2KFGA

Structure of the c-terminal domain of ehd1 in complex with fnyestdpftak
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
b'GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
molecule tags Protein binding
source organism Homo sapiens
publication title Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
pubmed doi rcsb
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kfgA00
1IWQA 2Y1NA 1JUOA 2K7BA 5AANA 4ZCVA 1B7TY 1J7QA 2KDHA 1AUIB 3MSEB 2O60A 3WHUB 2M8UA 3GK4X 1KK8C 2HF5A 1K96A 2LC5A 3LK0A 2JOJA 2HETA 4ORAB 3JTDC 1QASA 5I2OA 1EG3A 3FWBA 4AQJA 1BOCA 4OCIA 3KPXA 3CZTX 4NDDA 4UPGA 4YI8A 2JTTA 4R1EA 5ER5A 4MEWA 4AQIA 1JF0A 2BE6A 2EC6B 2KOTA 3I5FB 2MLFC 4YGCB 4HRGA 1DVIA 3TUYB 5ER4X 1S26D 2JULA 2NCPA 1BT6A 1KK7Y 2GGMA 3I5HC 1QIWA 1WLMA 4ICBA 1A29A 1OZSA 5JOLA 1CFFA 1SL7A 2LHIA 2AUCA 4PCWA 1QTXA 1EL4A 1JF2A 2NZ0A 5FYXA 1UHKA 1R2UA 4I5JA 3PSRA 4DRWA 4BY5A 4GNKB 2LM5A 1F4QA 2Y1MA 3DVJA 3M0WA 1SCMC 2H2KA 2L2EA 1QJTA 1YUSA 4GPLB 1YURA 1CDPA 2PMYA 5D69A 1Q80A 2CBLA 3ZNIA 1SKTA 2KI4B 1MF8B 4GGNA 2BE4A 5KTYA 4C0LA 1S3PA 2F8PA 1TNPA 2Y5IA 1IKUA 1QIVA 1CM4A 2KFFA 3LL8B 2BL0B 2F33A 1B47A 1M45A 1IJ5A 4C0KA 1RROA 1S1EA 2JXLA 1CM1A 2KGRA 3BQ3A 1OZOA 1JWDA 1S6CA 2I7AA 1G4YR 2LVKA 4OVNF 1OQPA 1YX7A 1BODA 2GV5A 1C7VA 1AHRA 2AAOA 3NSIA 1B8CA 1SR6B 2ZNEA 2LCPA 1TCOB 1ZUZA 2KGBC 4YGEB 4OV2A 2CNPA 1WRKA 1CLMA 1SY9A 4M2PA 4XJKA 3VRPA 2D8NA 2EHBA 3BYAA 4MN0A 2V53A 1MQ1A 1TCFA 1L2OC 1LA3A 2KAYA 3NSOA 4YGBB 3H4SE 1DGVA 2BBMA 2G9BA 3SG4A 1K94A 4WRIA 3TS5B 1RK9A 2Q91A 2LUCA 1ZOTB 3KHEA 1CNPA 1FW4A 1H4BA 3I5IB 3VRNA 2MHHA 4DUQA 1RECA 2LAPA 4PE4A 1QS7A 1KSMA 5AFPA 1K93D 4MZKA 4PHNA 1UUSA 1QX7A 1UHIA 1J7RA 5JJGA 1RFJA 3JTDB 4MRYA 4P5OE 5DKNA 1H8BA 1KFUL 1J7PA 2JT0A 2M1UA 2HQ8A 4PE1A 1DF0B 1UHJA 3AAKA 4ORCB 1OMDA 1YRUB 3CS1A 4GGFC 1GJYA 2M1KB 1S5GZ 4OR9B 1EG4A 5HYDA 1PVAA 1D1OA 2JC2A 4MSPA 1Y0VH 1YRTB 2ZN9A 4PE7A 1U5IA 2LANA 1NWDA 1AK8A 1XFYO 3KO0A 1SPYA 5BPJA 1SMGA 1B4CA 2WCEA 1OOJA 2OTGB 3PALA 2JWWA 1BR4B 1DJIA 2KYCA 5DKQA 1J7OA 3PN7C 2WCBA 4PE0A 3NXAA 2CT9A 4PHJA 3F45A 1MXLC 3D0YA 4GUKA 1CDMA 1BR1B 2KI6C 1NIWA 1ZMZA 2K8MB 4XYNA 4M2OA 2R2IA 2KI4C 1S36A 1B9AA 3EKJA 3SIAA 1YUTA 5K89A 1JSAA 2LMTA 1TNXA 3LCPC 2M7LA 3SG6A 1AJ5A 2JPTA 2KYFA 4GAOA 2KNEA 2LUXA 3ICBA 2OS8B 1OMRA 2I94A 1DF0A 2K7OA 2EC6C 3E3RA 2KFHA 1A2XA 4BY4A 1NSHA 4QJ3B 1SR6C 1WDCC 3PM8A 2CCMA 3CR2A 3I5HB 1NX1A 2AMIA 1ALWA 2BKIB 1UP5A 1BLQA 4OKHA 1OMVA 2NXQA 2Q4UA 1LVCD 1CDNA 1K95A 1IQ3A 5CSJA 2F3ZA 1KQVA 3I5GC 2LP3A 2M97A 1TNQA 2K7DA 2SCPA 1CDLA 2L4IA 3BUOB 5AEQA 2BBNA 1XFUO 4MVFA 4P2YB 1SCMB 3EKHA 4HRHA 2M0RA 1WY9A 3O78A 1BMOA 3VGOA 4YBHB 4ETOA 1B7TZ 3CR5X 2L98A 3A4UB 2Y4QA 1MR8A 3JVTC 5CSFA 2FCEA 3IQOA 1WLZA 2HQWA 3RM1A 1CB1A 2LMUA 3O6BA 1BF5A 3DVEA 5CSIA 1F54A 1EJ3A 4MZJA 1F8HA 3CGAA 3TZ1A 4HREE 4I5LB 1E8AA 1GQMA 4M2QA 1TOPA 1C07A 1EH2A 2JU0A 3OB1B 4NDBA 3BOWB 2WC8A 2OPOA 5I2QA 1KSOA 1S6IA 1PRWA 1CMFA 5PALA 2DOQA 1WRLA 2KAVA 2L51A 1KQMC 2L0PA 3EK8A 1PSRA 1ALVA 1DJXA 1N2DA 4PDZA 2PASA 3SG5A 1TNWA 3RLZA 3CWGA 1KFXS 1A75A 2JRFA 4NDCA 2SASA 1RTP1 2ZKMX 1SYMA 3PN7B 5AERA 5IBWA 1LKJA 2BKHB 2E30A 4A4BA 4YI9A 2LP2A 3ZWHA 1YVHA 2KBMA 1JC2A 1QV0A 1B1GA 4ZCUA 3DD4A 2MRDA 4Q04A 1FBVA 1SK6D 3VROA 4CFQA 4D1EA 1BG1A 4FQOA 1PSBA 4HSZA 4N5XA 1S6JA 2NLNA 3NSKA 4WQ2A 2COLB 4YGDB 1HT9A 2I18A 2JXCA 3LK1A 1XYDA 3O2PA 1IH0A 1B8LA 1LA0A 1DJZA 1W7IB 3DVMA 3GOFA 3D10A 1WDCB 3OX6A 1SBJA 4MRXA 5AXIA 5HLOA 1CMGA 2WCFA 2LLUA 1EXRA 3BUMB 4CFRA 2MA2A 1G8IA 1SNLA 1NX3A 1M31A 1AP4A 4N1FA 2A4JA 2FJUB 3EVVA 3EVUA 3OX5A 5DKRA 3AAJA 2FCDA 2B1UA 1CKKA 2L4HA 2H61C 2ZFDA 3KF9A 4N1GA 4CPVA 3DF0B 5GQQC 1KFXL 4NQGA 2M7NA 1JFKA 4TNCA 1OSAA 4WQ3A 1J55A 2MJWB 1CTRA 3O4YA 2LV7A 3PLFB 2IS9A 2NCOA 2ISDA 3JVTB 2K0JA 1IRJA 4MLWA 1KWOB 1VRKA 2K61A 2OS8C 3AKAA 4DS7A 1Y1XA 3SIBA 3PFVA 3SJSA 2M49B 1JFJA 1PULA 1XK4C 1TIZA 1Y6WA 3FWCA 3VRRA 3AKBA 2I2RE 2WORA 1QXPA 1RWYA 2K2AA 1B8RA 1PALA 3OB2B 1F4OA 5HKYA 1K90D 1QX5B 4CIDA 4AOMA 1NCYA 2F2PA 1XFZO 1FI5A 1U5IB 4QJ5B 1N0YA 5B8IB 1J1DA 1GGZA 3WNXB 3I5GB 1N65A 3SG3A 1CFCA 3BUXB 1JBAA 1TN4A 1MHOA 1MWNA 3CLNA 3EK7A 4JPZB 2LVJA 1M63B 1S5GY 3OHMB 1YTZC 2PRUA 3CTNA 5HKWA 2LLTA 1W7JB 3IQQA 1K9KA 2PVBA 3FIAA 3OP0A 3SG7A 1FF1A 2M3WA 3DVKA 3IF7A 1TRFA 1KK8B 2WNDA 1BJFA 2CXJA 3EK4A 4F0ZB 2JNFA 5CPVA 5G08A 2JT8A 1F70A 1DJYA 4E68A 3C1VA 1F71A 1FPWA 1IJ6A 2G2BA 5HLVA 1GGWA 1MUXA 1IGVA 1OE9B 4DIRA 1XO5A 2CTNA 1G33A 1AJ4A 2LVVA 2P6BB 1K9UA 2LNKA 3I5FC 5D7FA 5J3XA 1L7ZA 3DF0A 2GGZA 2QPTA 4I5KA 2K2FA 4XJKB 3TUYC 1DJGA 1ODBA 1K8UA 2LHLA 1UHNA 2KAXA 3TDUA 4MZLA 1KQMB 5I2LA 1WRZA 2KSPA 1XFVO 1QV1A 1UHHA 2JNXA 2QACA 1DJHA 2KQYA 2LVIA 4PALA 1M39A 3WXAA 3GK1A 3TDIA 4YGAA 4JQ0D 1DGUA 1K9PA 1NUBA 1Y1AA 3GK2A 4CLNA 1KK7Z 3D0YB 2FOTA 1UWOA 1NX2A 1XFXO 2EGDA 4PHMA 2MAZA 3SG2A 1FI6A 2BCBA 1X02A 1A4PA 2ZRTA 3HX4A 1QVIY 4A4CA 1XVJA 2BL0C 5KSZA 1TTXA 3PATA 2BCXA 2L50A 1QLKA 1DMOA 5HKZA 5CSNA 4GBAA 1A75B 1AVSA 1A03A 2WOSA 2JZIA 2KHNA 3WHTB 1NP8A 1KFUS 1QLSA 2O5GA 3BXKA 1V1FA 3KEVA 4I5NB 4C0JA 5F6TA 3BUWB 3QRXA 1SCVA 4GFTA 3LLEA 1YR5A 2ZRSA 4JWQA 1V1GA 1CFDA 1NCXA 2JQ6A 4YRUA 1CLBA 1C7WA 1RJVA 2KBIA 2KQ6A 5KU1A 3CR4X 2BECA 3TDZA 1CLLA 1IQ5A 4ORBB 1NCZA 1CFPA 1F55A 1ZFSA 1KCYA 1QATA 2ZNDA 3FS7A 3K21A 2K7CA 1ZACA 2M9GA 2PALA 1QVIZ 1LINA 2H61A 2RGIA 2HPSA 1XFWO 1HQVA 3BOWA 3I5IC 4DCKA 2LMVA 1YUUA 2PSRA 2KI6D 1DTLA 2LLSA 2M29A 2ZN8A 2E6WA 1BU3A 2F2OA 4PHKA 3VRQA 3NSLA 1M46A 1MXEA 3BUNB 1KWOC 1K2HA 2LE9B 1DJWA 1NX0A 4USLA 2L5XB 1NYAA 4QJ4B 1SL9A 1YX8A 3A8RA 5TNCA 1XK4A 4U8DA 3HCMA 4FTGA 1LXFC 2MBXA 4GGFA 1R6PA 1PK0D 1QX2A 2F3YA 1YVLA 2MLEC 4IL1A 2VRGA 1L2OB 3EVRA 4L9MA 5I8NA 1PVBA 1IG5A 1Y1UA 2JT3A 2JTZA 3TS5C 1DT7B 2KFGA 1SRAA 1UURA 1XA5A 4MBEA 1SW8A 2BCAA 2OTGC 2TN4A 1J1EA 1SL8A 1NPQA
chains in the Genus database with same CATH superfamily
2L5YA 1IWQA 2Y1NA 3OGNA 1JUOA 2K7BA 5AANA 4ZCVA 1B7TY 1J7QA 2KDHA 1AUIB 3MSEB 2O60A 3WHUB 2M8UA 4PT1A 3GK4X 1KK8C 2HF5A 1K96A 2LC5A 3LK0A 2JOJA 2HETA 4ORAB 3JTDC 1QASA 5I2OA 1LS8A 1EG3A 3FWBA 4AQJA 1BOCA 4OCIA 3KPXA 3CZTX 4NDDA 4UPGA 4YI8A 2JTTA 4R1EA 5ER5A 4MEWA 4AQIA 1JF0A 2BE6A 2EC6B 2KOTA 3I5FB 2MLFC 4YGCB 4HRGA 3UO9A 2WCKA 1DVIA 5DICA 3TUYB 5ER4X 3S0FA 1S26D 3D74A 2JULA 2NCPA 1BT6A 1KK7Y 2GGMA 3I5HC 1QIWA 3CZ2A 1WLMA 4ICBA 3S0DA 1A29A 1OW4A 1OZSA 5JOLA 1Z4HA 1CFFA 1SL7A 3B7AA 3K1EA 2LHIA 2AUCA 4PCWA 1QTXA 1EL4A 1JF2A 2NZ0A 5FYXA 1UHKA 3V2LA 1R2UA 4I5JA 3PSRA 4DRWA 4BY5A 4GNKB 1OOGA 2LM5A 1F4QA 2Y1MA 3DVJA 3M0WA 1OOFA 3CZ0A 1SCMC 2H2KA 4JKTA 2L2EA 1QJTA 1YUSA 4GPLB 1YURA 1CDPA 2PMYA 5D69A 1Q80A 2CBLA 2FJYA 1SKTA 2KI4B 1MF8B 4GGNA 2BE4A 5KTYA 4C0LA 1S3PA 2F8PA 1TNPA 2Y5IA 1IKUA 3SS3A 1QIVA 2WCMA 1CM4A 2KFFA 3LL8B 2BL0B 2F33A 1B47A 1M45A 1IJ5A 4C0KA 1RROA 1S1EA 2JXLA 1CM1A 2KGRA 3BQ3A 3D78A 1OZOA 1JWDA 1S6CA 2I7AA 1G4YR 2LVKA 4OVNF 1OQPA 1YX7A 1BODA 2GV5A 1C7VA 1AHRA 2AAOA 4INWA 3NSIA 1B8CA 1SR6B 2ZNEA 2LCPA 1TCOB 1ZUZA 2KGBC 4YGEB 4OV2A 1IIOA 2CNPA 1WRKA 1CLMA 1SY9A 2H8VA 4M2PA 4XJKA 3VRPA 2D8NA 2EHBA 3BYAA 4MN0A 2V53A 1MQ1A 1TCFA 1L2OC 1LA3A 2KAYA 3NSOA 4YGBB 3H4SE 3DZTA 1DGVA 2BBMA 2G9BA 3SG4A 1K94A 4WRIA 3Q8IA 3TS5B 1RK9A 2Q91A 2LUCA 5HL1A 1ZOTB 3KHEA 1CNPA 1FW4A 1H4BA 3I5IB 3VRNA 2MHHA 4DUQA 1RECA 2P70A 2LAPA 4PE4A 1QS7A 1KSMA 5AFPA 1K93D 4MZKA 4PHNA 1UUSA 1QX7A 1UHIA 1TUZA 1J7RA 1GM0A 5JJGA 3CDNA 3S0GA 1RFJA 3JTDB 4MRYA 4P5OE 5DKNA 1H8BA 4F7FA 1KFUL 1J7PA 2JT0A 2M1UA 2HQ8A 4PE1A 1OOHA 1DF0B 1UHJA 3AAKA 4ORCB 1OMDA 1YRUB 3CS1A 4GGFC 1GJYA 2M1KB 1S5GZ 4OR9B 1EG4A 3R1VA 1PVAA 1D1OA 2JC2A 1Z2CB 4MSPA 1Y0VH 1YRTB 2ZN9A 4PE7A 1U5IA 2LANA 5D3OA 3UNWA 1NWDA 1AK8A 1P28A 1XFYO 3KO0A 1SPYA 5BPJA 1SMGA 1B4CA 2WCEA 1OOJA 2OTGB 3PALA 2KLDA 2JWWA 1BR4B 1DJIA 2KYCA 5DKQA 1J7OA 3PN7C 3L4AA 2WCBA 4PE0A 1W9ZA 3NXAA 2CT9A 4PHJA 3F45A 1MXLC 3D0YA 4GUKA 1CDMA 1BR1B 2KI6C 4OZDA 1NIWA 1ZMZA 2K8MB 1C3ZA 4M2OA 2PQLA 2R2IA 2KI4C 2QEBA 4XYNA 1S36A 1B9AA 3EKJA 3SIAA 1YUTA 5K89A 1JSAA 2LMTA 1TNXA 3LCPC 2M7LA 3SG6A 2QDIA 1AJ5A 2JPTA 2KYFA 4GAOA 2KNEA 2LUXA 3ICBA 2GTEA 2OS8B 1OMRA 5HYDA 2I94A 1DF0A 2K7OA 2EC6C 3E3RA 2KFHA 1A2XA 3D76A 4BY4A 2P71A 1NSHA 3B87A 4QJ3B 1SR6C 3RZSA 1WDCC 3PM8A 3BFAA 2CCMA 3CR2A 3I5HB 1NX1A 3O4XA 2AMIA 3N7HA 1ALWA 2BKIB 1UP5A 1BLQA 4OKHA 1OMVA 2NXQA 2Q4UA 1LVCD 4JD9A 1CDNA 2WCLA 2WC5A 1K95A 1IQ3A 5CSJA 2F3ZA 1KQVA 3I5GC 2LP3A 2M97A 1TNQA 1OOIX 2K7DA 2SCPA 3CABA 1CDLA 2L4IA 3BUOB 5AEQA 2BBNA 1XFUO 4MVFA 4P2YB 1SCMB 3EKHA 1DELA 2M0RA 4HRHA 1WY9A 3O78A 1BMOA 3VGOA 4YBHB 4ETOA 1B7TZ 3SS4A 3L47A 3CR5X 2L98A 3A4UB 2Y4QA 3BFBA 4FQTA 1MR8A 3JVTC 5CSFA 2FCEA 3SS5A 3IQOA 1WLZA 2HQWA 3RM1A 2WCHA 1CB1A 2LMUA 3O6BA 1BF5A 3DVEA 5CSIA 1F54A 1EJ3A 4MZJA 3ZNIA 1F8HA 3CGAA 3TZ1A 3R72A 4HREE 4I5LB 1E8AA 1GQMA 4M2QA 1TOPA 1C07A 1EH2A 2JU0A 3OB1B 4NDBA 3BOWB 2WCJA 2WC8A 2OPOA 5I2QA 1KSOA 1S6IA 1PRWA 1CMFA 5PALA 2DOQA 1WRLA 2KAVA 2L51A 1KQMC 2L0PA 3EK8A 1PSRA 1ALVA 1DJXA 1N2DA 4PDZA 2PASA 3SG5A 1TNWA 3RLZA 3CWGA 2KPHA 1KFXS 1A75A 2JRFA 4NDCA 2SASA 1RTP1 2ZKMX 1SYMA 3DXLA 3PN7B 5AERA 5IBWA 1LKJA 2BKHB 2E30A 4A4BA 3BJHA 4YI9A 2LP2A 3ZWHA 1YVHA 3R1PA 2KBMA 3FE8A 2BNXA 1JC2A 1QV0A 1B1GA 4ZCUA 3DD4A 2MRDA 1T14A 4Q04A 1FBVA 1SK6D 3VROA 4CFQA 4D1EA 1BG1A 4FQOA 1PSBA 4HSZA 4N5XA 1S6JA 2NLNA 3NSKA 4WQ2A 2COLB 4YGDB 1HT9A 2I18A 2JXCA 3LK1A 1XYDA 3O2PA 1IH0A 2KLEA 1B8LA 1LA0A 1DJZA 1W7IB 3B88A 3DVMA 3GOFA 3D10A 1WDCB 3D75A 3OX6A 1SBJA 3D77A 4MRXA 5AXIA 5HLOA 1CMGA 2WCFA 2LLUA 1EXRA 3BUMB 4CFRA 2MA2A 1G8IA 1SNLA 3EG5B 1NX3A 3VB1A 1M31A 3R1OA 1AP4A 2BAPA 4N1FA 2A4JA 3CYZA 2FJUB 3EVVA 3EVUA 3OX5A 5DKRA 3AAJA 2FCDA 2B1UA 1CKKA 3S0BA 2L4HA 3B86A 2H61C 4INXA 2ZFDA 3D73A 3KF9A 4N1GA 4CPVA 3DF0B 5GQQC 1KFXL 4NQGA 2M7NA 1JFKA 4TNCA 1OSAA 4WQ3A 1J55A 2MJWB 1CTRA 3O4YA 2LV7A 3PLFB 2IS9A 2NCOA 2WC6A 3L4LA 2ISDA 2QEVA 2K0JA 3JVTB 1IRJA 3CZ1A 4MLWA 1KWOB 1VRKA 2K61A 2OS8C 3AKAA 4DS7A 1Y1XA 1DC1A 4KYNA 3SIBA 3PFVA 3SJSA 2M49B 1JFJA 1PULA 1XK4C 1TIZA 1Y6WA 3FWCA 3VRRA 3B6XA 3AKBA 2I2RE 2WORA 1QXPA 3S0AA 1RWYA 2K2AA 5FI2A 1B8RA 1PALA 3OB2B 1F4OA 5HKYA 1K90D 1QX5B 4CIDA 3QMEA 4AOMA 5FI7A 1NCYA 2F2PA 1XFZO 2K60A 1FI5A 1U5IB 4QJ5B 1N0YA 5B8IB 1J1DA 1GGZA 3WNXB 3I5GB 1N65A 3SG3A 1CFCA 3BUXB 1JBAA 1TN4A 1TUJA 1MHOA 1MWNA 3CLNA 3FE6A 3EK7A 4JPZB 2LVJA 2PYQA 1M63B 1S5GY 3OHMB 1YTZC 2PRUA 3CTNA 3NHIA 5HKWA 2LLTA 1W7JB 3IQQA 1K9KA 2PVBA 3FIAA 3OP0A 3SG7A 1FF1A 2M3WA 3DVKA 3IF7A 1TRFA 1KK8B 2WNDA 1BJFA 2CXJA 3EK4A 4F0ZB 2JNFA 5CPVA 5G08A 2JT8A 1F70A 1DJYA 4E68A 3C1VA 1F71A 2QEHA 1IJ6A 2G2BA 5HLVA 1FPWA 1GGWA 1MUXA 1IGVA 1OE9B 4DIRA 1XO5A 1C3YA 2CTNA 1G33A 1AJ4A 2LVVA 2P6BB 1K9UA 2LNKA 3I5FC 5D7FA 5J3XA 1L7ZA 3DF0A 2GGZA 2QPTA 4I5KA 2K2FA 3NHTA 4XJKB 1DJGA 3TUYC 1ODBA 1K8UA 2LHLA 1UHNA 2KAXA 3TDUA 4MZLA 1KQMB 5I2LA 1WRZA 1XFRA 2KSPA 3DYEA 1XFVO 1QV1A 1UHHA 2JNXA 2QACA 1DJHA 2KQYA 2LVIA 4PALA 1M39A 3WXAA 3GK1A 3TDIA 4YGAA 4JQ0D 1DGUA 1K9PA 1NUBA 1Y1AA 2JPOA 3GK2A 5EL2A 4CLNA 3S0EA 1KK7Z 3D0YB 2FOTA 1UWOA 1NX2A 1XFXO 2EGDA 4PHMA 2MAZA 3SG2A 1FI6A 2BCBA 1X02A 1A4PA 2L2CA 2ZRTA 3HX4A 1QVIY 4A4CA 1XVJA 2BL0C 5KSZA 1TTXA 3PATA 2BCXA 2ERBA 1QLKA 2L50A 1DMOA 5HKZA 5CSNA 4GBAA 1A75B 3NGVA 1AVSA 1A03A 2WOSA 2JZIA 2KHNA 3WHTB 1NP8A 1KFUS 1QLSA 2O5GA 3BXKA 1V1FA 3KEVA 4I5NB 4C0JA 5F6TA 1QWVA 3BUWB 3DY9A 1SCVA 3QRXA 4GFTA 3LLEA 1YR5A 2ZRSA 4JWQA 1V1GA 1CFDA 1NCXA 2JQ6A 4YRUA 1CLBA 1C7WA 1RJVA 2KBIA 2KQ6A 5KU1A 3CR4X 2BECA 5FI6A 3PM2A 1CLLA 1IQ5A 4ORBB 3TDZA 1NCZA 1CFPA 1F55A 1ZFSA 1KCYA 1QATA 2ZNDA 3FS7A 3K21A 2K7CA 1ZACA 3IVTA 2M9GA 2PALA 1QVIZ 3PJIA 1LINA 2H61A 2RGIA 2HPSA 4IJ7A 1XFWO 1HQVA 3BOWA 1DEKA 3I5IC 4DCKA 2LMVA 3OBVA 1YUUA 2PSRA 3BFHA 2KI6D 1DTLA 2LLSA 2M29A 2ZN8A 2E6WA 1BU3A 2F2OA 4PHKA 3VRQA 3NSLA 1M46A 1MXEA 3BUNB 1KWOC 1K2HA 2LE9B 1DQEA 1DJWA 1NX0A 4USLA 2L5XB 1NYAA 4QJ4B 1SL9A 1TWOA 5I94A 1YX8A 3A8RA 5TNCA 1XK4A 4U8DA 3HCMA 1SSEB 4FTGA 1LXFC 2MBXA 4GGFA 1R6PA 1PK0D 1QX2A 2F3YA 1YVLA 2MLEC 4IL1A 2VRGA 1L2OB 3EVRA 2YGUA 4L9MA 5I8NA 1PVBA 1IG5A 1Y1UA 2JT3A 2JTZA 3TS5C 1DT7B 2KFGA 1SRAA 1UURA 1XA5A 4MBEA 1SW8A 2BCAA 2OTGC 2QEOA 2TN4A 1J1EA 1ORGA 1SL8A 3FE9A 1NPQA
chains in the Genus database with same CATH topology
1IWQA 2Y1NA 1JUOA 2K7BA 5AANA 4ZCVA 1B7TY 1J7QA 2KDHA 1AUIB 3MSEB 2O60A 3WHUB 2M8UA 3GK4X 1KK8C 2HF5A 1K96A 2LC5A 3LK0A 2JOJA 2HETA 4ORAB 3JTDC 1QASA 5I2OA 1EG3A 3FWBA 4AQJA 1BOCA 4OCIA 3KPXA 3CZTX 4NDDA 4UPGA 4YI8A 2JTTA 4R1EA 5ER5A 4MEWA 4AQIA 1JF0A 2BE6A 2EC6B 2KOTA 3I5FB 2MLFC 4YGCB 4HRGA 1DVIA 3TUYB 5ER4X 1S26D 2JULA 2NCPA 1BT6A 1KK7Y 2GGMA 3I5HC 1QIWA 1WLMA 4ICBA 1A29A 1OZSA 5JOLA 1CFFA 1SL7A 2LHIA 2AUCA 4PCWA 1QTXA 1EL4A 1JF2A 2NZ0A 5FYXA 1UHKA 1R2UA 4I5JA 3PSRA 4DRWA 4BY5A 4GNKB 2LM5A 1F4QA 2Y1MA 3DVJA 3M0WA 1SCMC 2H2KA 2L2EA 1QJTA 1YUSA 4GPLB 1YURA 1CDPA 2PMYA 5D69A 1Q80A 2CBLA 3ZNIA 1SKTA 2KI4B 1MF8B 4GGNA 2BE4A 5KTYA 4C0LA 1S3PA 2F8PA 1TNPA 2Y5IA 1IKUA 1QIVA 1CM4A 2KFFA 3LL8B 2BL0B 2F33A 1B47A 1M45A 1IJ5A 4C0KA 1RROA 1S1EA 2JXLA 1CM1A 2KGRA 3BQ3A 1OZOA 1JWDA 1S6CA 2I7AA 1G4YR 2LVKA 4OVNF 1OQPA 1YX7A 1BODA 2GV5A 1C7VA 1AHRA 2AAOA 3NSIA 1B8CA 1SR6B 2ZNEA 2LCPA 1TCOB 1ZUZA 2KGBC 4YGEB 4OV2A 2CNPA 1WRKA 1CLMA 1SY9A 4M2PA 4XJKA 3VRPA 2D8NA 2EHBA 3BYAA 4MN0A 2V53A 1MQ1A 1TCFA 1L2OC 1LA3A 2KAYA 3NSOA 4YGBB 3H4SE 1DGVA 2BBMA 2G9BA 3SG4A 1K94A 4WRIA 3TS5B 1RK9A 2Q91A 2LUCA 1ZOTB 3KHEA 1CNPA 1FW4A 1H4BA 3I5IB 3VRNA 2MHHA 4DUQA 1RECA 2LAPA 4PE4A 1QS7A 1KSMA 5AFPA 1K93D 4MZKA 4PHNA 1UUSA 1QX7A 1UHIA 1J7RA 5JJGA 1RFJA 3JTDB 4MRYA 4P5OE 5DKNA 1H8BA 1KFUL 1J7PA 2JT0A 2M1UA 2HQ8A 4PE1A 1DF0B 1UHJA 3AAKA 4ORCB 1OMDA 1YRUB 3CS1A 4GGFC 1GJYA 2M1KB 1S5GZ 4OR9B 1EG4A 5HYDA 1PVAA 1D1OA 2JC2A 4MSPA 1Y0VH 1YRTB 2ZN9A 4PE7A 1U5IA 2LANA 1NWDA 1AK8A 1XFYO 3KO0A 1SPYA 5BPJA 1SMGA 1B4CA 2WCEA 1OOJA 2OTGB 3PALA 2JWWA 1BR4B 1DJIA 2KYCA 5DKQA 1J7OA 3PN7C 2WCBA 4PE0A 3NXAA 2CT9A 4PHJA 3F45A 1MXLC 3D0YA 4GUKA 1CDMA 1BR1B 2KI6C 1NIWA 1ZMZA 2K8MB 4XYNA 4M2OA 2R2IA 2KI4C 1S36A 1B9AA 3EKJA 3SIAA 1YUTA 5K89A 1JSAA 2LMTA 1TNXA 3LCPC 2M7LA 3SG6A 1AJ5A 2JPTA 2KYFA 4GAOA 2KNEA 2LUXA 3ICBA 2OS8B 1OMRA 2I94A 1DF0A 2K7OA 2EC6C 3E3RA 2KFHA 1A2XA 4BY4A 1NSHA 4QJ3B 1SR6C 1WDCC 3PM8A 2CCMA 3CR2A 3I5HB 1NX1A 2AMIA 1ALWA 2BKIB 1UP5A 1BLQA 4OKHA 1OMVA 2NXQA 2Q4UA 1LVCD 1CDNA 1K95A 1IQ3A 5CSJA 2F3ZA 1KQVA 3I5GC 2LP3A 2M97A 1TNQA 2K7DA 2SCPA 1CDLA 2L4IA 3BUOB 5AEQA 2BBNA 1XFUO 4MVFA 4P2YB 1SCMB 3EKHA 4HRHA 2M0RA 1WY9A 3O78A 1BMOA 3VGOA 4YBHB 4ETOA 1B7TZ 3CR5X 2L98A 3A4UB 2Y4QA 1MR8A 3JVTC 5CSFA 2FCEA 3IQOA 1WLZA 2HQWA 3RM1A 1CB1A 2LMUA 3O6BA 1BF5A 3DVEA 5CSIA 1F54A 1EJ3A 4MZJA 1F8HA 3CGAA 3TZ1A 4HREE 4I5LB 1E8AA 1GQMA 4M2QA 1TOPA 1C07A 1EH2A 2JU0A 3OB1B 4NDBA 3BOWB 2WC8A 2OPOA 5I2QA 1KSOA 1S6IA 1PRWA 1CMFA 5PALA 2DOQA 1WRLA 2KAVA 2L51A 1KQMC 2L0PA 3EK8A 1PSRA 1ALVA 1DJXA 1N2DA 4PDZA 2PASA 3SG5A 1TNWA 3RLZA 3CWGA 1KFXS 1A75A 2JRFA 4NDCA 2SASA 1RTP1 2ZKMX 1SYMA 3PN7B 5AERA 5IBWA 1LKJA 2BKHB 2E30A 4A4BA 4YI9A 2LP2A 3ZWHA 1YVHA 2KBMA 1JC2A 1QV0A 1B1GA 4ZCUA 3DD4A 2MRDA 4Q04A 1FBVA 1SK6D 3VROA 4CFQA 4D1EA 1BG1A 4FQOA 1PSBA 4HSZA 4N5XA 1S6JA 2NLNA 3NSKA 4WQ2A 2COLB 4YGDB 1HT9A 2I18A 2JXCA 3LK1A 1XYDA 3O2PA 1IH0A 1B8LA 1LA0A 1DJZA 1W7IB 3DVMA 3GOFA 3D10A 1WDCB 3OX6A 1SBJA 4MRXA 5AXIA 5HLOA 1CMGA 2WCFA 2LLUA 1EXRA 3BUMB 4CFRA 2MA2A 1G8IA 1SNLA 1NX3A 1M31A 1AP4A 4N1FA 2A4JA 2FJUB 3EVVA 3EVUA 3OX5A 5DKRA 3AAJA 2FCDA 2B1UA 1CKKA 2L4HA 2H61C 2ZFDA 3KF9A 4N1GA 4CPVA 3DF0B 5GQQC 1KFXL 4NQGA 2M7NA 1JFKA 4TNCA 1OSAA 4WQ3A 1J55A 2MJWB 1CTRA 3O4YA 2LV7A 3PLFB 2IS9A 2NCOA 2ISDA 3JVTB 2K0JA 1IRJA 4MLWA 1KWOB 1VRKA 2K61A 2OS8C 3AKAA 4DS7A 1Y1XA 3SIBA 3PFVA 3SJSA 2M49B 1JFJA 1PULA 1XK4C 1TIZA 1Y6WA 3FWCA 3VRRA 3AKBA 2I2RE 2WORA 1QXPA 1RWYA 2K2AA 1B8RA 1PALA 3OB2B 1F4OA 5HKYA 1K90D 1QX5B 4CIDA 4AOMA 1NCYA 2F2PA 1XFZO 1FI5A 1U5IB 4QJ5B 1N0YA 5B8IB 1J1DA 1GGZA 3WNXB 3I5GB 1N65A 3SG3A 1CFCA 3BUXB 1JBAA 1TN4A 1MHOA 1MWNA 3CLNA 3EK7A 4JPZB 2LVJA 1M63B 1S5GY 3OHMB 1YTZC 2PRUA 3CTNA 5HKWA 2LLTA 1W7JB 3IQQA 1K9KA 2PVBA 3FIAA 3OP0A 3SG7A 1FF1A 2M3WA 3DVKA 3IF7A 1TRFA 1KK8B 2WNDA 1BJFA 2CXJA 3EK4A 4F0ZB 2JNFA 5CPVA 5G08A 2JT8A 1F70A 1DJYA 4E68A 3C1VA 1F71A 1FPWA 1IJ6A 2G2BA 5HLVA 1GGWA 1MUXA 1IGVA 1OE9B 4DIRA 1XO5A 2CTNA 1G33A 1AJ4A 2LVVA 2P6BB 1K9UA 2LNKA 3I5FC 5D7FA 5J3XA 1L7ZA 3DF0A 2GGZA 2QPTA 4I5KA 2K2FA 4XJKB 3TUYC 1DJGA 1ODBA 1K8UA 2LHLA 1UHNA 2KAXA 3TDUA 4MZLA 1KQMB 5I2LA 1WRZA 2KSPA 1XFVO 1QV1A 1UHHA 2JNXA 2QACA 1DJHA 2KQYA 2LVIA 4PALA 1M39A 3WXAA 3GK1A 3TDIA 4YGAA 4JQ0D 1DGUA 1K9PA 1NUBA 1Y1AA 3GK2A 4CLNA 1KK7Z 3D0YB 2FOTA 1UWOA 1NX2A 1XFXO 2EGDA 4PHMA 2MAZA 3SG2A 1FI6A 2BCBA 1X02A 1A4PA 2ZRTA 3HX4A 1QVIY 4A4CA 1XVJA 2BL0C 5KSZA 1TTXA 3PATA 2BCXA 2L50A 1QLKA 1DMOA 5HKZA 5CSNA 4GBAA 1A75B 1AVSA 1A03A 2WOSA 2JZIA 2KHNA 3WHTB 1NP8A 1KFUS 1QLSA 2O5GA 3BXKA 1V1FA 3KEVA 4I5NB 4C0JA 5F6TA 3BUWB 3QRXA 1SCVA 4GFTA 3LLEA 1YR5A 2ZRSA 4JWQA 1V1GA 1CFDA 1NCXA 2JQ6A 4YRUA 1CLBA 1C7WA 1RJVA 2KBIA 2KQ6A 5KU1A 3CR4X 2BECA 3TDZA 1CLLA 1IQ5A 4ORBB 1NCZA 1CFPA 1F55A 1ZFSA 1KCYA 1QATA 2ZNDA 3FS7A 3K21A 2K7CA 1ZACA 2M9GA 2PALA 1QVIZ 1LINA 2H61A 2RGIA 2HPSA 1XFWO 1HQVA 3BOWA 3I5IC 4DCKA 2LMVA 1YUUA 2PSRA 2KI6D 1DTLA 2LLSA 2M29A 2ZN8A 2E6WA 1BU3A 2F2OA 4PHKA 3VRQA 3NSLA 1M46A 1MXEA 3BUNB 1KWOC 1K2HA 2LE9B 1DJWA 1NX0A 4USLA 2L5XB 1NYAA 4QJ4B 1SL9A 1YX8A 3A8RA 5TNCA 1XK4A 4U8DA 3HCMA 4FTGA 1LXFC 2MBXA 4GGFA 1R6PA 1PK0D 1QX2A 2F3YA 1YVLA 2MLEC 4IL1A 2VRGA 1L2OB 3EVRA 4L9MA 5I8NA 1PVBA 1IG5A 1Y1UA 2JT3A 2JTZA 3TS5C 1DT7B 2KFGA 1SRAA 1UURA 1XA5A 4MBEA 1SW8A 2BCAA 2OTGC 2TN4A 1J1EA 1SL8A 1NPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IWQ A;  2Y1N A;  1JUO A;  2K7B A;  5AAN A;  4ZCV A;  1B7T Y;  1J7Q A;  2KDH A;  1AUI B;  3MSE B;  2O60 A;  3WHU B;  2M8U A;  3GK4 X;  1KK8 C;  2HF5 A;  1K96 A;  2LC5 A;  3LK0 A;  2JOJ A;  2HET A;  4ORA B;  3JTD C;  1QAS A;  5I2O A;  1EG3 A;  3FWB A;  4AQJ A;  1BOC A;  4OCI A;  3KPX A;  3CZT X;  4NDD A;  4UPG A;  4YI8 A;  2JTT A;  4R1E A;  5ER5 A;  4MEW A;  4AQI A;  1JF0 A;  2BE6 A;  2EC6 B;  2KOT A;  3I5F B;  2MLF C;  4YGC B;  4HRG A;  1DVI A;  3TUY B;  5ER4 X;  1S26 D;  2JUL A;  2NCP A;  1BT6 A;  1KK7 Y;  2GGM A;  3I5H C;  1QIW A;  1WLM A;  4ICB A;  1A29 A;  1OZS A;  5JOL A;  1CFF A;  1SL7 A;  2LHI A;  2AUC A;  4PCW A;  1QTX A;  1EL4 A;  1JF2 A;  2NZ0 A;  5FYX A;  1UHK A;  1R2U A;  4I5J A;  3PSR A;  4DRW A;  4BY5 A;  4GNK B;  2LM5 A;  1F4Q A;  2Y1M A;  3DVJ A;  3M0W A;  1SCM C;  2H2K A;  2L2E A;  1QJT A;  1YUS A;  4GPL B;  1YUR A;  1CDP A;  2PMY A;  5D69 A;  1Q80 A;  2CBL A;  3ZNI A;  1SKT A;  2KI4 B;  1MF8 B;  4GGN A;  2BE4 A;  5KTY A;  4C0L A;  1S3P A;  2F8P A;  1TNP A;  2Y5I A;  1IKU A;  1QIV A;  1CM4 A;  2KFF A;  3LL8 B;  2BL0 B;  2F33 A;  1B47 A;  1M45 A;  1IJ5 A;  4C0K A;  1RRO A;  1S1E A;  2JXL A;  1CM1 A;  2KGR A;  3BQ3 A;  1OZO A;  1JWD A;  1S6C A;  2I7A A;  1G4Y R;  2LVK A;  4OVN F;  1OQP A;  1YX7 A;  1BOD A;  2GV5 A;  1C7V A;  1AHR A;  2AAO A;  3NSI A;  1B8C A;  1SR6 B;  2ZNE A;  2LCP A;  1TCO B;  1ZUZ A;  2KGB C;  4YGE B;  4OV2 A;  2CNP A;  1WRK A;  1CLM A;  1SY9 A;  4M2P A;  4XJK A;  3VRP A;  2D8N A;  2EHB A;  3BYA A;  4MN0 A;  2V53 A;  1MQ1 A;  1TCF A;  1L2O C;  1LA3 A;  2KAY A;  3NSO A;  4YGB B;  3H4S E;  1DGV A;  2BBM A;  2G9B A;  3SG4 A;  1K94 A;  4WRI A;  3TS5 B;  1RK9 A;  2Q91 A;  2LUC A;  1ZOT B;  3KHE A;  1CNP A;  1FW4 A;  1H4B A;  3I5I B;  3VRN A;  2MHH A;  4DUQ A;  1REC A;  2LAP A;  4PE4 A;  1QS7 A;  1KSM A;  5AFP A;  1K93 D;  4MZK A;  4PHN A;  1UUS A;  1QX7 A;  1UHI A;  1J7R A;  5JJG A;  1RFJ A;  3JTD B;  4MRY A;  4P5O E;  5DKN A;  1H8B A;  1KFU L;  1J7P A;  2JT0 A;  2M1U A;  2HQ8 A;  4PE1 A;  1DF0 B;  1UHJ A;  3AAK A;  4ORC B;  1OMD A;  1YRU B;  3CS1 A;  4GGF C;  1GJY A;  2M1K B;  1S5G Z;  4OR9 B;  1EG4 A;  5HYD A;  1PVA A;  1D1O A;  2JC2 A;  4MSP A;  1Y0V H;  1YRT B;  2ZN9 A;  4PE7 A;  1U5I A;  2LAN A;  1NWD A;  1AK8 A;  1XFY O;  3KO0 A;  1SPY A;  5BPJ A;  1SMG A;  1B4C A;  2WCE A;  1OOJ A;  2OTG B;  3PAL A;  2JWW A;  1BR4 B;  1DJI A;  2KYC A;  5DKQ A;  1J7O A;  3PN7 C;  2WCB A;  4PE0 A;  3NXA A;  2CT9 A;  4PHJ A;  3F45 A;  1MXL C;  3D0Y A;  4GUK A;  1CDM A;  1BR1 B;  2KI6 C;  1NIW A;  1ZMZ A;  2K8M B;  4XYN A;  4M2O A;  2R2I A;  2KI4 C;  1S36 A;  1B9A A;  3EKJ A;  3SIA A;  1YUT A;  5K89 A;  1JSA A;  2LMT A;  1TNX A;  3LCP C;  2M7L A;  3SG6 A;  1AJ5 A;  2JPT A;  2KYF A;  4GAO A;  2KNE A;  2LUX A;  3ICB A;  2OS8 B;  1OMR A;  2I94 A;  1DF0 A;  2K7O A;  2EC6 C;  3E3R A;  2KFH A;  1A2X A;  4BY4 A;  1NSH A;  4QJ3 B;  1SR6 C;  1WDC C;  3PM8 A;  2CCM A;  3CR2 A;  3I5H B;  1NX1 A;  2AMI A;  1ALW A;  2BKI B;  1UP5 A;  1BLQ A;  4OKH A;  1OMV A;  2NXQ A;  2Q4U A;  1LVC D;  1CDN A;  1K95 A;  1IQ3 A;  5CSJ A;  2F3Z A;  1KQV A;  3I5G C;  2LP3 A;  2M97 A;  1TNQ A;  2K7D A;  2SCP A;  1CDL A;  2L4I A;  3BUO B;  5AEQ A;  2BBN A;  1XFU O;  4MVF A;  4P2Y B;  1SCM B;  3EKH A;  4HRH A;  2M0R A;  1WY9 A;  3O78 A;  1BMO A;  3VGO A;  4YBH B;  4ETO A;  1B7T Z;  3CR5 X;  2L98 A;  3A4U B;  2Y4Q A;  1MR8 A;  3JVT C;  5CSF A;  2FCE A;  3IQO A;  1WLZ A;  2HQW A;  3RM1 A;  1CB1 A;  2LMU A;  3O6B A;  1BF5 A;  3DVE A;  5CSI A;  1F54 A;  1EJ3 A;  4MZJ A;  1F8H A;  3CGA A;  3TZ1 A;  4HRE E;  4I5L B;  1E8A A;  1GQM A;  4M2Q A;  1TOP A;  1C07 A;  1EH2 A;  2JU0 A;  3OB1 B;  4NDB A;  3BOW B;  2WC8 A;  2OPO A;  5I2Q A;  1KSO A;  1S6I A;  1PRW A;  1CMF A;  5PAL A;  2DOQ A;  1WRL A;  2KAV A;  2L51 A;  1KQM C;  2L0P A;  3EK8 A;  1PSR A;  1ALV A;  1DJX A;  1N2D A;  4PDZ A;  2PAS A;  3SG5 A;  1TNW A;  3RLZ A;  3CWG A;  1KFX S;  1A75 A;  2JRF A;  4NDC A;  2SAS A;  1RTP 1;  2ZKM X;  1SYM A;  3PN7 B;  5AER A;  5IBW A;  1LKJ A;  2BKH B;  2E30 A;  4A4B A;  4YI9 A;  2LP2 A;  3ZWH A;  1YVH A;  2KBM A;  1JC2 A;  1QV0 A;  1B1G A;  4ZCU A;  3DD4 A;  2MRD A;  4Q04 A;  1FBV A;  1SK6 D;  3VRO A;  4CFQ A;  4D1E A;  1BG1 A;  4FQO A;  1PSB A;  4HSZ A;  4N5X A;  1S6J A;  2NLN A;  3NSK A;  4WQ2 A;  2COL B;  4YGD B;  1HT9 A;  2I18 A;  2JXC A;  3LK1 A;  1XYD A;  3O2P A;  1IH0 A;  1B8L A;  1LA0 A;  1DJZ A;  1W7I B;  3DVM A;  3GOF A;  3D10 A;  1WDC B;  3OX6 A;  1SBJ A;  4MRX A;  5AXI A;  5HLO A;  1CMG A;  2WCF A;  2LLU A;  1EXR A;  3BUM B;  4CFR A;  2MA2 A;  1G8I A;  1SNL A;  1NX3 A;  1M31 A;  1AP4 A;  4N1F A;  2A4J A;  2FJU B;  3EVV A;  3EVU A;  3OX5 A;  5DKR A;  3AAJ A;  2FCD A;  2B1U A;  1CKK A;  2L4H A;  2H61 C;  2ZFD A;  3KF9 A;  4N1G A;  4CPV A;  3DF0 B;  5GQQ C;  1KFX L;  4NQG A;  2M7N A;  1JFK A;  4TNC A;  1OSA A;  4WQ3 A;  1J55 A;  2MJW B;  1CTR A;  3O4Y A;  2LV7 A;  3PLF B;  2IS9 A;  2NCO A;  2ISD A;  3JVT B;  2K0J A;  1IRJ A;  4MLW A;  1KWO B;  1VRK A;  2K61 A;  2OS8 C;  3AKA A;  4DS7 A;  1Y1X A;  3SIB A;  3PFV A;  3SJS A;  2M49 B;  1JFJ A;  1PUL A;  1XK4 C;  1TIZ A;  1Y6W A;  3FWC A;  3VRR A;  3AKB A;  2I2R E;  2WOR A;  1QXP A;  1RWY A;  2K2A A;  1B8R A;  1PAL A;  3OB2 B;  1F4O A;  5HKY A;  1K90 D;  1QX5 B;  4CID A;  4AOM A;  1NCY A;  2F2P A;  1XFZ O;  1FI5 A;  1U5I B;  4QJ5 B;  1N0Y A;  5B8I B;  1J1D A;  1GGZ A;  3WNX B;  3I5G B;  1N65 A;  3SG3 A;  1CFC A;  3BUX B;  1JBA A;  1TN4 A;  1MHO A;  1MWN A;  3CLN A;  3EK7 A;  4JPZ B;  2LVJ A;  1M63 B;  1S5G Y;  3OHM B;  1YTZ C;  2PRU A;  3CTN A;  5HKW A;  2LLT A;  1W7J B;  3IQQ A;  1K9K A;  2PVB A;  3FIA A;  3OP0 A;  3SG7 A;  1FF1 A;  2M3W A;  3DVK A;  3IF7 A;  1TRF A;  1KK8 B;  2WND A;  1BJF A;  2CXJ A;  3EK4 A;  4F0Z B;  2JNF A;  5CPV A;  5G08 A;  2JT8 A;  1F70 A;  1DJY A;  4E68 A;  3C1V A;  1F71 A;  1FPW A;  1IJ6 A;  2G2B A;  5HLV A;  1GGW A;  1MUX A;  1IGV A;  1OE9 B;  4DIR A;  1XO5 A;  2CTN A;  1G33 A;  1AJ4 A;  2LVV A;  2P6B B;  1K9U A;  2LNK A;  3I5F C;  5D7F A;  5J3X A;  1L7Z A;  3DF0 A;  2GGZ A;  2QPT A;  4I5K A;  2K2F A;  4XJK B;  3TUY C;  1DJG A;  1ODB A;  1K8U A;  2LHL A;  1UHN A;  2KAX A;  3TDU A;  4MZL A;  1KQM B;  5I2L A;  1WRZ A;  2KSP A;  1XFV O;  1QV1 A;  1UHH A;  2JNX A;  2QAC A;  1DJH A;  2KQY A;  2LVI A;  4PAL A;  1M39 A;  3WXA A;  3GK1 A;  3TDI A;  4YGA A;  4JQ0 D;  1DGU A;  1K9P A;  1NUB A;  1Y1A A;  3GK2 A;  4CLN A;  1KK7 Z;  3D0Y B;  2FOT A;  1UWO A;  1NX2 A;  1XFX O;  2EGD A;  4PHM A;  2MAZ A;  3SG2 A;  1FI6 A;  2BCB A;  1X02 A;  1A4P A;  2ZRT A;  3HX4 A;  1QVI Y;  4A4C A;  1XVJ A;  2BL0 C;  5KSZ A;  1TTX A;  3PAT A;  2BCX A;  2L50 A;  1QLK A;  1DMO A;  5HKZ A;  5CSN A;  4GBA A;  1A75 B;  1AVS A;  1A03 A;  2WOS A;  2JZI A;  2KHN A;  3WHT B;  1NP8 A;  1KFU S;  1QLS A;  2O5G A;  3BXK A;  1V1F A;  3KEV A;  4I5N B;  4C0J A;  5F6T A;  3BUW B;  3QRX A;  1SCV A;  4GFT A;  3LLE A;  1YR5 A;  2ZRS A;  4JWQ A;  1V1G A;  1CFD A;  1NCX A;  2JQ6 A;  4YRU A;  1CLB A;  1C7W A;  1RJV A;  2KBI A;  2KQ6 A;  5KU1 A;  3CR4 X;  2BEC A;  3TDZ A;  1CLL A;  1IQ5 A;  4ORB B;  1NCZ A;  1CFP A;  1F55 A;  1ZFS A;  1KCY A;  1QAT A;  2ZND A;  3FS7 A;  3K21 A;  2K7C A;  1ZAC A;  2M9G A;  2PAL A;  1QVI Z;  1LIN A;  2H61 A;  2RGI A;  2HPS A;  1XFW O;  1HQV A;  3BOW A;  3I5I C;  4DCK A;  2LMV A;  1YUU A;  2PSR A;  2KI6 D;  1DTL A;  2LLS A;  2M29 A;  2ZN8 A;  2E6W A;  1BU3 A;  2F2O A;  4PHK A;  3VRQ A;  3NSL A;  1M46 A;  1MXE A;  3BUN B;  1KWO C;  1K2H A;  2LE9 B;  1DJW A;  1NX0 A;  4USL A;  2L5X B;  1NYA A;  4QJ4 B;  1SL9 A;  1YX8 A;  3A8R A;  5TNC A;  1XK4 A;  4U8D A;  3HCM A;  4FTG A;  1LXF C;  2MBX A;  4GGF A;  1R6P A;  1PK0 D;  1QX2 A;  2F3Y A;  1YVL A;  2MLE C;  4IL1 A;  2VRG A;  1L2O B;  3EVR A;  4L9M A;  5I8N A;  1PVB A;  1IG5 A;  1Y1U A;  2JT3 A;  2JTZ A;  3TS5 C;  1DT7 B;  2KFG A;  1SRA A;  1UUR A;  1XA5 A;  4MBE A;  1SW8 A;  2BCA A;  2OTG C;  2TN4 A;  1J1E A;  1SL8 A;  1NPQ A; 
#chains in the Genus database with same CATH topology
 2L5Y A;  1IWQ A;  2Y1N A;  3OGN A;  1JUO A;  2K7B A;  5AAN A;  4ZCV A;  1B7T Y;  1J7Q A;  2KDH A;  1AUI B;  3MSE B;  2O60 A;  3WHU B;  2M8U A;  4PT1 A;  3GK4 X;  1KK8 C;  2HF5 A;  1K96 A;  2LC5 A;  3LK0 A;  2JOJ A;  2HET A;  4ORA B;  3JTD C;  1QAS A;  5I2O A;  1LS8 A;  1EG3 A;  3FWB A;  4AQJ A;  1BOC A;  4OCI A;  3KPX A;  3CZT X;  4NDD A;  4UPG A;  4YI8 A;  2JTT A;  4R1E A;  5ER5 A;  4MEW A;  4AQI A;  1JF0 A;  2BE6 A;  2EC6 B;  2KOT A;  3I5F B;  2MLF C;  4YGC B;  4HRG A;  3UO9 A;  2WCK A;  1DVI A;  5DIC A;  3TUY B;  5ER4 X;  3S0F A;  1S26 D;  3D74 A;  2JUL A;  2NCP A;  1BT6 A;  1KK7 Y;  2GGM A;  3I5H C;  1QIW A;  3CZ2 A;  1WLM A;  4ICB A;  3S0D A;  1A29 A;  1OW4 A;  1OZS A;  5JOL A;  1Z4H A;  1CFF A;  1SL7 A;  3B7A A;  3K1E A;  2LHI A;  2AUC A;  4PCW A;  1QTX A;  1EL4 A;  1JF2 A;  2NZ0 A;  5FYX A;  1UHK A;  3V2L A;  1R2U A;  4I5J A;  3PSR A;  4DRW A;  4BY5 A;  4GNK B;  1OOG A;  2LM5 A;  1F4Q A;  2Y1M A;  3DVJ A;  3M0W A;  1OOF A;  3CZ0 A;  1SCM C;  2H2K A;  4JKT A;  2L2E A;  1QJT A;  1YUS A;  4GPL B;  1YUR A;  1CDP A;  2PMY A;  5D69 A;  1Q80 A;  2CBL A;  2FJY A;  1SKT A;  2KI4 B;  1MF8 B;  4GGN A;  2BE4 A;  5KTY A;  4C0L A;  1S3P A;  2F8P A;  1TNP A;  2Y5I A;  1IKU A;  3SS3 A;  1QIV A;  2WCM A;  1CM4 A;  2KFF A;  3LL8 B;  2BL0 B;  2F33 A;  1B47 A;  1M45 A;  1IJ5 A;  4C0K A;  1RRO A;  1S1E A;  2JXL A;  1CM1 A;  2KGR A;  3BQ3 A;  3D78 A;  1OZO A;  1JWD A;  1S6C A;  2I7A A;  1G4Y R;  2LVK A;  4OVN F;  1OQP A;  1YX7 A;  1BOD A;  2GV5 A;  1C7V A;  1AHR A;  2AAO A;  4INW A;  3NSI A;  1B8C A;  1SR6 B;  2ZNE A;  2LCP A;  1TCO B;  1ZUZ A;  2KGB C;  4YGE B;  4OV2 A;  1IIO A;  2CNP A;  1WRK A;  1CLM A;  1SY9 A;  2H8V A;  4M2P A;  4XJK A;  3VRP A;  2D8N A;  2EHB A;  3BYA A;  4MN0 A;  2V53 A;  1MQ1 A;  1TCF A;  1L2O C;  1LA3 A;  2KAY A;  3NSO A;  4YGB B;  3H4S E;  3DZT A;  1DGV A;  2BBM A;  2G9B A;  3SG4 A;  1K94 A;  4WRI A;  3Q8I A;  3TS5 B;  1RK9 A;  2Q91 A;  2LUC A;  5HL1 A;  1ZOT B;  3KHE A;  1CNP A;  1FW4 A;  1H4B A;  3I5I B;  3VRN A;  2MHH A;  4DUQ A;  1REC A;  2P70 A;  2LAP A;  4PE4 A;  1QS7 A;  1KSM A;  5AFP A;  1K93 D;  4MZK A;  4PHN A;  1UUS A;  1QX7 A;  1UHI A;  1TUZ A;  1J7R A;  1GM0 A;  5JJG A;  3CDN A;  3S0G A;  1RFJ A;  3JTD B;  4MRY A;  4P5O E;  5DKN A;  1H8B A;  4F7F A;  1KFU L;  1J7P A;  2JT0 A;  2M1U A;  2HQ8 A;  4PE1 A;  1OOH A;  1DF0 B;  1UHJ A;  3AAK A;  4ORC B;  1OMD A;  1YRU B;  3CS1 A;  4GGF C;  1GJY A;  2M1K B;  1S5G Z;  4OR9 B;  1EG4 A;  3R1V A;  1PVA A;  1D1O A;  2JC2 A;  1Z2C B;  4MSP A;  1Y0V H;  1YRT B;  2ZN9 A;  4PE7 A;  1U5I A;  2LAN A;  5D3O A;  3UNW A;  1NWD A;  1AK8 A;  1P28 A;  1XFY O;  3KO0 A;  1SPY A;  5BPJ A;  1SMG A;  1B4C A;  2WCE A;  1OOJ A;  2OTG B;  3PAL A;  2KLD A;  2JWW A;  1BR4 B;  1DJI A;  2KYC A;  5DKQ A;  1J7O A;  3PN7 C;  3L4A A;  2WCB A;  4PE0 A;  1W9Z A;  3NXA A;  2CT9 A;  4PHJ A;  3F45 A;  1MXL C;  3D0Y A;  4GUK A;  1CDM A;  1BR1 B;  2KI6 C;  4OZD A;  1NIW A;  1ZMZ A;  2K8M B;  1C3Z A;  4M2O A;  2PQL A;  2R2I A;  2KI4 C;  2QEB A;  4XYN A;  1S36 A;  1B9A A;  3EKJ A;  3SIA A;  1YUT A;  5K89 A;  1JSA A;  2LMT A;  1TNX A;  3LCP C;  2M7L A;  3SG6 A;  2QDI A;  1AJ5 A;  2JPT A;  2KYF A;  4GAO A;  2KNE A;  2LUX A;  3ICB A;  2GTE A;  2OS8 B;  1OMR A;  5HYD A;  2I94 A;  1DF0 A;  2K7O A;  2EC6 C;  3E3R A;  2KFH A;  1A2X A;  3D76 A;  4BY4 A;  2P71 A;  1NSH A;  3B87 A;  4QJ3 B;  1SR6 C;  3RZS A;  1WDC C;  3PM8 A;  3BFA A;  2CCM A;  3CR2 A;  3I5H B;  1NX1 A;  3O4X A;  2AMI A;  3N7H A;  1ALW A;  2BKI B;  1UP5 A;  1BLQ A;  4OKH A;  1OMV A;  2NXQ A;  2Q4U A;  1LVC D;  4JD9 A;  1CDN A;  2WCL A;  2WC5 A;  1K95 A;  1IQ3 A;  5CSJ A;  2F3Z A;  1KQV A;  3I5G C;  2LP3 A;  2M97 A;  1TNQ A;  1OOI X;  2K7D A;  2SCP A;  3CAB A;  1CDL A;  2L4I A;  3BUO B;  5AEQ A;  2BBN A;  1XFU O;  4MVF A;  4P2Y B;  1SCM B;  3EKH A;  1DEL A;  2M0R A;  4HRH A;  1WY9 A;  3O78 A;  1BMO A;  3VGO A;  4YBH B;  4ETO A;  1B7T Z;  3SS4 A;  3L47 A;  3CR5 X;  2L98 A;  3A4U B;  2Y4Q A;  3BFB A;  4FQT A;  1MR8 A;  3JVT C;  5CSF A;  2FCE A;  3SS5 A;  3IQO A;  1WLZ A;  2HQW A;  3RM1 A;  2WCH A;  1CB1 A;  2LMU A;  3O6B A;  1BF5 A;  3DVE A;  5CSI A;  1F54 A;  1EJ3 A;  4MZJ A;  3ZNI A;  1F8H A;  3CGA A;  3TZ1 A;  3R72 A;  4HRE E;  4I5L B;  1E8A A;  1GQM A;  4M2Q A;  1TOP A;  1C07 A;  1EH2 A;  2JU0 A;  3OB1 B;  4NDB A;  3BOW B;  2WCJ A;  2WC8 A;  2OPO A;  5I2Q A;  1KSO A;  1S6I A;  1PRW A;  1CMF A;  5PAL A;  2DOQ A;  1WRL A;  2KAV A;  2L51 A;  1KQM C;  2L0P A;  3EK8 A;  1PSR A;  1ALV A;  1DJX A;  1N2D A;  4PDZ A;  2PAS A;  3SG5 A;  1TNW A;  3RLZ A;  3CWG A;  2KPH A;  1KFX S;  1A75 A;  2JRF A;  4NDC A;  2SAS A;  1RTP 1;  2ZKM X;  1SYM A;  3DXL A;  3PN7 B;  5AER A;  5IBW A;  1LKJ A;  2BKH B;  2E30 A;  4A4B A;  3BJH A;  4YI9 A;  2LP2 A;  3ZWH A;  1YVH A;  3R1P A;  2KBM A;  3FE8 A;  2BNX A;  1JC2 A;  1QV0 A;  1B1G A;  4ZCU A;  3DD4 A;  2MRD A;  1T14 A;  4Q04 A;  1FBV A;  1SK6 D;  3VRO A;  4CFQ A;  4D1E A;  1BG1 A;  4FQO A;  1PSB A;  4HSZ A;  4N5X A;  1S6J A;  2NLN A;  3NSK A;  4WQ2 A;  2COL B;  4YGD B;  1HT9 A;  2I18 A;  2JXC A;  3LK1 A;  1XYD A;  3O2P A;  1IH0 A;  2KLE A;  1B8L A;  1LA0 A;  1DJZ A;  1W7I B;  3B88 A;  3DVM A;  3GOF A;  3D10 A;  1WDC B;  3D75 A;  3OX6 A;  1SBJ A;  3D77 A;  4MRX A;  5AXI A;  5HLO A;  1CMG A;  2WCF A;  2LLU A;  1EXR A;  3BUM B;  4CFR A;  2MA2 A;  1G8I A;  1SNL A;  3EG5 B;  1NX3 A;  3VB1 A;  1M31 A;  3R1O A;  1AP4 A;  2BAP A;  4N1F A;  2A4J A;  3CYZ A;  2FJU B;  3EVV A;  3EVU A;  3OX5 A;  5DKR A;  3AAJ A;  2FCD A;  2B1U A;  1CKK A;  3S0B A;  2L4H A;  3B86 A;  2H61 C;  4INX A;  2ZFD A;  3D73 A;  3KF9 A;  4N1G A;  4CPV A;  3DF0 B;  5GQQ C;  1KFX L;  4NQG A;  2M7N A;  1JFK A;  4TNC A;  1OSA A;  4WQ3 A;  1J55 A;  2MJW B;  1CTR A;  3O4Y A;  2LV7 A;  3PLF B;  2IS9 A;  2NCO A;  2WC6 A;  3L4L A;  2ISD A;  2QEV A;  2K0J A;  3JVT B;  1IRJ A;  3CZ1 A;  4MLW A;  1KWO B;  1VRK A;  2K61 A;  2OS8 C;  3AKA A;  4DS7 A;  1Y1X A;  1DC1 A;  4KYN A;  3SIB A;  3PFV A;  3SJS A;  2M49 B;  1JFJ A;  1PUL A;  1XK4 C;  1TIZ A;  1Y6W A;  3FWC A;  3VRR A;  3B6X A;  3AKB A;  2I2R E;  2WOR A;  1QXP A;  3S0A A;  1RWY A;  2K2A A;  5FI2 A;  1B8R A;  1PAL A;  3OB2 B;  1F4O A;  5HKY A;  1K90 D;  1QX5 B;  4CID A;  3QME A;  4AOM A;  5FI7 A;  1NCY A;  2F2P A;  1XFZ O;  2K60 A;  1FI5 A;  1U5I B;  4QJ5 B;  1N0Y A;  5B8I B;  1J1D A;  1GGZ A;  3WNX B;  3I5G B;  1N65 A;  3SG3 A;  1CFC A;  3BUX B;  1JBA A;  1TN4 A;  1TUJ A;  1MHO A;  1MWN A;  3CLN A;  3FE6 A;  3EK7 A;  4JPZ B;  2LVJ A;  2PYQ A;  1M63 B;  1S5G Y;  3OHM B;  1YTZ C;  2PRU A;  3CTN A;  3NHI A;  5HKW A;  2LLT A;  1W7J B;  3IQQ A;  1K9K A;  2PVB A;  3FIA A;  3OP0 A;  3SG7 A;  1FF1 A;  2M3W A;  3DVK A;  3IF7 A;  1TRF A;  1KK8 B;  2WND A;  1BJF A;  2CXJ A;  3EK4 A;  4F0Z B;  2JNF A;  5CPV A;  5G08 A;  2JT8 A;  1F70 A;  1DJY A;  4E68 A;  3C1V A;  1F71 A;  2QEH A;  1IJ6 A;  2G2B A;  5HLV A;  1FPW A;  1GGW A;  1MUX A;  1IGV A;  1OE9 B;  4DIR A;  1XO5 A;  1C3Y A;  2CTN A;  1G33 A;  1AJ4 A;  2LVV A;  2P6B B;  1K9U A;  2LNK A;  3I5F C;  5D7F A;  5J3X A;  1L7Z A;  3DF0 A;  2GGZ A;  2QPT A;  4I5K A;  2K2F A;  3NHT A;  4XJK B;  1DJG A;  3TUY C;  1ODB A;  1K8U A;  2LHL A;  1UHN A;  2KAX A;  3TDU A;  4MZL A;  1KQM B;  5I2L A;  1WRZ A;  1XFR A;  2KSP A;  3DYE A;  1XFV O;  1QV1 A;  1UHH A;  2JNX A;  2QAC A;  1DJH A;  2KQY A;  2LVI A;  4PAL A;  1M39 A;  3WXA A;  3GK1 A;  3TDI A;  4YGA A;  4JQ0 D;  1DGU A;  1K9P A;  1NUB A;  1Y1A A;  2JPO A;  3GK2 A;  5EL2 A;  4CLN A;  3S0E A;  1KK7 Z;  3D0Y B;  2FOT A;  1UWO A;  1NX2 A;  1XFX O;  2EGD A;  4PHM A;  2MAZ A;  3SG2 A;  1FI6 A;  2BCB A;  1X02 A;  1A4P A;  2L2C A;  2ZRT A;  3HX4 A;  1QVI Y;  4A4C A;  1XVJ A;  2BL0 C;  5KSZ A;  1TTX A;  3PAT A;  2BCX A;  2ERB A;  1QLK A;  2L50 A;  1DMO A;  5HKZ A;  5CSN A;  4GBA A;  1A75 B;  3NGV A;  1AVS A;  1A03 A;  2WOS A;  2JZI A;  2KHN A;  3WHT B;  1NP8 A;  1KFU S;  1QLS A;  2O5G A;  3BXK A;  1V1F A;  3KEV A;  4I5N B;  4C0J A;  5F6T A;  1QWV A;  3BUW B;  3DY9 A;  1SCV A;  3QRX A;  4GFT A;  3LLE A;  1YR5 A;  2ZRS A;  4JWQ A;  1V1G A;  1CFD A;  1NCX A;  2JQ6 A;  4YRU A;  1CLB A;  1C7W A;  1RJV A;  2KBI A;  2KQ6 A;  5KU1 A;  3CR4 X;  2BEC A;  5FI6 A;  3PM2 A;  1CLL A;  1IQ5 A;  4ORB B;  3TDZ A;  1NCZ A;  1CFP A;  1F55 A;  1ZFS A;  1KCY A;  1QAT A;  2ZND A;  3FS7 A;  3K21 A;  2K7C A;  1ZAC A;  3IVT A;  2M9G A;  2PAL A;  1QVI Z;  3PJI A;  1LIN A;  2H61 A;  2RGI A;  2HPS A;  4IJ7 A;  1XFW O;  1HQV A;  3BOW A;  1DEK A;  3I5I C;  4DCK A;  2LMV A;  3OBV A;  1YUU A;  2PSR A;  3BFH A;  2KI6 D;  1DTL A;  2LLS A;  2M29 A;  2ZN8 A;  2E6W A;  1BU3 A;  2F2O A;  4PHK A;  3VRQ A;  3NSL A;  1M46 A;  1MXE A;  3BUN B;  1KWO C;  1K2H A;  2LE9 B;  1DQE A;  1DJW A;  1NX0 A;  4USL A;  2L5X B;  1NYA A;  4QJ4 B;  1SL9 A;  1TWO A;  5I94 A;  1YX8 A;  3A8R A;  5TNC A;  1XK4 A;  4U8D A;  3HCM A;  1SSE B;  4FTG A;  1LXF C;  2MBX A;  4GGF A;  1R6P A;  1PK0 D;  1QX2 A;  2F3Y A;  1YVL A;  2MLE C;  4IL1 A;  2VRG A;  1L2O B;  3EVR A;  2YGU A;  4L9M A;  5I8N A;  1PVB A;  1IG5 A;  1Y1U A;  2JT3 A;  2JTZ A;  3TS5 C;  1DT7 B;  2KFG A;  1SRA A;  1UUR A;  1XA5 A;  4MBE A;  1SW8 A;  2BCA A;  2OTG C;  2QEO A;  2TN4 A;  1J1E A;  1ORG A;  1SL8 A;  3FE9 A;  1NPQ A; 
#chains in the Genus database with same CATH homology
 1IWQ A;  2Y1N A;  1JUO A;  2K7B A;  5AAN A;  4ZCV A;  1B7T Y;  1J7Q A;  2KDH A;  1AUI B;  3MSE B;  2O60 A;  3WHU B;  2M8U A;  3GK4 X;  1KK8 C;  2HF5 A;  1K96 A;  2LC5 A;  3LK0 A;  2JOJ A;  2HET A;  4ORA B;  3JTD C;  1QAS A;  5I2O A;  1EG3 A;  3FWB A;  4AQJ A;  1BOC A;  4OCI A;  3KPX A;  3CZT X;  4NDD A;  4UPG A;  4YI8 A;  2JTT A;  4R1E A;  5ER5 A;  4MEW A;  4AQI A;  1JF0 A;  2BE6 A;  2EC6 B;  2KOT A;  3I5F B;  2MLF C;  4YGC B;  4HRG A;  1DVI A;  3TUY B;  5ER4 X;  1S26 D;  2JUL A;  2NCP A;  1BT6 A;  1KK7 Y;  2GGM A;  3I5H C;  1QIW A;  1WLM A;  4ICB A;  1A29 A;  1OZS A;  5JOL A;  1CFF A;  1SL7 A;  2LHI A;  2AUC A;  4PCW A;  1QTX A;  1EL4 A;  1JF2 A;  2NZ0 A;  5FYX A;  1UHK A;  1R2U A;  4I5J A;  3PSR A;  4DRW A;  4BY5 A;  4GNK B;  2LM5 A;  1F4Q A;  2Y1M A;  3DVJ A;  3M0W A;  1SCM C;  2H2K A;  2L2E A;  1QJT A;  1YUS A;  4GPL B;  1YUR A;  1CDP A;  2PMY A;  5D69 A;  1Q80 A;  2CBL A;  3ZNI A;  1SKT A;  2KI4 B;  1MF8 B;  4GGN A;  2BE4 A;  5KTY A;  4C0L A;  1S3P A;  2F8P A;  1TNP A;  2Y5I A;  1IKU A;  1QIV A;  1CM4 A;  2KFF A;  3LL8 B;  2BL0 B;  2F33 A;  1B47 A;  1M45 A;  1IJ5 A;  4C0K A;  1RRO A;  1S1E A;  2JXL A;  1CM1 A;  2KGR A;  3BQ3 A;  1OZO A;  1JWD A;  1S6C A;  2I7A A;  1G4Y R;  2LVK A;  4OVN F;  1OQP A;  1YX7 A;  1BOD A;  2GV5 A;  1C7V A;  1AHR A;  2AAO A;  3NSI A;  1B8C A;  1SR6 B;  2ZNE A;  2LCP A;  1TCO B;  1ZUZ A;  2KGB C;  4YGE B;  4OV2 A;  2CNP A;  1WRK A;  1CLM A;  1SY9 A;  4M2P A;  4XJK A;  3VRP A;  2D8N A;  2EHB A;  3BYA A;  4MN0 A;  2V53 A;  1MQ1 A;  1TCF A;  1L2O C;  1LA3 A;  2KAY A;  3NSO A;  4YGB B;  3H4S E;  1DGV A;  2BBM A;  2G9B A;  3SG4 A;  1K94 A;  4WRI A;  3TS5 B;  1RK9 A;  2Q91 A;  2LUC A;  1ZOT B;  3KHE A;  1CNP A;  1FW4 A;  1H4B A;  3I5I B;  3VRN A;  2MHH A;  4DUQ A;  1REC A;  2LAP A;  4PE4 A;  1QS7 A;  1KSM A;  5AFP A;  1K93 D;  4MZK A;  4PHN A;  1UUS A;  1QX7 A;  1UHI A;  1J7R A;  5JJG A;  1RFJ A;  3JTD B;  4MRY A;  4P5O E;  5DKN A;  1H8B A;  1KFU L;  1J7P A;  2JT0 A;  2M1U A;  2HQ8 A;  4PE1 A;  1DF0 B;  1UHJ A;  3AAK A;  4ORC B;  1OMD A;  1YRU B;  3CS1 A;  4GGF C;  1GJY A;  2M1K B;  1S5G Z;  4OR9 B;  1EG4 A;  5HYD A;  1PVA A;  1D1O A;  2JC2 A;  4MSP A;  1Y0V H;  1YRT B;  2ZN9 A;  4PE7 A;  1U5I A;  2LAN A;  1NWD A;  1AK8 A;  1XFY O;  3KO0 A;  1SPY A;  5BPJ A;  1SMG A;  1B4C A;  2WCE A;  1OOJ A;  2OTG B;  3PAL A;  2JWW A;  1BR4 B;  1DJI A;  2KYC A;  5DKQ A;  1J7O A;  3PN7 C;  2WCB A;  4PE0 A;  3NXA A;  2CT9 A;  4PHJ A;  3F45 A;  1MXL C;  3D0Y A;  4GUK A;  1CDM A;  1BR1 B;  2KI6 C;  1NIW A;  1ZMZ A;  2K8M B;  4XYN A;  4M2O A;  2R2I A;  2KI4 C;  1S36 A;  1B9A A;  3EKJ A;  3SIA A;  1YUT A;  5K89 A;  1JSA A;  2LMT A;  1TNX A;  3LCP C;  2M7L A;  3SG6 A;  1AJ5 A;  2JPT A;  2KYF A;  4GAO A;  2KNE A;  2LUX A;  3ICB A;  2OS8 B;  1OMR A;  2I94 A;  1DF0 A;  2K7O A;  2EC6 C;  3E3R A;  2KFH A;  1A2X A;  4BY4 A;  1NSH A;  4QJ3 B;  1SR6 C;  1WDC C;  3PM8 A;  2CCM A;  3CR2 A;  3I5H B;  1NX1 A;  2AMI A;  1ALW A;  2BKI B;  1UP5 A;  1BLQ A;  4OKH A;  1OMV A;  2NXQ A;  2Q4U A;  1LVC D;  1CDN A;  1K95 A;  1IQ3 A;  5CSJ A;  2F3Z A;  1KQV A;  3I5G C;  2LP3 A;  2M97 A;  1TNQ A;  2K7D A;  2SCP A;  1CDL A;  2L4I A;  3BUO B;  5AEQ A;  2BBN A;  1XFU O;  4MVF A;  4P2Y B;  1SCM B;  3EKH A;  4HRH A;  2M0R A;  1WY9 A;  3O78 A;  1BMO A;  3VGO A;  4YBH B;  4ETO A;  1B7T Z;  3CR5 X;  2L98 A;  3A4U B;  2Y4Q A;  1MR8 A;  3JVT C;  5CSF A;  2FCE A;  3IQO A;  1WLZ A;  2HQW A;  3RM1 A;  1CB1 A;  2LMU A;  3O6B A;  1BF5 A;  3DVE A;  5CSI A;  1F54 A;  1EJ3 A;  4MZJ A;  1F8H A;  3CGA A;  3TZ1 A;  4HRE E;  4I5L B;  1E8A A;  1GQM A;  4M2Q A;  1TOP A;  1C07 A;  1EH2 A;  2JU0 A;  3OB1 B;  4NDB A;  3BOW B;  2WC8 A;  2OPO A;  5I2Q A;  1KSO A;  1S6I A;  1PRW A;  1CMF A;  5PAL A;  2DOQ A;  1WRL A;  2KAV A;  2L51 A;  1KQM C;  2L0P A;  3EK8 A;  1PSR A;  1ALV A;  1DJX A;  1N2D A;  4PDZ A;  2PAS A;  3SG5 A;  1TNW A;  3RLZ A;  3CWG A;  1KFX S;  1A75 A;  2JRF A;  4NDC A;  2SAS A;  1RTP 1;  2ZKM X;  1SYM A;  3PN7 B;  5AER A;  5IBW A;  1LKJ A;  2BKH B;  2E30 A;  4A4B A;  4YI9 A;  2LP2 A;  3ZWH A;  1YVH A;  2KBM A;  1JC2 A;  1QV0 A;  1B1G A;  4ZCU A;  3DD4 A;  2MRD A;  4Q04 A;  1FBV A;  1SK6 D;  3VRO A;  4CFQ A;  4D1E A;  1BG1 A;  4FQO A;  1PSB A;  4HSZ A;  4N5X A;  1S6J A;  2NLN A;  3NSK A;  4WQ2 A;  2COL B;  4YGD B;  1HT9 A;  2I18 A;  2JXC A;  3LK1 A;  1XYD A;  3O2P A;  1IH0 A;  1B8L A;  1LA0 A;  1DJZ A;  1W7I B;  3DVM A;  3GOF A;  3D10 A;  1WDC B;  3OX6 A;  1SBJ A;  4MRX A;  5AXI A;  5HLO A;  1CMG A;  2WCF A;  2LLU A;  1EXR A;  3BUM B;  4CFR A;  2MA2 A;  1G8I A;  1SNL A;  1NX3 A;  1M31 A;  1AP4 A;  4N1F A;  2A4J A;  2FJU B;  3EVV A;  3EVU A;  3OX5 A;  5DKR A;  3AAJ A;  2FCD A;  2B1U A;  1CKK A;  2L4H A;  2H61 C;  2ZFD A;  3KF9 A;  4N1G A;  4CPV A;  3DF0 B;  5GQQ C;  1KFX L;  4NQG A;  2M7N A;  1JFK A;  4TNC A;  1OSA A;  4WQ3 A;  1J55 A;  2MJW B;  1CTR A;  3O4Y A;  2LV7 A;  3PLF B;  2IS9 A;  2NCO A;  2ISD A;  3JVT B;  2K0J A;  1IRJ A;  4MLW A;  1KWO B;  1VRK A;  2K61 A;  2OS8 C;  3AKA A;  4DS7 A;  1Y1X A;  3SIB A;  3PFV A;  3SJS A;  2M49 B;  1JFJ A;  1PUL A;  1XK4 C;  1TIZ A;  1Y6W A;  3FWC A;  3VRR A;  3AKB A;  2I2R E;  2WOR A;  1QXP A;  1RWY A;  2K2A A;  1B8R A;  1PAL A;  3OB2 B;  1F4O A;  5HKY A;  1K90 D;  1QX5 B;  4CID A;  4AOM A;  1NCY A;  2F2P A;  1XFZ O;  1FI5 A;  1U5I B;  4QJ5 B;  1N0Y A;  5B8I B;  1J1D A;  1GGZ A;  3WNX B;  3I5G B;  1N65 A;  3SG3 A;  1CFC A;  3BUX B;  1JBA A;  1TN4 A;  1MHO A;  1MWN A;  3CLN A;  3EK7 A;  4JPZ B;  2LVJ A;  1M63 B;  1S5G Y;  3OHM B;  1YTZ C;  2PRU A;  3CTN A;  5HKW A;  2LLT A;  1W7J B;  3IQQ A;  1K9K A;  2PVB A;  3FIA A;  3OP0 A;  3SG7 A;  1FF1 A;  2M3W A;  3DVK A;  3IF7 A;  1TRF A;  1KK8 B;  2WND A;  1BJF A;  2CXJ A;  3EK4 A;  4F0Z B;  2JNF A;  5CPV A;  5G08 A;  2JT8 A;  1F70 A;  1DJY A;  4E68 A;  3C1V A;  1F71 A;  1FPW A;  1IJ6 A;  2G2B A;  5HLV A;  1GGW A;  1MUX A;  1IGV A;  1OE9 B;  4DIR A;  1XO5 A;  2CTN A;  1G33 A;  1AJ4 A;  2LVV A;  2P6B B;  1K9U A;  2LNK A;  3I5F C;  5D7F A;  5J3X A;  1L7Z A;  3DF0 A;  2GGZ A;  2QPT A;  4I5K A;  2K2F A;  4XJK B;  3TUY C;  1DJG A;  1ODB A;  1K8U A;  2LHL A;  1UHN A;  2KAX A;  3TDU A;  4MZL A;  1KQM B;  5I2L A;  1WRZ A;  2KSP A;  1XFV O;  1QV1 A;  1UHH A;  2JNX A;  2QAC A;  1DJH A;  2KQY A;  2LVI A;  4PAL A;  1M39 A;  3WXA A;  3GK1 A;  3TDI A;  4YGA A;  4JQ0 D;  1DGU A;  1K9P A;  1NUB A;  1Y1A A;  3GK2 A;  4CLN A;  1KK7 Z;  3D0Y B;  2FOT A;  1UWO A;  1NX2 A;  1XFX O;  2EGD A;  4PHM A;  2MAZ A;  3SG2 A;  1FI6 A;  2BCB A;  1X02 A;  1A4P A;  2ZRT A;  3HX4 A;  1QVI Y;  4A4C A;  1XVJ A;  2BL0 C;  5KSZ A;  1TTX A;  3PAT A;  2BCX A;  2L50 A;  1QLK A;  1DMO A;  5HKZ A;  5CSN A;  4GBA A;  1A75 B;  1AVS A;  1A03 A;  2WOS A;  2JZI A;  2KHN A;  3WHT B;  1NP8 A;  1KFU S;  1QLS A;  2O5G A;  3BXK A;  1V1F A;  3KEV A;  4I5N B;  4C0J A;  5F6T A;  3BUW B;  3QRX A;  1SCV A;  4GFT A;  3LLE A;  1YR5 A;  2ZRS A;  4JWQ A;  1V1G A;  1CFD A;  1NCX A;  2JQ6 A;  4YRU A;  1CLB A;  1C7W A;  1RJV A;  2KBI A;  2KQ6 A;  5KU1 A;  3CR4 X;  2BEC A;  3TDZ A;  1CLL A;  1IQ5 A;  4ORB B;  1NCZ A;  1CFP A;  1F55 A;  1ZFS A;  1KCY A;  1QAT A;  2ZND A;  3FS7 A;  3K21 A;  2K7C A;  1ZAC A;  2M9G A;  2PAL A;  1QVI Z;  1LIN A;  2H61 A;  2RGI A;  2HPS A;  1XFW O;  1HQV A;  3BOW A;  3I5I C;  4DCK A;  2LMV A;  1YUU A;  2PSR A;  2KI6 D;  1DTL A;  2LLS A;  2M29 A;  2ZN8 A;  2E6W A;  1BU3 A;  2F2O A;  4PHK A;  3VRQ A;  3NSL A;  1M46 A;  1MXE A;  3BUN B;  1KWO C;  1K2H A;  2LE9 B;  1DJW A;  1NX0 A;  4USL A;  2L5X B;  1NYA A;  4QJ4 B;  1SL9 A;  1YX8 A;  3A8R A;  5TNC A;  1XK4 A;  4U8D A;  3HCM A;  4FTG A;  1LXF C;  2MBX A;  4GGF A;  1R6P A;  1PK0 D;  1QX2 A;  2F3Y A;  1YVL A;  2MLE C;  4IL1 A;  2VRG A;  1L2O B;  3EVR A;  4L9M A;  5I8N A;  1PVB A;  1IG5 A;  1Y1U A;  2JT3 A;  2JTZ A;  3TS5 C;  1DT7 B;  2KFG A;  1SRA A;  1UUR A;  1XA5 A;  4MBE A;  1SW8 A;  2BCA A;  2OTG C;  2TN4 A;  1J1E A;  1SL8 A;  1NPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...