2KFGA

Structure of the c-terminal domain of ehd1 in complex with fnyestdpftak
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
b'GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kfgA00
1LVCD 2KYCA 1BODA 3DD4A 3BUNB 1SPYA 1NPQA 1PVAA 2H2KA 2ZNEA 4U8DA 5HLOA 4USLA 2JRFA 3GK1A 3OB2B 5DKRA 5HLVA 5J3XA 1DJIA 2LE9B 5B8IB 5KTYA 2BKHB 1M63B 1WDCC 3LK1A 1PALA 3NSLA 1Y0VH 1S5GY 5I8NA 1PSRA 2FOTA 2KYFA 3SG5A 3E3RA 5HKYA 2Y4QA 2AAOA 1KWOB 2PSRA 3PFVA 4NQGA 4ORAB 4WQ3A 2MBXA 1QJTA 2LMVA 1SL9A 4AQIA 5CPVA 1TIZA 1NWDA 1LINA 1AVSA 1PK0D 1Y1UA 3DF0B 3I5IB 4XYNA 4E68A 3SG3A 2BCXA 1QV1A 4P2YB 2L5XB 2MHHA 2VRGA 3D10A 1KK7Z 4MZLA 1J1DA 4M2OA 4CPVA 1TNXA 5DKQA 1NSHA 2HETA 1SL7A 2ZRTA 4L9MA 2JOJA 2NCOA 1N0YA 4OCIA 3SG6A 2L4IA 2M7LA 1AP4A 1J7OA 4XJKA 5D69A 2F33A 3FS7A 1NYAA 2M1KB 3VRRA 2L4HA 1XK4C 1J7RA 3BOWB 1BT6A 2P6BB 1CFDA 2LCPA 4QJ4B 1F8HA 2Q91A 2KI6C 2KGRA 1TOPA 3DVJA 2Y5IA 2JT8A 5JOLA 3EKJA 1KCYA 4MZJA 1PVBA 2M9GA 3IF7A 2JXCA 3O4YA 2B1UA 1FI5A 2M3WA 2NXQA 4DS7A 3TS5B 1UUSA 3CLNA 1KK7Y 1MF8B 2M97A 3CR5X 4GNKB 3EVRA 3WHUB 4CFQA 3KHEA 2PRUA 5IBWA 2JT3A 1BMOA 1ZFSA 1XA5A 1X02A 2SCPA 2H61A 3RLZA 5F6TA 4MVFA 2KOTA 3O2PA 1UP5A 4TNCA 4CFRA 4P5OE 2CBLA 1OSAA 3PLFB 1F70A 1QIWA 3EVUA 3TS5C 5CSNA 1A2XA 2LMTA 4N5XA 1JUOA 3FIAA 1NX0A 2OPOA 1JF2A 2JXLA 1IWQA 3SG7A 4A4BA 1ZMZA 1CLMA 1BJFA 3WXAA 1F4OA 3NSKA 1UHKA 4YI8A 1F55A 1LA3A 1YTZC 3I5FB 1DVIA 3FWBA 2F3ZA 4DRWA 2ZN8A 3EK4A 1TCFA 1CDMA 4NDBA 2HQ8A 1OQPA 2M49B 1TCOB 1WRKA 2KBMA 3VGOA 1AUIB 4AQJA 1SL8A 1V1GA 3SIAA 5JJGA 2KFGA 1SY9A 2JT0A 1YRTB 2BL0B 2LP3A 3D0YA 4MBEA 1QXPA 1KK8B 1CMFA 5CSFA 1NX1A 1Q80A 2KFFA 1C07A 2WCBA 2FCEA 3I5FC 1ALVA 1K96A 4M2QA 2K2AA 4R1EA 2KBIA 1TNWA 1DJXA 1K9PA 4F0ZB 2OTGC 1UHJA 2JWWA 1TN4A 2ISDA 1CM4A 3CS1A 2E6WA 3EK8A 5AFPA 2JC2A 1ZUZA 2BL0C 1KFUS 1OMVA 1A03A 4BY4A 1KK8C 1S3PA 1BR1B 4DIRA 1CFPA 3C1VA 1DJYA 2KHNA 3JVTB 1M45A 2K7OA 2MLFC 1EG3A 3A8RA 4AOMA 1DF0B 1QX5B 1WRLA 1BG1A 1XK4A 3SIBA 2AUCA 3AKBA 3KEVA 1SR6C 1ODBA 4PHMA 2JULA 3KPXA 4M2PA 1F54A 5CSJA 3CR4X 1TNQA 1UWOA 1B9AA 5I2OA 2SASA 3AAJA 1DGUA 2CXJA 1RWYA 1S6JA 3TDUA 2MLEC 1K2HA 2O5GA 3GK4X 1A75A 4N1GA 3PM8A 1Y1AA 2MJWB 1A4PA 3CZTX 3JVTC 3OX6A 1QASA 1TNPA 1SCVA 2LVVA 1C7VA 2K8MB 1G8IA 4MEWA 2DOQA 4NDDA 1B7TY 2BCAA 1XO5A 5DKNA 3BOWA 1U5IB 1XFVO 3OHMB 1SK6D 1DTLA 1OZSA 3O78A 2JTTA 2K7DA 4PDZA 4YBHB 2CT9A 3TZ1A 4MZKA 1MR8A 1B4CA 5ER5A 2IS9A 5AXIA 2QACA 2K2FA 2JNFA 5AANA 1IH0A 1CLBA 2TN4A 1RTP1 1SKTA 1SNLA 2LVIA 5AEQA 2F3YA 1F71A 1SBJA 4ZCUA 2KAVA 1A29A 2BBNA 4JPZB 4PHKA 1G33A 1M46A 2K7CA 1YX8A 1MHOA 4YRUA 1FBVA 4GGFC 1QLSA 2JZIA 1NCYA 2WORA 1IQ5A 3EVVA 2CTNA 1R6PA 1IJ5A 4I5NB 5FYXA 1WRZA 5I2QA 2I7AA 3SG2A 1MXEA 1KFXS 2WNDA 1EL4A 1NUBA 1UURA 2LMUA 1EJ3A 3BYAA 2EC6B 2LV7A 4PE1A 2O60A 1XYDA 1J55A 5TNCA 1S1EA 1SMGA 2JQ6A 3I5GB 1OE9B 1JBAA 2I94A 1LA0A 3VRNA 2ZNDA 1CLLA 1KSOA 3CR2A 2PVBA 3AKAA 1IGVA 3BUOB 1NX2A 2KSPA 2L50A 2L0PA 1CKKA 4WQ2A 1K93D 2NZ0A 5K89A 2HPSA 2M0RA 4ZCVA 5G08A 2EC6C 1CNPA 3OB1B 4OV2A 4NDCA 1J1EA 3I5GC 3TDIA 4C0JA 4OKHA 2Q4UA 3FWCA 2KNEA 1QIVA 1XFXO 2OTGB 5HKZA 1LKJA 2KAXA 3NSIA 2KAYA 1OZOA 1BU3A 5KSZA 1DJGA 1TTXA 1DF0A 2BCBA 2Y1NA 1CFFA 1NP8A 1N2DA 1WLMA 4JWQA 2WOSA 1PULA 1UHIA 2FCDA 1C7WA 1LXFC 3RM1A 2JNXA 2LHIA 3VRPA 5PALA 2ZRSA 1QX7A 1SR6B 1CDNA 1QS7A 2F8PA 2KQ6A 1FW4A 2KDHA 1PSBA 1BR4B 3WHTB 1OOJA 1B47A 3ZWHA 1NIWA 1B7TZ 2LP2A 4HSZA 2KI4B 1K95A 2ZKMX 1NX3A 2LLTA 1H8BA 1QV0A 2L98A 4PHNA 1W7JB 2LUXA 2ZN9A 2HQWA 1MXLC 1F4QA 2A4JA 1GQMA 2OS8B 1SW8A 2D8NA 3O6BA 1FI6A 3DVMA 1YR5A 3DF0A 1QLKA 1FF1A 1R2UA 1SYMA 2MAZA 4PALA 1H4BA 5CSIA 3ZNIA 2KGBC 1M39A 4GBAA 1BLQA 1K8UA 1RECA 1N65A 3PATA 4GGFA 4HREE 2H61C 3TDZA 1XFYO 2FJUB 1QVIZ 1UHNA 2KI4C 3IQOA 3HX4A 1JWDA 4HRHA 2LLSA 1RFJA 2LANA 2MA2A 2M1UA 2BE4A 2LAPA 2E30A 2OS8C 2PASA 4MSPA 1JFJA 4OVNF 3PN7B 1BOCA 1NCZA 1SCMB 4YGEB 3I5HB 1JC2A 1QX2A 1CTRA 3LL8B 2RGIA 4JQ0D 5GQQC 2KI6D 2JPTA 2CNPA 1GGZA 3MSEB 3LK0A 2LNKA 1CB1A 3M0WA 1KSMA 4GAOA 3TUYC 1B8RA 1K9UA 1TRFA 2PMYA 3ICBA 2PALA 2G2BA 3NXAA 1QVIY 3PN7C 1JSAA 4I5KA 1SCMC 4GPLB 3I5HC 4BY5A 4YGCB 4YGAA 1DT7B 2BKIB 1DJZA 4MLWA 1DMOA 2CCMA 2LVJA 3EK7A 1HT9A 1YUUA 2L2EA 1IG5A 1E8AA 3BQ3A 4CIDA 4GUKA 4OR9B 1KFUL 4CLNA 3BXKA 2F2OA 4DCKA 1YRUB 3K21A 1B1GA 3A4UB 4FQOA 1GJYA 1B8CA 2LHLA 3F45A 4YGDB 1M31A 1CFCA 1EH2A 3OP0A 1VRKA 1SRAA 3GK2A 1KWOC 1S6CA 1YUTA 3VRQA 3AAKA 3SG4A 1A75B 1UHHA 2NCPA 2NLNA 1YUSA 1XFUO 1AK8A 5AERA 4YI9A 1V1FA 2R2IA 1QTXA 1RROA 2M29A 4GFTA 3KF9A 1IJ6A 2LVKA 1G4YR 1YURA 3I5IC 1MWNA 1S36A 3KO0A 1K9KA 2WCEA 3NSOA 2JU0A 1L7ZA 2GV5A 2LC5A 4IL1A 4D1EA 2M8UA 1IQ3A 2K7BA 4QJ5B 2L51A 5HKWA 2BBMA 2K0JA 3BUXB 4WRIA 1IKUA 1AJ4A 1HQVA 3VROA 4HRGA 2KFHA 2LUCA 2Y1MA 3DVEA 1S6IA 2LLUA 1ZACA 2M7NA 2F2PA 2WCFA 4XJKB 4ETOA 3CWGA 3EKHA 2KQYA 1Y6WA 1RJVA 4C0LA 1KQMB 1J7PA 1S26D 5HYDA 4MRXA 1B8LA 1WLZA 1KQVA 4PCWA 5BPJA 3LLEA 1CDLA 4YGBB 5I2LA 1GGWA 1CMGA 4A4CA 1ALWA 2EHBA 3LCPC 1CDPA 1CM1A 1IRJA 4GGNA 3PSRA 3IQQA 4MRYA 4ICBA 3HCMA 3BUMB 3PALA 2JTZA 2GGZA 2I2RE 2BECA 4MN0A 1KQMC 2EGDA 3H4SE 4Q04A 1DGVA 1ZOTB 2QPTA 4C0KA 1L2OB 3SJSA 1AHRA 3JTDB 4I5LB 1OMDA 4PHJA 2AMIA 5D7FA 2V53A 5KU1A 1DJWA 1XFWO 3QRXA 4UPGA 1KFXL 1YVLA 3DVKA 4I5JA 1K94A 4QJ3B 1NCXA 2MRDA 1MQ1A 1Y1XA 1FPWA 1D1OA 1RK9A 3OX5A 1DJHA 1U5IA 1XVJA 3CTNA 4ORCB 1OMRA 2LM5A 2COLB 2GGMA 3BUWB 1XFZO 1JFKA 3GOFA 1J7QA 3CGAA 2HF5A 1L2OC 3JTDC 4FTGA 1WY9A 2WC8A 1S5GZ 2I18A 2G9BA 1EG4A 4N1FA 1EXRA 4DUQA 3WNXB 2BE6A 2K61A 1BF5A 1YVHA 4ORBB 1AJ5A 1MUXA 3TUYB 2ZFDA 1K90D 1WDCB 4PE0A 5ER4X 4PE4A 1PRWA 1JF0A 4PE7A 1W7IB 1YX7A 3D0YB 1QATA
chains in the Genus database with same CATH superfamily
1LVCD 2KYCA 1BODA 3DD4A 3BUNB 1SPYA 1ORGA 1NPQA 1PVAA 2H2KA 2ZNEA 4U8DA 5HLOA 4USLA 2JRFA 3GK1A 3OB2B 5DKRA 5HLVA 5J3XA 1DJIA 2LE9B 5B8IB 3EG5B 5KTYA 2BKHB 1M63B 1WDCC 3LK1A 1PALA 3NSLA 1Y0VH 1S5GY 5I8NA 1PSRA 2FOTA 2KYFA 3SG5A 3E3RA 5HKYA 3N7HA 2Y4QA 2AAOA 1KWOB 2PSRA 3PFVA 4NQGA 4ORAB 4WQ3A 2MBXA 1QJTA 2LMVA 1SL9A 4AQIA 4PT1A 5CPVA 2K60A 5D3OA 1TIZA 1NWDA 1LINA 1AVSA 1PK0D 1Y1UA 2WCMA 3DF0B 3I5IB 4XYNA 3SG3A 2BCXA 1QV1A 3B86A 4E68A 2P71A 3CZ1A 4P2YB 2L5XB 2MHHA 2VRGA 3D10A 1KK7Z 4MZLA 1W9ZA 1J1DA 4M2OA 4CPVA 2BAPA 1TNXA 5DKQA 1NSHA 2HETA 1SL7A 2ZRTA 4L9MA 2JOJA 2NCOA 1N0YA 4OCIA 3SG6A 2L4IA 2M7LA 1AP4A 1J7OA 4XJKA 5D69A 2F33A 3FS7A 2JPOA 1NYAA 2M1KB 3VRRA 2L4HA 1XK4C 4KYNA 1J7RA 1OOFA 3BOWB 1BT6A 2P6BB 1CFDA 2LCPA 4QJ4B 1F8HA 2Q91A 1QWVA 2KI6C 2KGRA 3OBVA 1TOPA 3DVJA 2Y5IA 1OW4A 2QDIA 2JT8A 2KLEA 5JOLA 3EKJA 1KCYA 4MZJA 1PVBA 2M9GA 3IF7A 2JXCA 3O4YA 2B1UA 1FI5A 2M3WA 2NXQA 4DS7A 3TS5B 1UUSA 3CLNA 1KK7Y 1MF8B 2M97A 3CR5X 4GNKB 3EVRA 3WHUB 4CFQA 3KHEA 2PRUA 3R1VA 5IBWA 2JT3A 1BMOA 1ZFSA 1XA5A 1X02A 2SCPA 2H61A 3RLZA 5F6TA 4MVFA 1TWOA 2KOTA 3O2PA 1UP5A 4TNCA 4CFRA 4P5OE 2CBLA 1OSAA 3PLFB 1F70A 1QIWA 3EVUA 3TS5C 5CSNA 1A2XA 2LMTA 4N5XA 3BFAA 1JUOA 3FIAA 1NX0A 2OPOA 3CZ2A 1JF2A 2JXLA 1IWQA 3B88A 3SG7A 4A4BA 1ZMZA 1CLMA 1BJFA 4IJ7A 3WXAA 1F4OA 3NSKA 1UHKA 3DZTA 3FE6A 4YI8A 1LA3A 1F55A 1YTZC 3I5FB 2KPHA 1DVIA 3FWBA 2F3ZA 4DRWA 2ZN8A 3EK4A 1TCFA 1CDMA 4NDBA 2HQ8A 1OQPA 2M49B 4OZDA 1TCOB 1WRKA 2KBMA 3VGOA 1IIOA 1AUIB 4AQJA 1SL8A 1V1GA 2WC5A 2QEBA 3SIAA 5JJGA 2KFGA 1SY9A 2JT0A 1XFRA 1YRTB 2BL0B 2LP3A 3D0YA 1TUZA 3CABA 4MBEA 1QXPA 1KK8B 1CMFA 5CSFA 1NX1A 1Q80A 2KFFA 1C07A 1Z4HA 3BFHA 2WCBA 2FCEA 3I5FC 1ALVA 1K96A 4M2QA 2K2AA 4R1EA 2KBIA 1TNWA 1DJXA 1K9PA 4INWA 4F0ZB 2OTGC 1UHJA 2JWWA 1TN4A 2ISDA 1CM4A 3CS1A 5FI7A 2E6WA 3EK8A 5AFPA 2JC2A 1DQEA 1ZUZA 2BL0C 1KFUS 1OMVA 2QEHA 1A03A 4BY4A 1KK8C 1S3PA 1BR1B 4DIRA 1CFPA 3C1VA 1DJYA 2KHNA 3JVTB 1M45A 2K7OA 2MLFC 1EG3A 3A8RA 4INXA 4AOMA 1DF0B 1QX5B 1WRLA 1BG1A 1XK4A 3SIBA 2AUCA 3AKBA 3KEVA 1SR6C 1ODBA 4PHMA 2JULA 2H8VA 3KPXA 3D75A 4M2PA 1F54A 3NGVA 5CSJA 3CR4X 1TNQA 1UWOA 1B9AA 5EL2A 5I2OA 2SASA 3AAJA 4JKTA 1DGUA 2CXJA 2ERBA 1RWYA 1S6JA 3TDUA 2MLEC 1K2HA 2O5GA 3GK4X 3SS3A 1A75A 2PYQA 4N1GA 1T14A 3PM8A 1Y1AA 2MJWB 1A4PA 3CZTX 3JVTC 3OX6A 5HL1A 1QASA 1TNPA 1SCVA 2LVVA 1C7VA 2K8MB 1G8IA 4MEWA 2DOQA 4NDDA 1B7TY 2BCAA 1XO5A 2WCJA 5DKNA 3BOWA 1U5IB 1XFVO 3IVTA 3OHMB 1SK6D 3S0BA 1DTLA 1OZSA 3O78A 2JTTA 2K7DA 4PDZA 4YBHB 2CT9A 3TZ1A 4MZKA 1MR8A 1B4CA 5ER5A 2IS9A 5AXIA 2QACA 2K2FA 2QEVA 2JNFA 5AANA 1IH0A 3K1EA 1CLBA 2TN4A 1RTP1 1SKTA 1SNLA 2LVIA 5AEQA 2F3YA 1F71A 1SBJA 4ZCUA 2KAVA 1A29A 2BBNA 4JPZB 4PHKA 1G33A 2FJYA 3OGNA 1M46A 2K7CA 1YX8A 1MHOA 4YRUA 1SSEB 1FBVA 4GGFC 1QLSA 2JZIA 1NCYA 2WORA 1IQ5A 3EVVA 2CTNA 1R6PA 1IJ5A 4I5NB 5FYXA 1WRZA 5I2QA 2I7AA 3SG2A 1MXEA 1KFXS 2WNDA 1EL4A 1NUBA 1UURA 2LMUA 1EJ3A 3BYAA 2EC6B 2LV7A 4PE1A 2O60A 1XYDA 1J55A 2L5YA 5TNCA 1S1EA 1SMGA 2JQ6A 3I5GB 3Q8IA 1OE9B 1JBAA 2I94A 1LA0A 3VRNA 2ZNDA 1CLLA 1KSOA 3UO9A 3CR2A 2PVBA 3AKAA 1IGVA 3BUOB 1NX2A 2KSPA 2L50A 2L0PA 1CKKA 4WQ2A 1K93D 2NZ0A 5K89A 2HPSA 2M0RA 4ZCVA 5G08A 2EC6C 3D76A 3OB1B 3QMEA 1CNPA 4OV2A 4NDCA 1J1EA 3I5GC 3TDIA 4C0JA 4OKHA 3S0DA 2Q4UA 3FWCA 2KNEA 1QIVA 1XFXO 2OTGB 5HKZA 1LKJA 2KAXA 3NSIA 2KAYA 1OZOA 1BU3A 5KSZA 1DJGA 1TTXA 1DF0A 2BCBA 2Y1NA 1CFFA 1NP8A 1N2DA 1WLMA 4JWQA 2WOSA 1PULA 1UHIA 2FCDA 1C7WA 1LXFC 3RM1A 2JNXA 2LHIA 3VRPA 5PALA 2ZRSA 1OOGA 1QX7A 1SR6B 1CDNA 1QS7A 2F8PA 2KQ6A 1FW4A 2KDHA 1PSBA 3D78A 1BR4B 3WHTB 1OOJA 3CZ0A 1B47A 2KLDA 3ZWHA 1NIWA 1B7TZ 2LP2A 4HSZA 2KI4B 1K95A 2ZKMX 1NX3A 2LLTA 1H8BA 1QV0A 2L98A 4PHNA 1W7JB 3RZSA 2LUXA 2ZN9A 2HQWA 1MXLC 1F4QA 2A4JA 1GQMA 1DEKA 2OS8B 1SW8A 2D8NA 3O6BA 1FI6A 3DVMA 1YR5A 3DF0A 1QLKA 1FF1A 1R2UA 1SYMA 2MAZA 4PALA 1H4BA 5CSIA 3ZNIA 2KGBC 1M39A 4GBAA 1BLQA 3D73A 1K8UA 1RECA 5FI6A 1N65A 3PATA 4GGFA 4HREE 2H61C 3TDZA 5I94A 1XFYO 2FJUB 1QVIZ 1UHNA 2KI4C 3IQOA 3HX4A 1JWDA 4HRHA 2LLSA 2PQLA 1RFJA 2LANA 2MA2A 2M1UA 2BE4A 2LAPA 2E30A 2OS8C 2PASA 4MSPA 1JFJA 4OVNF 1Z2CB 3PN7B 1BOCA 1NCZA 1SCMB 4YGEB 3I5HB 1JC2A 1QX2A 1CTRA 3LL8B 1P28A 2RGIA 4JQ0D 5GQQC 2KI6D 2JPTA 2CNPA 1GGZA 3MSEB 3LK0A 2LNKA 3SS4A 2QEOA 1KSMA 3M0WA 1CB1A 3PJIA 3O4XA 4GAOA 3TUYC 1B8RA 1K9UA 1TRFA 2PMYA 3ICBA 2PALA 2G2BA 1GM0A 3NXAA 1QVIY 3PN7C 3D74A 3R72A 3SS5A 1JSAA 4I5KA 3B6XA 1SCMC 4GPLB 1DELA 3I5HC 4BY5A 1TUJA 4YGCB 4YGAA 1DT7B 2BKIB 1DJZA 4MLWA 1DMOA 2CCMA 2LVJA 3EK7A 1HT9A 1YUUA 2L2EA 1IG5A 4FQTA 1E8AA 3BQ3A 4CIDA 4GUKA 4OR9B 1KFUL 4CLNA 3BXKA 2F2OA 3S0EA 1YRUB 3K21A 4DCKA 1B1GA 3A4UB 4FQOA 1GJYA 1B8CA 2LHLA 2WC6A 3F45A 1M31A 3R1OA 4YGDB 3NHIA 3DYEA 1CFCA 1EH2A 3OP0A 1VRKA 1SRAA 3GK2A 1KWOC 1S6CA 1YUTA 3VRQA 3AAKA 3SG4A 1A75B 1UHHA 2NCPA 2NLNA 1LS8A 1YUSA 1OOHA 1XFUO 5AERA 1AK8A 4YI9A 1V1FA 2R2IA 1QTXA 1RROA 2M29A 4GFTA 3KF9A 1IJ6A 2LVKA 1G4YR 1YURA 3I5IC 3B87A 1MWNA 1S36A 3KO0A 1K9KA 2WCEA 3NSOA 2JU0A 1L7ZA 2GV5A 2LC5A 3DXLA 4IL1A 4D1EA 2M8UA 1IQ3A 2K7BA 3CDNA 4QJ5B 2L51A 5HKWA 3S0FA 2BBMA 2K0JA 2WCHA 3BUXB 4WRIA 1IKUA 1AJ4A 1HQVA 3VROA 2P70A 4HRGA 2KFHA 5FI2A 2LUCA 2Y1MA 3DVEA 1S6IA 2LLUA 1ZACA 2M7NA 2F2PA 2WCFA 3L47A 1C3ZA 2WCLA 4XJKB 3BFBA 4ETOA 3CWGA 3EKHA 2KQYA 1Y6WA 1RJVA 4C0LA 1KQMB 1J7PA 1S26D 5HYDA 4MRXA 1B8LA 1WLZA 1KQVA 4PCWA 5BPJA 3LLEA 1CDLA 4YGBB 5I2LA 1GGWA 1CMGA 3UNWA 4A4CA 1ALWA 2EHBA 3LCPC 1CDPA 4F7FA 1CM1A 1IRJA 2WCKA 4GGNA 3PSRA 3DY9A 3IQQA 4MRYA 4ICBA 3HCMA 3BUMB 3PALA 2JTZA 2GGZA 2I2RE 3FE9A 2BECA 3L4AA 3S0GA 3PM2A 4MN0A 1KQMC 2EGDA 1DC1A 3H4SE 4Q04A 1DGVA 1ZOTB 2QPTA 4C0KA 1L2OB 2BNXA 3SJSA 1AHRA 3R1PA 3JTDB 4I5LB 1OMDA 4PHJA 2AMIA 3BJHA 5D7FA 2V53A 5KU1A 1DJWA 1XFWO 3QRXA 4UPGA 1KFXL 1YVLA 3DVKA 4I5JA 1K94A 3D77A 4QJ3B 1NCXA 2MRDA 1MQ1A 1Y1XA 1FPWA 1D1OA 1RK9A 2YGUA 1DJHA 1U5IA 1XVJA 3CTNA 3OX5A 4ORCB 3V2LA 1OMRA 2LM5A 2COLB 2GGMA 3BUWB 1XFZO 1JFKA 3GOFA 3NHTA 1J7QA 2L2CA 3CGAA 2HF5A 1L2OC 3JTDC 4FTGA 1WY9A 3FE8A 3VB1A 2GTEA 2WC8A 1S5GZ 2I18A 2G9BA 5DICA 1EG4A 4N1FA 1EXRA 4DUQA 3WNXB 2BE6A 2K61A 1BF5A 1YVHA 4ORBB 3B7AA 1AJ5A 3CYZA 3S0AA 1MUXA 3TUYB 2ZFDA 1K90D 1WDCB 4JD9A 4PE0A 5ER4X 4PE4A 1PRWA 1JF0A 4PE7A 1OOIX 1C3YA 1W7IB 1YX7A 3D0YB 1QATA 3L4LA
chains in the Genus database with same CATH topology
1LVCD 2KYCA 1BODA 3DD4A 3BUNB 1SPYA 1NPQA 1PVAA 2H2KA 2ZNEA 4U8DA 5HLOA 4USLA 2JRFA 3GK1A 3OB2B 5DKRA 5HLVA 5J3XA 1DJIA 2LE9B 5B8IB 5KTYA 2BKHB 1M63B 1WDCC 3LK1A 1PALA 3NSLA 1Y0VH 1S5GY 5I8NA 1PSRA 2FOTA 2KYFA 3SG5A 3E3RA 5HKYA 2Y4QA 2AAOA 1KWOB 2PSRA 3PFVA 4NQGA 4ORAB 4WQ3A 2MBXA 1QJTA 2LMVA 1SL9A 4AQIA 5CPVA 1TIZA 1NWDA 1LINA 1AVSA 1PK0D 1Y1UA 3DF0B 3I5IB 4XYNA 4E68A 3SG3A 2BCXA 1QV1A 4P2YB 2L5XB 2MHHA 2VRGA 3D10A 1KK7Z 4MZLA 1J1DA 4M2OA 4CPVA 1TNXA 5DKQA 1NSHA 2HETA 1SL7A 2ZRTA 4L9MA 2JOJA 2NCOA 1N0YA 4OCIA 3SG6A 2L4IA 2M7LA 1AP4A 1J7OA 4XJKA 5D69A 2F33A 3FS7A 1NYAA 2M1KB 3VRRA 2L4HA 1XK4C 1J7RA 3BOWB 1BT6A 2P6BB 1CFDA 2LCPA 4QJ4B 1F8HA 2Q91A 2KI6C 2KGRA 1TOPA 3DVJA 2Y5IA 2JT8A 5JOLA 3EKJA 1KCYA 4MZJA 1PVBA 2M9GA 3IF7A 2JXCA 3O4YA 2B1UA 1FI5A 2M3WA 2NXQA 4DS7A 3TS5B 1UUSA 3CLNA 1KK7Y 1MF8B 2M97A 3CR5X 4GNKB 3EVRA 3WHUB 4CFQA 3KHEA 2PRUA 5IBWA 2JT3A 1BMOA 1ZFSA 1XA5A 1X02A 2SCPA 2H61A 3RLZA 5F6TA 4MVFA 2KOTA 3O2PA 1UP5A 4TNCA 4CFRA 4P5OE 2CBLA 1OSAA 3PLFB 1F70A 1QIWA 3EVUA 3TS5C 5CSNA 1A2XA 2LMTA 4N5XA 1JUOA 3FIAA 1NX0A 2OPOA 1JF2A 2JXLA 1IWQA 3SG7A 4A4BA 1ZMZA 1CLMA 1BJFA 3WXAA 1F4OA 3NSKA 1UHKA 4YI8A 1F55A 1LA3A 1YTZC 3I5FB 1DVIA 3FWBA 2F3ZA 4DRWA 2ZN8A 3EK4A 1TCFA 1CDMA 4NDBA 2HQ8A 1OQPA 2M49B 1TCOB 1WRKA 2KBMA 3VGOA 1AUIB 4AQJA 1SL8A 1V1GA 3SIAA 5JJGA 2KFGA 1SY9A 2JT0A 1YRTB 2BL0B 2LP3A 3D0YA 4MBEA 1QXPA 1KK8B 1CMFA 5CSFA 1NX1A 1Q80A 2KFFA 1C07A 2WCBA 2FCEA 3I5FC 1ALVA 1K96A 4M2QA 2K2AA 4R1EA 2KBIA 1TNWA 1DJXA 1K9PA 4F0ZB 2OTGC 1UHJA 2JWWA 1TN4A 2ISDA 1CM4A 3CS1A 2E6WA 3EK8A 5AFPA 2JC2A 1ZUZA 2BL0C 1KFUS 1OMVA 1A03A 4BY4A 1KK8C 1S3PA 1BR1B 4DIRA 1CFPA 3C1VA 1DJYA 2KHNA 3JVTB 1M45A 2K7OA 2MLFC 1EG3A 3A8RA 4AOMA 1DF0B 1QX5B 1WRLA 1BG1A 1XK4A 3SIBA 2AUCA 3AKBA 3KEVA 1SR6C 1ODBA 4PHMA 2JULA 3KPXA 4M2PA 1F54A 5CSJA 3CR4X 1TNQA 1UWOA 1B9AA 5I2OA 2SASA 3AAJA 1DGUA 2CXJA 1RWYA 1S6JA 3TDUA 2MLEC 1K2HA 2O5GA 3GK4X 1A75A 4N1GA 3PM8A 1Y1AA 2MJWB 1A4PA 3CZTX 3JVTC 3OX6A 1QASA 1TNPA 1SCVA 2LVVA 1C7VA 2K8MB 1G8IA 4MEWA 2DOQA 4NDDA 1B7TY 2BCAA 1XO5A 5DKNA 3BOWA 1U5IB 1XFVO 3OHMB 1SK6D 1DTLA 1OZSA 3O78A 2JTTA 2K7DA 4PDZA 4YBHB 2CT9A 3TZ1A 4MZKA 1MR8A 1B4CA 5ER5A 2IS9A 5AXIA 2QACA 2K2FA 2JNFA 5AANA 1IH0A 1CLBA 2TN4A 1RTP1 1SKTA 1SNLA 2LVIA 5AEQA 2F3YA 1F71A 1SBJA 4ZCUA 2KAVA 1A29A 2BBNA 4JPZB 4PHKA 1G33A 1M46A 2K7CA 1YX8A 1MHOA 4YRUA 1FBVA 4GGFC 1QLSA 2JZIA 1NCYA 2WORA 1IQ5A 3EVVA 2CTNA 1R6PA 1IJ5A 4I5NB 5FYXA 1WRZA 5I2QA 2I7AA 3SG2A 1MXEA 1KFXS 2WNDA 1EL4A 1NUBA 1UURA 2LMUA 1EJ3A 3BYAA 2EC6B 2LV7A 4PE1A 2O60A 1XYDA 1J55A 5TNCA 1S1EA 1SMGA 2JQ6A 3I5GB 1OE9B 1JBAA 2I94A 1LA0A 3VRNA 2ZNDA 1CLLA 1KSOA 3CR2A 2PVBA 3AKAA 1IGVA 3BUOB 1NX2A 2KSPA 2L50A 2L0PA 1CKKA 4WQ2A 1K93D 2NZ0A 5K89A 2HPSA 2M0RA 4ZCVA 5G08A 2EC6C 1CNPA 3OB1B 4OV2A 4NDCA 1J1EA 3I5GC 3TDIA 4C0JA 4OKHA 2Q4UA 3FWCA 2KNEA 1QIVA 1XFXO 2OTGB 5HKZA 1LKJA 2KAXA 3NSIA 2KAYA 1OZOA 1BU3A 5KSZA 1DJGA 1TTXA 1DF0A 2BCBA 2Y1NA 1CFFA 1NP8A 1N2DA 1WLMA 4JWQA 2WOSA 1PULA 1UHIA 2FCDA 1C7WA 1LXFC 3RM1A 2JNXA 2LHIA 3VRPA 5PALA 2ZRSA 1QX7A 1SR6B 1CDNA 1QS7A 2F8PA 2KQ6A 1FW4A 2KDHA 1PSBA 1BR4B 3WHTB 1OOJA 1B47A 3ZWHA 1NIWA 1B7TZ 2LP2A 4HSZA 2KI4B 1K95A 2ZKMX 1NX3A 2LLTA 1H8BA 1QV0A 2L98A 4PHNA 1W7JB 2LUXA 2ZN9A 2HQWA 1MXLC 1F4QA 2A4JA 1GQMA 2OS8B 1SW8A 2D8NA 3O6BA 1FI6A 3DVMA 1YR5A 3DF0A 1QLKA 1FF1A 1R2UA 1SYMA 2MAZA 4PALA 1H4BA 5CSIA 3ZNIA 2KGBC 1M39A 4GBAA 1BLQA 1K8UA 1RECA 1N65A 3PATA 4GGFA 4HREE 2H61C 3TDZA 1XFYO 2FJUB 1QVIZ 1UHNA 2KI4C 3IQOA 3HX4A 1JWDA 4HRHA 2LLSA 1RFJA 2LANA 2MA2A 2M1UA 2BE4A 2LAPA 2E30A 2OS8C 2PASA 4MSPA 1JFJA 4OVNF 3PN7B 1BOCA 1NCZA 1SCMB 4YGEB 3I5HB 1JC2A 1QX2A 1CTRA 3LL8B 2RGIA 4JQ0D 5GQQC 2KI6D 2JPTA 2CNPA 1GGZA 3MSEB 3LK0A 2LNKA 1CB1A 3M0WA 1KSMA 4GAOA 3TUYC 1B8RA 1K9UA 1TRFA 2PMYA 3ICBA 2PALA 2G2BA 3NXAA 1QVIY 3PN7C 1JSAA 4I5KA 1SCMC 4GPLB 3I5HC 4BY5A 4YGCB 4YGAA 1DT7B 2BKIB 1DJZA 4MLWA 1DMOA 2CCMA 2LVJA 3EK7A 1HT9A 1YUUA 2L2EA 1IG5A 1E8AA 3BQ3A 4CIDA 4GUKA 4OR9B 1KFUL 4CLNA 3BXKA 2F2OA 4DCKA 1YRUB 3K21A 1B1GA 3A4UB 4FQOA 1GJYA 1B8CA 2LHLA 3F45A 4YGDB 1M31A 1CFCA 1EH2A 3OP0A 1VRKA 1SRAA 3GK2A 1KWOC 1S6CA 1YUTA 3VRQA 3AAKA 3SG4A 1A75B 1UHHA 2NCPA 2NLNA 1YUSA 1XFUO 1AK8A 5AERA 4YI9A 1V1FA 2R2IA 1QTXA 1RROA 2M29A 4GFTA 3KF9A 1IJ6A 2LVKA 1G4YR 1YURA 3I5IC 1MWNA 1S36A 3KO0A 1K9KA 2WCEA 3NSOA 2JU0A 1L7ZA 2GV5A 2LC5A 4IL1A 4D1EA 2M8UA 1IQ3A 2K7BA 4QJ5B 2L51A 5HKWA 2BBMA 2K0JA 3BUXB 4WRIA 1IKUA 1AJ4A 1HQVA 3VROA 4HRGA 2KFHA 2LUCA 2Y1MA 3DVEA 1S6IA 2LLUA 1ZACA 2M7NA 2F2PA 2WCFA 4XJKB 4ETOA 3CWGA 3EKHA 2KQYA 1Y6WA 1RJVA 4C0LA 1KQMB 1J7PA 1S26D 5HYDA 4MRXA 1B8LA 1WLZA 1KQVA 4PCWA 5BPJA 3LLEA 1CDLA 4YGBB 5I2LA 1GGWA 1CMGA 4A4CA 1ALWA 2EHBA 3LCPC 1CDPA 1CM1A 1IRJA 4GGNA 3PSRA 3IQQA 4MRYA 4ICBA 3HCMA 3BUMB 3PALA 2JTZA 2GGZA 2I2RE 2BECA 4MN0A 1KQMC 2EGDA 3H4SE 4Q04A 1DGVA 1ZOTB 2QPTA 4C0KA 1L2OB 3SJSA 1AHRA 3JTDB 4I5LB 1OMDA 4PHJA 2AMIA 5D7FA 2V53A 5KU1A 1DJWA 1XFWO 3QRXA 4UPGA 1KFXL 1YVLA 3DVKA 4I5JA 1K94A 4QJ3B 1NCXA 2MRDA 1MQ1A 1Y1XA 1FPWA 1D1OA 1RK9A 3OX5A 1DJHA 1U5IA 1XVJA 3CTNA 4ORCB 1OMRA 2LM5A 2COLB 2GGMA 3BUWB 1XFZO 1JFKA 3GOFA 1J7QA 3CGAA 2HF5A 1L2OC 3JTDC 4FTGA 1WY9A 2WC8A 1S5GZ 2I18A 2G9BA 1EG4A 4N1FA 1EXRA 4DUQA 3WNXB 2BE6A 2K61A 1BF5A 1YVHA 4ORBB 1AJ5A 1MUXA 3TUYB 2ZFDA 1K90D 1WDCB 4PE0A 5ER4X 4PE4A 1PRWA 1JF0A 4PE7A 1W7IB 1YX7A 3D0YB 1QATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVC D;  2KYC A;  1BOD A;  3DD4 A;  3BUN B;  1SPY A;  1NPQ A;  1PVA A;  2H2K A;  2ZNE A;  4U8D A;  5HLO A;  4USL A;  2JRF A;  3GK1 A;  3OB2 B;  5DKR A;  5HLV A;  5J3X A;  1DJI A;  2LE9 B;  5B8I B;  5KTY A;  2BKH B;  1M63 B;  1WDC C;  3LK1 A;  1PAL A;  3NSL A;  1Y0V H;  1S5G Y;  5I8N A;  1PSR A;  2FOT A;  2KYF A;  3SG5 A;  3E3R A;  5HKY A;  2Y4Q A;  2AAO A;  1KWO B;  2PSR A;  3PFV A;  4NQG A;  4ORA B;  4WQ3 A;  2MBX A;  1QJT A;  2LMV A;  1SL9 A;  4AQI A;  5CPV A;  1TIZ A;  1NWD A;  1LIN A;  1AVS A;  1PK0 D;  1Y1U A;  3DF0 B;  3I5I B;  4XYN A;  4E68 A;  3SG3 A;  2BCX A;  1QV1 A;  4P2Y B;  2L5X B;  2MHH A;  2VRG A;  3D10 A;  1KK7 Z;  4MZL A;  1J1D A;  4M2O A;  4CPV A;  1TNX A;  5DKQ A;  1NSH A;  2HET A;  1SL7 A;  2ZRT A;  4L9M A;  2JOJ A;  2NCO A;  1N0Y A;  4OCI A;  3SG6 A;  2L4I A;  2M7L A;  1AP4 A;  1J7O A;  4XJK A;  5D69 A;  2F33 A;  3FS7 A;  1NYA A;  2M1K B;  3VRR A;  2L4H A;  1XK4 C;  1J7R A;  3BOW B;  1BT6 A;  2P6B B;  1CFD A;  2LCP A;  4QJ4 B;  1F8H A;  2Q91 A;  2KI6 C;  2KGR A;  1TOP A;  3DVJ A;  2Y5I A;  2JT8 A;  5JOL A;  3EKJ A;  1KCY A;  4MZJ A;  1PVB A;  2M9G A;  3IF7 A;  2JXC A;  3O4Y A;  2B1U A;  1FI5 A;  2M3W A;  2NXQ A;  4DS7 A;  3TS5 B;  1UUS A;  3CLN A;  1KK7 Y;  1MF8 B;  2M97 A;  3CR5 X;  4GNK B;  3EVR A;  3WHU B;  4CFQ A;  3KHE A;  2PRU A;  5IBW A;  2JT3 A;  1BMO A;  1ZFS A;  1XA5 A;  1X02 A;  2SCP A;  2H61 A;  3RLZ A;  5F6T A;  4MVF A;  2KOT A;  3O2P A;  1UP5 A;  4TNC A;  4CFR A;  4P5O E;  2CBL A;  1OSA A;  3PLF B;  1F70 A;  1QIW A;  3EVU A;  3TS5 C;  5CSN A;  1A2X A;  2LMT A;  4N5X A;  1JUO A;  3FIA A;  1NX0 A;  2OPO A;  1JF2 A;  2JXL A;  1IWQ A;  3SG7 A;  4A4B A;  1ZMZ A;  1CLM A;  1BJF A;  3WXA A;  1F4O A;  3NSK A;  1UHK A;  4YI8 A;  1F55 A;  1LA3 A;  1YTZ C;  3I5F B;  1DVI A;  3FWB A;  2F3Z A;  4DRW A;  2ZN8 A;  3EK4 A;  1TCF A;  1CDM A;  4NDB A;  2HQ8 A;  1OQP A;  2M49 B;  1TCO B;  1WRK A;  2KBM A;  3VGO A;  1AUI B;  4AQJ A;  1SL8 A;  1V1G A;  3SIA A;  5JJG A;  2KFG A;  1SY9 A;  2JT0 A;  1YRT B;  2BL0 B;  2LP3 A;  3D0Y A;  4MBE A;  1QXP A;  1KK8 B;  1CMF A;  5CSF A;  1NX1 A;  1Q80 A;  2KFF A;  1C07 A;  2WCB A;  2FCE A;  3I5F C;  1ALV A;  1K96 A;  4M2Q A;  2K2A A;  4R1E A;  2KBI A;  1TNW A;  1DJX A;  1K9P A;  4F0Z B;  2OTG C;  1UHJ A;  2JWW A;  1TN4 A;  2ISD A;  1CM4 A;  3CS1 A;  2E6W A;  3EK8 A;  5AFP A;  2JC2 A;  1ZUZ A;  2BL0 C;  1KFU S;  1OMV A;  1A03 A;  4BY4 A;  1KK8 C;  1S3P A;  1BR1 B;  4DIR A;  1CFP A;  3C1V A;  1DJY A;  2KHN A;  3JVT B;  1M45 A;  2K7O A;  2MLF C;  1EG3 A;  3A8R A;  4AOM A;  1DF0 B;  1QX5 B;  1WRL A;  1BG1 A;  1XK4 A;  3SIB A;  2AUC A;  3AKB A;  3KEV A;  1SR6 C;  1ODB A;  4PHM A;  2JUL A;  3KPX A;  4M2P A;  1F54 A;  5CSJ A;  3CR4 X;  1TNQ A;  1UWO A;  1B9A A;  5I2O A;  2SAS A;  3AAJ A;  1DGU A;  2CXJ A;  1RWY A;  1S6J A;  3TDU A;  2MLE C;  1K2H A;  2O5G A;  3GK4 X;  1A75 A;  4N1G A;  3PM8 A;  1Y1A A;  2MJW B;  1A4P A;  3CZT X;  3JVT C;  3OX6 A;  1QAS A;  1TNP A;  1SCV A;  2LVV A;  1C7V A;  2K8M B;  1G8I A;  4MEW A;  2DOQ A;  4NDD A;  1B7T Y;  2BCA A;  1XO5 A;  5DKN A;  3BOW A;  1U5I B;  1XFV O;  3OHM B;  1SK6 D;  1DTL A;  1OZS A;  3O78 A;  2JTT A;  2K7D A;  4PDZ A;  4YBH B;  2CT9 A;  3TZ1 A;  4MZK A;  1MR8 A;  1B4C A;  5ER5 A;  2IS9 A;  5AXI A;  2QAC A;  2K2F A;  2JNF A;  5AAN A;  1IH0 A;  1CLB A;  2TN4 A;  1RTP 1;  1SKT A;  1SNL A;  2LVI A;  5AEQ A;  2F3Y A;  1F71 A;  1SBJ A;  4ZCU A;  2KAV A;  1A29 A;  2BBN A;  4JPZ B;  4PHK A;  1G33 A;  1M46 A;  2K7C A;  1YX8 A;  1MHO A;  4YRU A;  1FBV A;  4GGF C;  1QLS A;  2JZI A;  1NCY A;  2WOR A;  1IQ5 A;  3EVV A;  2CTN A;  1R6P A;  1IJ5 A;  4I5N B;  5FYX A;  1WRZ A;  5I2Q A;  2I7A A;  3SG2 A;  1MXE A;  1KFX S;  2WND A;  1EL4 A;  1NUB A;  1UUR A;  2LMU A;  1EJ3 A;  3BYA A;  2EC6 B;  2LV7 A;  4PE1 A;  2O60 A;  1XYD A;  1J55 A;  5TNC A;  1S1E A;  1SMG A;  2JQ6 A;  3I5G B;  1OE9 B;  1JBA A;  2I94 A;  1LA0 A;  3VRN A;  2ZND A;  1CLL A;  1KSO A;  3CR2 A;  2PVB A;  3AKA A;  1IGV A;  3BUO B;  1NX2 A;  2KSP A;  2L50 A;  2L0P A;  1CKK A;  4WQ2 A;  1K93 D;  2NZ0 A;  5K89 A;  2HPS A;  2M0R A;  4ZCV A;  5G08 A;  2EC6 C;  1CNP A;  3OB1 B;  4OV2 A;  4NDC A;  1J1E A;  3I5G C;  3TDI A;  4C0J A;  4OKH A;  2Q4U A;  3FWC A;  2KNE A;  1QIV A;  1XFX O;  2OTG B;  5HKZ A;  1LKJ A;  2KAX A;  3NSI A;  2KAY A;  1OZO A;  1BU3 A;  5KSZ A;  1DJG A;  1TTX A;  1DF0 A;  2BCB A;  2Y1N A;  1CFF A;  1NP8 A;  1N2D A;  1WLM A;  4JWQ A;  2WOS A;  1PUL A;  1UHI A;  2FCD A;  1C7W A;  1LXF C;  3RM1 A;  2JNX A;  2LHI A;  3VRP A;  5PAL A;  2ZRS A;  1QX7 A;  1SR6 B;  1CDN A;  1QS7 A;  2F8P A;  2KQ6 A;  1FW4 A;  2KDH A;  1PSB A;  1BR4 B;  3WHT B;  1OOJ A;  1B47 A;  3ZWH A;  1NIW A;  1B7T Z;  2LP2 A;  4HSZ A;  2KI4 B;  1K95 A;  2ZKM X;  1NX3 A;  2LLT A;  1H8B A;  1QV0 A;  2L98 A;  4PHN A;  1W7J B;  2LUX A;  2ZN9 A;  2HQW A;  1MXL C;  1F4Q A;  2A4J A;  1GQM A;  2OS8 B;  1SW8 A;  2D8N A;  3O6B A;  1FI6 A;  3DVM A;  1YR5 A;  3DF0 A;  1QLK A;  1FF1 A;  1R2U A;  1SYM A;  2MAZ A;  4PAL A;  1H4B A;  5CSI A;  3ZNI A;  2KGB C;  1M39 A;  4GBA A;  1BLQ A;  1K8U A;  1REC A;  1N65 A;  3PAT A;  4GGF A;  4HRE E;  2H61 C;  3TDZ A;  1XFY O;  2FJU B;  1QVI Z;  1UHN A;  2KI4 C;  3IQO A;  3HX4 A;  1JWD A;  4HRH A;  2LLS A;  1RFJ A;  2LAN A;  2MA2 A;  2M1U A;  2BE4 A;  2LAP A;  2E30 A;  2OS8 C;  2PAS A;  4MSP A;  1JFJ A;  4OVN F;  3PN7 B;  1BOC A;  1NCZ A;  1SCM B;  4YGE B;  3I5H B;  1JC2 A;  1QX2 A;  1CTR A;  3LL8 B;  2RGI A;  4JQ0 D;  5GQQ C;  2KI6 D;  2JPT A;  2CNP A;  1GGZ A;  3MSE B;  3LK0 A;  2LNK A;  1CB1 A;  3M0W A;  1KSM A;  4GAO A;  3TUY C;  1B8R A;  1K9U A;  1TRF A;  2PMY A;  3ICB A;  2PAL A;  2G2B A;  3NXA A;  1QVI Y;  3PN7 C;  1JSA A;  4I5K A;  1SCM C;  4GPL B;  3I5H C;  4BY5 A;  4YGC B;  4YGA A;  1DT7 B;  2BKI B;  1DJZ A;  4MLW A;  1DMO A;  2CCM A;  2LVJ A;  3EK7 A;  1HT9 A;  1YUU A;  2L2E A;  1IG5 A;  1E8A A;  3BQ3 A;  4CID A;  4GUK A;  4OR9 B;  1KFU L;  4CLN A;  3BXK A;  2F2O A;  4DCK A;  1YRU B;  3K21 A;  1B1G A;  3A4U B;  4FQO A;  1GJY A;  1B8C A;  2LHL A;  3F45 A;  4YGD B;  1M31 A;  1CFC A;  1EH2 A;  3OP0 A;  1VRK A;  1SRA A;  3GK2 A;  1KWO C;  1S6C A;  1YUT A;  3VRQ A;  3AAK A;  3SG4 A;  1A75 B;  1UHH A;  2NCP A;  2NLN A;  1YUS A;  1XFU O;  1AK8 A;  5AER A;  4YI9 A;  1V1F A;  2R2I A;  1QTX A;  1RRO A;  2M29 A;  4GFT A;  3KF9 A;  1IJ6 A;  2LVK A;  1G4Y R;  1YUR A;  3I5I C;  1MWN A;  1S36 A;  3KO0 A;  1K9K A;  2WCE A;  3NSO A;  2JU0 A;  1L7Z A;  2GV5 A;  2LC5 A;  4IL1 A;  4D1E A;  2M8U A;  1IQ3 A;  2K7B A;  4QJ5 B;  2L51 A;  5HKW A;  2BBM A;  2K0J A;  3BUX B;  4WRI A;  1IKU A;  1AJ4 A;  1HQV A;  3VRO A;  4HRG A;  2KFH A;  2LUC A;  2Y1M A;  3DVE A;  1S6I A;  2LLU A;  1ZAC A;  2M7N A;  2F2P A;  2WCF A;  4XJK B;  4ETO A;  3CWG A;  3EKH A;  2KQY A;  1Y6W A;  1RJV A;  4C0L A;  1KQM B;  1J7P A;  1S26 D;  5HYD A;  4MRX A;  1B8L A;  1WLZ A;  1KQV A;  4PCW A;  5BPJ A;  3LLE A;  1CDL A;  4YGB B;  5I2L A;  1GGW A;  1CMG A;  4A4C A;  1ALW A;  2EHB A;  3LCP C;  1CDP A;  1CM1 A;  1IRJ A;  4GGN A;  3PSR A;  3IQQ A;  4MRY A;  4ICB A;  3HCM A;  3BUM B;  3PAL A;  2JTZ A;  2GGZ A;  2I2R E;  2BEC A;  4MN0 A;  1KQM C;  2EGD A;  3H4S E;  4Q04 A;  1DGV A;  1ZOT B;  2QPT A;  4C0K A;  1L2O B;  3SJS A;  1AHR A;  3JTD B;  4I5L B;  1OMD A;  4PHJ A;  2AMI A;  5D7F A;  2V53 A;  5KU1 A;  1DJW A;  1XFW O;  3QRX A;  4UPG A;  1KFX L;  1YVL A;  3DVK A;  4I5J A;  1K94 A;  4QJ3 B;  1NCX A;  2MRD A;  1MQ1 A;  1Y1X A;  1FPW A;  1D1O A;  1RK9 A;  3OX5 A;  1DJH A;  1U5I A;  1XVJ A;  3CTN A;  4ORC B;  1OMR A;  2LM5 A;  2COL B;  2GGM A;  3BUW B;  1XFZ O;  1JFK A;  3GOF A;  1J7Q A;  3CGA A;  2HF5 A;  1L2O C;  3JTD C;  4FTG A;  1WY9 A;  2WC8 A;  1S5G Z;  2I18 A;  2G9B A;  1EG4 A;  4N1F A;  1EXR A;  4DUQ A;  3WNX B;  2BE6 A;  2K61 A;  1BF5 A;  1YVH A;  4ORB B;  1AJ5 A;  1MUX A;  3TUY B;  2ZFD A;  1K90 D;  1WDC B;  4PE0 A;  5ER4 X;  4PE4 A;  1PRW A;  1JF0 A;  4PE7 A;  1W7I B;  1YX7 A;  3D0Y B;  1QAT A; 
#chains in the Genus database with same CATH topology
 1LVC D;  2KYC A;  1BOD A;  3DD4 A;  3BUN B;  1SPY A;  1ORG A;  1NPQ A;  1PVA A;  2H2K A;  2ZNE A;  4U8D A;  5HLO A;  4USL A;  2JRF A;  3GK1 A;  3OB2 B;  5DKR A;  5HLV A;  5J3X A;  1DJI A;  2LE9 B;  5B8I B;  3EG5 B;  5KTY A;  2BKH B;  1M63 B;  1WDC C;  3LK1 A;  1PAL A;  3NSL A;  1Y0V H;  1S5G Y;  5I8N A;  1PSR A;  2FOT A;  2KYF A;  3SG5 A;  3E3R A;  5HKY A;  3N7H A;  2Y4Q A;  2AAO A;  1KWO B;  2PSR A;  3PFV A;  4NQG A;  4ORA B;  4WQ3 A;  2MBX A;  1QJT A;  2LMV A;  1SL9 A;  4AQI A;  4PT1 A;  5CPV A;  2K60 A;  5D3O A;  1TIZ A;  1NWD A;  1LIN A;  1AVS A;  1PK0 D;  1Y1U A;  2WCM A;  3DF0 B;  3I5I B;  4XYN A;  3SG3 A;  2BCX A;  1QV1 A;  3B86 A;  4E68 A;  2P71 A;  3CZ1 A;  4P2Y B;  2L5X B;  2MHH A;  2VRG A;  3D10 A;  1KK7 Z;  4MZL A;  1W9Z A;  1J1D A;  4M2O A;  4CPV A;  2BAP A;  1TNX A;  5DKQ A;  1NSH A;  2HET A;  1SL7 A;  2ZRT A;  4L9M A;  2JOJ A;  2NCO A;  1N0Y A;  4OCI A;  3SG6 A;  2L4I A;  2M7L A;  1AP4 A;  1J7O A;  4XJK A;  5D69 A;  2F33 A;  3FS7 A;  2JPO A;  1NYA A;  2M1K B;  3VRR A;  2L4H A;  1XK4 C;  4KYN A;  1J7R A;  1OOF A;  3BOW B;  1BT6 A;  2P6B B;  1CFD A;  2LCP A;  4QJ4 B;  1F8H A;  2Q91 A;  1QWV A;  2KI6 C;  2KGR A;  3OBV A;  1TOP A;  3DVJ A;  2Y5I A;  1OW4 A;  2QDI A;  2JT8 A;  2KLE A;  5JOL A;  3EKJ A;  1KCY A;  4MZJ A;  1PVB A;  2M9G A;  3IF7 A;  2JXC A;  3O4Y A;  2B1U A;  1FI5 A;  2M3W A;  2NXQ A;  4DS7 A;  3TS5 B;  1UUS A;  3CLN A;  1KK7 Y;  1MF8 B;  2M97 A;  3CR5 X;  4GNK B;  3EVR A;  3WHU B;  4CFQ A;  3KHE A;  2PRU A;  3R1V A;  5IBW A;  2JT3 A;  1BMO A;  1ZFS A;  1XA5 A;  1X02 A;  2SCP A;  2H61 A;  3RLZ A;  5F6T A;  4MVF A;  1TWO A;  2KOT A;  3O2P A;  1UP5 A;  4TNC A;  4CFR A;  4P5O E;  2CBL A;  1OSA A;  3PLF B;  1F70 A;  1QIW A;  3EVU A;  3TS5 C;  5CSN A;  1A2X A;  2LMT A;  4N5X A;  3BFA A;  1JUO A;  3FIA A;  1NX0 A;  2OPO A;  3CZ2 A;  1JF2 A;  2JXL A;  1IWQ A;  3B88 A;  3SG7 A;  4A4B A;  1ZMZ A;  1CLM A;  1BJF A;  4IJ7 A;  3WXA A;  1F4O A;  3NSK A;  1UHK A;  3DZT A;  3FE6 A;  4YI8 A;  1LA3 A;  1F55 A;  1YTZ C;  3I5F B;  2KPH A;  1DVI A;  3FWB A;  2F3Z A;  4DRW A;  2ZN8 A;  3EK4 A;  1TCF A;  1CDM A;  4NDB A;  2HQ8 A;  1OQP A;  2M49 B;  4OZD A;  1TCO B;  1WRK A;  2KBM A;  3VGO A;  1IIO A;  1AUI B;  4AQJ A;  1SL8 A;  1V1G A;  2WC5 A;  2QEB A;  3SIA A;  5JJG A;  2KFG A;  1SY9 A;  2JT0 A;  1XFR A;  1YRT B;  2BL0 B;  2LP3 A;  3D0Y A;  1TUZ A;  3CAB A;  4MBE A;  1QXP A;  1KK8 B;  1CMF A;  5CSF A;  1NX1 A;  1Q80 A;  2KFF A;  1C07 A;  1Z4H A;  3BFH A;  2WCB A;  2FCE A;  3I5F C;  1ALV A;  1K96 A;  4M2Q A;  2K2A A;  4R1E A;  2KBI A;  1TNW A;  1DJX A;  1K9P A;  4INW A;  4F0Z B;  2OTG C;  1UHJ A;  2JWW A;  1TN4 A;  2ISD A;  1CM4 A;  3CS1 A;  5FI7 A;  2E6W A;  3EK8 A;  5AFP A;  2JC2 A;  1DQE A;  1ZUZ A;  2BL0 C;  1KFU S;  1OMV A;  2QEH A;  1A03 A;  4BY4 A;  1KK8 C;  1S3P A;  1BR1 B;  4DIR A;  1CFP A;  3C1V A;  1DJY A;  2KHN A;  3JVT B;  1M45 A;  2K7O A;  2MLF C;  1EG3 A;  3A8R A;  4INX A;  4AOM A;  1DF0 B;  1QX5 B;  1WRL A;  1BG1 A;  1XK4 A;  3SIB A;  2AUC A;  3AKB A;  3KEV A;  1SR6 C;  1ODB A;  4PHM A;  2JUL A;  2H8V A;  3KPX A;  3D75 A;  4M2P A;  1F54 A;  3NGV A;  5CSJ A;  3CR4 X;  1TNQ A;  1UWO A;  1B9A A;  5EL2 A;  5I2O A;  2SAS A;  3AAJ A;  4JKT A;  1DGU A;  2CXJ A;  2ERB A;  1RWY A;  1S6J A;  3TDU A;  2MLE C;  1K2H A;  2O5G A;  3GK4 X;  3SS3 A;  1A75 A;  2PYQ A;  4N1G A;  1T14 A;  3PM8 A;  1Y1A A;  2MJW B;  1A4P A;  3CZT X;  3JVT C;  3OX6 A;  5HL1 A;  1QAS A;  1TNP A;  1SCV A;  2LVV A;  1C7V A;  2K8M B;  1G8I A;  4MEW A;  2DOQ A;  4NDD A;  1B7T Y;  2BCA A;  1XO5 A;  2WCJ A;  5DKN A;  3BOW A;  1U5I B;  1XFV O;  3IVT A;  3OHM B;  1SK6 D;  3S0B A;  1DTL A;  1OZS A;  3O78 A;  2JTT A;  2K7D A;  4PDZ A;  4YBH B;  2CT9 A;  3TZ1 A;  4MZK A;  1MR8 A;  1B4C A;  5ER5 A;  2IS9 A;  5AXI A;  2QAC A;  2K2F A;  2QEV A;  2JNF A;  5AAN A;  1IH0 A;  3K1E A;  1CLB A;  2TN4 A;  1RTP 1;  1SKT A;  1SNL A;  2LVI A;  5AEQ A;  2F3Y A;  1F71 A;  1SBJ A;  4ZCU A;  2KAV A;  1A29 A;  2BBN A;  4JPZ B;  4PHK A;  1G33 A;  2FJY A;  3OGN A;  1M46 A;  2K7C A;  1YX8 A;  1MHO A;  4YRU A;  1SSE B;  1FBV A;  4GGF C;  1QLS A;  2JZI A;  1NCY A;  2WOR A;  1IQ5 A;  3EVV A;  2CTN A;  1R6P A;  1IJ5 A;  4I5N B;  5FYX A;  1WRZ A;  5I2Q A;  2I7A A;  3SG2 A;  1MXE A;  1KFX S;  2WND A;  1EL4 A;  1NUB A;  1UUR A;  2LMU A;  1EJ3 A;  3BYA A;  2EC6 B;  2LV7 A;  4PE1 A;  2O60 A;  1XYD A;  1J55 A;  2L5Y A;  5TNC A;  1S1E A;  1SMG A;  2JQ6 A;  3I5G B;  3Q8I A;  1OE9 B;  1JBA A;  2I94 A;  1LA0 A;  3VRN A;  2ZND A;  1CLL A;  1KSO A;  3UO9 A;  3CR2 A;  2PVB A;  3AKA A;  1IGV A;  3BUO B;  1NX2 A;  2KSP A;  2L50 A;  2L0P A;  1CKK A;  4WQ2 A;  1K93 D;  2NZ0 A;  5K89 A;  2HPS A;  2M0R A;  4ZCV A;  5G08 A;  2EC6 C;  3D76 A;  3OB1 B;  3QME A;  1CNP A;  4OV2 A;  4NDC A;  1J1E A;  3I5G C;  3TDI A;  4C0J A;  4OKH A;  3S0D A;  2Q4U A;  3FWC A;  2KNE A;  1QIV A;  1XFX O;  2OTG B;  5HKZ A;  1LKJ A;  2KAX A;  3NSI A;  2KAY A;  1OZO A;  1BU3 A;  5KSZ A;  1DJG A;  1TTX A;  1DF0 A;  2BCB A;  2Y1N A;  1CFF A;  1NP8 A;  1N2D A;  1WLM A;  4JWQ A;  2WOS A;  1PUL A;  1UHI A;  2FCD A;  1C7W A;  1LXF C;  3RM1 A;  2JNX A;  2LHI A;  3VRP A;  5PAL A;  2ZRS A;  1OOG A;  1QX7 A;  1SR6 B;  1CDN A;  1QS7 A;  2F8P A;  2KQ6 A;  1FW4 A;  2KDH A;  1PSB A;  3D78 A;  1BR4 B;  3WHT B;  1OOJ A;  3CZ0 A;  1B47 A;  2KLD A;  3ZWH A;  1NIW A;  1B7T Z;  2LP2 A;  4HSZ A;  2KI4 B;  1K95 A;  2ZKM X;  1NX3 A;  2LLT A;  1H8B A;  1QV0 A;  2L98 A;  4PHN A;  1W7J B;  3RZS A;  2LUX A;  2ZN9 A;  2HQW A;  1MXL C;  1F4Q A;  2A4J A;  1GQM A;  1DEK A;  2OS8 B;  1SW8 A;  2D8N A;  3O6B A;  1FI6 A;  3DVM A;  1YR5 A;  3DF0 A;  1QLK A;  1FF1 A;  1R2U A;  1SYM A;  2MAZ A;  4PAL A;  1H4B A;  5CSI A;  3ZNI A;  2KGB C;  1M39 A;  4GBA A;  1BLQ A;  3D73 A;  1K8U A;  1REC A;  5FI6 A;  1N65 A;  3PAT A;  4GGF A;  4HRE E;  2H61 C;  3TDZ A;  5I94 A;  1XFY O;  2FJU B;  1QVI Z;  1UHN A;  2KI4 C;  3IQO A;  3HX4 A;  1JWD A;  4HRH A;  2LLS A;  2PQL A;  1RFJ A;  2LAN A;  2MA2 A;  2M1U A;  2BE4 A;  2LAP A;  2E30 A;  2OS8 C;  2PAS A;  4MSP A;  1JFJ A;  4OVN F;  1Z2C B;  3PN7 B;  1BOC A;  1NCZ A;  1SCM B;  4YGE B;  3I5H B;  1JC2 A;  1QX2 A;  1CTR A;  3LL8 B;  1P28 A;  2RGI A;  4JQ0 D;  5GQQ C;  2KI6 D;  2JPT A;  2CNP A;  1GGZ A;  3MSE B;  3LK0 A;  2LNK A;  3SS4 A;  2QEO A;  1KSM A;  3M0W A;  1CB1 A;  3PJI A;  3O4X A;  4GAO A;  3TUY C;  1B8R A;  1K9U A;  1TRF A;  2PMY A;  3ICB A;  2PAL A;  2G2B A;  1GM0 A;  3NXA A;  1QVI Y;  3PN7 C;  3D74 A;  3R72 A;  3SS5 A;  1JSA A;  4I5K A;  3B6X A;  1SCM C;  4GPL B;  1DEL A;  3I5H C;  4BY5 A;  1TUJ A;  4YGC B;  4YGA A;  1DT7 B;  2BKI B;  1DJZ A;  4MLW A;  1DMO A;  2CCM A;  2LVJ A;  3EK7 A;  1HT9 A;  1YUU A;  2L2E A;  1IG5 A;  4FQT A;  1E8A A;  3BQ3 A;  4CID A;  4GUK A;  4OR9 B;  1KFU L;  4CLN A;  3BXK A;  2F2O A;  3S0E A;  1YRU B;  3K21 A;  4DCK A;  1B1G A;  3A4U B;  4FQO A;  1GJY A;  1B8C A;  2LHL A;  2WC6 A;  3F45 A;  1M31 A;  3R1O A;  4YGD B;  3NHI A;  3DYE A;  1CFC A;  1EH2 A;  3OP0 A;  1VRK A;  1SRA A;  3GK2 A;  1KWO C;  1S6C A;  1YUT A;  3VRQ A;  3AAK A;  3SG4 A;  1A75 B;  1UHH A;  2NCP A;  2NLN A;  1LS8 A;  1YUS A;  1OOH A;  1XFU O;  5AER A;  1AK8 A;  4YI9 A;  1V1F A;  2R2I A;  1QTX A;  1RRO A;  2M29 A;  4GFT A;  3KF9 A;  1IJ6 A;  2LVK A;  1G4Y R;  1YUR A;  3I5I C;  3B87 A;  1MWN A;  1S36 A;  3KO0 A;  1K9K A;  2WCE A;  3NSO A;  2JU0 A;  1L7Z A;  2GV5 A;  2LC5 A;  3DXL A;  4IL1 A;  4D1E A;  2M8U A;  1IQ3 A;  2K7B A;  3CDN A;  4QJ5 B;  2L51 A;  5HKW A;  3S0F A;  2BBM A;  2K0J A;  2WCH A;  3BUX B;  4WRI A;  1IKU A;  1AJ4 A;  1HQV A;  3VRO A;  2P70 A;  4HRG A;  2KFH A;  5FI2 A;  2LUC A;  2Y1M A;  3DVE A;  1S6I A;  2LLU A;  1ZAC A;  2M7N A;  2F2P A;  2WCF A;  3L47 A;  1C3Z A;  2WCL A;  4XJK B;  3BFB A;  4ETO A;  3CWG A;  3EKH A;  2KQY A;  1Y6W A;  1RJV A;  4C0L A;  1KQM B;  1J7P A;  1S26 D;  5HYD A;  4MRX A;  1B8L A;  1WLZ A;  1KQV A;  4PCW A;  5BPJ A;  3LLE A;  1CDL A;  4YGB B;  5I2L A;  1GGW A;  1CMG A;  3UNW A;  4A4C A;  1ALW A;  2EHB A;  3LCP C;  1CDP A;  4F7F A;  1CM1 A;  1IRJ A;  2WCK A;  4GGN A;  3PSR A;  3DY9 A;  3IQQ A;  4MRY A;  4ICB A;  3HCM A;  3BUM B;  3PAL A;  2JTZ A;  2GGZ A;  2I2R E;  3FE9 A;  2BEC A;  3L4A A;  3S0G A;  3PM2 A;  4MN0 A;  1KQM C;  2EGD A;  1DC1 A;  3H4S E;  4Q04 A;  1DGV A;  1ZOT B;  2QPT A;  4C0K A;  1L2O B;  2BNX A;  3SJS A;  1AHR A;  3R1P A;  3JTD B;  4I5L B;  1OMD A;  4PHJ A;  2AMI A;  3BJH A;  5D7F A;  2V53 A;  5KU1 A;  1DJW A;  1XFW O;  3QRX A;  4UPG A;  1KFX L;  1YVL A;  3DVK A;  4I5J A;  1K94 A;  3D77 A;  4QJ3 B;  1NCX A;  2MRD A;  1MQ1 A;  1Y1X A;  1FPW A;  1D1O A;  1RK9 A;  2YGU A;  1DJH A;  1U5I A;  1XVJ A;  3CTN A;  3OX5 A;  4ORC B;  3V2L A;  1OMR A;  2LM5 A;  2COL B;  2GGM A;  3BUW B;  1XFZ O;  1JFK A;  3GOF A;  3NHT A;  1J7Q A;  2L2C A;  3CGA A;  2HF5 A;  1L2O C;  3JTD C;  4FTG A;  1WY9 A;  3FE8 A;  3VB1 A;  2GTE A;  2WC8 A;  1S5G Z;  2I18 A;  2G9B A;  5DIC A;  1EG4 A;  4N1F A;  1EXR A;  4DUQ A;  3WNX B;  2BE6 A;  2K61 A;  1BF5 A;  1YVH A;  4ORB B;  3B7A A;  1AJ5 A;  3CYZ A;  3S0A A;  1MUX A;  3TUY B;  2ZFD A;  1K90 D;  1WDC B;  4JD9 A;  4PE0 A;  5ER4 X;  4PE4 A;  1PRW A;  1JF0 A;  4PE7 A;  1OOI X;  1C3Y A;  1W7I B;  1YX7 A;  3D0Y B;  1QAT A;  3L4L A; 
#chains in the Genus database with same CATH homology
 1LVC D;  2KYC A;  1BOD A;  3DD4 A;  3BUN B;  1SPY A;  1NPQ A;  1PVA A;  2H2K A;  2ZNE A;  4U8D A;  5HLO A;  4USL A;  2JRF A;  3GK1 A;  3OB2 B;  5DKR A;  5HLV A;  5J3X A;  1DJI A;  2LE9 B;  5B8I B;  5KTY A;  2BKH B;  1M63 B;  1WDC C;  3LK1 A;  1PAL A;  3NSL A;  1Y0V H;  1S5G Y;  5I8N A;  1PSR A;  2FOT A;  2KYF A;  3SG5 A;  3E3R A;  5HKY A;  2Y4Q A;  2AAO A;  1KWO B;  2PSR A;  3PFV A;  4NQG A;  4ORA B;  4WQ3 A;  2MBX A;  1QJT A;  2LMV A;  1SL9 A;  4AQI A;  5CPV A;  1TIZ A;  1NWD A;  1LIN A;  1AVS A;  1PK0 D;  1Y1U A;  3DF0 B;  3I5I B;  4XYN A;  4E68 A;  3SG3 A;  2BCX A;  1QV1 A;  4P2Y B;  2L5X B;  2MHH A;  2VRG A;  3D10 A;  1KK7 Z;  4MZL A;  1J1D A;  4M2O A;  4CPV A;  1TNX A;  5DKQ A;  1NSH A;  2HET A;  1SL7 A;  2ZRT A;  4L9M A;  2JOJ A;  2NCO A;  1N0Y A;  4OCI A;  3SG6 A;  2L4I A;  2M7L A;  1AP4 A;  1J7O A;  4XJK A;  5D69 A;  2F33 A;  3FS7 A;  1NYA A;  2M1K B;  3VRR A;  2L4H A;  1XK4 C;  1J7R A;  3BOW B;  1BT6 A;  2P6B B;  1CFD A;  2LCP A;  4QJ4 B;  1F8H A;  2Q91 A;  2KI6 C;  2KGR A;  1TOP A;  3DVJ A;  2Y5I A;  2JT8 A;  5JOL A;  3EKJ A;  1KCY A;  4MZJ A;  1PVB A;  2M9G A;  3IF7 A;  2JXC A;  3O4Y A;  2B1U A;  1FI5 A;  2M3W A;  2NXQ A;  4DS7 A;  3TS5 B;  1UUS A;  3CLN A;  1KK7 Y;  1MF8 B;  2M97 A;  3CR5 X;  4GNK B;  3EVR A;  3WHU B;  4CFQ A;  3KHE A;  2PRU A;  5IBW A;  2JT3 A;  1BMO A;  1ZFS A;  1XA5 A;  1X02 A;  2SCP A;  2H61 A;  3RLZ A;  5F6T A;  4MVF A;  2KOT A;  3O2P A;  1UP5 A;  4TNC A;  4CFR A;  4P5O E;  2CBL A;  1OSA A;  3PLF B;  1F70 A;  1QIW A;  3EVU A;  3TS5 C;  5CSN A;  1A2X A;  2LMT A;  4N5X A;  1JUO A;  3FIA A;  1NX0 A;  2OPO A;  1JF2 A;  2JXL A;  1IWQ A;  3SG7 A;  4A4B A;  1ZMZ A;  1CLM A;  1BJF A;  3WXA A;  1F4O A;  3NSK A;  1UHK A;  4YI8 A;  1F55 A;  1LA3 A;  1YTZ C;  3I5F B;  1DVI A;  3FWB A;  2F3Z A;  4DRW A;  2ZN8 A;  3EK4 A;  1TCF A;  1CDM A;  4NDB A;  2HQ8 A;  1OQP A;  2M49 B;  1TCO B;  1WRK A;  2KBM A;  3VGO A;  1AUI B;  4AQJ A;  1SL8 A;  1V1G A;  3SIA A;  5JJG A;  2KFG A;  1SY9 A;  2JT0 A;  1YRT B;  2BL0 B;  2LP3 A;  3D0Y A;  4MBE A;  1QXP A;  1KK8 B;  1CMF A;  5CSF A;  1NX1 A;  1Q80 A;  2KFF A;  1C07 A;  2WCB A;  2FCE A;  3I5F C;  1ALV A;  1K96 A;  4M2Q A;  2K2A A;  4R1E A;  2KBI A;  1TNW A;  1DJX A;  1K9P A;  4F0Z B;  2OTG C;  1UHJ A;  2JWW A;  1TN4 A;  2ISD A;  1CM4 A;  3CS1 A;  2E6W A;  3EK8 A;  5AFP A;  2JC2 A;  1ZUZ A;  2BL0 C;  1KFU S;  1OMV A;  1A03 A;  4BY4 A;  1KK8 C;  1S3P A;  1BR1 B;  4DIR A;  1CFP A;  3C1V A;  1DJY A;  2KHN A;  3JVT B;  1M45 A;  2K7O A;  2MLF C;  1EG3 A;  3A8R A;  4AOM A;  1DF0 B;  1QX5 B;  1WRL A;  1BG1 A;  1XK4 A;  3SIB A;  2AUC A;  3AKB A;  3KEV A;  1SR6 C;  1ODB A;  4PHM A;  2JUL A;  3KPX A;  4M2P A;  1F54 A;  5CSJ A;  3CR4 X;  1TNQ A;  1UWO A;  1B9A A;  5I2O A;  2SAS A;  3AAJ A;  1DGU A;  2CXJ A;  1RWY A;  1S6J A;  3TDU A;  2MLE C;  1K2H A;  2O5G A;  3GK4 X;  1A75 A;  4N1G A;  3PM8 A;  1Y1A A;  2MJW B;  1A4P A;  3CZT X;  3JVT C;  3OX6 A;  1QAS A;  1TNP A;  1SCV A;  2LVV A;  1C7V A;  2K8M B;  1G8I A;  4MEW A;  2DOQ A;  4NDD A;  1B7T Y;  2BCA A;  1XO5 A;  5DKN A;  3BOW A;  1U5I B;  1XFV O;  3OHM B;  1SK6 D;  1DTL A;  1OZS A;  3O78 A;  2JTT A;  2K7D A;  4PDZ A;  4YBH B;  2CT9 A;  3TZ1 A;  4MZK A;  1MR8 A;  1B4C A;  5ER5 A;  2IS9 A;  5AXI A;  2QAC A;  2K2F A;  2JNF A;  5AAN A;  1IH0 A;  1CLB A;  2TN4 A;  1RTP 1;  1SKT A;  1SNL A;  2LVI A;  5AEQ A;  2F3Y A;  1F71 A;  1SBJ A;  4ZCU A;  2KAV A;  1A29 A;  2BBN A;  4JPZ B;  4PHK A;  1G33 A;  1M46 A;  2K7C A;  1YX8 A;  1MHO A;  4YRU A;  1FBV A;  4GGF C;  1QLS A;  2JZI A;  1NCY A;  2WOR A;  1IQ5 A;  3EVV A;  2CTN A;  1R6P A;  1IJ5 A;  4I5N B;  5FYX A;  1WRZ A;  5I2Q A;  2I7A A;  3SG2 A;  1MXE A;  1KFX S;  2WND A;  1EL4 A;  1NUB A;  1UUR A;  2LMU A;  1EJ3 A;  3BYA A;  2EC6 B;  2LV7 A;  4PE1 A;  2O60 A;  1XYD A;  1J55 A;  5TNC A;  1S1E A;  1SMG A;  2JQ6 A;  3I5G B;  1OE9 B;  1JBA A;  2I94 A;  1LA0 A;  3VRN A;  2ZND A;  1CLL A;  1KSO A;  3CR2 A;  2PVB A;  3AKA A;  1IGV A;  3BUO B;  1NX2 A;  2KSP A;  2L50 A;  2L0P A;  1CKK A;  4WQ2 A;  1K93 D;  2NZ0 A;  5K89 A;  2HPS A;  2M0R A;  4ZCV A;  5G08 A;  2EC6 C;  1CNP A;  3OB1 B;  4OV2 A;  4NDC A;  1J1E A;  3I5G C;  3TDI A;  4C0J A;  4OKH A;  2Q4U A;  3FWC A;  2KNE A;  1QIV A;  1XFX O;  2OTG B;  5HKZ A;  1LKJ A;  2KAX A;  3NSI A;  2KAY A;  1OZO A;  1BU3 A;  5KSZ A;  1DJG A;  1TTX A;  1DF0 A;  2BCB A;  2Y1N A;  1CFF A;  1NP8 A;  1N2D A;  1WLM A;  4JWQ A;  2WOS A;  1PUL A;  1UHI A;  2FCD A;  1C7W A;  1LXF C;  3RM1 A;  2JNX A;  2LHI A;  3VRP A;  5PAL A;  2ZRS A;  1QX7 A;  1SR6 B;  1CDN A;  1QS7 A;  2F8P A;  2KQ6 A;  1FW4 A;  2KDH A;  1PSB A;  1BR4 B;  3WHT B;  1OOJ A;  1B47 A;  3ZWH A;  1NIW A;  1B7T Z;  2LP2 A;  4HSZ A;  2KI4 B;  1K95 A;  2ZKM X;  1NX3 A;  2LLT A;  1H8B A;  1QV0 A;  2L98 A;  4PHN A;  1W7J B;  2LUX A;  2ZN9 A;  2HQW A;  1MXL C;  1F4Q A;  2A4J A;  1GQM A;  2OS8 B;  1SW8 A;  2D8N A;  3O6B A;  1FI6 A;  3DVM A;  1YR5 A;  3DF0 A;  1QLK A;  1FF1 A;  1R2U A;  1SYM A;  2MAZ A;  4PAL A;  1H4B A;  5CSI A;  3ZNI A;  2KGB C;  1M39 A;  4GBA A;  1BLQ A;  1K8U A;  1REC A;  1N65 A;  3PAT A;  4GGF A;  4HRE E;  2H61 C;  3TDZ A;  1XFY O;  2FJU B;  1QVI Z;  1UHN A;  2KI4 C;  3IQO A;  3HX4 A;  1JWD A;  4HRH A;  2LLS A;  1RFJ A;  2LAN A;  2MA2 A;  2M1U A;  2BE4 A;  2LAP A;  2E30 A;  2OS8 C;  2PAS A;  4MSP A;  1JFJ A;  4OVN F;  3PN7 B;  1BOC A;  1NCZ A;  1SCM B;  4YGE B;  3I5H B;  1JC2 A;  1QX2 A;  1CTR A;  3LL8 B;  2RGI A;  4JQ0 D;  5GQQ C;  2KI6 D;  2JPT A;  2CNP A;  1GGZ A;  3MSE B;  3LK0 A;  2LNK A;  1CB1 A;  3M0W A;  1KSM A;  4GAO A;  3TUY C;  1B8R A;  1K9U A;  1TRF A;  2PMY A;  3ICB A;  2PAL A;  2G2B A;  3NXA A;  1QVI Y;  3PN7 C;  1JSA A;  4I5K A;  1SCM C;  4GPL B;  3I5H C;  4BY5 A;  4YGC B;  4YGA A;  1DT7 B;  2BKI B;  1DJZ A;  4MLW A;  1DMO A;  2CCM A;  2LVJ A;  3EK7 A;  1HT9 A;  1YUU A;  2L2E A;  1IG5 A;  1E8A A;  3BQ3 A;  4CID A;  4GUK A;  4OR9 B;  1KFU L;  4CLN A;  3BXK A;  2F2O A;  4DCK A;  1YRU B;  3K21 A;  1B1G A;  3A4U B;  4FQO A;  1GJY A;  1B8C A;  2LHL A;  3F45 A;  4YGD B;  1M31 A;  1CFC A;  1EH2 A;  3OP0 A;  1VRK A;  1SRA A;  3GK2 A;  1KWO C;  1S6C A;  1YUT A;  3VRQ A;  3AAK A;  3SG4 A;  1A75 B;  1UHH A;  2NCP A;  2NLN A;  1YUS A;  1XFU O;  1AK8 A;  5AER A;  4YI9 A;  1V1F A;  2R2I A;  1QTX A;  1RRO A;  2M29 A;  4GFT A;  3KF9 A;  1IJ6 A;  2LVK A;  1G4Y R;  1YUR A;  3I5I C;  1MWN A;  1S36 A;  3KO0 A;  1K9K A;  2WCE A;  3NSO A;  2JU0 A;  1L7Z A;  2GV5 A;  2LC5 A;  4IL1 A;  4D1E A;  2M8U A;  1IQ3 A;  2K7B A;  4QJ5 B;  2L51 A;  5HKW A;  2BBM A;  2K0J A;  3BUX B;  4WRI A;  1IKU A;  1AJ4 A;  1HQV A;  3VRO A;  4HRG A;  2KFH A;  2LUC A;  2Y1M A;  3DVE A;  1S6I A;  2LLU A;  1ZAC A;  2M7N A;  2F2P A;  2WCF A;  4XJK B;  4ETO A;  3CWG A;  3EKH A;  2KQY A;  1Y6W A;  1RJV A;  4C0L A;  1KQM B;  1J7P A;  1S26 D;  5HYD A;  4MRX A;  1B8L A;  1WLZ A;  1KQV A;  4PCW A;  5BPJ A;  3LLE A;  1CDL A;  4YGB B;  5I2L A;  1GGW A;  1CMG A;  4A4C A;  1ALW A;  2EHB A;  3LCP C;  1CDP A;  1CM1 A;  1IRJ A;  4GGN A;  3PSR A;  3IQQ A;  4MRY A;  4ICB A;  3HCM A;  3BUM B;  3PAL A;  2JTZ A;  2GGZ A;  2I2R E;  2BEC A;  4MN0 A;  1KQM C;  2EGD A;  3H4S E;  4Q04 A;  1DGV A;  1ZOT B;  2QPT A;  4C0K A;  1L2O B;  3SJS A;  1AHR A;  3JTD B;  4I5L B;  1OMD A;  4PHJ A;  2AMI A;  5D7F A;  2V53 A;  5KU1 A;  1DJW A;  1XFW O;  3QRX A;  4UPG A;  1KFX L;  1YVL A;  3DVK A;  4I5J A;  1K94 A;  4QJ3 B;  1NCX A;  2MRD A;  1MQ1 A;  1Y1X A;  1FPW A;  1D1O A;  1RK9 A;  3OX5 A;  1DJH A;  1U5I A;  1XVJ A;  3CTN A;  4ORC B;  1OMR A;  2LM5 A;  2COL B;  2GGM A;  3BUW B;  1XFZ O;  1JFK A;  3GOF A;  1J7Q A;  3CGA A;  2HF5 A;  1L2O C;  3JTD C;  4FTG A;  1WY9 A;  2WC8 A;  1S5G Z;  2I18 A;  2G9B A;  1EG4 A;  4N1F A;  1EXR A;  4DUQ A;  3WNX B;  2BE6 A;  2K61 A;  1BF5 A;  1YVH A;  4ORB B;  1AJ5 A;  1MUX A;  3TUY B;  2ZFD A;  1K90 D;  1WDC B;  4PE0 A;  5ER4 X;  4PE4 A;  1PRW A;  1JF0 A;  4PE7 A;  1W7I B;  1YX7 A;  3D0Y B;  1QAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...