2KFGA

Structure of the c-terminal domain of ehd1 in complex with fnyestdpftak
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kfgA00
5CSFA 2BL0C 1FI5A 2M0RA 1B8RA 2LLSA 1AJ4A 3BUMB 2KFHA 3JVTC 1AJ5A 1JFKA 2FJUB 5D69A 2HF5A 4JWQA 2PVBA 2Y4QA 4WQ3A 3SG7A 1K8UA 1UUSA 3BUXB 2BKIB 3CLNA 2KBMA 3ZNIA 1L2OC 2JPTA 2Q4UA 4MBEA 1KWOB 1TNPA 3CR2A 3O2PA 5I2LA 1UHHA 1YVHA 3VRNA 4GNKB 2HPSA 1ZFSA 1H4BA 1ZACA 1SK6D 1DGVA 2CTNA 4F0ZB 5HKYA 1AK8A 1BJFA 4QJ3B 1C7VA 1S3PA 1QX2A 3NSOA 4GPLB 3A8RA 2NZ0A 2BCXA 1A29A 3I5FB 4BY4A 2K7DA 3OX6A 1UURA 1Y0VH 1OE9B 1K95A 1RWYA 5AXIA 4C0LA 2JQ6A 1SCMB 5B8IB 4HSZA 2KI4B 2I94A 2L2EA 3OHMB 1FF1A 2WOSA 1Y1XA 2DOQA 3VROA 1RK9A 2RGIA 1SL9A 2A4JA 3BYAA 2MRDA 5F6TA 2CT9A 3EK4A 2COLB 1MWNA 1ODBA 5ER5A 3DVKA 1K9KA 4M2QA 1CMFA 4CFQA 2KAVA 1YTZC 4PHKA 2CCMA 5DKRA 1LA3A 1FBVA 2L51A 1KFXS 5HKWA 1CLMA 1KK8C 2LMTA 4P5OE 1JUOA 3AKAA 4FTGA 3CR4X 3SG3A 1WLZA 4CPVA 1S5GY 4HREE 4PCWA 3H4SE 3VRPA 1KQVA 2K61A 1CLBA 3SIAA 1CKKA 1QJTA 2JZIA 4DS7A 3PFVA 1KSMA 3KO0A 3SG5A 1B8CA 2F2OA 4PHMA 1K90D 1M31A 3F45A 2KNEA 3AAJA 1LKJA 4L9MA 1UHNA 1ALVA 4XYNA 1XFUO 2L4IA 4ICBA 5CSJA 1J1DA 2LCPA 3OB1B 1QASA 4M2OA 1MUXA 1NWDA 4YGDB 1S36A 1EL4A 2KHNA 2KFFA 1TNQA 2V53A 4HRHA 1B7TZ 4OVNF 1OZOA 2KSPA 3WHUB 5HKZA 2WCFA 2E6WA 4PE0A 1CB1A 4M2PA 1EXRA 5D7FA 4P2YB 1IRJA 2L0PA 1CNPA 2L4HA 3DVJA 3EK7A 1UHIA 2L98A 2G2BA 1Y1AA 1YUUA 2KGRA 1DJHA 3JTDB 2GGMA 1QIVA 4PE4A 2LMUA 5HLOA 5HLVA 3A4UB 2BL0B 3BXKA 3TDIA 2H61A 4PHNA 4QJ4B 4QJ5B 1PALA 1J7QA 3VRRA 2AAOA 4HRGA 3C1VA 2KAYA 1PVAA 1QXPA 3JVTB 5I2OA 2JWWA 2OPOA 3HX4A 4MN0A 2EGDA 1NX0A 1LXFC 3M0WA 1S6JA 1TTXA 2AMIA 3PN7C 1LA0A 1S5GZ 2HQWA 4ORCB 4CIDA 1K9PA 4GGNA 3I5HB 2LP3A 1SW8A 1G33A 1SL7A 1IWQA 1C07A 4IL1A 2MJWB 4DCKA 1NUBA 1KFUS 4WQ2A 2K7CA 3CR5X 2NXQA 1VRKA 3KEVA 1PK0D 1CFDA 2M7NA 1HT9A 2JC2A 2JT8A 2LVKA 1SR6C 2LV7A 4MEWA 4DIRA 3LLEA 1CDPA 1KFUL 3TDZA 4PDZA 3I5HC 3IF7A 1PSRA 2M97A 1GGZA 1RJVA 1QX7A 2ZKMX 4CLNA 1SNLA 2LNKA 3TS5C 1KCYA 4MVFA 1QATA 1M45A 2M3WA 1CDMA 3DF0B 2Y5IA 1S6IA 5IBWA 4NDCA 1QTXA 4MRYA 2WCEA 2KI6C 3ZWHA 1B7TY 1W7JB 1NSHA 1MXEA 1MXLC 1YUTA 1YURA 2K7OA 4ZCUA 1R6PA 1KK8B 1J55A 1GQMA 1QX5B 3LK0A 4AQIA 1XK4C 2F3ZA 2CXJA 1UWOA 2LVIA 1OSAA 1OMVA 1F70A 2OS8C 5I8NA 5KU1A 4I5NB 1Q80A 5PALA 1IQ3A 1F4QA 1M39A 4AOMA 2LHIA 1CLLA 2WORA 2KOTA 2M8UA 4YGEB 2NCPA 3WXAA 2M29A 2ZNDA 3VGOA 1B8LA 1S26D 1AHRA 1E8AA 1XA5A 1IKUA 1J7RA 2EC6C 4TNCA 2LLTA 1RTP1 1CFPA 2P6BB 1TNWA 1XK4A 5KSZA 1JSAA 1NX2A 1TIZA 1YVLA 2LVJA 2Y1NA 1N0YA 2ZN9A 1AUIB 1RROA 2VRGA 1K93D 1OOJA 1FI6A 4JQ0D 2M9GA 5AERA 1JC2A 2KFGA 2LUCA 3DF0A 4DUQA 3LCPC 1PVBA 1IGVA 3CS1A 3SG4A 1H8BA 1NPQA 4MZJA 3CWGA 1A4PA 4NQGA 1SYMA 1CMGA 4GGFC 1J1EA 1BU3A 1OMDA 1JFJA 2SCPA 1LVCD 5G08A 2ZRSA 1CFFA 4NDBA 1YRTB 3BOWB 1G4YR 1OZSA 2KDHA 1NCYA 2GGZA 3DVEA 1U5IB 2MBXA 1NX1A 3FIAA 2JRFA 3MSEB 4I5JA 2WNDA 4OKHA 2LAPA 4A4BA 1BLQA 2HQ8A 1WRKA 4A4CA 1OMRA 2F3YA 1PULA 4I5KA 5HYDA 3PN7B 2BE4A 1KQMC 1BMOA 4YRUA 3KF9A 1ZUZA 2K0JA 1MHOA 1N65A 2BE6A 2ZRTA 3KHEA 3PLFB 2QACA 4MZKA 4N1GA 5BPJA 2I18A 5CSIA 5JJGA 1Y1UA 1RECA 2JTTA 1XVJA 2JTZA 4MZLA 1DTLA 1XO5A 2GV5A 2JNFA 2JU0A 3PM8A 1WY9A 2KAXA 4Q04A 1XFYO 3GK2A 2BCBA 3O6BA 4MRXA 1F71A 2I2RE 2JT0A 3I5GC 5FYXA 2MAZA 4MSPA 1B9AA 3LL8B 1XYDA 1BOCA 2O60A 2F33A 1PRWA 1SR6B 1XFXO 1NP8A 2FCDA 1A75B 4JPZB 1YX8A 3BOWA 3NSLA 1BF5A 2G9BA 1QLSA 2ZN8A 1NYAA 1F55A 1OQPA 3OP0A 1U5IA 5KTYA 2BKHB 1DJXA 2MLFC 1SL8A 1G8IA 1UP5A 1IG5A 1MF8B 3TS5B 2ZFDA 2M1UA 1TRFA 2HETA 2BBNA 1F4OA 1K96A 1EG4A 5ER4X 2JULA 1BT6A 2BCAA 1DVIA 1A03A 3E3RA 1L7ZA 4GFTA 2PMYA 3EKHA 1SPYA 3HCMA 3IQQA 2K2FA 1SBJA 1MQ1A 2PALA 1IJ6A 2JXLA 1SCVA 1A2XA 4YGBB 1EH2A 3TUYC 3AKBA 3BUOB 1PSBA 1V1GA 4PHJA 2OS8B 4N1FA 3TZ1A 3OX5A 2CBLA 4D1EA 1DT7B 2E30A 1X02A 5J3XA 1IH0A 3EK8A 5DKQA 2KGBC 3PALA 1W7IB 3SG2A 3RM1A 3EVRA 1RFJA 1QLKA 3GK1A 3CZTX 1C7WA 1D1OA 1CM4A 2JNXA 2O5GA 2EC6B 5I2QA 3I5IC 1A75A 4UPGA 4OV2A 1UHJA 3KPXA 1QS7A 4XJKB 1WLMA 2JT3A 2MHHA 4I5LB 3SG6A 4FQOA 3DD4A 4MLWA 1QIWA 2M7LA 1EG3A 1R2UA 1J7PA 1BR1B 1BR4B 3SJSA 1JBAA 3DVMA 2IS9A 2L5XB 2F8PA 3LK1A 2MLEC 4OR9B 4BY5A 3BUWB 1JF2A 1DGUA 1NX3A 2B1UA 2ZNEA 3FWBA 1M63B 1M46A 2SASA 5CPVA 1B47A 2PSRA 3WNXB 2EHBA 1S1EA 2LM5A 4E68A 2K8MB 3WHTB 4PALA 1J7OA 4PE7A 1KWOC 2MA2A 1YUSA 3D10A 1JF0A 1WRLA 5GQQC 2Q91A 1UHKA 4PE1A 2WC8A 1ZMZA 1QV0A 2KQ6A 3GK4X 2M49B 1ALWA 1DJZA 1EJ3A 5AANA 1BODA 1DMOA 1N2DA 3I5FC 1MR8A 2KQYA 2K2AA 2BECA 1KQMB 2KYFA 1KK7Y 3GOFA 4XJKA 1BG1A 1F54A 1XFZO 2Y1MA 1CTRA 2PASA 1YX7A 5DKNA 1K94A 2JOJA 1SCMC 4ORAB 1TNXA 4GBAA 4R1EA 4YI9A 2KI4C 4ORBB 3FS7A 2LLUA 3IQOA 3RLZA 1QVIY 2LUXA 2LMVA 3VRQA 4U8DA 1CDLA 2OTGB 1KFXL 1DF0B 1LINA 5JOLA 3BUNB 1DJGA 3EVUA 1V1FA 4NDDA 4ETOA 1AP4A 4C0JA 3D0YB 2KYCA 3TDUA 3I5GB 2CNPA 3O4YA 2F2PA 4YBHB 4GGFA 5AEQA 1NCZA 1TCOB 3CGAA 1SKTA 2LVVA 1XFVO 4WRIA 4AQJA 1F8HA 1AVSA 1KSOA 1WDCB 3SIBA 3K21A 4YI8A 1WRZA 1B1GA 1K2HA 3PSRA 1YRUB 2PRUA 4OCIA 3QRXA 2K7BA 1IJ5A 4C0KA 4N5XA 2M1KB 3OB2B 1GGWA 4GUKA 1DJYA 1IQ5A 2BBMA 1TN4A 3ICBA 5K89A 1YR5A 2OTGC 1XFWO 2FCEA 2H61C 4CFRA 1CFCA 1DJWA 1SMGA 3CTNA 1NIWA 2LC5A 1B4CA 2H2KA 3EVVA 1QV1A 2ISDA 2D8NA 2KBIA 1NCXA 2FOTA 1SRAA 2QPTA 2LE9B 2TN4A 4USLA 3BQ3A 1K9UA 2JXCA 2NLNA 1WDCC 3NXAA 4GAOA 1TCFA 3TUYB 2LANA 1S6CA 1Y6WA 3NSIA 5TNCA 1DF0A 4YGCB 1JWDA 3AAKA 2LP2A 3FWCA 3PATA 1ZOTB 2I7AA 3D0YA 1FPWA 1GJYA 2WCBA 3EKJA 1SY9A 1CDNA 1KK7Z 2AUCA 2NCOA 1CM1A 2R2IA 4YGAA 5CSNA 4ZCVA 2L50A 1TOPA 1DJIA 2KI6D 2LHLA 3I5IB 1FW4A 1QVIZ 1L2OB 1HQVA 3JTDC 5AFPA 4DRWA 3O78A 3NSKA
chains in the Genus database with same CATH superfamily
5CSFA 2BL0C 1FI5A 2M0RA 4INXA 1B8RA 2LLSA 1AJ4A 3BUMB 2KFHA 3JVTC 1AJ5A 3B86A 1JFKA 2FJUB 5D69A 5FI7A 2HF5A 3NGVA 4JWQA 2PVBA 2Y4QA 4WQ3A 3SG7A 1K8UA 1UUSA 3BUXB 2BKIB 3CLNA 2KBMA 3ZNIA 1L2OC 2JPTA 2Q4UA 4MBEA 1KWOB 1TNPA 3CR2A 3S0FA 3O2PA 3L4AA 5I2LA 1UHHA 1YVHA 3VRNA 3B6XA 4GNKB 3S0BA 2HPSA 1ZFSA 1H4BA 1ZACA 1SK6D 1DGVA 2CTNA 4F0ZB 5HKYA 1AK8A 1BJFA 4QJ3B 1C7VA 1S3PA 1QX2A 1TWOA 3CZ2A 3NSOA 4GPLB 3A8RA 2NZ0A 2BCXA 1A29A 3I5FB 4BY4A 2K7DA 2YGUA 1UURA 3OX6A 5FI6A 1Y0VH 1OE9B 1K95A 1RWYA 5AXIA 5D3OA 4C0LA 2JQ6A 5EL2A 3S0EA 1SCMB 5B8IB 4HSZA 2KI4B 2I94A 2L2EA 3OHMB 1FF1A 2WOSA 3CYZA 1Y1XA 2DOQA 3VROA 1RK9A 2RGIA 1SL9A 2A4JA 3BYAA 2MRDA 5F6TA 2CT9A 3EK4A 2COLB 1MWNA 1ODBA 3OGNA 3DVKA 5ER5A 1LS8A 1K9KA 4M2QA 1CMFA 4CFQA 2KAVA 1TUJA 1YTZC 4PHKA 3VB1A 2CCMA 5DKRA 1LA3A 1FBVA 2L51A 1KFXS 5HKWA 1CLMA 4KYNA 1QWVA 1KK8C 2LMTA 4P5OE 1JUOA 3AKAA 4FTGA 3CR4X 3N7HA 3SG3A 1WLZA 4CPVA 1S5GY 4HREE 4PCWA 3H4SE 3VRPA 1KQVA 2K61A 1CLBA 3SIAA 1CKKA 1QJTA 2JZIA 4DS7A 3PFVA 1KSMA 3KO0A 3SG5A 1B8CA 2F2OA 4PHMA 1K90D 1M31A 3F45A 2K60A 2KNEA 3AAJA 1LKJA 4L9MA 1UHNA 1ALVA 3UO9A 4XYNA 1XFUO 2L4IA 4ICBA 5CSJA 1J1DA 1OOIX 2LCPA 1QASA 3OB1B 4M2OA 1MUXA 1NWDA 4YGDB 1S36A 1EL4A 1C3ZA 2KFFA 2KHNA 1TNQA 3DZTA 2V53A 4HRHA 1B7TZ 4OVNF 1OZOA 2KSPA 3WHUB 1DQEA 5HKZA 2WCFA 3S0DA 2E6WA 4PE0A 1CB1A 4M2PA 2BNXA 1EXRA 5D7FA 3SS3A 4P2YB 1IRJA 2L0PA 1CNPA 2L4HA 3DVJA 3EK7A 1UHIA 2L98A 2G2BA 1Y1AA 1YUUA 3CZ0A 2KGRA 1DJHA 3JTDB 2GGMA 1QIVA 4PE4A 2LMUA 5HLOA 1DELA 3S0GA 5HLVA 3A4UB 2BL0B 3BXKA 3L4LA 2H61A 4PHNA 3TDIA 4QJ4B 4QJ5B 3SS5A 4F7FA 1PALA 1J7QA 3VRRA 2AAOA 4HRGA 3C1VA 2KAYA 1PVAA 1QXPA 3JVTB 5I2OA 2JWWA 2OPOA 2BAPA 3HX4A 4MN0A 2EGDA 1NX0A 1LXFC 2QDIA 1S6JA 1TTXA 2AMIA 3M0WA 3PN7C 1LA0A 1S5GZ 2HQWA 4ORCB 4CIDA 1K9PA 4GGNA 3I5HB 3D73A 2LP3A 1SW8A 1G33A 3B7AA 1GM0A 3DY9A 3O4XA 1SL7A 1IWQA 1C07A 4IL1A 2MJWB 4DCKA 1NUBA 1KFUS 4WQ2A 2K7CA 3CR5X 2NXQA 1VRKA 3KEVA 1PK0D 1CFDA 3R1OA 2M7NA 1HT9A 2JC2A 2JT8A 2LVKA 1SR6C 2LV7A 4MEWA 4DIRA 3LLEA 1CDPA 1KFUL 3TDZA 4PDZA 3I5HC 3IF7A 1PSRA 2M97A 1GGZA 1RJVA 3K1EA 1ORGA 1QX7A 2ZKMX 4CLNA 1SNLA 2LNKA 3TS5C 1KCYA 4MVFA 1QATA 1M45A 2H8VA 1CDMA 2M3WA 2Y5IA 1S6IA 3B88A 3DF0B 4NDCA 5IBWA 1QTXA 4MRYA 2WCEA 3DXLA 2KI6C 3ZWHA 1B7TY 1W7JB 1NSHA 1MXEA 1MXLC 5I94A 1YUTA 1YURA 2K7OA 4ZCUA 3CDNA 1R6PA 3PJIA 1KK8B 1J55A 1GQMA 1QX5B 3LK0A 4AQIA 1XK4C 2F3ZA 2CXJA 1UWOA 2LVIA 2WCHA 1OSAA 1OMVA 1F70A 2OS8C 5I8NA 5KU1A 2P70A 4I5NB 1Q80A 4JPZB 5PALA 1IQ3A 1F4QA 1M39A 4AOMA 2LHIA 1CLLA 2WORA 2KOTA 2FJYA 3B87A 1IIOA 2M8UA 4YGEB 2NCPA 3WXAA 2M29A 2ZNDA 3VGOA 1B8LA 1S26D 1AHRA 1TUZA 3R1VA 1E8AA 1XA5A 1IKUA 1J7RA 2EC6C 4TNCA 2LLTA 1RTP1 1CFPA 2P6BB 1TNWA 1XK4A 5KSZA 1JSAA 4JKTA 1NX2A 1TIZA 1YVLA 2LVJA 2Y1NA 1N0YA 2ZN9A 1AUIB 1RROA 2VRGA 1K93D 1OOJA 2QEOA 1FI6A 4JQ0D 2M9GA 5AERA 1JC2A 2KFGA 2LUCA 3DF0A 4DUQA 3LCPC 1PVBA 3D74A 1IGVA 3CS1A 3SG4A 1H8BA 1NPQA 4MZJA 3CWGA 1A4PA 4NQGA 1SYMA 1CMGA 4GGFC 1J1EA 1BU3A 1OMDA 3Q8IA 1JFJA 2SCPA 1LVCD 5G08A 2ZRSA 2QEVA 1CFFA 4NDBA 1YRTB 3BOWB 1G4YR 1OZSA 2KDHA 1NCYA 2GGZA 3DVEA 1U5IB 2MBXA 1NX1A 3FIAA 2JRFA 3MSEB 4I5JA 2WNDA 4OKHA 2LAPA 4A4BA 1BLQA 2HQ8A 1WRKA 4A4CA 1OMRA 2F3YA 1PULA 4I5KA 5HYDA 3PN7B 2BE4A 1KQMC 1BMOA 3BFHA 3KF9A 4YRUA 1OOFA 1ZUZA 2K0JA 1MHOA 1N65A 2BE6A 2ZRTA 3KHEA 3PLFB 2QACA 3R1PA 4MZKA 4N1GA 5BPJA 2I18A 5CSIA 5JJGA 1Y1UA 1RECA 2KLDA 2WCKA 2JTTA 1XVJA 2JTZA 2JPOA 1DTLA 1XO5A 2GV5A 2JNFA 2JU0A 4MZLA 3PM8A 1WY9A 2KAXA 4Q04A 1XFYO 3GK2A 2BCBA 3O6BA 4MRXA 1F71A 2I2RE 2JT0A 3I5GC 5FYXA 3BJHA 2MAZA 4MSPA 1Z4HA 1B9AA 3LL8B 1XYDA 1BOCA 2O60A 2F33A 1PRWA 1SR6B 1XFXO 1NP8A 1OOHA 1A75B 1DEKA 2FCDA 3D76A 1YX8A 3BOWA 3NSLA 1BF5A 2G9BA 1QLSA 1W9ZA 2ZN8A 1NYAA 1F55A 1OQPA 3OP0A 1U5IA 5KTYA 2BKHB 3PM2A 1DJXA 2MLFC 1SL8A 1G8IA 1UP5A 1IG5A 1MF8B 3TS5B 2ZFDA 2M1UA 1TRFA 2HETA 2BBNA 1F4OA 1K96A 1EG4A 5ER4X 2ERBA 2JULA 1BT6A 2BCAA 1DVIA 1A03A 1SSEB 3E3RA 1L7ZA 4GFTA 3L47A 2PMYA 1P28A 1SPYA 3EKHA 3HCMA 3IQQA 2K2FA 3FE8A 1SBJA 1MQ1A 2PALA 1IJ6A 2JXLA 1SCVA 1A2XA 4YGBB 1EH2A 3TUYC 3AKBA 3BUOB 1PSBA 1V1GA 4PHJA 2OS8B 4N1FA 3TZ1A 3OX5A 2CBLA 4D1EA 1DT7B 2E30A 1X02A 5J3XA 1C3YA 1IH0A 3EK8A 5DKQA 2KGBC 3FE6A 3PALA 1W7IB 3BFBA 3SG2A 3RM1A 3EVRA 1RFJA 1QLKA 3GK1A 3CZTX 1C7WA 3D77A 1D1OA 1CM4A 2JNXA 2O5GA 2EC6B 5I2QA 3QMEA 3I5IC 3UNWA 1A75A 4UPGA 4OV2A 1UHJA 3KPXA 1QS7A 4XJKB 3S0AA 1WLMA 2JT3A 2MHHA 3R72A 4I5LB 3SG6A 4FQOA 3DD4A 4MLWA 1QIWA 2M7LA 1EG3A 1R2UA 1J7PA 1BR1B 1BR4B 2WCLA 3SJSA 1JBAA 3DVMA 2IS9A 2L2CA 2L5XB 2F8PA 3LK1A 2MLEC 4OR9B 4BY5A 3BUWB 1JF2A 2QEBA 3EG5B 1DGUA 1NX3A 2B1UA 2ZNEA 3FWBA 1M63B 1M46A 2SASA 5CPVA 1B47A 2PSRA 3WNXB 5HL1A 2EHBA 5DICA 1S1EA 2LM5A 4E68A 2K8MB 3WHTB 4PALA 1J7OA 4PE7A 3CZ1A 1KWOC 2MA2A 1YUSA 3D10A 1JF0A 1WRLA 5GQQC 2Q91A 1UHKA 4PE1A 2WC8A 3NHIA 1ZMZA 2P71A 1QV0A 2WCJA 4FQTA 2KQ6A 2KPHA 3GK4X 2GTEA 2M49B 2QEHA 1ALWA 1DJZA 1EJ3A 5AANA 4INWA 1BODA 1DMOA 1N2DA 3I5FC 1MR8A 2KQYA 2K2AA 2BECA 1KQMB 2KYFA 1KK7Y 3GOFA 4XJKA 1BG1A 1F54A 1XFZO 2Y1MA 1CTRA 2PASA 1YX7A 3NHTA 1K94A 5DKNA 2JOJA 4JD9A 1SCMC 4ORAB 1TNXA 4GBAA 4R1EA 4YI9A 2KI4C 4ORBB 3FS7A 2LLUA 3IQOA 3RLZA 1QVIY 1T14A 2LUXA 2LMVA 3FE9A 3SS4A 3VRQA 4U8DA 1CDLA 2OTGB 1KFXL 1DF0B 1LINA 5JOLA 3BUNB 1DJGA 1XFRA 1V1FA 3EVUA 4NDDA 4ETOA 1AP4A 4C0JA 3D0YB 1OOGA 2KYCA 2WC5A 3TDUA 3I5GB 2CNPA 3O4YA 2F2PA 4YBHB 4GGFA 5AEQA 1NCZA 1TCOB 3CGAA 1SKTA 2LVVA 1XFVO 4WRIA 4AQJA 1F8HA 1AVSA 1KSOA 1WDCB 3SIBA 3K21A 4YI8A 1WRZA 1B1GA 1K2HA 3PSRA 1OW4A 1YRUB 2KLEA 2PRUA 4OCIA 3QRXA 2K7BA 1IJ5A 4C0KA 4N5XA 2M1KB 3OB2B 1GGWA 4GUKA 1DJYA 1IQ5A 2BBMA 1TN4A 3ICBA 5K89A 1YR5A 2OTGC 1XFWO 2FCEA 2H61C 2PYQA 1DC1A 4CFRA 1CFCA 1DJWA 1SMGA 3CTNA 1NIWA 2LC5A 1B4CA 2H2KA 3BFAA 3EVVA 1QV1A 2ISDA 2D8NA 2KBIA 3CABA 1NCXA 2FOTA 1SRAA 2QPTA 2LE9B 2TN4A 4USLA 3BQ3A 1K9UA 2JXCA 2NLNA 1WDCC 3NXAA 4GAOA 1TCFA 4IJ7A 3TUYB 3V2LA 3D75A 2LANA 1S6CA 1Y6WA 3NSIA 4PT1A 5TNCA 1DF0A 4YGCB 1JWDA 3AAKA 2WCMA 2LP2A 3FWCA 3PATA 1ZOTB 3D78A 2I7AA 3D0YA 1FPWA 1GJYA 2WCBA 3EKJA 1SY9A 2PQLA 1CDNA 1KK7Z 2AUCA 2NCOA 1CM1A 2R2IA 4YGAA 5CSNA 2WC6A 1Z2CB 4ZCVA 2L50A 1TOPA 1DJIA 2KI6D 2LHLA 3I5IB 3OBVA 1FW4A 5FI2A 3DYEA 3IVTA 1QVIZ 1L2OB 1HQVA 4OZDA 3JTDC 5AFPA 4DRWA 3O78A 2L5YA 3NSKA 3RZSA
chains in the Genus database with same CATH topology
5CSFA 2BL0C 1FI5A 2M0RA 1B8RA 2LLSA 1AJ4A 3BUMB 2KFHA 3JVTC 1AJ5A 1JFKA 2FJUB 5D69A 2HF5A 4JWQA 2PVBA 2Y4QA 4WQ3A 3SG7A 1K8UA 1UUSA 3BUXB 2BKIB 3CLNA 2KBMA 3ZNIA 1L2OC 2JPTA 2Q4UA 4MBEA 1KWOB 1TNPA 3CR2A 3O2PA 5I2LA 1UHHA 1YVHA 3VRNA 4GNKB 2HPSA 1ZFSA 1H4BA 1ZACA 1SK6D 1DGVA 2CTNA 4F0ZB 5HKYA 1AK8A 1BJFA 4QJ3B 1C7VA 1S3PA 1QX2A 3NSOA 4GPLB 3A8RA 2NZ0A 2BCXA 1A29A 3I5FB 4BY4A 2K7DA 3OX6A 1UURA 1Y0VH 1OE9B 1K95A 1RWYA 5AXIA 4C0LA 2JQ6A 1SCMB 5B8IB 4HSZA 2KI4B 2I94A 2L2EA 3OHMB 1FF1A 2WOSA 1Y1XA 2DOQA 3VROA 1RK9A 2RGIA 1SL9A 2A4JA 3BYAA 2MRDA 5F6TA 2CT9A 3EK4A 2COLB 1MWNA 1ODBA 5ER5A 3DVKA 1K9KA 4M2QA 1CMFA 4CFQA 2KAVA 1YTZC 4PHKA 2CCMA 5DKRA 1LA3A 1FBVA 2L51A 1KFXS 5HKWA 1CLMA 1KK8C 2LMTA 4P5OE 1JUOA 3AKAA 4FTGA 3CR4X 3SG3A 1WLZA 4CPVA 1S5GY 4HREE 4PCWA 3H4SE 3VRPA 1KQVA 2K61A 1CLBA 3SIAA 1CKKA 1QJTA 2JZIA 4DS7A 3PFVA 1KSMA 3KO0A 3SG5A 1B8CA 2F2OA 4PHMA 1K90D 1M31A 3F45A 2KNEA 3AAJA 1LKJA 4L9MA 1UHNA 1ALVA 4XYNA 1XFUO 2L4IA 4ICBA 5CSJA 1J1DA 2LCPA 3OB1B 1QASA 4M2OA 1MUXA 1NWDA 4YGDB 1S36A 1EL4A 2KHNA 2KFFA 1TNQA 2V53A 4HRHA 1B7TZ 4OVNF 1OZOA 2KSPA 3WHUB 5HKZA 2WCFA 2E6WA 4PE0A 1CB1A 4M2PA 1EXRA 5D7FA 4P2YB 1IRJA 2L0PA 1CNPA 2L4HA 3DVJA 3EK7A 1UHIA 2L98A 2G2BA 1Y1AA 1YUUA 2KGRA 1DJHA 3JTDB 2GGMA 1QIVA 4PE4A 2LMUA 5HLOA 5HLVA 3A4UB 2BL0B 3BXKA 3TDIA 2H61A 4PHNA 4QJ4B 4QJ5B 1PALA 1J7QA 3VRRA 2AAOA 4HRGA 3C1VA 2KAYA 1PVAA 1QXPA 3JVTB 5I2OA 2JWWA 2OPOA 3HX4A 4MN0A 2EGDA 1NX0A 1LXFC 3M0WA 1S6JA 1TTXA 2AMIA 3PN7C 1LA0A 1S5GZ 2HQWA 4ORCB 4CIDA 1K9PA 4GGNA 3I5HB 2LP3A 1SW8A 1G33A 1SL7A 1IWQA 1C07A 4IL1A 2MJWB 4DCKA 1NUBA 1KFUS 4WQ2A 2K7CA 3CR5X 2NXQA 1VRKA 3KEVA 1PK0D 1CFDA 2M7NA 1HT9A 2JC2A 2JT8A 2LVKA 1SR6C 2LV7A 4MEWA 4DIRA 3LLEA 1CDPA 1KFUL 3TDZA 4PDZA 3I5HC 3IF7A 1PSRA 2M97A 1GGZA 1RJVA 1QX7A 2ZKMX 4CLNA 1SNLA 2LNKA 3TS5C 1KCYA 4MVFA 1QATA 1M45A 2M3WA 1CDMA 3DF0B 2Y5IA 1S6IA 5IBWA 4NDCA 1QTXA 4MRYA 2WCEA 2KI6C 3ZWHA 1B7TY 1W7JB 1NSHA 1MXEA 1MXLC 1YUTA 1YURA 2K7OA 4ZCUA 1R6PA 1KK8B 1J55A 1GQMA 1QX5B 3LK0A 4AQIA 1XK4C 2F3ZA 2CXJA 1UWOA 2LVIA 1OSAA 1OMVA 1F70A 2OS8C 5I8NA 5KU1A 4I5NB 1Q80A 5PALA 1IQ3A 1F4QA 1M39A 4AOMA 2LHIA 1CLLA 2WORA 2KOTA 2M8UA 4YGEB 2NCPA 3WXAA 2M29A 2ZNDA 3VGOA 1B8LA 1S26D 1AHRA 1E8AA 1XA5A 1IKUA 1J7RA 2EC6C 4TNCA 2LLTA 1RTP1 1CFPA 2P6BB 1TNWA 1XK4A 5KSZA 1JSAA 1NX2A 1TIZA 1YVLA 2LVJA 2Y1NA 1N0YA 2ZN9A 1AUIB 1RROA 2VRGA 1K93D 1OOJA 1FI6A 4JQ0D 2M9GA 5AERA 1JC2A 2KFGA 2LUCA 3DF0A 4DUQA 3LCPC 1PVBA 1IGVA 3CS1A 3SG4A 1H8BA 1NPQA 4MZJA 3CWGA 1A4PA 4NQGA 1SYMA 1CMGA 4GGFC 1J1EA 1BU3A 1OMDA 1JFJA 2SCPA 1LVCD 5G08A 2ZRSA 1CFFA 4NDBA 1YRTB 3BOWB 1G4YR 1OZSA 2KDHA 1NCYA 2GGZA 3DVEA 1U5IB 2MBXA 1NX1A 3FIAA 2JRFA 3MSEB 4I5JA 2WNDA 4OKHA 2LAPA 4A4BA 1BLQA 2HQ8A 1WRKA 4A4CA 1OMRA 2F3YA 1PULA 4I5KA 5HYDA 3PN7B 2BE4A 1KQMC 1BMOA 4YRUA 3KF9A 1ZUZA 2K0JA 1MHOA 1N65A 2BE6A 2ZRTA 3KHEA 3PLFB 2QACA 4MZKA 4N1GA 5BPJA 2I18A 5CSIA 5JJGA 1Y1UA 1RECA 2JTTA 1XVJA 2JTZA 4MZLA 1DTLA 1XO5A 2GV5A 2JNFA 2JU0A 3PM8A 1WY9A 2KAXA 4Q04A 1XFYO 3GK2A 2BCBA 3O6BA 4MRXA 1F71A 2I2RE 2JT0A 3I5GC 5FYXA 2MAZA 4MSPA 1B9AA 3LL8B 1XYDA 1BOCA 2O60A 2F33A 1PRWA 1SR6B 1XFXO 1NP8A 2FCDA 1A75B 4JPZB 1YX8A 3BOWA 3NSLA 1BF5A 2G9BA 1QLSA 2ZN8A 1NYAA 1F55A 1OQPA 3OP0A 1U5IA 5KTYA 2BKHB 1DJXA 2MLFC 1SL8A 1G8IA 1UP5A 1IG5A 1MF8B 3TS5B 2ZFDA 2M1UA 1TRFA 2HETA 2BBNA 1F4OA 1K96A 1EG4A 5ER4X 2JULA 1BT6A 2BCAA 1DVIA 1A03A 3E3RA 1L7ZA 4GFTA 2PMYA 3EKHA 1SPYA 3HCMA 3IQQA 2K2FA 1SBJA 1MQ1A 2PALA 1IJ6A 2JXLA 1SCVA 1A2XA 4YGBB 1EH2A 3TUYC 3AKBA 3BUOB 1PSBA 1V1GA 4PHJA 2OS8B 4N1FA 3TZ1A 3OX5A 2CBLA 4D1EA 1DT7B 2E30A 1X02A 5J3XA 1IH0A 3EK8A 5DKQA 2KGBC 3PALA 1W7IB 3SG2A 3RM1A 3EVRA 1RFJA 1QLKA 3GK1A 3CZTX 1C7WA 1D1OA 1CM4A 2JNXA 2O5GA 2EC6B 5I2QA 3I5IC 1A75A 4UPGA 4OV2A 1UHJA 3KPXA 1QS7A 4XJKB 1WLMA 2JT3A 2MHHA 4I5LB 3SG6A 4FQOA 3DD4A 4MLWA 1QIWA 2M7LA 1EG3A 1R2UA 1J7PA 1BR1B 1BR4B 3SJSA 1JBAA 3DVMA 2IS9A 2L5XB 2F8PA 3LK1A 2MLEC 4OR9B 4BY5A 3BUWB 1JF2A 1DGUA 1NX3A 2B1UA 2ZNEA 3FWBA 1M63B 1M46A 2SASA 5CPVA 1B47A 2PSRA 3WNXB 2EHBA 1S1EA 2LM5A 4E68A 2K8MB 3WHTB 4PALA 1J7OA 4PE7A 1KWOC 2MA2A 1YUSA 3D10A 1JF0A 1WRLA 5GQQC 2Q91A 1UHKA 4PE1A 2WC8A 1ZMZA 1QV0A 2KQ6A 3GK4X 2M49B 1ALWA 1DJZA 1EJ3A 5AANA 1BODA 1DMOA 1N2DA 3I5FC 1MR8A 2KQYA 2K2AA 2BECA 1KQMB 2KYFA 1KK7Y 3GOFA 4XJKA 1BG1A 1F54A 1XFZO 2Y1MA 1CTRA 2PASA 1YX7A 5DKNA 1K94A 2JOJA 1SCMC 4ORAB 1TNXA 4GBAA 4R1EA 4YI9A 2KI4C 4ORBB 3FS7A 2LLUA 3IQOA 3RLZA 1QVIY 2LUXA 2LMVA 3VRQA 4U8DA 1CDLA 2OTGB 1KFXL 1DF0B 1LINA 5JOLA 3BUNB 1DJGA 3EVUA 1V1FA 4NDDA 4ETOA 1AP4A 4C0JA 3D0YB 2KYCA 3TDUA 3I5GB 2CNPA 3O4YA 2F2PA 4YBHB 4GGFA 5AEQA 1NCZA 1TCOB 3CGAA 1SKTA 2LVVA 1XFVO 4WRIA 4AQJA 1F8HA 1AVSA 1KSOA 1WDCB 3SIBA 3K21A 4YI8A 1WRZA 1B1GA 1K2HA 3PSRA 1YRUB 2PRUA 4OCIA 3QRXA 2K7BA 1IJ5A 4C0KA 4N5XA 2M1KB 3OB2B 1GGWA 4GUKA 1DJYA 1IQ5A 2BBMA 1TN4A 3ICBA 5K89A 1YR5A 2OTGC 1XFWO 2FCEA 2H61C 4CFRA 1CFCA 1DJWA 1SMGA 3CTNA 1NIWA 2LC5A 1B4CA 2H2KA 3EVVA 1QV1A 2ISDA 2D8NA 2KBIA 1NCXA 2FOTA 1SRAA 2QPTA 2LE9B 2TN4A 4USLA 3BQ3A 1K9UA 2JXCA 2NLNA 1WDCC 3NXAA 4GAOA 1TCFA 3TUYB 2LANA 1S6CA 1Y6WA 3NSIA 5TNCA 1DF0A 4YGCB 1JWDA 3AAKA 2LP2A 3FWCA 3PATA 1ZOTB 2I7AA 3D0YA 1FPWA 1GJYA 2WCBA 3EKJA 1SY9A 1CDNA 1KK7Z 2AUCA 2NCOA 1CM1A 2R2IA 4YGAA 5CSNA 4ZCVA 2L50A 1TOPA 1DJIA 2KI6D 2LHLA 3I5IB 1FW4A 1QVIZ 1L2OB 1HQVA 3JTDC 5AFPA 4DRWA 3O78A 3NSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSF A;  2BL0 C;  1FI5 A;  2M0R A;  1B8R A;  2LLS A;  1AJ4 A;  3BUM B;  2KFH A;  3JVT C;  1AJ5 A;  1JFK A;  2FJU B;  5D69 A;  2HF5 A;  4JWQ A;  2PVB A;  2Y4Q A;  4WQ3 A;  3SG7 A;  1K8U A;  1UUS A;  3BUX B;  2BKI B;  3CLN A;  2KBM A;  3ZNI A;  1L2O C;  2JPT A;  2Q4U A;  4MBE A;  1KWO B;  1TNP A;  3CR2 A;  3O2P A;  5I2L A;  1UHH A;  1YVH A;  3VRN A;  4GNK B;  2HPS A;  1ZFS A;  1H4B A;  1ZAC A;  1SK6 D;  1DGV A;  2CTN A;  4F0Z B;  5HKY A;  1AK8 A;  1BJF A;  4QJ3 B;  1C7V A;  1S3P A;  1QX2 A;  3NSO A;  4GPL B;  3A8R A;  2NZ0 A;  2BCX A;  1A29 A;  3I5F B;  4BY4 A;  2K7D A;  3OX6 A;  1UUR A;  1Y0V H;  1OE9 B;  1K95 A;  1RWY A;  5AXI A;  4C0L A;  2JQ6 A;  1SCM B;  5B8I B;  4HSZ A;  2KI4 B;  2I94 A;  2L2E A;  3OHM B;  1FF1 A;  2WOS A;  1Y1X A;  2DOQ A;  3VRO A;  1RK9 A;  2RGI A;  1SL9 A;  2A4J A;  3BYA A;  2MRD A;  5F6T A;  2CT9 A;  3EK4 A;  2COL B;  1MWN A;  1ODB A;  5ER5 A;  3DVK A;  1K9K A;  4M2Q A;  1CMF A;  4CFQ A;  2KAV A;  1YTZ C;  4PHK A;  2CCM A;  5DKR A;  1LA3 A;  1FBV A;  2L51 A;  1KFX S;  5HKW A;  1CLM A;  1KK8 C;  2LMT A;  4P5O E;  1JUO A;  3AKA A;  4FTG A;  3CR4 X;  3SG3 A;  1WLZ A;  4CPV A;  1S5G Y;  4HRE E;  4PCW A;  3H4S E;  3VRP A;  1KQV A;  2K61 A;  1CLB A;  3SIA A;  1CKK A;  1QJT A;  2JZI A;  4DS7 A;  3PFV A;  1KSM A;  3KO0 A;  3SG5 A;  1B8C A;  2F2O A;  4PHM A;  1K90 D;  1M31 A;  3F45 A;  2KNE A;  3AAJ A;  1LKJ A;  4L9M A;  1UHN A;  1ALV A;  4XYN A;  1XFU O;  2L4I A;  4ICB A;  5CSJ A;  1J1D A;  2LCP A;  3OB1 B;  1QAS A;  4M2O A;  1MUX A;  1NWD A;  4YGD B;  1S36 A;  1EL4 A;  2KHN A;  2KFF A;  1TNQ A;  2V53 A;  4HRH A;  1B7T Z;  4OVN F;  1OZO A;  2KSP A;  3WHU B;  5HKZ A;  2WCF A;  2E6W A;  4PE0 A;  1CB1 A;  4M2P A;  1EXR A;  5D7F A;  4P2Y B;  1IRJ A;  2L0P A;  1CNP A;  2L4H A;  3DVJ A;  3EK7 A;  1UHI A;  2L98 A;  2G2B A;  1Y1A A;  1YUU A;  2KGR A;  1DJH A;  3JTD B;  2GGM A;  1QIV A;  4PE4 A;  2LMU A;  5HLO A;  5HLV A;  3A4U B;  2BL0 B;  3BXK A;  3TDI A;  2H61 A;  4PHN A;  4QJ4 B;  4QJ5 B;  1PAL A;  1J7Q A;  3VRR A;  2AAO A;  4HRG A;  3C1V A;  2KAY A;  1PVA A;  1QXP A;  3JVT B;  5I2O A;  2JWW A;  2OPO A;  3HX4 A;  4MN0 A;  2EGD A;  1NX0 A;  1LXF C;  3M0W A;  1S6J A;  1TTX A;  2AMI A;  3PN7 C;  1LA0 A;  1S5G Z;  2HQW A;  4ORC B;  4CID A;  1K9P A;  4GGN A;  3I5H B;  2LP3 A;  1SW8 A;  1G33 A;  1SL7 A;  1IWQ A;  1C07 A;  4IL1 A;  2MJW B;  4DCK A;  1NUB A;  1KFU S;  4WQ2 A;  2K7C A;  3CR5 X;  2NXQ A;  1VRK A;  3KEV A;  1PK0 D;  1CFD A;  2M7N A;  1HT9 A;  2JC2 A;  2JT8 A;  2LVK A;  1SR6 C;  2LV7 A;  4MEW A;  4DIR A;  3LLE A;  1CDP A;  1KFU L;  3TDZ A;  4PDZ A;  3I5H C;  3IF7 A;  1PSR A;  2M97 A;  1GGZ A;  1RJV A;  1QX7 A;  2ZKM X;  4CLN A;  1SNL A;  2LNK A;  3TS5 C;  1KCY A;  4MVF A;  1QAT A;  1M45 A;  2M3W A;  1CDM A;  3DF0 B;  2Y5I A;  1S6I A;  5IBW A;  4NDC A;  1QTX A;  4MRY A;  2WCE A;  2KI6 C;  3ZWH A;  1B7T Y;  1W7J B;  1NSH A;  1MXE A;  1MXL C;  1YUT A;  1YUR A;  2K7O A;  4ZCU A;  1R6P A;  1KK8 B;  1J55 A;  1GQM A;  1QX5 B;  3LK0 A;  4AQI A;  1XK4 C;  2F3Z A;  2CXJ A;  1UWO A;  2LVI A;  1OSA A;  1OMV A;  1F70 A;  2OS8 C;  5I8N A;  5KU1 A;  4I5N B;  1Q80 A;  5PAL A;  1IQ3 A;  1F4Q A;  1M39 A;  4AOM A;  2LHI A;  1CLL A;  2WOR A;  2KOT A;  2M8U A;  4YGE B;  2NCP A;  3WXA A;  2M29 A;  2ZND A;  3VGO A;  1B8L A;  1S26 D;  1AHR A;  1E8A A;  1XA5 A;  1IKU A;  1J7R A;  2EC6 C;  4TNC A;  2LLT A;  1RTP 1;  1CFP A;  2P6B B;  1TNW A;  1XK4 A;  5KSZ A;  1JSA A;  1NX2 A;  1TIZ A;  1YVL A;  2LVJ A;  2Y1N A;  1N0Y A;  2ZN9 A;  1AUI B;  1RRO A;  2VRG A;  1K93 D;  1OOJ A;  1FI6 A;  4JQ0 D;  2M9G A;  5AER A;  1JC2 A;  2KFG A;  2LUC A;  3DF0 A;  4DUQ A;  3LCP C;  1PVB A;  1IGV A;  3CS1 A;  3SG4 A;  1H8B A;  1NPQ A;  4MZJ A;  3CWG A;  1A4P A;  4NQG A;  1SYM A;  1CMG A;  4GGF C;  1J1E A;  1BU3 A;  1OMD A;  1JFJ A;  2SCP A;  1LVC D;  5G08 A;  2ZRS A;  1CFF A;  4NDB A;  1YRT B;  3BOW B;  1G4Y R;  1OZS A;  2KDH A;  1NCY A;  2GGZ A;  3DVE A;  1U5I B;  2MBX A;  1NX1 A;  3FIA A;  2JRF A;  3MSE B;  4I5J A;  2WND A;  4OKH A;  2LAP A;  4A4B A;  1BLQ A;  2HQ8 A;  1WRK A;  4A4C A;  1OMR A;  2F3Y A;  1PUL A;  4I5K A;  5HYD A;  3PN7 B;  2BE4 A;  1KQM C;  1BMO A;  4YRU A;  3KF9 A;  1ZUZ A;  2K0J A;  1MHO A;  1N65 A;  2BE6 A;  2ZRT A;  3KHE A;  3PLF B;  2QAC A;  4MZK A;  4N1G A;  5BPJ A;  2I18 A;  5CSI A;  5JJG A;  1Y1U A;  1REC A;  2JTT A;  1XVJ A;  2JTZ A;  4MZL A;  1DTL A;  1XO5 A;  2GV5 A;  2JNF A;  2JU0 A;  3PM8 A;  1WY9 A;  2KAX A;  4Q04 A;  1XFY O;  3GK2 A;  2BCB A;  3O6B A;  4MRX A;  1F71 A;  2I2R E;  2JT0 A;  3I5G C;  5FYX A;  2MAZ A;  4MSP A;  1B9A A;  3LL8 B;  1XYD A;  1BOC A;  2O60 A;  2F33 A;  1PRW A;  1SR6 B;  1XFX O;  1NP8 A;  2FCD A;  1A75 B;  4JPZ B;  1YX8 A;  3BOW A;  3NSL A;  1BF5 A;  2G9B A;  1QLS A;  2ZN8 A;  1NYA A;  1F55 A;  1OQP A;  3OP0 A;  1U5I A;  5KTY A;  2BKH B;  1DJX A;  2MLF C;  1SL8 A;  1G8I A;  1UP5 A;  1IG5 A;  1MF8 B;  3TS5 B;  2ZFD A;  2M1U A;  1TRF A;  2HET A;  2BBN A;  1F4O A;  1K96 A;  1EG4 A;  5ER4 X;  2JUL A;  1BT6 A;  2BCA A;  1DVI A;  1A03 A;  3E3R A;  1L7Z A;  4GFT A;  2PMY A;  3EKH A;  1SPY A;  3HCM A;  3IQQ A;  2K2F A;  1SBJ A;  1MQ1 A;  2PAL A;  1IJ6 A;  2JXL A;  1SCV A;  1A2X A;  4YGB B;  1EH2 A;  3TUY C;  3AKB A;  3BUO B;  1PSB A;  1V1G A;  4PHJ A;  2OS8 B;  4N1F A;  3TZ1 A;  3OX5 A;  2CBL A;  4D1E A;  1DT7 B;  2E30 A;  1X02 A;  5J3X A;  1IH0 A;  3EK8 A;  5DKQ A;  2KGB C;  3PAL A;  1W7I B;  3SG2 A;  3RM1 A;  3EVR A;  1RFJ A;  1QLK A;  3GK1 A;  3CZT X;  1C7W A;  1D1O A;  1CM4 A;  2JNX A;  2O5G A;  2EC6 B;  5I2Q A;  3I5I C;  1A75 A;  4UPG A;  4OV2 A;  1UHJ A;  3KPX A;  1QS7 A;  4XJK B;  1WLM A;  2JT3 A;  2MHH A;  4I5L B;  3SG6 A;  4FQO A;  3DD4 A;  4MLW A;  1QIW A;  2M7L A;  1EG3 A;  1R2U A;  1J7P A;  1BR1 B;  1BR4 B;  3SJS A;  1JBA A;  3DVM A;  2IS9 A;  2L5X B;  2F8P A;  3LK1 A;  2MLE C;  4OR9 B;  4BY5 A;  3BUW B;  1JF2 A;  1DGU A;  1NX3 A;  2B1U A;  2ZNE A;  3FWB A;  1M63 B;  1M46 A;  2SAS A;  5CPV A;  1B47 A;  2PSR A;  3WNX B;  2EHB A;  1S1E A;  2LM5 A;  4E68 A;  2K8M B;  3WHT B;  4PAL A;  1J7O A;  4PE7 A;  1KWO C;  2MA2 A;  1YUS A;  3D10 A;  1JF0 A;  1WRL A;  5GQQ C;  2Q91 A;  1UHK A;  4PE1 A;  2WC8 A;  1ZMZ A;  1QV0 A;  2KQ6 A;  3GK4 X;  2M49 B;  1ALW A;  1DJZ A;  1EJ3 A;  5AAN A;  1BOD A;  1DMO A;  1N2D A;  3I5F C;  1MR8 A;  2KQY A;  2K2A A;  2BEC A;  1KQM B;  2KYF A;  1KK7 Y;  3GOF A;  4XJK A;  1BG1 A;  1F54 A;  1XFZ O;  2Y1M A;  1CTR A;  2PAS A;  1YX7 A;  5DKN A;  1K94 A;  2JOJ A;  1SCM C;  4ORA B;  1TNX A;  4GBA A;  4R1E A;  4YI9 A;  2KI4 C;  4ORB B;  3FS7 A;  2LLU A;  3IQO A;  3RLZ A;  1QVI Y;  2LUX A;  2LMV A;  3VRQ A;  4U8D A;  1CDL A;  2OTG B;  1KFX L;  1DF0 B;  1LIN A;  5JOL A;  3BUN B;  1DJG A;  3EVU A;  1V1F A;  4NDD A;  4ETO A;  1AP4 A;  4C0J A;  3D0Y B;  2KYC A;  3TDU A;  3I5G B;  2CNP A;  3O4Y A;  2F2P A;  4YBH B;  4GGF A;  5AEQ A;  1NCZ A;  1TCO B;  3CGA A;  1SKT A;  2LVV A;  1XFV O;  4WRI A;  4AQJ A;  1F8H A;  1AVS A;  1KSO A;  1WDC B;  3SIB A;  3K21 A;  4YI8 A;  1WRZ A;  1B1G A;  1K2H A;  3PSR A;  1YRU B;  2PRU A;  4OCI A;  3QRX A;  2K7B A;  1IJ5 A;  4C0K A;  4N5X A;  2M1K B;  3OB2 B;  1GGW A;  4GUK A;  1DJY A;  1IQ5 A;  2BBM A;  1TN4 A;  3ICB A;  5K89 A;  1YR5 A;  2OTG C;  1XFW O;  2FCE A;  2H61 C;  4CFR A;  1CFC A;  1DJW A;  1SMG A;  3CTN A;  1NIW A;  2LC5 A;  1B4C A;  2H2K A;  3EVV A;  1QV1 A;  2ISD A;  2D8N A;  2KBI A;  1NCX A;  2FOT A;  1SRA A;  2QPT A;  2LE9 B;  2TN4 A;  4USL A;  3BQ3 A;  1K9U A;  2JXC A;  2NLN A;  1WDC C;  3NXA A;  4GAO A;  1TCF A;  3TUY B;  2LAN A;  1S6C A;  1Y6W A;  3NSI A;  5TNC A;  1DF0 A;  4YGC B;  1JWD A;  3AAK A;  2LP2 A;  3FWC A;  3PAT A;  1ZOT B;  2I7A A;  3D0Y A;  1FPW A;  1GJY A;  2WCB A;  3EKJ A;  1SY9 A;  1CDN A;  1KK7 Z;  2AUC A;  2NCO A;  1CM1 A;  2R2I A;  4YGA A;  5CSN A;  4ZCV A;  2L50 A;  1TOP A;  1DJI A;  2KI6 D;  2LHL A;  3I5I B;  1FW4 A;  1QVI Z;  1L2O B;  1HQV A;  3JTD C;  5AFP A;  4DRW A;  3O78 A;  3NSK A; 
#chains in the Genus database with same CATH topology
 5CSF A;  2BL0 C;  1FI5 A;  2M0R A;  4INX A;  1B8R A;  2LLS A;  1AJ4 A;  3BUM B;  2KFH A;  3JVT C;  1AJ5 A;  3B86 A;  1JFK A;  2FJU B;  5D69 A;  5FI7 A;  2HF5 A;  3NGV A;  4JWQ A;  2PVB A;  2Y4Q A;  4WQ3 A;  3SG7 A;  1K8U A;  1UUS A;  3BUX B;  2BKI B;  3CLN A;  2KBM A;  3ZNI A;  1L2O C;  2JPT A;  2Q4U A;  4MBE A;  1KWO B;  1TNP A;  3CR2 A;  3S0F A;  3O2P A;  3L4A A;  5I2L A;  1UHH A;  1YVH A;  3VRN A;  3B6X A;  4GNK B;  3S0B A;  2HPS A;  1ZFS A;  1H4B A;  1ZAC A;  1SK6 D;  1DGV A;  2CTN A;  4F0Z B;  5HKY A;  1AK8 A;  1BJF A;  4QJ3 B;  1C7V A;  1S3P A;  1QX2 A;  1TWO A;  3CZ2 A;  3NSO A;  4GPL B;  3A8R A;  2NZ0 A;  2BCX A;  1A29 A;  3I5F B;  4BY4 A;  2K7D A;  2YGU A;  1UUR A;  3OX6 A;  5FI6 A;  1Y0V H;  1OE9 B;  1K95 A;  1RWY A;  5AXI A;  5D3O A;  4C0L A;  2JQ6 A;  5EL2 A;  3S0E A;  1SCM B;  5B8I B;  4HSZ A;  2KI4 B;  2I94 A;  2L2E A;  3OHM B;  1FF1 A;  2WOS A;  3CYZ A;  1Y1X A;  2DOQ A;  3VRO A;  1RK9 A;  2RGI A;  1SL9 A;  2A4J A;  3BYA A;  2MRD A;  5F6T A;  2CT9 A;  3EK4 A;  2COL B;  1MWN A;  1ODB A;  3OGN A;  3DVK A;  5ER5 A;  1LS8 A;  1K9K A;  4M2Q A;  1CMF A;  4CFQ A;  2KAV A;  1TUJ A;  1YTZ C;  4PHK A;  3VB1 A;  2CCM A;  5DKR A;  1LA3 A;  1FBV A;  2L51 A;  1KFX S;  5HKW A;  1CLM A;  4KYN A;  1QWV A;  1KK8 C;  2LMT A;  4P5O E;  1JUO A;  3AKA A;  4FTG A;  3CR4 X;  3N7H A;  3SG3 A;  1WLZ A;  4CPV A;  1S5G Y;  4HRE E;  4PCW A;  3H4S E;  3VRP A;  1KQV A;  2K61 A;  1CLB A;  3SIA A;  1CKK A;  1QJT A;  2JZI A;  4DS7 A;  3PFV A;  1KSM A;  3KO0 A;  3SG5 A;  1B8C A;  2F2O A;  4PHM A;  1K90 D;  1M31 A;  3F45 A;  2K60 A;  2KNE A;  3AAJ A;  1LKJ A;  4L9M A;  1UHN A;  1ALV A;  3UO9 A;  4XYN A;  1XFU O;  2L4I A;  4ICB A;  5CSJ A;  1J1D A;  1OOI X;  2LCP A;  1QAS A;  3OB1 B;  4M2O A;  1MUX A;  1NWD A;  4YGD B;  1S36 A;  1EL4 A;  1C3Z A;  2KFF A;  2KHN A;  1TNQ A;  3DZT A;  2V53 A;  4HRH A;  1B7T Z;  4OVN F;  1OZO A;  2KSP A;  3WHU B;  1DQE A;  5HKZ A;  2WCF A;  3S0D A;  2E6W A;  4PE0 A;  1CB1 A;  4M2P A;  2BNX A;  1EXR A;  5D7F A;  3SS3 A;  4P2Y B;  1IRJ A;  2L0P A;  1CNP A;  2L4H A;  3DVJ A;  3EK7 A;  1UHI A;  2L98 A;  2G2B A;  1Y1A A;  1YUU A;  3CZ0 A;  2KGR A;  1DJH A;  3JTD B;  2GGM A;  1QIV A;  4PE4 A;  2LMU A;  5HLO A;  1DEL A;  3S0G A;  5HLV A;  3A4U B;  2BL0 B;  3BXK A;  3L4L A;  2H61 A;  4PHN A;  3TDI A;  4QJ4 B;  4QJ5 B;  3SS5 A;  4F7F A;  1PAL A;  1J7Q A;  3VRR A;  2AAO A;  4HRG A;  3C1V A;  2KAY A;  1PVA A;  1QXP A;  3JVT B;  5I2O A;  2JWW A;  2OPO A;  2BAP A;  3HX4 A;  4MN0 A;  2EGD A;  1NX0 A;  1LXF C;  2QDI A;  1S6J A;  1TTX A;  2AMI A;  3M0W A;  3PN7 C;  1LA0 A;  1S5G Z;  2HQW A;  4ORC B;  4CID A;  1K9P A;  4GGN A;  3I5H B;  3D73 A;  2LP3 A;  1SW8 A;  1G33 A;  3B7A A;  1GM0 A;  3DY9 A;  3O4X A;  1SL7 A;  1IWQ A;  1C07 A;  4IL1 A;  2MJW B;  4DCK A;  1NUB A;  1KFU S;  4WQ2 A;  2K7C A;  3CR5 X;  2NXQ A;  1VRK A;  3KEV A;  1PK0 D;  1CFD A;  3R1O A;  2M7N A;  1HT9 A;  2JC2 A;  2JT8 A;  2LVK A;  1SR6 C;  2LV7 A;  4MEW A;  4DIR A;  3LLE A;  1CDP A;  1KFU L;  3TDZ A;  4PDZ A;  3I5H C;  3IF7 A;  1PSR A;  2M97 A;  1GGZ A;  1RJV A;  3K1E A;  1ORG A;  1QX7 A;  2ZKM X;  4CLN A;  1SNL A;  2LNK A;  3TS5 C;  1KCY A;  4MVF A;  1QAT A;  1M45 A;  2H8V A;  1CDM A;  2M3W A;  2Y5I A;  1S6I A;  3B88 A;  3DF0 B;  4NDC A;  5IBW A;  1QTX A;  4MRY A;  2WCE A;  3DXL A;  2KI6 C;  3ZWH A;  1B7T Y;  1W7J B;  1NSH A;  1MXE A;  1MXL C;  5I94 A;  1YUT A;  1YUR A;  2K7O A;  4ZCU A;  3CDN A;  1R6P A;  3PJI A;  1KK8 B;  1J55 A;  1GQM A;  1QX5 B;  3LK0 A;  4AQI A;  1XK4 C;  2F3Z A;  2CXJ A;  1UWO A;  2LVI A;  2WCH A;  1OSA A;  1OMV A;  1F70 A;  2OS8 C;  5I8N A;  5KU1 A;  2P70 A;  4I5N B;  1Q80 A;  4JPZ B;  5PAL A;  1IQ3 A;  1F4Q A;  1M39 A;  4AOM A;  2LHI A;  1CLL A;  2WOR A;  2KOT A;  2FJY A;  3B87 A;  1IIO A;  2M8U A;  4YGE B;  2NCP A;  3WXA A;  2M29 A;  2ZND A;  3VGO A;  1B8L A;  1S26 D;  1AHR A;  1TUZ A;  3R1V A;  1E8A A;  1XA5 A;  1IKU A;  1J7R A;  2EC6 C;  4TNC A;  2LLT A;  1RTP 1;  1CFP A;  2P6B B;  1TNW A;  1XK4 A;  5KSZ A;  1JSA A;  4JKT A;  1NX2 A;  1TIZ A;  1YVL A;  2LVJ A;  2Y1N A;  1N0Y A;  2ZN9 A;  1AUI B;  1RRO A;  2VRG A;  1K93 D;  1OOJ A;  2QEO A;  1FI6 A;  4JQ0 D;  2M9G A;  5AER A;  1JC2 A;  2KFG A;  2LUC A;  3DF0 A;  4DUQ A;  3LCP C;  1PVB A;  3D74 A;  1IGV A;  3CS1 A;  3SG4 A;  1H8B A;  1NPQ A;  4MZJ A;  3CWG A;  1A4P A;  4NQG A;  1SYM A;  1CMG A;  4GGF C;  1J1E A;  1BU3 A;  1OMD A;  3Q8I A;  1JFJ A;  2SCP A;  1LVC D;  5G08 A;  2ZRS A;  2QEV A;  1CFF A;  4NDB A;  1YRT B;  3BOW B;  1G4Y R;  1OZS A;  2KDH A;  1NCY A;  2GGZ A;  3DVE A;  1U5I B;  2MBX A;  1NX1 A;  3FIA A;  2JRF A;  3MSE B;  4I5J A;  2WND A;  4OKH A;  2LAP A;  4A4B A;  1BLQ A;  2HQ8 A;  1WRK A;  4A4C A;  1OMR A;  2F3Y A;  1PUL A;  4I5K A;  5HYD A;  3PN7 B;  2BE4 A;  1KQM C;  1BMO A;  3BFH A;  3KF9 A;  4YRU A;  1OOF A;  1ZUZ A;  2K0J A;  1MHO A;  1N65 A;  2BE6 A;  2ZRT A;  3KHE A;  3PLF B;  2QAC A;  3R1P A;  4MZK A;  4N1G A;  5BPJ A;  2I18 A;  5CSI A;  5JJG A;  1Y1U A;  1REC A;  2KLD A;  2WCK A;  2JTT A;  1XVJ A;  2JTZ A;  2JPO A;  1DTL A;  1XO5 A;  2GV5 A;  2JNF A;  2JU0 A;  4MZL A;  3PM8 A;  1WY9 A;  2KAX A;  4Q04 A;  1XFY O;  3GK2 A;  2BCB A;  3O6B A;  4MRX A;  1F71 A;  2I2R E;  2JT0 A;  3I5G C;  5FYX A;  3BJH A;  2MAZ A;  4MSP A;  1Z4H A;  1B9A A;  3LL8 B;  1XYD A;  1BOC A;  2O60 A;  2F33 A;  1PRW A;  1SR6 B;  1XFX O;  1NP8 A;  1OOH A;  1A75 B;  1DEK A;  2FCD A;  3D76 A;  1YX8 A;  3BOW A;  3NSL A;  1BF5 A;  2G9B A;  1QLS A;  1W9Z A;  2ZN8 A;  1NYA A;  1F55 A;  1OQP A;  3OP0 A;  1U5I A;  5KTY A;  2BKH B;  3PM2 A;  1DJX A;  2MLF C;  1SL8 A;  1G8I A;  1UP5 A;  1IG5 A;  1MF8 B;  3TS5 B;  2ZFD A;  2M1U A;  1TRF A;  2HET A;  2BBN A;  1F4O A;  1K96 A;  1EG4 A;  5ER4 X;  2ERB A;  2JUL A;  1BT6 A;  2BCA A;  1DVI A;  1A03 A;  1SSE B;  3E3R A;  1L7Z A;  4GFT A;  3L47 A;  2PMY A;  1P28 A;  1SPY A;  3EKH A;  3HCM A;  3IQQ A;  2K2F A;  3FE8 A;  1SBJ A;  1MQ1 A;  2PAL A;  1IJ6 A;  2JXL A;  1SCV A;  1A2X A;  4YGB B;  1EH2 A;  3TUY C;  3AKB A;  3BUO B;  1PSB A;  1V1G A;  4PHJ A;  2OS8 B;  4N1F A;  3TZ1 A;  3OX5 A;  2CBL A;  4D1E A;  1DT7 B;  2E30 A;  1X02 A;  5J3X A;  1C3Y A;  1IH0 A;  3EK8 A;  5DKQ A;  2KGB C;  3FE6 A;  3PAL A;  1W7I B;  3BFB A;  3SG2 A;  3RM1 A;  3EVR A;  1RFJ A;  1QLK A;  3GK1 A;  3CZT X;  1C7W A;  3D77 A;  1D1O A;  1CM4 A;  2JNX A;  2O5G A;  2EC6 B;  5I2Q A;  3QME A;  3I5I C;  3UNW A;  1A75 A;  4UPG A;  4OV2 A;  1UHJ A;  3KPX A;  1QS7 A;  4XJK B;  3S0A A;  1WLM A;  2JT3 A;  2MHH A;  3R72 A;  4I5L B;  3SG6 A;  4FQO A;  3DD4 A;  4MLW A;  1QIW A;  2M7L A;  1EG3 A;  1R2U A;  1J7P A;  1BR1 B;  1BR4 B;  2WCL A;  3SJS A;  1JBA A;  3DVM A;  2IS9 A;  2L2C A;  2L5X B;  2F8P A;  3LK1 A;  2MLE C;  4OR9 B;  4BY5 A;  3BUW B;  1JF2 A;  2QEB A;  3EG5 B;  1DGU A;  1NX3 A;  2B1U A;  2ZNE A;  3FWB A;  1M63 B;  1M46 A;  2SAS A;  5CPV A;  1B47 A;  2PSR A;  3WNX B;  5HL1 A;  2EHB A;  5DIC A;  1S1E A;  2LM5 A;  4E68 A;  2K8M B;  3WHT B;  4PAL A;  1J7O A;  4PE7 A;  3CZ1 A;  1KWO C;  2MA2 A;  1YUS A;  3D10 A;  1JF0 A;  1WRL A;  5GQQ C;  2Q91 A;  1UHK A;  4PE1 A;  2WC8 A;  3NHI A;  1ZMZ A;  2P71 A;  1QV0 A;  2WCJ A;  4FQT A;  2KQ6 A;  2KPH A;  3GK4 X;  2GTE A;  2M49 B;  2QEH A;  1ALW A;  1DJZ A;  1EJ3 A;  5AAN A;  4INW A;  1BOD A;  1DMO A;  1N2D A;  3I5F C;  1MR8 A;  2KQY A;  2K2A A;  2BEC A;  1KQM B;  2KYF A;  1KK7 Y;  3GOF A;  4XJK A;  1BG1 A;  1F54 A;  1XFZ O;  2Y1M A;  1CTR A;  2PAS A;  1YX7 A;  3NHT A;  1K94 A;  5DKN A;  2JOJ A;  4JD9 A;  1SCM C;  4ORA B;  1TNX A;  4GBA A;  4R1E A;  4YI9 A;  2KI4 C;  4ORB B;  3FS7 A;  2LLU A;  3IQO A;  3RLZ A;  1QVI Y;  1T14 A;  2LUX A;  2LMV A;  3FE9 A;  3SS4 A;  3VRQ A;  4U8D A;  1CDL A;  2OTG B;  1KFX L;  1DF0 B;  1LIN A;  5JOL A;  3BUN B;  1DJG A;  1XFR A;  1V1F A;  3EVU A;  4NDD A;  4ETO A;  1AP4 A;  4C0J A;  3D0Y B;  1OOG A;  2KYC A;  2WC5 A;  3TDU A;  3I5G B;  2CNP A;  3O4Y A;  2F2P A;  4YBH B;  4GGF A;  5AEQ A;  1NCZ A;  1TCO B;  3CGA A;  1SKT A;  2LVV A;  1XFV O;  4WRI A;  4AQJ A;  1F8H A;  1AVS A;  1KSO A;  1WDC B;  3SIB A;  3K21 A;  4YI8 A;  1WRZ A;  1B1G A;  1K2H A;  3PSR A;  1OW4 A;  1YRU B;  2KLE A;  2PRU A;  4OCI A;  3QRX A;  2K7B A;  1IJ5 A;  4C0K A;  4N5X A;  2M1K B;  3OB2 B;  1GGW A;  4GUK A;  1DJY A;  1IQ5 A;  2BBM A;  1TN4 A;  3ICB A;  5K89 A;  1YR5 A;  2OTG C;  1XFW O;  2FCE A;  2H61 C;  2PYQ A;  1DC1 A;  4CFR A;  1CFC A;  1DJW A;  1SMG A;  3CTN A;  1NIW A;  2LC5 A;  1B4C A;  2H2K A;  3BFA A;  3EVV A;  1QV1 A;  2ISD A;  2D8N A;  2KBI A;  3CAB A;  1NCX A;  2FOT A;  1SRA A;  2QPT A;  2LE9 B;  2TN4 A;  4USL A;  3BQ3 A;  1K9U A;  2JXC A;  2NLN A;  1WDC C;  3NXA A;  4GAO A;  1TCF A;  4IJ7 A;  3TUY B;  3V2L A;  3D75 A;  2LAN A;  1S6C A;  1Y6W A;  3NSI A;  4PT1 A;  5TNC A;  1DF0 A;  4YGC B;  1JWD A;  3AAK A;  2WCM A;  2LP2 A;  3FWC A;  3PAT A;  1ZOT B;  3D78 A;  2I7A A;  3D0Y A;  1FPW A;  1GJY A;  2WCB A;  3EKJ A;  1SY9 A;  2PQL A;  1CDN A;  1KK7 Z;  2AUC A;  2NCO A;  1CM1 A;  2R2I A;  4YGA A;  5CSN A;  2WC6 A;  1Z2C B;  4ZCV A;  2L50 A;  1TOP A;  1DJI A;  2KI6 D;  2LHL A;  3I5I B;  3OBV A;  1FW4 A;  5FI2 A;  3DYE A;  3IVT A;  1QVI Z;  1L2O B;  1HQV A;  4OZD A;  3JTD C;  5AFP A;  4DRW A;  3O78 A;  2L5Y A;  3NSK A;  3RZS A; 
#chains in the Genus database with same CATH homology
 5CSF A;  2BL0 C;  1FI5 A;  2M0R A;  1B8R A;  2LLS A;  1AJ4 A;  3BUM B;  2KFH A;  3JVT C;  1AJ5 A;  1JFK A;  2FJU B;  5D69 A;  2HF5 A;  4JWQ A;  2PVB A;  2Y4Q A;  4WQ3 A;  3SG7 A;  1K8U A;  1UUS A;  3BUX B;  2BKI B;  3CLN A;  2KBM A;  3ZNI A;  1L2O C;  2JPT A;  2Q4U A;  4MBE A;  1KWO B;  1TNP A;  3CR2 A;  3O2P A;  5I2L A;  1UHH A;  1YVH A;  3VRN A;  4GNK B;  2HPS A;  1ZFS A;  1H4B A;  1ZAC A;  1SK6 D;  1DGV A;  2CTN A;  4F0Z B;  5HKY A;  1AK8 A;  1BJF A;  4QJ3 B;  1C7V A;  1S3P A;  1QX2 A;  3NSO A;  4GPL B;  3A8R A;  2NZ0 A;  2BCX A;  1A29 A;  3I5F B;  4BY4 A;  2K7D A;  3OX6 A;  1UUR A;  1Y0V H;  1OE9 B;  1K95 A;  1RWY A;  5AXI A;  4C0L A;  2JQ6 A;  1SCM B;  5B8I B;  4HSZ A;  2KI4 B;  2I94 A;  2L2E A;  3OHM B;  1FF1 A;  2WOS A;  1Y1X A;  2DOQ A;  3VRO A;  1RK9 A;  2RGI A;  1SL9 A;  2A4J A;  3BYA A;  2MRD A;  5F6T A;  2CT9 A;  3EK4 A;  2COL B;  1MWN A;  1ODB A;  5ER5 A;  3DVK A;  1K9K A;  4M2Q A;  1CMF A;  4CFQ A;  2KAV A;  1YTZ C;  4PHK A;  2CCM A;  5DKR A;  1LA3 A;  1FBV A;  2L51 A;  1KFX S;  5HKW A;  1CLM A;  1KK8 C;  2LMT A;  4P5O E;  1JUO A;  3AKA A;  4FTG A;  3CR4 X;  3SG3 A;  1WLZ A;  4CPV A;  1S5G Y;  4HRE E;  4PCW A;  3H4S E;  3VRP A;  1KQV A;  2K61 A;  1CLB A;  3SIA A;  1CKK A;  1QJT A;  2JZI A;  4DS7 A;  3PFV A;  1KSM A;  3KO0 A;  3SG5 A;  1B8C A;  2F2O A;  4PHM A;  1K90 D;  1M31 A;  3F45 A;  2KNE A;  3AAJ A;  1LKJ A;  4L9M A;  1UHN A;  1ALV A;  4XYN A;  1XFU O;  2L4I A;  4ICB A;  5CSJ A;  1J1D A;  2LCP A;  3OB1 B;  1QAS A;  4M2O A;  1MUX A;  1NWD A;  4YGD B;  1S36 A;  1EL4 A;  2KHN A;  2KFF A;  1TNQ A;  2V53 A;  4HRH A;  1B7T Z;  4OVN F;  1OZO A;  2KSP A;  3WHU B;  5HKZ A;  2WCF A;  2E6W A;  4PE0 A;  1CB1 A;  4M2P A;  1EXR A;  5D7F A;  4P2Y B;  1IRJ A;  2L0P A;  1CNP A;  2L4H A;  3DVJ A;  3EK7 A;  1UHI A;  2L98 A;  2G2B A;  1Y1A A;  1YUU A;  2KGR A;  1DJH A;  3JTD B;  2GGM A;  1QIV A;  4PE4 A;  2LMU A;  5HLO A;  5HLV A;  3A4U B;  2BL0 B;  3BXK A;  3TDI A;  2H61 A;  4PHN A;  4QJ4 B;  4QJ5 B;  1PAL A;  1J7Q A;  3VRR A;  2AAO A;  4HRG A;  3C1V A;  2KAY A;  1PVA A;  1QXP A;  3JVT B;  5I2O A;  2JWW A;  2OPO A;  3HX4 A;  4MN0 A;  2EGD A;  1NX0 A;  1LXF C;  3M0W A;  1S6J A;  1TTX A;  2AMI A;  3PN7 C;  1LA0 A;  1S5G Z;  2HQW A;  4ORC B;  4CID A;  1K9P A;  4GGN A;  3I5H B;  2LP3 A;  1SW8 A;  1G33 A;  1SL7 A;  1IWQ A;  1C07 A;  4IL1 A;  2MJW B;  4DCK A;  1NUB A;  1KFU S;  4WQ2 A;  2K7C A;  3CR5 X;  2NXQ A;  1VRK A;  3KEV A;  1PK0 D;  1CFD A;  2M7N A;  1HT9 A;  2JC2 A;  2JT8 A;  2LVK A;  1SR6 C;  2LV7 A;  4MEW A;  4DIR A;  3LLE A;  1CDP A;  1KFU L;  3TDZ A;  4PDZ A;  3I5H C;  3IF7 A;  1PSR A;  2M97 A;  1GGZ A;  1RJV A;  1QX7 A;  2ZKM X;  4CLN A;  1SNL A;  2LNK A;  3TS5 C;  1KCY A;  4MVF A;  1QAT A;  1M45 A;  2M3W A;  1CDM A;  3DF0 B;  2Y5I A;  1S6I A;  5IBW A;  4NDC A;  1QTX A;  4MRY A;  2WCE A;  2KI6 C;  3ZWH A;  1B7T Y;  1W7J B;  1NSH A;  1MXE A;  1MXL C;  1YUT A;  1YUR A;  2K7O A;  4ZCU A;  1R6P A;  1KK8 B;  1J55 A;  1GQM A;  1QX5 B;  3LK0 A;  4AQI A;  1XK4 C;  2F3Z A;  2CXJ A;  1UWO A;  2LVI A;  1OSA A;  1OMV A;  1F70 A;  2OS8 C;  5I8N A;  5KU1 A;  4I5N B;  1Q80 A;  5PAL A;  1IQ3 A;  1F4Q A;  1M39 A;  4AOM A;  2LHI A;  1CLL A;  2WOR A;  2KOT A;  2M8U A;  4YGE B;  2NCP A;  3WXA A;  2M29 A;  2ZND A;  3VGO A;  1B8L A;  1S26 D;  1AHR A;  1E8A A;  1XA5 A;  1IKU A;  1J7R A;  2EC6 C;  4TNC A;  2LLT A;  1RTP 1;  1CFP A;  2P6B B;  1TNW A;  1XK4 A;  5KSZ A;  1JSA A;  1NX2 A;  1TIZ A;  1YVL A;  2LVJ A;  2Y1N A;  1N0Y A;  2ZN9 A;  1AUI B;  1RRO A;  2VRG A;  1K93 D;  1OOJ A;  1FI6 A;  4JQ0 D;  2M9G A;  5AER A;  1JC2 A;  2KFG A;  2LUC A;  3DF0 A;  4DUQ A;  3LCP C;  1PVB A;  1IGV A;  3CS1 A;  3SG4 A;  1H8B A;  1NPQ A;  4MZJ A;  3CWG A;  1A4P A;  4NQG A;  1SYM A;  1CMG A;  4GGF C;  1J1E A;  1BU3 A;  1OMD A;  1JFJ A;  2SCP A;  1LVC D;  5G08 A;  2ZRS A;  1CFF A;  4NDB A;  1YRT B;  3BOW B;  1G4Y R;  1OZS A;  2KDH A;  1NCY A;  2GGZ A;  3DVE A;  1U5I B;  2MBX A;  1NX1 A;  3FIA A;  2JRF A;  3MSE B;  4I5J A;  2WND A;  4OKH A;  2LAP A;  4A4B A;  1BLQ A;  2HQ8 A;  1WRK A;  4A4C A;  1OMR A;  2F3Y A;  1PUL A;  4I5K A;  5HYD A;  3PN7 B;  2BE4 A;  1KQM C;  1BMO A;  4YRU A;  3KF9 A;  1ZUZ A;  2K0J A;  1MHO A;  1N65 A;  2BE6 A;  2ZRT A;  3KHE A;  3PLF B;  2QAC A;  4MZK A;  4N1G A;  5BPJ A;  2I18 A;  5CSI A;  5JJG A;  1Y1U A;  1REC A;  2JTT A;  1XVJ A;  2JTZ A;  4MZL A;  1DTL A;  1XO5 A;  2GV5 A;  2JNF A;  2JU0 A;  3PM8 A;  1WY9 A;  2KAX A;  4Q04 A;  1XFY O;  3GK2 A;  2BCB A;  3O6B A;  4MRX A;  1F71 A;  2I2R E;  2JT0 A;  3I5G C;  5FYX A;  2MAZ A;  4MSP A;  1B9A A;  3LL8 B;  1XYD A;  1BOC A;  2O60 A;  2F33 A;  1PRW A;  1SR6 B;  1XFX O;  1NP8 A;  2FCD A;  1A75 B;  4JPZ B;  1YX8 A;  3BOW A;  3NSL A;  1BF5 A;  2G9B A;  1QLS A;  2ZN8 A;  1NYA A;  1F55 A;  1OQP A;  3OP0 A;  1U5I A;  5KTY A;  2BKH B;  1DJX A;  2MLF C;  1SL8 A;  1G8I A;  1UP5 A;  1IG5 A;  1MF8 B;  3TS5 B;  2ZFD A;  2M1U A;  1TRF A;  2HET A;  2BBN A;  1F4O A;  1K96 A;  1EG4 A;  5ER4 X;  2JUL A;  1BT6 A;  2BCA A;  1DVI A;  1A03 A;  3E3R A;  1L7Z A;  4GFT A;  2PMY A;  3EKH A;  1SPY A;  3HCM A;  3IQQ A;  2K2F A;  1SBJ A;  1MQ1 A;  2PAL A;  1IJ6 A;  2JXL A;  1SCV A;  1A2X A;  4YGB B;  1EH2 A;  3TUY C;  3AKB A;  3BUO B;  1PSB A;  1V1G A;  4PHJ A;  2OS8 B;  4N1F A;  3TZ1 A;  3OX5 A;  2CBL A;  4D1E A;  1DT7 B;  2E30 A;  1X02 A;  5J3X A;  1IH0 A;  3EK8 A;  5DKQ A;  2KGB C;  3PAL A;  1W7I B;  3SG2 A;  3RM1 A;  3EVR A;  1RFJ A;  1QLK A;  3GK1 A;  3CZT X;  1C7W A;  1D1O A;  1CM4 A;  2JNX A;  2O5G A;  2EC6 B;  5I2Q A;  3I5I C;  1A75 A;  4UPG A;  4OV2 A;  1UHJ A;  3KPX A;  1QS7 A;  4XJK B;  1WLM A;  2JT3 A;  2MHH A;  4I5L B;  3SG6 A;  4FQO A;  3DD4 A;  4MLW A;  1QIW A;  2M7L A;  1EG3 A;  1R2U A;  1J7P A;  1BR1 B;  1BR4 B;  3SJS A;  1JBA A;  3DVM A;  2IS9 A;  2L5X B;  2F8P A;  3LK1 A;  2MLE C;  4OR9 B;  4BY5 A;  3BUW B;  1JF2 A;  1DGU A;  1NX3 A;  2B1U A;  2ZNE A;  3FWB A;  1M63 B;  1M46 A;  2SAS A;  5CPV A;  1B47 A;  2PSR A;  3WNX B;  2EHB A;  1S1E A;  2LM5 A;  4E68 A;  2K8M B;  3WHT B;  4PAL A;  1J7O A;  4PE7 A;  1KWO C;  2MA2 A;  1YUS A;  3D10 A;  1JF0 A;  1WRL A;  5GQQ C;  2Q91 A;  1UHK A;  4PE1 A;  2WC8 A;  1ZMZ A;  1QV0 A;  2KQ6 A;  3GK4 X;  2M49 B;  1ALW A;  1DJZ A;  1EJ3 A;  5AAN A;  1BOD A;  1DMO A;  1N2D A;  3I5F C;  1MR8 A;  2KQY A;  2K2A A;  2BEC A;  1KQM B;  2KYF A;  1KK7 Y;  3GOF A;  4XJK A;  1BG1 A;  1F54 A;  1XFZ O;  2Y1M A;  1CTR A;  2PAS A;  1YX7 A;  5DKN A;  1K94 A;  2JOJ A;  1SCM C;  4ORA B;  1TNX A;  4GBA A;  4R1E A;  4YI9 A;  2KI4 C;  4ORB B;  3FS7 A;  2LLU A;  3IQO A;  3RLZ A;  1QVI Y;  2LUX A;  2LMV A;  3VRQ A;  4U8D A;  1CDL A;  2OTG B;  1KFX L;  1DF0 B;  1LIN A;  5JOL A;  3BUN B;  1DJG A;  3EVU A;  1V1F A;  4NDD A;  4ETO A;  1AP4 A;  4C0J A;  3D0Y B;  2KYC A;  3TDU A;  3I5G B;  2CNP A;  3O4Y A;  2F2P A;  4YBH B;  4GGF A;  5AEQ A;  1NCZ A;  1TCO B;  3CGA A;  1SKT A;  2LVV A;  1XFV O;  4WRI A;  4AQJ A;  1F8H A;  1AVS A;  1KSO A;  1WDC B;  3SIB A;  3K21 A;  4YI8 A;  1WRZ A;  1B1G A;  1K2H A;  3PSR A;  1YRU B;  2PRU A;  4OCI A;  3QRX A;  2K7B A;  1IJ5 A;  4C0K A;  4N5X A;  2M1K B;  3OB2 B;  1GGW A;  4GUK A;  1DJY A;  1IQ5 A;  2BBM A;  1TN4 A;  3ICB A;  5K89 A;  1YR5 A;  2OTG C;  1XFW O;  2FCE A;  2H61 C;  4CFR A;  1CFC A;  1DJW A;  1SMG A;  3CTN A;  1NIW A;  2LC5 A;  1B4C A;  2H2K A;  3EVV A;  1QV1 A;  2ISD A;  2D8N A;  2KBI A;  1NCX A;  2FOT A;  1SRA A;  2QPT A;  2LE9 B;  2TN4 A;  4USL A;  3BQ3 A;  1K9U A;  2JXC A;  2NLN A;  1WDC C;  3NXA A;  4GAO A;  1TCF A;  3TUY B;  2LAN A;  1S6C A;  1Y6W A;  3NSI A;  5TNC A;  1DF0 A;  4YGC B;  1JWD A;  3AAK A;  2LP2 A;  3FWC A;  3PAT A;  1ZOT B;  2I7A A;  3D0Y A;  1FPW A;  1GJY A;  2WCB A;  3EKJ A;  1SY9 A;  1CDN A;  1KK7 Z;  2AUC A;  2NCO A;  1CM1 A;  2R2I A;  4YGA A;  5CSN A;  4ZCV A;  2L50 A;  1TOP A;  1DJI A;  2KI6 D;  2LHL A;  3I5I B;  1FW4 A;  1QVI Z;  1L2O B;  1HQV A;  3JTD C;  5AFP A;  4DRW A;  3O78 A;  3NSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...