 3R1OA 1OSAA 3BUOB 3LLEA 3SS3A 1A4PA 2LC5A 3ZWHA 1TUJA 4YGEB 4P5OE 4MRXA 2KLDA 4QJ4B 2VRGA 1LVCD 3GK1A 2HF5A 3OP0A 3D78A 3SS5A 3CDNA 3TDZA 2MLEC 2L4IA 1OOFA 1SY9A 2WCFA 1JC2A 1F54A 3O6BA 2JRFA 2FCEA 2FCDA 2F8PA 1WRZA 4ZCVA 1K95A 3BOWA 5I94A 1IWQA 3CZ1A 4MBEA 1U5IB 1IJ5A 1C3YA 1QASA 3TUYB 2L2EA 3A8RA 5HKWA 1QV1A 1LA3A 1CDPA 1R2UA 1XK4A 2Y5IA 4MEWA 2JXLA 5HYDA 2LMUA 3B86A 3VB1A 1CNPA 4PHJA 2G9BA 2PQLA 2KDHA 2M1UA 1CMFA 3DVJA 4JWQA 1CTRA 3DF0A 4INXA 1L7ZA 3Q8IA 3CLNA 3JVTB 1RWYA 3EK7A 1OMVA 3D0YB 1A75B 1Y1UA 3S0FA 1MXLC 1F55A 1QIVA 1ZMZA 3OGNA 4M2QA 1BJFA 1NPQA 2FJYA 1MF8B 1K90D 2K0JA 2NLNA 1NX1A 2YGUA 3B6XA 1ORGA 1PULA 1TWOA 2A4JA 2EC6B 4M2OA 1E8AA 1FI5A 1RK9A 1BU3A 2JOJA 1YX8A 2KFGA 5CSJA 3VRQA 1C7VA 4BY5A 3D77A 1L2OB 1YRTB 2JNXA 3QMEA 2KGBC 3JTDB 1QWVA 2WCLA 1KQMB 4OVNF 3BUMB 2LE9B 5DKQA 1PVAA 1IIOA 3WHTB 1DJXA 1X02A 1QX5B 1WY9A 1DQEA 2K7CA 1PSRA 1PSBA 2MHHA 1MWNA 2SASA 1NX3A 4MZKA 3VGOA 1CLLA 1HT9A 3B87A 5F6TA 1OOHA 1QLKA 1SK6D 4GUKA 1T14A 2QDIA 1SPYA 2L5XB 1ODBA 1Y6WA 4A4CA 3I5GB 1QTXA 5K89A 1KWOB 2R2IA 1F8HA 1DVIA 2CXJA 4GBAA 1J7RA 4OR9B 1GGWA 4KYNA 3R72A 4OKHA 1KCYA 3HCMA 2KQ6A 3CZTX 3AAKA 3PLFB 4I5KA 2NXQA 1TCFA 2JQ6A 3D10A 1KFUS 3BFBA 1NSHA 1IQ3A 3F45A 4GPLB 1LINA 3BXKA 4IJ7A 1FBVA 1K94A 4I5LB 1AHRA 2QACA 3EK4A 3FIAA 1J1DA 3PSRA 2JTTA 1G33A 2LHLA 1BLQA 1SMGA 2LM5A 2CT9A 3LL8B 2ZRTA 1PK0D 4NDDA 1YUTA 1XK4C 3D76A 4CFRA 3EG5B 3C1VA 1G4YR 4PCWA 2DOQA 1NX2A 1SKTA 2Y1NA 3CYZA 1BR4B 5JJGA 1TOPA 1YURA 1IRJA 5AFPA 1BF5A 1QV0A 2KFHA 1H8BA 1K93D 2FJUB 1J7PA 2QEOA 1UHNA 1C07A 1SRAA 2CBLA 2KNEA 1DGUA 1DF0A 4XJKB 3AKBA 1XVJA 2KAXA 5KU1A 2LMVA 4DIRA 4F0ZB 4QJ3B 2WORA 2MLFC 3KF9A 1DJYA 1NUBA 1SL7A 3D74A 3I5IC 4HSZA 2BL0B 2LP3A 4INWA 3SJSA 4I5JA 5G08A 1M45A 2K60A 2OTGB 3KO0A 4GGNA 5AANA 1YR5A 4PHKA 1J1EA 1UP5A 4PHMA 1KQVA 3PM2A 1IKUA 1SYMA 5DKNA 1JBAA 2JTZA 5CSFA 1OZOA 3FWBA 4ORAB 5AERA 1SCMB 1J7QA 1FI6A 2M97A 1J55A 5HL1A 1YUSA 2BCAA 2BCBA 4XYNA 3SG4A 1YVLA 3SG5A 5KSZA 2KI6D 2PRUA 5GQQC 1B9AA 1DELA 1YUUA 5J3XA 4DUQA 3TUYC 1NX0A 4GNKB 3O4YA 3OX5A 2HETA 5BPJA 3R1VA 2ZN9A 4P2YB 1V1GA 1S26D 1S6IA 1RJVA 2OS8B 2AAOA 2GTEA 2Y1MA 3BJHA 5B8IB 4YI9A 3JVTC 2PASA 3OB1B 1SNLA 4DCKA 3H4SE 1W7JB 1EH2A 4MVFA 2BAPA 1QLSA 3EVRA 4XJKA 3EKJA 1QVIZ 3CZ0A 5JOLA 3EVUA 3S0BA 1SSEB 2BE6A 2EC6C 2L50A 3IQQA 1AUIB 1ZFSA 3DY9A 1J7OA 1V1FA 1L2OC 4AOMA 1IJ6A 1TNPA 2LLUA 4GGFA 4OV2A 3JTDC 3UNWA 5I8NA 2PMYA 1KQMC 1GM0A 1WLMA 1NCYA 2JT3A 2EHBA 3FE9A 5TNCA 2COLB 3PJIA 3FE8A 1EXRA 2ZKMX 1FPWA 2P6BB 2JT8A 1TRFA 1K9KA 5D3OA 1CDLA 1BOCA 1SBJA 3HX4A 1XO5A 4YBHB 1AVSA 2BCXA 4CPVA 1XFXO 2M1KB 3I5GC 5DKRA 1KWOC 4QJ5B 4MRYA 1QVIY 3NHTA 1TN4A 1YTZC 1MQ1A 2RGIA 2QEBA 1OE9B 3E3RA 3FS7A 2ISDA 2KI4B 4JQ0D 2F3ZA 1B8RA 2JU0A 2KOTA 3DVKA 1VRKA 3NXAA 2LVJA 3CABA 3DZTA 3EK8A 1OOGA 4NQGA 1K2HA 1BR1B 1Y1XA 3TDUA 2JC2A 1TUZA 3B7AA 3TZ1A 2MJWB 1DT7B 1C3ZA 2PVBA 2LMTA 4USLA 1M63B 1SW8A 1U5IA 4C0KA 1NCZA 1OOJA 1OW4A 2JPOA 2O60A 3L47A 1XFWO 1K8UA 3CR2A 1S3PA 2BBNA 3KEVA 1JF2A 1Y1AA 3DD4A 4YGDB 2LAPA 1CM1A 2WCMA 1JWDA 4HREE 2WCBA 2IS9A 1NP8A 3BUWB 1QATA 4PDZA 5EL2A 2JNFA 1LKJA 1JUOA 4ORCB 1SL9A 2ZRSA 2LV7A 2JPTA 1ALVA 3D0YA 1A75A 1AJ5A 1UHIA 2JULA 1ALWA 1ZACA 5I2QA 3RLZA 5FI2A 1KK8B 2B1UA 2LLTA 2LUCA 1DJWA 2LVKA 2BL0C 2WCEA 1BT6A 1CFDA 1NYAA 3I5FB 5AXIA 3SIBA 2OPOA 4PE4A 3VROA 2OTGC 4N5XA 4GGFC 2K7BA 3AAJA 3IQOA 2MBXA 1KFUL 1BMOA 2WCHA 1G8IA 5I2LA 1CKKA 3EKHA 3WHUB 1CM4A 1QS7A 2ERBA 1NIWA 2HQWA 2JWWA 2O5GA 3GOFA 1FF1A 1M39A 2KGRA 1SCMC 1DJIA 4R1EA 2D8NA 3FWCA 1BG1A 2M7NA 4JPZB 3CGAA 2FOTA 1B7TZ 3B88A 5PALA 5IBWA 2HQ8A 1RECA 3L4LA 4C0JA 4MN0A 1NCXA 1KFXS 3CTNA 1XFUO 2BE4A 4N1FA 1JF0A 2OS8C 3IF7A 2F33A 2LUXA 1B8LA 3KPXA 3K21A 3PN7B 2K61A 5KTYA 1WDCB 4NDBA 4L9MA 2P70A 1Z2CB 1XFZO 2K7OA 1SR6B 1TTXA 1AP4A 1GGZA 1Z4HA 2H61C 1UWOA 4PT1A 2WOSA 2QEHA 2LP2A 5CPVA 1F70A 4GAOA 2JZIA 3CWGA 3FE6A 3ZNIA 1B1GA 1XFYO 2K8MB 2LCPA 2WCKA 2KHNA 4FQOA 3NSLA 1B7TY 3ICBA 1UHKA 3TS5B 2ZFDA 3AKAA 1K9PA 2E6WA 1K96A 2SCPA 4PHNA 2CNPA 2PSRA 1AJ4A 3CR4X 2LNKA 3NHIA 4JD9A 4YGCB 2M7LA 1MXEA 4WQ2A 1CLBA 5HKYA 4JKTA 1DJGA 2M9GA 2K2AA 1QX7A 1UUSA 3L4AA 1Y0VH 3NGVA 4HRHA 3N7HA 1OMDA 1RFJA 1AK8A 2KBIA 1TNXA 1QX2A 3DF0B 2Q4UA 3KHEA 3DXLA 2EGDA 1TNQA 5I2OA 2KSPA
chains in the Genus database with same CATH topology
1M31A 3BQ3A 3PALA 3O2PA 1K9UA 2MAZA 3GK2A 1S6CA 1OZSA 4YRUA 1BODA 3NSIA 3TDIA 2MA2A 2KAYA 1YX7A 1RROA 2K7DA 5ER5A 4ZCUA 1TIZA 1QJTA 2KI4C 4A4BA 1QIWA 2JXCA 3VRRA 5CSIA 5CSNA 1WRKA 3I5HB 1JFKA 4U8DA 4M2PA 2H2KA 2ZNEA 4CFQA 4PALA 1CDMA 1D1OA 1R6PA 1S1EA 2KQYA 4D1EA 1DTLA 2CCMA 2F2OA 3OB2B 5D7FA 3A4UB 1WLZA 2PALA 2Y4QA 4DRWA 4DS7A 1IH0A 2NCOA 1UHJA 2K2FA 3O78A 4Q04A 1KK7Z 3NSOA 1KSMA 2KFFA 1EG3A 2JT0A 1N65A 1SL8A 1M46A 3BYAA 2I18A 2BECA 2H61A 2I94A 1N0YA 1KK8C 1OQPA 4PE0A 4CIDA 3I5FC 2LHIA 1CFPA 1IGVA 4GFTA 2AMIA 1LXFC 2KAVA 1H4BA 3LCPC 2CTNA 1ZUZA 1EL4A 3SG2A 1CLMA 1FW4A 2ZNDA 3M0WA 3SG6A 1Q80A 1F4QA 1OMRA 4WQ3A 1MR8A 3RM1A 3DVMA 1CMGA 3PM8A 4ORBB 1EJ3A 1MUXA 4MZLA 3SG3A 1A29A 1GJYA 1KK7Y 1CDNA 2M49B 1DF0B 1RTP1 1XFVO 2KYFA 5FYXA 4MZJA 1B8CA 1IQ5A 2L4HA 1XYDA 1JFJA 4E68A 2G2BA 2I2RE 3OHMB 3PATA 2HPSA 1S36A 3MSEB 3PN7C 3LK1A 1CB1A 1WDCC 2KYCA 5AEQA 3PFVA 5HLVA 4UPGA 1KSOA 1PRWA 1YRUB 1S6JA 1SR6C 4YGAA 2QPTA 2TN4A 2V53A 1DJZA 1PVBA 1PALA 4PE7A 1C7WA 2F3YA 1DMOA 2LLSA 3DVEA 1S5GZ 3BUXB 1GQMA 3WNXB 4ETOA 3VRPA 2M3WA 4WRIA 5HLOA 2M0RA 2M8UA 2WC8A 2WNDA 3TS5C 2I7AA 3SIAA 2LVIA 1MHOA 2KI6C 2NZ0A 1CFFA 5HKZA 2GGZA 1F4OA 4HRGA 4AQIA 4YI8A 1YVHA 1LA0A 1SCVA 1TNWA 4TNCA 1DGVA 5D69A 2BBMA 4CLNA 1TCOB 3LK0A 2L98A 1F71A 1B4CA 5ER4X 2L51A 2KBMA 1HQVA 4OCIA 1UHHA 4I5NB 4NDCA 2BKHB 4N1GA 1A2XA 1KFXL 1UURA 4C0LA 2GV5A 3GK4X 1WRLA 3BOWB 3CS1A 1W7IB 1NWDA 4MLWA 1S5GY 1DJHA 1N2DA 1ZOTB 3I5HC 3EVVA 3WXAA 3BUNB 2LANA 1A03A 2F2PA 2GGMA 4PE1A 4FTGA 1EG4A 1IG5A 1XA5A 2M29A 4MSPA 4YGBB 3QRXA 1JSAA 4IL1A 1CFCA 2ZN8A 3OX6A 2Q91A 2MRDA 2AUCA 2NCPA 1QXPA 2L0PA 2E30A 4BY4A 4AQJA 1B47A 2LVVA 3VRNA 3I5IB 4ICBA 3SG7A 3NSKA 2BKIB 1OSAA 3BUOB 3LLEA 1A4PA 2LC5A 3ZWHA 4YGEB 4P5OE 4MRXA 4QJ4B 2VRGA 1LVCD 3GK1A 2HF5A 3OP0A 3TDZA 2MLEC 2L4IA 1SY9A 2WCFA 1JC2A 1F54A 3O6BA 2JRFA 2FCEA 2FCDA 2F8PA 1WRZA 4ZCVA 1K95A 3BOWA 1IWQA 4MBEA 1U5IB 1IJ5A 1QASA 3TUYB 2L2EA 3A8RA 5HKWA 1QV1A 1LA3A 1CDPA 1R2UA 1XK4A 2Y5IA 4MEWA 2JXLA 5HYDA 2LMUA 1CNPA 4PHJA 2G9BA 2KDHA 2M1UA 1CMFA 3DVJA 4JWQA 1CTRA 3DF0A 1L7ZA 3CLNA 3JVTB 1RWYA 3EK7A 1OMVA 3D0YB 1A75B 1Y1UA 1MXLC 1F55A 1QIVA 1ZMZA 4M2QA 1BJFA 1NPQA 2K0JA 1MF8B 1K90D 2NLNA 3CR5X 1NX1A 1PULA 2A4JA 1FI5A 2EC6B 4M2OA 1E8AA 1RK9A 1BU3A 2JOJA 1YX8A 2KFGA 5CSJA 3VRQA 1C7VA 4BY5A 1L2OB 1YRTB 2JNXA 2KGBC 3JTDB 1KQMB 4OVNF 3BUMB 2LE9B 5DKQA 1PVAA 3WHTB 1DJXA 1X02A 1QX5B 1WY9A 2K7CA 4I5KA 1PSRA 1PSBA 2MHHA 1MWNA 2SASA 1NX3A 4MZKA 3VGOA 1CLLA 1HT9A 5F6TA 1QLKA 1SK6D 4GUKA 1SPYA 2L5XB 1ODBA 1Y6WA 4A4CA 3I5GB 1QTXA 5K89A 1KWOB 2R2IA 1F8HA 1DVIA 2CXJA 4GBAA 1J7RA 4OR9B 1GGWA 4OKHA 1KCYA 3HCMA 2KQ6A 3CZTX 3AAKA 3PLFB 2NXQA 1TCFA 2JQ6A 3D10A 1KFUS 1IQ3A 1NSHA 3F45A 4GPLB 1LINA 3BXKA 1FBVA 1K94A 4I5LB 1AHRA 2QACA 3EK4A 3FIAA 1J1DA 3PSRA 2JTTA 1G33A 2LHLA 1BLQA 1SMGA 2LM5A 2CT9A 3LL8B 2ZRTA 1PK0D 4NDDA 1YUTA 1XK4C 4CFRA 3C1VA 1G4YR 4PCWA 2DOQA 1NX2A 1SKTA 2Y1NA 1BR4B 5JJGA 1TOPA 1YURA 1IRJA 5AFPA 1BF5A 1QV0A 2KFHA 1H8BA 1K93D 2FJUB 1J7PA 1UHNA 1C07A 1SRAA 2CBLA 2KNEA 1DGUA 1DF0A 4XJKB 3AKBA 1XVJA 2KAXA 5KU1A 2LMVA 4DIRA 4F0ZB 2WORA 2MLFC 3KF9A 1DJYA 1NUBA 1SL7A 3I5IC 4HSZA 2BL0B 2LP3A 3SJSA 4I5JA 5G08A 1M45A 2OTGB 3KO0A 4GGNA 5AANA 1YR5A 4PHKA 1J1EA 1UP5A 4PHMA 1KQVA 1IKUA 1SYMA 5DKNA 1JBAA 2JTZA 5CSFA 1OZOA 3FWBA 4ORAB 5AERA 1SCMB 1J7QA 2M97A 1J55A 1YUSA 2BCAA 2BCBA 4XYNA 3SG4A 1YVLA 3SG5A 5KSZA 2KI6D 2PRUA 5GQQC 1B9AA 1YUUA 5J3XA 4DUQA 3TUYC 1NX0A 4GNKB 3O4YA 3OX5A 2HETA 5BPJA 2ZN9A 4P2YB 1V1GA 1S26D 1S6IA 1RJVA 2OS8B 2AAOA 2Y1MA 5B8IB 4YI9A 3JVTC 2PASA 3OB1B 1SNLA 4DCKA 3H4SE 1W7JB 1EH2A 4MVFA 1QLSA 3EVRA 4XJKA 3EKJA 1QVIZ 5JOLA 3EVUA 2BE6A 2EC6C 2L50A 3IQQA 1AUIB 1ZFSA 1J7OA 1V1FA 1L2OC 4AOMA 1IJ6A 1TNPA 2LLUA 4GGFA 4OV2A 3JTDC 5I8NA 2PMYA 1KQMC 1WLMA 1NCYA 2JT3A 2EHBA 5TNCA 2COLB 1EXRA 2ZKMX 1FPWA 2P6BB 2JT8A 1TRFA 1K9KA 1CDLA 1BOCA 1SBJA 3HX4A 1XO5A 4YBHB 1AVSA 2BCXA 4CPVA 1XFXO 2M1KB 3I5GC 5DKRA 1KWOC 4QJ5B 4MRYA 1QVIY 1TN4A 1YTZC 1MQ1A 2RGIA 1OE9B 3E3RA 3FS7A 2ISDA 2KI4B 4JQ0D 2F3ZA 1B8RA 2JU0A 2KOTA 3DVKA 1VRKA 3NXAA 2LVJA 3EK8A 4NQGA 1K2HA 1BR1B 1Y1XA 3TDUA 2JC2A 3TZ1A 2MJWB 1DT7B 2PVBA 2LMTA 4USLA 1M63B 1SW8A 1U5IA 4C0KA 1NCZA 1OOJA 2O60A 1XFWO 1K8UA 3CR2A 1S3PA 2BBNA 3KEVA 1JF2A 1Y1AA 3DD4A 4YGDB 2LAPA 1CM1A 1JWDA 4HREE 2WCBA 2IS9A 1NP8A 3BUWB 1QATA 4PDZA 2JNFA 1LKJA 1JUOA 4ORCB 1SL9A 2ZRSA 2LV7A 2JPTA 1ALVA 3D0YA 1A75A 1AJ5A 1UHIA 2JULA 1ALWA 1ZACA 5I2QA 3RLZA 1KK8B 2B1UA 2LLTA 2LUCA 1DJWA 2LVKA 2BL0C 2WCEA 1BT6A 1CFDA 1NYAA 3I5FB 5AXIA 3SIBA 2OPOA 4PE4A 3VROA 2OTGC 4N5XA 4GGFC 2K7BA 3AAJA 3IQOA 2MBXA 1KFUL 1BMOA 1G8IA 5I2LA 1CKKA 3EKHA 3WHUB 1CM4A 1QS7A 2HQWA 1NIWA 2JWWA 2O5GA 3GOFA 1FF1A 1FI6A 1M39A 2KGRA 1SCMC 1DJIA 4R1EA 2D8NA 3FWCA 1BG1A 2M7NA 4JPZB 3CGAA 2FOTA 1B7TZ 5PALA 5IBWA 2HQ8A 1RECA 4C0JA 4MN0A 1NCXA 1KFXS 3CTNA 1XFUO 2BE4A 4N1FA 1JF0A 2OS8C 3IF7A 2F33A 2LUXA 1B8LA 3KPXA 3K21A 3PN7B 2K61A 5KTYA 1WDCB 4NDBA 4L9MA 1XFZO 2K7OA 1SR6B 1TTXA 1AP4A 1GGZA 2H61C 1UWOA 2WOSA 5CPVA 2LP2A 1F70A 4GAOA 2JZIA 3CWGA 3ZNIA 1B1GA 1XFYO 2K8MB 2LCPA 4FQOA 2KHNA 3NSLA 1B7TY 3ICBA 1UHKA 3TS5B 2ZFDA 3AKAA 1K9PA 2E6WA 1K96A 2SCPA 4PHNA 2CNPA 2PSRA 1AJ4A 3CR4X 2LNKA 4YGCB 2M7LA 1MXEA 4WQ2A 1CLBA 5HKYA 1DJGA 2M9GA 2K2AA 1QX7A 1UUSA 4QJ3B 1Y0VH 4HRHA 1OMDA 1RFJA 1AK8A 2KBIA 1TNXA 1QX2A 3DF0B 2Q4UA 3KHEA 2EGDA 1TNQA 5I2OA 2KSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M31 A;  3BQ3 A;  3PAL A;  3O2P A;  1K9U A;  2MAZ A;  3GK2 A;  1S6C A;  1OZS A;  4YRU A;  1BOD A;  3NSI A;  3TDI A;  2MA2 A;  2KAY A;  1YX7 A;  1RRO A;  2K7D A;  5ER5 A;  4ZCU A;  1TIZ A;  1QJT A;  2KI4 C;  4A4B A;  1QIW A;  2JXC A;  3VRR A;  5CSI A;  5CSN A;  1WRK A;  3I5H B;  1JFK A;  4U8D A;  4M2P A;  2H2K A;  2ZNE A;  4CFQ A;  4PAL A;  1CDM A;  1D1O A;  1R6P A;  1S1E A;  2KQY A;  4D1E A;  1DTL A;  2CCM A;  2F2O A;  3OB2 B;  5D7F A;  3A4U B;  1WLZ A;  2PAL A;  2Y4Q A;  4DRW A;  4DS7 A;  1IH0 A;  2NCO A;  1UHJ A;  2K2F A;  3O78 A;  4Q04 A;  1KK7 Z;  3NSO A;  1KSM A;  2KFF A;  1EG3 A;  2JT0 A;  1N65 A;  1SL8 A;  1M46 A;  3BYA A;  2I18 A;  2BEC A;  2H61 A;  2I94 A;  1N0Y A;  1KK8 C;  1OQP A;  4PE0 A;  4CID A;  3I5F C;  2LHI A;  1CFP A;  1IGV A;  4GFT A;  2AMI A;  1LXF C;  2KAV A;  1H4B A;  3LCP C;  2CTN A;  1ZUZ A;  1EL4 A;  3SG2 A;  1CLM A;  1FW4 A;  2ZND A;  3M0W A;  3SG6 A;  1Q80 A;  1F4Q A;  1OMR A;  4WQ3 A;  1MR8 A;  3RM1 A;  3DVM A;  1CMG A;  3PM8 A;  4ORB B;  1EJ3 A;  1MUX A;  4MZL A;  3SG3 A;  1A29 A;  1GJY A;  1KK7 Y;  1CDN A;  2M49 B;  1DF0 B;  1RTP 1;  1XFV O;  2KYF A;  5FYX A;  4MZJ A;  1B8C A;  1IQ5 A;  2L4H A;  1XYD A;  1JFJ A;  4E68 A;  2G2B A;  2I2R E;  3OHM B;  3PAT A;  2HPS A;  1S36 A;  3MSE B;  3PN7 C;  3LK1 A;  1CB1 A;  1WDC C;  2KYC A;  5AEQ A;  3PFV A;  5HLV A;  4UPG A;  1KSO A;  1PRW A;  1YRU B;  1S6J A;  1SR6 C;  4YGA A;  2QPT A;  2TN4 A;  2V53 A;  1DJZ A;  1PVB A;  1PAL A;  4PE7 A;  1C7W A;  2F3Y A;  1DMO A;  2LLS A;  3DVE A;  1S5G Z;  3BUX B;  1GQM A;  3WNX B;  4ETO A;  3VRP A;  2M3W A;  4WRI A;  5HLO A;  2M0R A;  2M8U A;  2WC8 A;  2WND A;  3TS5 C;  2I7A A;  3SIA A;  2LVI A;  1MHO A;  2KI6 C;  2NZ0 A;  1CFF A;  5HKZ A;  2GGZ A;  1F4O A;  4HRG A;  4AQI A;  4YI8 A;  1YVH A;  1LA0 A;  1SCV A;  1TNW A;  4TNC A;  1DGV A;  5D69 A;  2BBM A;  4CLN A;  1TCO B;  3LK0 A;  2L98 A;  1F71 A;  1B4C A;  5ER4 X;  2L51 A;  2KBM A;  1HQV A;  4OCI A;  1UHH A;  4I5N B;  4NDC A;  2BKH B;  4N1G A;  1A2X A;  1KFX L;  1UUR A;  4C0L A;  2GV5 A;  3GK4 X;  1WRL A;  3BOW B;  3CS1 A;  1W7I B;  1NWD A;  4MLW A;  1S5G Y;  1DJH A;  1N2D A;  1ZOT B;  3I5H C;  3EVV A;  3WXA A;  3BUN B;  2LAN A;  1A03 A;  2F2P A;  2GGM A;  4PE1 A;  4FTG A;  1EG4 A;  1IG5 A;  1XA5 A;  2M29 A;  4MSP A;  4YGB B;  3QRX A;  1JSA A;  4IL1 A;  1CFC A;  2ZN8 A;  3OX6 A;  2Q91 A;  2MRD A;  2AUC A;  2NCP A;  1QXP A;  2L0P A;  2E30 A;  4BY4 A;  4AQJ A;  1B47 A;  2LVV A;  3VRN A;  3I5I B;  4ICB A;  3SG7 A;  3NSK A;  2BKI B;  1OSA A;  3BUO B;  3LLE A;  1A4P A;  2LC5 A;  3ZWH A;  4YGE B;  4P5O E;  4MRX A;  4QJ4 B;  2VRG A;  1LVC D;  3GK1 A;  2HF5 A;  3OP0 A;  3TDZ A;  2MLE C;  2L4I A;  1SY9 A;  2WCF A;  1JC2 A;  1F54 A;  3O6B A;  2JRF A;  2FCE A;  2FCD A;  2F8P A;  1WRZ A;  4ZCV A;  1K95 A;  3BOW A;  1IWQ A;  4MBE A;  1U5I B;  1IJ5 A;  1QAS A;  3TUY B;  2L2E A;  3A8R A;  5HKW A;  1QV1 A;  1LA3 A;  1CDP A;  1R2U A;  1XK4 A;  2Y5I A;  4MEW A;  2JXL A;  5HYD A;  2LMU A;  1CNP A;  4PHJ A;  2G9B A;  2KDH A;  2M1U A;  1CMF A;  3DVJ A;  4JWQ A;  1CTR A;  3DF0 A;  1L7Z A;  3CLN A;  3JVT B;  1RWY A;  3EK7 A;  1OMV A;  3D0Y B;  1A75 B;  1Y1U A;  1MXL C;  1F55 A;  1QIV A;  1ZMZ A;  4M2Q A;  1BJF A;  1NPQ A;  2K0J A;  1MF8 B;  1K90 D;  2NLN A;  3CR5 X;  1NX1 A;  1PUL A;  2A4J A;  1FI5 A;  2EC6 B;  4M2O A;  1E8A A;  1RK9 A;  1BU3 A;  2JOJ A;  1YX8 A;  2KFG A;  5CSJ A;  3VRQ A;  1C7V A;  4BY5 A;  1L2O B;  1YRT B;  2JNX A;  2KGB C;  3JTD B;  1KQM B;  4OVN F;  3BUM B;  2LE9 B;  5DKQ A;  1PVA A;  3WHT B;  1DJX A;  1X02 A;  1QX5 B;  1WY9 A;  2K7C A;  4I5K A;  1PSR A;  1PSB A;  2MHH A;  1MWN A;  2SAS A;  1NX3 A;  4MZK A;  3VGO A;  1CLL A;  1HT9 A;  5F6T A;  1QLK A;  1SK6 D;  4GUK A;  1SPY A;  2L5X B;  1ODB A;  1Y6W A;  4A4C A;  3I5G B;  1QTX A;  5K89 A;  1KWO B;  2R2I A;  1F8H A;  1DVI A;  2CXJ A;  4GBA A;  1J7R A;  4OR9 B;  1GGW A;  4OKH A;  1KCY A;  3HCM A;  2KQ6 A;  3CZT X;  3AAK A;  3PLF B;  2NXQ A;  1TCF A;  2JQ6 A;  3D10 A;  1KFU S;  1IQ3 A;  1NSH A;  3F45 A;  4GPL B;  1LIN A;  3BXK A;  1FBV A;  1K94 A;  4I5L B;  1AHR A;  2QAC A;  3EK4 A;  3FIA A;  1J1D A;  3PSR A;  2JTT A;  1G33 A;  2LHL A;  1BLQ A;  1SMG A;  2LM5 A;  2CT9 A;  3LL8 B;  2ZRT A;  1PK0 D;  4NDD A;  1YUT A;  1XK4 C;  4CFR A;  3C1V A;  1G4Y R;  4PCW A;  2DOQ A;  1NX2 A;  1SKT A;  2Y1N A;  1BR4 B;  5JJG A;  1TOP A;  1YUR A;  1IRJ A;  5AFP A;  1BF5 A;  1QV0 A;  2KFH A;  1H8B A;  1K93 D;  2FJU B;  1J7P A;  1UHN A;  1C07 A;  1SRA A;  2CBL A;  2KNE A;  1DGU A;  1DF0 A;  4XJK B;  3AKB A;  1XVJ A;  2KAX A;  5KU1 A;  2LMV A;  4DIR A;  4F0Z B;  2WOR A;  2MLF C;  3KF9 A;  1DJY A;  1NUB A;  1SL7 A;  3I5I C;  4HSZ A;  2BL0 B;  2LP3 A;  3SJS A;  4I5J A;  5G08 A;  1M45 A;  2OTG B;  3KO0 A;  4GGN A;  5AAN A;  1YR5 A;  4PHK A;  1J1E A;  1UP5 A;  4PHM A;  1KQV A;  1IKU A;  1SYM A;  5DKN A;  1JBA A;  2JTZ A;  5CSF A;  1OZO A;  3FWB A;  4ORA B;  5AER A;  1SCM B;  1J7Q A;  2M97 A;  1J55 A;  1YUS A;  2BCA A;  2BCB A;  4XYN A;  3SG4 A;  1YVL A;  3SG5 A;  5KSZ A;  2KI6 D;  2PRU A;  5GQQ C;  1B9A A;  1YUU A;  5J3X A;  4DUQ A;  3TUY C;  1NX0 A;  4GNK B;  3O4Y A;  3OX5 A;  2HET A;  5BPJ A;  2ZN9 A;  4P2Y B;  1V1G A;  1S26 D;  1S6I A;  1RJV A;  2OS8 B;  2AAO A;  2Y1M A;  5B8I B;  4YI9 A;  3JVT C;  2PAS A;  3OB1 B;  1SNL A;  4DCK A;  3H4S E;  1W7J B;  1EH2 A;  4MVF A;  1QLS A;  3EVR A;  4XJK A;  3EKJ A;  1QVI Z;  5JOL A;  3EVU A;  2BE6 A;  2EC6 C;  2L50 A;  3IQQ A;  1AUI B;  1ZFS A;  1J7O A;  1V1F A;  1L2O C;  4AOM A;  1IJ6 A;  1TNP A;  2LLU A;  4GGF A;  4OV2 A;  3JTD C;  5I8N A;  2PMY A;  1KQM C;  1WLM A;  1NCY A;  2JT3 A;  2EHB A;  5TNC A;  2COL B;  1EXR A;  2ZKM X;  1FPW A;  2P6B B;  2JT8 A;  1TRF A;  1K9K A;  1CDL A;  1BOC A;  1SBJ A;  3HX4 A;  1XO5 A;  4YBH B;  1AVS A;  2BCX A;  4CPV A;  1XFX O;  2M1K B;  3I5G C;  5DKR A;  1KWO C;  4QJ5 B;  4MRY A;  1QVI Y;  1TN4 A;  1YTZ C;  1MQ1 A;  2RGI A;  1OE9 B;  3E3R A;  3FS7 A;  2ISD A;  2KI4 B;  4JQ0 D;  2F3Z A;  1B8R A;  2JU0 A;  2KOT A;  3DVK A;  1VRK A;  3NXA A;  2LVJ A;  3EK8 A;  4NQG A;  1K2H A;  1BR1 B;  1Y1X A;  3TDU A;  2JC2 A;  3TZ1 A;  2MJW B;  1DT7 B;  2PVB A;  2LMT A;  4USL A;  1M63 B;  1SW8 A;  1U5I A;  4C0K A;  1NCZ A;  1OOJ A;  2O60 A;  1XFW O;  1K8U A;  3CR2 A;  1S3P A;  2BBN A;  3KEV A;  1JF2 A;  1Y1A A;  3DD4 A;  4YGD B;  2LAP A;  1CM1 A;  1JWD A;  4HRE E;  2WCB A;  2IS9 A;  1NP8 A;  3BUW B;  1QAT A;  4PDZ A;  2JNF A;  1LKJ A;  1JUO A;  4ORC B;  1SL9 A;  2ZRS A;  2LV7 A;  2JPT A;  1ALV A;  3D0Y A;  1A75 A;  1AJ5 A;  1UHI A;  2JUL A;  1ALW A;  1ZAC A;  5I2Q A;  3RLZ A;  1KK8 B;  2B1U A;  2LLT A;  2LUC A;  1DJW A;  2LVK A;  2BL0 C;  2WCE A;  1BT6 A;  1CFD A;  1NYA A;  3I5F B;  5AXI A;  3SIB A;  2OPO A;  4PE4 A;  3VRO A;  2OTG C;  4N5X A;  4GGF C;  2K7B A;  3AAJ A;  3IQO A;  2MBX A;  1KFU L;  1BMO A;  1G8I A;  5I2L A;  1CKK A;  3EKH A;  3WHU B;  1CM4 A;  1QS7 A;  2HQW A;  1NIW A;  2JWW A;  2O5G A;  3GOF A;  1FF1 A;  1FI6 A;  1M39 A;  2KGR A;  1SCM C;  1DJI A;  4R1E A;  2D8N A;  3FWC A;  1BG1 A;  2M7N A;  4JPZ B;  3CGA A;  2FOT A;  1B7T Z;  5PAL A;  5IBW A;  2HQ8 A;  1REC A;  4C0J A;  4MN0 A;  1NCX A;  1KFX S;  3CTN A;  1XFU O;  2BE4 A;  4N1F A;  1JF0 A;  2OS8 C;  3IF7 A;  2F33 A;  2LUX A;  1B8L A;  3KPX A;  3K21 A;  3PN7 B;  2K61 A;  5KTY A;  1WDC B;  4NDB A;  4L9M A;  1XFZ O;  2K7O A;  1SR6 B;  1TTX A;  1AP4 A;  1GGZ A;  2H61 C;  1UWO A;  2WOS A;  5CPV A;  2LP2 A;  1F70 A;  4GAO A;  2JZI A;  3CWG A;  3ZNI A;  1B1G A;  1XFY O;  2K8M B;  2LCP A;  4FQO A;  2KHN A;  3NSL A;  1B7T Y;  3ICB A;  1UHK A;  3TS5 B;  2ZFD A;  3AKA A;  1K9P A;  2E6W A;  1K96 A;  2SCP A;  4PHN A;  2CNP A;  2PSR A;  1AJ4 A;  3CR4 X;  2LNK A;  4YGC B;  2M7L A;  1MXE A;  4WQ2 A;  1CLB A;  5HKY A;  1DJG A;  2M9G A;  2K2A A;  1QX7 A;  1UUS A;  4QJ3 B;  1Y0V H;  4HRH A;  1OMD A;  1RFJ A;  1AK8 A;  2KBI A;  1TNX A;  1QX2 A;  3DF0 B;  2Q4U A;  3KHE A;  2EGD A;  1TNQ A;  5I2O A;  2KSP A; 
#chains in the Genus database with same CATH topology
 1M31 A;  3BQ3 A;  3PAL A;  3O2P A;  1K9U A;  2WC6 A;  2MAZ A;  3GK2 A;  1S6C A;  1OZS A;  4YRU A;  1BOD A;  3NSI A;  3TDI A;  2MA2 A;  2KAY A;  1YX7 A;  1RRO A;  2K7D A;  5ER5 A;  1P28 A;  4ZCU A;  1TIZ A;  1QJT A;  2KI4 C;  4A4B A;  1QIW A;  2JXC A;  3VRR A;  5CSI A;  5CSN A;  1WRK A;  3I5H B;  1JFK A;  2KLE A;  4U8D A;  2P71 A;  5DIC A;  4M2P A;  2H2K A;  2ZNE A;  4CFQ A;  4PAL A;  3IVT A;  1CDM A;  1D1O A;  1R6P A;  1S1E A;  2KQY A;  4D1E A;  1DTL A;  2CCM A;  2F2O A;  2KPH A;  3OB2 B;  5D7F A;  3A4U B;  1WLZ A;  2PAL A;  2Y4Q A;  4DRW A;  2BNX A;  4DS7 A;  1W9Z A;  3R1P A;  1IH0 A;  2NCO A;  3DYE A;  3UO9 A;  1UHJ A;  2K2F A;  3O78 A;  4Q04 A;  1KK7 Z;  3NSO A;  1KSM A;  2KFF A;  4FQT A;  1EG3 A;  2JT0 A;  3S0E A;  2H8V A;  1N65 A;  1SL8 A;  1M46 A;  3BYA A;  2I18 A;  2BEC A;  2H61 A;  2I94 A;  1N0Y A;  1KK8 C;  1OQP A;  2PYQ A;  3BFA A;  4PE0 A;  4CID A;  1DC1 A;  3I5F C;  2LHI A;  1CFP A;  1IGV A;  4GFT A;  2AMI A;  1LXF C;  2KAV A;  1H4B A;  3LCP C;  2CTN A;  1ZUZ A;  1EL4 A;  3SG2 A;  1CLM A;  1FW4 A;  5FI7 A;  1LS8 A;  2ZND A;  3M0W A;  3BFH A;  3SG6 A;  1Q80 A;  1F4Q A;  1OMR A;  4WQ3 A;  1MR8 A;  3RM1 A;  3DVM A;  1CMG A;  3PM8 A;  4ORB B;  1EJ3 A;  1MUX A;  4MZL A;  3SG3 A;  1A29 A;  2WC5 A;  1GJY A;  1KK7 Y;  1CDN A;  2M49 B;  1DF0 B;  1XFR A;  1RTP 1;  1XFV O;  2KYF A;  5FYX A;  3S0D A;  4MZJ A;  3S0G A;  3OBV A;  1B8C A;  1IQ5 A;  2L4H A;  2WCJ A;  1XYD A;  1JFJ A;  4E68 A;  3S0A A;  2G2B A;  2I2R E;  3OHM B;  3PAT A;  2HPS A;  1S36 A;  3MSE B;  3PN7 C;  3LK1 A;  1CB1 A;  1WDC C;  2KYC A;  5AEQ A;  3PFV A;  1DEK A;  5HLV A;  3K1E A;  4UPG A;  1KSO A;  1PRW A;  1YRU B;  1S6J A;  1SR6 C;  5FI6 A;  3CZ2 A;  2QPT A;  2TN4 A;  4YGA A;  3D75 A;  2V53 A;  1DJZ A;  1PVB A;  1PAL A;  4PE7 A;  1C7W A;  2F3Y A;  3SS4 A;  1DMO A;  1OOI X;  2LLS A;  1S5G Z;  3DVE A;  3BUX B;  1GQM A;  3WNX B;  4ETO A;  3VRP A;  2M3W A;  4WRI A;  3D73 A;  5HLO A;  2M0R A;  2M8U A;  2WC8 A;  2WND A;  3TS5 C;  2I7A A;  3SIA A;  2LVI A;  1MHO A;  2KI6 C;  2NZ0 A;  3RZS A;  1CFF A;  5HKZ A;  2GGZ A;  1F4O A;  4HRG A;  4AQI A;  4YI8 A;  2L2C A;  1YVH A;  1LA0 A;  1SCV A;  1TNW A;  4TNC A;  1DGV A;  5D69 A;  2BBM A;  4CLN A;  1TCO B;  3LK0 A;  2L98 A;  1F71 A;  1B4C A;  5ER4 X;  2L51 A;  2KBM A;  1HQV A;  4OCI A;  1UHH A;  4I5N B;  4NDC A;  2BKH B;  4N1G A;  1A2X A;  1KFX L;  1UUR A;  4C0L A;  2GV5 A;  3GK4 X;  1WRL A;  3BOW B;  3CS1 A;  1W7I B;  1NWD A;  4MLW A;  1S5G Y;  1DJH A;  1N2D A;  1ZOT B;  3O4X A;  3I5H C;  3EVV A;  3WXA A;  3BUN B;  2LAN A;  1A03 A;  2F2P A;  2GGM A;  4PE1 A;  4FTG A;  1EG4 A;  1IG5 A;  1XA5 A;  2M29 A;  4MSP A;  4YGB B;  3QRX A;  1JSA A;  4IL1 A;  2L5Y A;  1CFC A;  2ZN8 A;  3OX6 A;  2Q91 A;  2MRD A;  2AUC A;  2NCP A;  1QXP A;  3CR5 X;  2L0P A;  2E30 A;  4BY4 A;  4F7F A;  4AQJ A;  4OZD A;  1B47 A;  2LVV A;  3VRN A;  3V2L A;  3I5I B;  4ICB A;  3SG7 A;  3NSK A;  2BKI B;  2QEV A;  3R1O A;  1OSA A;  3BUO B;  3LLE A;  3SS3 A;  1A4P A;  2LC5 A;  3ZWH A;  1TUJ A;  4YGE B;  4P5O E;  4MRX A;  2KLD A;  4QJ4 B;  2VRG A;  1LVC D;  3GK1 A;  2HF5 A;  3OP0 A;  3D78 A;  3SS5 A;  3CDN A;  3TDZ A;  2MLE C;  2L4I A;  1OOF A;  1SY9 A;  2WCF A;  1JC2 A;  1F54 A;  3O6B A;  2JRF A;  2FCE A;  2FCD A;  2F8P A;  1WRZ A;  4ZCV A;  1K95 A;  3BOW A;  5I94 A;  1IWQ A;  3CZ1 A;  4MBE A;  1U5I B;  1IJ5 A;  1C3Y A;  1QAS A;  3TUY B;  2L2E A;  3A8R A;  5HKW A;  1QV1 A;  1LA3 A;  1CDP A;  1R2U A;  1XK4 A;  2Y5I A;  4MEW A;  2JXL A;  5HYD A;  2LMU A;  3B86 A;  3VB1 A;  1CNP A;  4PHJ A;  2G9B A;  2PQL A;  2KDH A;  2M1U A;  1CMF A;  3DVJ A;  4JWQ A;  1CTR A;  3DF0 A;  4INX A;  1L7Z A;  3Q8I A;  3CLN A;  3JVT B;  1RWY A;  3EK7 A;  1OMV A;  3D0Y B;  1A75 B;  1Y1U A;  3S0F A;  1MXL C;  1F55 A;  1QIV A;  1ZMZ A;  3OGN A;  4M2Q A;  1BJF A;  1NPQ A;  2FJY A;  1MF8 B;  1K90 D;  2K0J A;  2NLN A;  1NX1 A;  2YGU A;  3B6X A;  1ORG A;  1PUL A;  1TWO A;  2A4J A;  2EC6 B;  4M2O A;  1E8A A;  1FI5 A;  1RK9 A;  1BU3 A;  2JOJ A;  1YX8 A;  2KFG A;  5CSJ A;  3VRQ A;  1C7V A;  4BY5 A;  3D77 A;  1L2O B;  1YRT B;  2JNX A;  3QME A;  2KGB C;  3JTD B;  1QWV A;  2WCL A;  1KQM B;  4OVN F;  3BUM B;  2LE9 B;  5DKQ A;  1PVA A;  1IIO A;  3WHT B;  1DJX A;  1X02 A;  1QX5 B;  1WY9 A;  1DQE A;  2K7C A;  1PSR A;  1PSB A;  2MHH A;  1MWN A;  2SAS A;  1NX3 A;  4MZK A;  3VGO A;  1CLL A;  1HT9 A;  3B87 A;  5F6T A;  1OOH A;  1QLK A;  1SK6 D;  4GUK A;  1T14 A;  2QDI A;  1SPY A;  2L5X B;  1ODB A;  1Y6W A;  4A4C A;  3I5G B;  1QTX A;  5K89 A;  1KWO B;  2R2I A;  1F8H A;  1DVI A;  2CXJ A;  4GBA A;  1J7R A;  4OR9 B;  1GGW A;  4KYN A;  3R72 A;  4OKH A;  1KCY A;  3HCM A;  2KQ6 A;  3CZT X;  3AAK A;  3PLF B;  4I5K A;  2NXQ A;  1TCF A;  2JQ6 A;  3D10 A;  1KFU S;  3BFB A;  1NSH A;  1IQ3 A;  3F45 A;  4GPL B;  1LIN A;  3BXK A;  4IJ7 A;  1FBV A;  1K94 A;  4I5L B;  1AHR A;  2QAC A;  3EK4 A;  3FIA A;  1J1D A;  3PSR A;  2JTT A;  1G33 A;  2LHL A;  1BLQ A;  1SMG A;  2LM5 A;  2CT9 A;  3LL8 B;  2ZRT A;  1PK0 D;  4NDD A;  1YUT A;  1XK4 C;  3D76 A;  4CFR A;  3EG5 B;  3C1V A;  1G4Y R;  4PCW A;  2DOQ A;  1NX2 A;  1SKT A;  2Y1N A;  3CYZ A;  1BR4 B;  5JJG A;  1TOP A;  1YUR A;  1IRJ A;  5AFP A;  1BF5 A;  1QV0 A;  2KFH A;  1H8B A;  1K93 D;  2FJU B;  1J7P A;  2QEO A;  1UHN A;  1C07 A;  1SRA A;  2CBL A;  2KNE A;  1DGU A;  1DF0 A;  4XJK B;  3AKB A;  1XVJ A;  2KAX A;  5KU1 A;  2LMV A;  4DIR A;  4F0Z B;  4QJ3 B;  2WOR A;  2MLF C;  3KF9 A;  1DJY A;  1NUB A;  1SL7 A;  3D74 A;  3I5I C;  4HSZ A;  2BL0 B;  2LP3 A;  4INW A;  3SJS A;  4I5J A;  5G08 A;  1M45 A;  2K60 A;  2OTG B;  3KO0 A;  4GGN A;  5AAN A;  1YR5 A;  4PHK A;  1J1E A;  1UP5 A;  4PHM A;  1KQV A;  3PM2 A;  1IKU A;  1SYM A;  5DKN A;  1JBA A;  2JTZ A;  5CSF A;  1OZO A;  3FWB A;  4ORA B;  5AER A;  1SCM B;  1J7Q A;  1FI6 A;  2M97 A;  1J55 A;  5HL1 A;  1YUS A;  2BCA A;  2BCB A;  4XYN A;  3SG4 A;  1YVL A;  3SG5 A;  5KSZ A;  2KI6 D;  2PRU A;  5GQQ C;  1B9A A;  1DEL A;  1YUU A;  5J3X A;  4DUQ A;  3TUY C;  1NX0 A;  4GNK B;  3O4Y A;  3OX5 A;  2HET A;  5BPJ A;  3R1V A;  2ZN9 A;  4P2Y B;  1V1G A;  1S26 D;  1S6I A;  1RJV A;  2OS8 B;  2AAO A;  2GTE A;  2Y1M A;  3BJH A;  5B8I B;  4YI9 A;  3JVT C;  2PAS A;  3OB1 B;  1SNL A;  4DCK A;  3H4S E;  1W7J B;  1EH2 A;  4MVF A;  2BAP A;  1QLS A;  3EVR A;  4XJK A;  3EKJ A;  1QVI Z;  3CZ0 A;  5JOL A;  3EVU A;  3S0B A;  1SSE B;  2BE6 A;  2EC6 C;  2L50 A;  3IQQ A;  1AUI B;  1ZFS A;  3DY9 A;  1J7O A;  1V1F A;  1L2O C;  4AOM A;  1IJ6 A;  1TNP A;  2LLU A;  4GGF A;  4OV2 A;  3JTD C;  3UNW A;  5I8N A;  2PMY A;  1KQM C;  1GM0 A;  1WLM A;  1NCY A;  2JT3 A;  2EHB A;  3FE9 A;  5TNC A;  2COL B;  3PJI A;  3FE8 A;  1EXR A;  2ZKM X;  1FPW A;  2P6B B;  2JT8 A;  1TRF A;  1K9K A;  5D3O A;  1CDL A;  1BOC A;  1SBJ A;  3HX4 A;  1XO5 A;  4YBH B;  1AVS A;  2BCX A;  4CPV A;  1XFX O;  2M1K B;  3I5G C;  5DKR A;  1KWO C;  4QJ5 B;  4MRY A;  1QVI Y;  3NHT A;  1TN4 A;  1YTZ C;  1MQ1 A;  2RGI A;  2QEB A;  1OE9 B;  3E3R A;  3FS7 A;  2ISD A;  2KI4 B;  4JQ0 D;  2F3Z A;  1B8R A;  2JU0 A;  2KOT A;  3DVK A;  1VRK A;  3NXA A;  2LVJ A;  3CAB A;  3DZT A;  3EK8 A;  1OOG A;  4NQG A;  1K2H A;  1BR1 B;  1Y1X A;  3TDU A;  2JC2 A;  1TUZ A;  3B7A A;  3TZ1 A;  2MJW B;  1DT7 B;  1C3Z A;  2PVB A;  2LMT A;  4USL A;  1M63 B;  1SW8 A;  1U5I A;  4C0K A;  1NCZ A;  1OOJ A;  1OW4 A;  2JPO A;  2O60 A;  3L47 A;  1XFW O;  1K8U A;  3CR2 A;  1S3P A;  2BBN A;  3KEV A;  1JF2 A;  1Y1A A;  3DD4 A;  4YGD B;  2LAP A;  1CM1 A;  2WCM A;  1JWD A;  4HRE E;  2WCB A;  2IS9 A;  1NP8 A;  3BUW B;  1QAT A;  4PDZ A;  5EL2 A;  2JNF A;  1LKJ A;  1JUO A;  4ORC B;  1SL9 A;  2ZRS A;  2LV7 A;  2JPT A;  1ALV A;  3D0Y A;  1A75 A;  1AJ5 A;  1UHI A;  2JUL A;  1ALW A;  1ZAC A;  5I2Q A;  3RLZ A;  5FI2 A;  1KK8 B;  2B1U A;  2LLT A;  2LUC A;  1DJW A;  2LVK A;  2BL0 C;  2WCE A;  1BT6 A;  1CFD A;  1NYA A;  3I5F B;  5AXI A;  3SIB A;  2OPO A;  4PE4 A;  3VRO A;  2OTG C;  4N5X A;  4GGF C;  2K7B A;  3AAJ A;  3IQO A;  2MBX A;  1KFU L;  1BMO A;  2WCH A;  1G8I A;  5I2L A;  1CKK A;  3EKH A;  3WHU B;  1CM4 A;  1QS7 A;  2ERB A;  1NIW A;  2HQW A;  2JWW A;  2O5G A;  3GOF A;  1FF1 A;  1M39 A;  2KGR A;  1SCM C;  1DJI A;  4R1E A;  2D8N A;  3FWC A;  1BG1 A;  2M7N A;  4JPZ B;  3CGA A;  2FOT A;  1B7T Z;  3B88 A;  5PAL A;  5IBW A;  2HQ8 A;  1REC A;  3L4L A;  4C0J A;  4MN0 A;  1NCX A;  1KFX S;  3CTN A;  1XFU O;  2BE4 A;  4N1F A;  1JF0 A;  2OS8 C;  3IF7 A;  2F33 A;  2LUX A;  1B8L A;  3KPX A;  3K21 A;  3PN7 B;  2K61 A;  5KTY A;  1WDC B;  4NDB A;  4L9M A;  2P70 A;  1Z2C B;  1XFZ O;  2K7O A;  1SR6 B;  1TTX A;  1AP4 A;  1GGZ A;  1Z4H A;  2H61 C;  1UWO A;  4PT1 A;  2WOS A;  2QEH A;  2LP2 A;  5CPV A;  1F70 A;  4GAO A;  2JZI A;  3CWG A;  3FE6 A;  3ZNI A;  1B1G A;  1XFY O;  2K8M B;  2LCP A;  2WCK A;  2KHN A;  4FQO A;  3NSL A;  1B7T Y;  3ICB A;  1UHK A;  3TS5 B;  2ZFD A;  3AKA A;  1K9P A;  2E6W A;  1K96 A;  2SCP A;  4PHN A;  2CNP A;  2PSR A;  1AJ4 A;  3CR4 X;  2LNK A;  3NHI A;  4JD9 A;  4YGC B;  2M7L A;  1MXE A;  4WQ2 A;  1CLB A;  5HKY A;  4JKT A;  1DJG A;  2M9G A;  2K2A A;  1QX7 A;  1UUS A;  3L4A A;  1Y0V H;  3NGV A;  4HRH A;  3N7H A;  1OMD A;  1RFJ A;  1AK8 A;  2KBI A;  1TNX A;  1QX2 A;  3DF0 B;  2Q4U A;  3KHE A;  3DXL A;  2EGD A;  1TNQ A;  5I2O A;  2KSP A; 
#chains in the Genus database with same CATH homology
 1M31 A;  3BQ3 A;  3PAL A;  3O2P A;  1K9U A;  2MAZ A;  3GK2 A;  1S6C A;  1OZS A;  4YRU A;  1BOD A;  3NSI A;  3TDI A;  2MA2 A;  2KAY A;  1YX7 A;  1RRO A;  2K7D A;  5ER5 A;  4ZCU A;  1TIZ A;  1QJT A;  2KI4 C;  4A4B A;  1QIW A;  2JXC A;  3VRR A;  5CSI A;  5CSN A;  1WRK A;  3I5H B;  1JFK A;  4U8D A;  4M2P A;  2H2K A;  2ZNE A;  4CFQ A;  4PAL A;  1CDM A;  1D1O A;  1R6P A;  1S1E A;  2KQY A;  4D1E A;  1DTL A;  2CCM A;  2F2O A;  3OB2 B;  5D7F A;  3A4U B;  1WLZ A;  2PAL A;  2Y4Q A;  4DRW A;  4DS7 A;  1IH0 A;  2NCO A;  1UHJ A;  2K2F A;  3O78 A;  4Q04 A;  1KK7 Z;  3NSO A;  1KSM A;  2KFF A;  1EG3 A;  2JT0 A;  1N65 A;  1SL8 A;  1M46 A;  3BYA A;  2I18 A;  2BEC A;  2H61 A;  2I94 A;  1N0Y A;  1KK8 C;  1OQP A;  4PE0 A;  4CID A;  3I5F C;  2LHI A;  1CFP A;  1IGV A;  4GFT A;  2AMI A;  1LXF C;  2KAV A;  1H4B A;  3LCP C;  2CTN A;  1ZUZ A;  1EL4 A;  3SG2 A;  1CLM A;  1FW4 A;  2ZND A;  3M0W A;  3SG6 A;  1Q80 A;  1F4Q A;  1OMR A;  4WQ3 A;  1MR8 A;  3RM1 A;  3DVM A;  1CMG A;  3PM8 A;  4ORB B;  1EJ3 A;  1MUX A;  4MZL A;  3SG3 A;  1A29 A;  1GJY A;  1KK7 Y;  1CDN A;  2M49 B;  1DF0 B;  1RTP 1;  1XFV O;  2KYF A;  5FYX A;  4MZJ A;  1B8C A;  1IQ5 A;  2L4H A;  1XYD A;  1JFJ A;  4E68 A;  2G2B A;  2I2R E;  3OHM B;  3PAT A;  2HPS A;  1S36 A;  3MSE B;  3PN7 C;  3LK1 A;  1CB1 A;  1WDC C;  2KYC A;  5AEQ A;  3PFV A;  5HLV A;  4UPG A;  1KSO A;  1PRW A;  1YRU B;  1S6J A;  1SR6 C;  4YGA A;  2QPT A;  2TN4 A;  2V53 A;  1DJZ A;  1PVB A;  1PAL A;  4PE7 A;  1C7W A;  2F3Y A;  1DMO A;  2LLS A;  3DVE A;  1S5G Z;  3BUX B;  1GQM A;  3WNX B;  4ETO A;  3VRP A;  2M3W A;  4WRI A;  5HLO A;  2M0R A;  2M8U A;  2WC8 A;  2WND A;  3TS5 C;  2I7A A;  3SIA A;  2LVI A;  1MHO A;  2KI6 C;  2NZ0 A;  1CFF A;  5HKZ A;  2GGZ A;  1F4O A;  4HRG A;  4AQI A;  4YI8 A;  1YVH A;  1LA0 A;  1SCV A;  1TNW A;  4TNC A;  1DGV A;  5D69 A;  2BBM A;  4CLN A;  1TCO B;  3LK0 A;  2L98 A;  1F71 A;  1B4C A;  5ER4 X;  2L51 A;  2KBM A;  1HQV A;  4OCI A;  1UHH A;  4I5N B;  4NDC A;  2BKH B;  4N1G A;  1A2X A;  1KFX L;  1UUR A;  4C0L A;  2GV5 A;  3GK4 X;  1WRL A;  3BOW B;  3CS1 A;  1W7I B;  1NWD A;  4MLW A;  1S5G Y;  1DJH A;  1N2D A;  1ZOT B;  3I5H C;  3EVV A;  3WXA A;  3BUN B;  2LAN A;  1A03 A;  2F2P A;  2GGM A;  4PE1 A;  4FTG A;  1EG4 A;  1IG5 A;  1XA5 A;  2M29 A;  4MSP A;  4YGB B;  3QRX A;  1JSA A;  4IL1 A;  1CFC A;  2ZN8 A;  3OX6 A;  2Q91 A;  2MRD A;  2AUC A;  2NCP A;  1QXP A;  2L0P A;  2E30 A;  4BY4 A;  4AQJ A;  1B47 A;  2LVV A;  3VRN A;  3I5I B;  4ICB A;  3SG7 A;  3NSK A;  2BKI B;  1OSA A;  3BUO B;  3LLE A;  1A4P A;  2LC5 A;  3ZWH A;  4YGE B;  4P5O E;  4MRX A;  4QJ4 B;  2VRG A;  1LVC D;  3GK1 A;  2HF5 A;  3OP0 A;  3TDZ A;  2MLE C;  2L4I A;  1SY9 A;  2WCF A;  1JC2 A;  1F54 A;  3O6B A;  2JRF A;  2FCE A;  2FCD A;  2F8P A;  1WRZ A;  4ZCV A;  1K95 A;  3BOW A;  1IWQ A;  4MBE A;  1U5I B;  1IJ5 A;  1QAS A;  3TUY B;  2L2E A;  3A8R A;  5HKW A;  1QV1 A;  1LA3 A;  1CDP A;  1R2U A;  1XK4 A;  2Y5I A;  4MEW A;  2JXL A;  5HYD A;  2LMU A;  1CNP A;  4PHJ A;  2G9B A;  2KDH A;  2M1U A;  1CMF A;  3DVJ A;  4JWQ A;  1CTR A;  3DF0 A;  1L7Z A;  3CLN A;  3JVT B;  1RWY A;  3EK7 A;  1OMV A;  3D0Y B;  1A75 B;  1Y1U A;  1MXL C;  1F55 A;  1QIV A;  1ZMZ A;  4M2Q A;  1BJF A;  1NPQ A;  2K0J A;  1MF8 B;  1K90 D;  2NLN A;  3CR5 X;  1NX1 A;  1PUL A;  2A4J A;  1FI5 A;  2EC6 B;  4M2O A;  1E8A A;  1RK9 A;  1BU3 A;  2JOJ A;  1YX8 A;  2KFG A;  5CSJ A;  3VRQ A;  1C7V A;  4BY5 A;  1L2O B;  1YRT B;  2JNX A;  2KGB C;  3JTD B;  1KQM B;  4OVN F;  3BUM B;  2LE9 B;  5DKQ A;  1PVA A;  3WHT B;  1DJX A;  1X02 A;  1QX5 B;  1WY9 A;  2K7C A;  4I5K A;  1PSR A;  1PSB A;  2MHH A;  1MWN A;  2SAS A;  1NX3 A;  4MZK A;  3VGO A;  1CLL A;  1HT9 A;  5F6T A;  1QLK A;  1SK6 D;  4GUK A;  1SPY A;  2L5X B;  1ODB A;  1Y6W A;  4A4C A;  3I5G B;  1QTX A;  5K89 A;  1KWO B;  2R2I A;  1F8H A;  1DVI A;  2CXJ A;  4GBA A;  1J7R A;  4OR9 B;  1GGW A;  4OKH A;  1KCY A;  3HCM A;  2KQ6 A;  3CZT X;  3AAK A;  3PLF B;  2NXQ A;  1TCF A;  2JQ6 A;  3D10 A;  1KFU S;  1IQ3 A;  1NSH A;  3F45 A;  4GPL B;  1LIN A;  3BXK A;  1FBV A;  1K94 A;  4I5L B;  1AHR A;  2QAC A;  3EK4 A;  3FIA A;  1J1D A;  3PSR A;  2JTT A;  1G33 A;  2LHL A;  1BLQ A;  1SMG A;  2LM5 A;  2CT9 A;  3LL8 B;  2ZRT A;  1PK0 D;  4NDD A;  1YUT A;  1XK4 C;  4CFR A;  3C1V A;  1G4Y R;  4PCW A;  2DOQ A;  1NX2 A;  1SKT A;  2Y1N A;  1BR4 B;  5JJG A;  1TOP A;  1YUR A;  1IRJ A;  5AFP A;  1BF5 A;  1QV0 A;  2KFH A;  1H8B A;  1K93 D;  2FJU B;  1J7P A;  1UHN A;  1C07 A;  1SRA A;  2CBL A;  2KNE A;  1DGU A;  1DF0 A;  4XJK B;  3AKB A;  1XVJ A;  2KAX A;  5KU1 A;  2LMV A;  4DIR A;  4F0Z B;  2WOR A;  2MLF C;  3KF9 A;  1DJY A;  1NUB A;  1SL7 A;  3I5I C;  4HSZ A;  2BL0 B;  2LP3 A;  3SJS A;  4I5J A;  5G08 A;  1M45 A;  2OTG B;  3KO0 A;  4GGN A;  5AAN A;  1YR5 A;  4PHK A;  1J1E A;  1UP5 A;  4PHM A;  1KQV A;  1IKU A;  1SYM A;  5DKN A;  1JBA A;  2JTZ A;  5CSF A;  1OZO A;  3FWB A;  4ORA B;  5AER A;  1SCM B;  1J7Q A;  2M97 A;  1J55 A;  1YUS A;  2BCA A;  2BCB A;  4XYN A;  3SG4 A;  1YVL A;  3SG5 A;  5KSZ A;  2KI6 D;  2PRU A;  5GQQ C;  1B9A A;  1YUU A;  5J3X A;  4DUQ A;  3TUY C;  1NX0 A;  4GNK B;  3O4Y A;  3OX5 A;  2HET A;  5BPJ A;  2ZN9 A;  4P2Y B;  1V1G A;  1S26 D;  1S6I A;  1RJV A;  2OS8 B;  2AAO A;  2Y1M A;  5B8I B;  4YI9 A;  3JVT C;  2PAS A;  3OB1 B;  1SNL A;  4DCK A;  3H4S E;  1W7J B;  1EH2 A;  4MVF A;  1QLS A;  3EVR A;  4XJK A;  3EKJ A;  1QVI Z;  5JOL A;  3EVU A;  2BE6 A;  2EC6 C;  2L50 A;  3IQQ A;  1AUI B;  1ZFS A;  1J7O A;  1V1F A;  1L2O C;  4AOM A;  1IJ6 A;  1TNP A;  2LLU A;  4GGF A;  4OV2 A;  3JTD C;  5I8N A;  2PMY A;  1KQM C;  1WLM A;  1NCY A;  2JT3 A;  2EHB A;  5TNC A;  2COL B;  1EXR A;  2ZKM X;  1FPW A;  2P6B B;  2JT8 A;  1TRF A;  1K9K A;  1CDL A;  1BOC A;  1SBJ A;  3HX4 A;  1XO5 A;  4YBH B;  1AVS A;  2BCX A;  4CPV A;  1XFX O;  2M1K B;  3I5G C;  5DKR A;  1KWO C;  4QJ5 B;  4MRY A;  1QVI Y;  1TN4 A;  1YTZ C;  1MQ1 A;  2RGI A;  1OE9 B;  3E3R A;  3FS7 A;  2ISD A;  2KI4 B;  4JQ0 D;  2F3Z A;  1B8R A;  2JU0 A;  2KOT A;  3DVK A;  1VRK A;  3NXA A;  2LVJ A;  3EK8 A;  4NQG A;  1K2H A;  1BR1 B;  1Y1X A;  3TDU A;  2JC2 A;  3TZ1 A;  2MJW B;  1DT7 B;  2PVB A;  2LMT A;  4USL A;  1M63 B;  1SW8 A;  1U5I A;  4C0K A;  1NCZ A;  1OOJ A;  2O60 A;  1XFW O;  1K8U A;  3CR2 A;  1S3P A;  2BBN A;  3KEV A;  1JF2 A;  1Y1A A;  3DD4 A;  4YGD B;  2LAP A;  1CM1 A;  1JWD A;  4HRE E;  2WCB A;  2IS9 A;  1NP8 A;  3BUW B;  1QAT A;  4PDZ A;  2JNF A;  1LKJ A;  1JUO A;  4ORC B;  1SL9 A;  2ZRS A;  2LV7 A;  2JPT A;  1ALV A;  3D0Y A;  1A75 A;  1AJ5 A;  1UHI A;  2JUL A;  1ALW A;  1ZAC A;  5I2Q A;  3RLZ A;  1KK8 B;  2B1U A;  2LLT A;  2LUC A;  1DJW A;  2LVK A;  2BL0 C;  2WCE A;  1BT6 A;  1CFD A;  1NYA A;  3I5F B;  5AXI A;  3SIB A;  2OPO A;  4PE4 A;  3VRO A;  2OTG C;  4N5X A;  4GGF C;  2K7B A;  3AAJ A;  3IQO A;  2MBX A;  1KFU L;  1BMO A;  1G8I A;  5I2L A;  1CKK A;  3EKH A;  3WHU B;  1CM4 A;  1QS7 A;  2HQW A;  1NIW A;  2JWW A;  2O5G A;  3GOF A;  1FF1 A;  1FI6 A;  1M39 A;  2KGR A;  1SCM C;  1DJI A;  4R1E A;  2D8N A;  3FWC A;  1BG1 A;  2M7N A;  4JPZ B;  3CGA A;  2FOT A;  1B7T Z;  5PAL A;  5IBW A;  2HQ8 A;  1REC A;  4C0J A;  4MN0 A;  1NCX A;  1KFX S;  3CTN A;  1XFU O;  2BE4 A;  4N1F A;  1JF0 A;  2OS8 C;  3IF7 A;  2F33 A;  2LUX A;  1B8L A;  3KPX A;  3K21 A;  3PN7 B;  2K61 A;  5KTY A;  1WDC B;  4NDB A;  4L9M A;  1XFZ O;  2K7O A;  1SR6 B;  1TTX A;  1AP4 A;  1GGZ A;  2H61 C;  1UWO A;  2WOS A;  5CPV A;  2LP2 A;  1F70 A;  4GAO A;  2JZI A;  3CWG A;  3ZNI A;  1B1G A;  1XFY O;  2K8M B;  2LCP A;  4FQO A;  2KHN A;  3NSL A;  1B7T Y;  3ICB A;  1UHK A;  3TS5 B;  2ZFD A;  3AKA A;  1K9P A;  2E6W A;  1K96 A;  2SCP A;  4PHN A;  2CNP A;  2PSR A;  1AJ4 A;  3CR4 X;  2LNK A;  4YGC B;  2M7L A;  1MXE A;  4WQ2 A;  1CLB A;  5HKY A;  1DJG A;  2M9G A;  2K2A A;  1QX7 A;  1UUS A;  4QJ3 B;  1Y0V H;  4HRH A;  1OMD A;  1RFJ A;  1AK8 A;  2KBI A;  1TNX A;  1QX2 A;  3DF0 B;  2Q4U A;  3KHE A;  2EGD A;  1TNQ A;  5I2O A;  2KSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...