1J7RA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
LGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
molecule keywords Calcium Vector Protein
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7rA00
4QJ5B 1JBAA 1QIWA 1YUSA 1SYMA 3DVKA 2IS9A 2LLTA 5TNCA 1BODA 4MRYA 2WCEA 1K9KA 1K93D 1H4BA 1BR1B 1GJYA 5ER5A 1NSHA 1CB1A 3MSEB 2HETA 2L0PA 2ZKMX 1DJWA 1S36A 2OS8B 1IGVA 3I5HB 1G4YR 1JFJA 2KQ6A 1OE9B 1RECA 2K61A 1A75B 2LCPA 4C0LA 5BPJA 4TNCA 3SIAA 4CPVA 1TTXA 1NP8A 2BECA 3GK1A 1FF1A 2KFHA 2LMTA 1B4CA 1H8BA 1EXRA 1N65A 3FS7A 1S3PA 2G2BA 3TDUA 2LM5A 1JUOA 1YVLA 2CCMA 1S6JA 1BOCA 2JU0A 2LMUA 2ZNDA 2JT0A 5KTYA 2JT8A 1M39A 1K8UA 2NCOA 1C7VA 1AJ5A 1MXLC 1XFXO 4BY4A 2O60A 2MHHA 1LXFC 1WY9A 1KWOC 2F2PA 3PATA 2K7DA 4YGEB 2BE6A 4P5OE 1PRWA 3CR5X 4NDCA 1K9PA 5AANA 2WCBA 2LC5A 1SKTA 1QJTA 1NWDA 2NLNA 3NXAA 1DF0A 1ALWA 1SPYA 1LVCD 1L7ZA 4PE4A 3C1VA 2M97A 1L2OC 3SIBA 2LVVA 1DVIA 1QV0A 1HT9A 1LA3A 3WXAA 3EK4A 3NSOA 4I5NB 1QX7A 1S5GZ 3TS5B 5I8NA 1EL4A 4YBHB 1NIWA 5KSZA 2I94A 1WDCB 1B8CA 4OKHA 2K0JA 3WHTB 1J1EA 2HF5A 5AXIA 1B1GA 1M46A 3WHUB 2JPTA 1U5IB 4M2QA 1F4QA 1RROA 5CPVA 4NDBA 4ETOA 1FPWA 2F3ZA 1QX2A 3D0YA 3SG3A 4MRXA 3SG4A 1SR6C 2RGIA 1AHRA 2JOJA 2K7OA 2AUCA 2H2KA 2M0RA 4M2PA 1M63B 3WNXB 2OS8C 1J7PA 1XYDA 1Y1UA 3A8RA 2JZIA 4YGCB 4PHNA 2M29A 3KEVA 1NYAA 4MZKA 4PDZA 3BQ3A 3BUOB 4YGAA 3OX6A 2M49B 4DIRA 4FTGA 4YRUA 4OCIA 1XK4C 2JC2A 4DS7A 2K7CA 3QRXA 3PALA 2COLB 3KF9A 1ALVA 3CS1A 1YX8A 1S26D 1IKUA 2LUXA 4GGFC 2WCFA 1CFFA 1PSBA 2CXJA 3LK1A 1UHNA 1DT7B 3OHMB 1DJZA 2LE9B 3EKHA 3M0WA 4OVNF 1TCOB 1VRKA 1CDPA 1S5GY 3GK2A 3IF7A 4WQ2A 1NCZA 5I2QA 1J7OA 1BMOA 2E6WA 3SJSA 3LL8B 4QJ3B 1LINA 2JNXA 4C0JA 2HQ8A 5G08A 2M3WA 1PALA 2BL0B 1EG3A 2L5XB 2WORA 1K96A 1F55A 3PN7B 5JJGA 2FCDA 1YR5A 2KQYA 2LHIA 1LKJA 3NSLA 1KFUS 3F45A 1OQPA 4YGBB 3NSKA 3O78A 1OSAA 1XVJA 2KI6C 3CGAA 4R1EA 1JF2A 4NDDA 1KK8B 2LMVA 4JQ0D 3CZTX 3TS5C 2LUCA 5CSFA 3E3RA 3KO0A 1DJYA 1EJ3A 1A75A 2KAYA 3SG2A 5ER4X 4PALA 1KK7Z 3VRNA 1KQMB 3LLEA 5AFPA 4CFRA 2BKIB 1JSAA 1XFWO 2A4JA 2Y5IA 4L9MA 2O5GA 5DKQA 4I5KA 1SBJA 4I5LB 2GGMA 3TUYC 3OP0A 1XFYO 2KNEA 2KFGA 5AEQA 1NX1A 3I5HC 2JTTA 1C7WA 4MVFA 1AP4A 2JNFA 1N2DA 4YI9A 2MA2A 1YUTA 4GAOA 4MZLA 1N0YA 5CSJA 2L50A 1NPQA 2M7LA 1QXPA 4M2OA 1SY9A 1K95A 2QPTA 1BU3A 2F8PA 1EH2A 1PVBA 1GQMA 2KI6D 4PHJA 2KI4C 3EKJA 3I5FB 1AK8A 1Y1XA 3CTNA 1JWDA 4YGDB 2JXCA 2NZ0A 2QACA 4DUQA 1EG4A 1CM4A 1FI5A 1JF0A 2LANA 5D7FA 2KDHA 3DF0B 1SW8A 1YRTB 1PK0D 1B9AA 3JVTB 1QX5B 2KGBC 1S6IA 2BCXA 2TN4A 4BY5A 2ISDA 1NCYA 1MXEA 1C07A 1QATA 1WLZA 3BXKA 1DF0B 3SG6A 1SCVA 5F6TA 1IG5A 1G33A 2GGZA 1PVAA 2VRGA 1CLLA 4ICBA 4QJ4B 2BKHB 3I5GC 1PULA 3GK4X 1QASA 3VRPA 1TIZA 1W7JB 3EK8A 1OMRA 1CFPA 2JXLA 1QLSA 2FOTA 2LNKA 1OZSA 4PCWA 4E68A 1FW4A 1KFXS 1BR4B 3JTDB 1IWQA 1OZOA 2JT3A 4I5JA 1RK9A 2Y1MA 2AMIA 2EC6C 1F8HA 3RM1A 1E8AA 4FQOA 3DVJA 1KQMC 2KHNA 3D0YB 3FIAA 5HKYA 1KFXL 2L98A 1UHJA 2JRFA 3DVEA 1UHHA 1SK6D 5DKNA 1WLMA 3VRQA 5K89A 2Y4QA 1JC2A 1DMOA 1PSRA 2KGRA 2KBMA 2SCPA 1CTRA 2JWWA 2K8MB 2PVBA 2B1UA 5B8IB 1J1DA 4HRHA 1DJXA 4PHKA 2EHBA 2LP3A 3PN7C 4DCKA 3AAKA 4AQIA 1QS7A 1CLMA 1IQ3A 1QIVA 2FJUB 2OTGC 3HX4A 4ORCB 1A03A 5AERA 2M1UA 2WC8A 3GOFA 3BOWA 5CSIA 2CNPA 1BF5A 2Q4UA 2KI4B 3I5FC 2NXQA 1M31A 1ZUZA 2OPOA 1J7RA 1SL8A 1IJ5A 1YURA 2E30A 2JQ6A 2M8UA 2BCAA 2KYCA 1OMDA 3VGOA 3AKBA 1TRFA 4MSPA 2MLEC 3EVVA 1KK7Y 1MQ1A 5HLOA 1DGVA 1DTLA 2K2AA 2L2EA 3VRRA 4AOMA 2LAPA 4N1FA 1B47A 1KCYA 1ZMZA 1G8IA 2KOTA 1IQ5A 1DJGA 2CTNA 1SL7A 2LLUA 4A4CA 1XFUO 3BYAA 3CWGA 2ZN8A 1XO5A 1HQVA 5I2LA 3ZWHA 3FWCA 1MUXA 1NX3A 3EVRA 2PALA 1R6PA 2KSPA 4U8DA 1TNWA 2M9GA 1SCMB 2ZN9A 4P2YB 4XJKA 5JOLA 1XFVO 1BG1A 1SMGA 2CT9A 2LLSA 3BUMB 2PRUA 4PE7A 4OR9B 3SG7A 1NUBA 1YVHA 2MAZA 5HYDA 1AUIB 4JWQA 2ZNEA 1Y0VH 4XYNA 2LVIA 1A29A 1K90D 3SG5A 1Q80A 1B8RA 3TUYB 1SR6B 5IBWA 2BBNA 2MRDA 4HSZA 4HRGA 3OB2B 5KU1A 2MBXA 1BT6A 1WRKA 4ORBB 4MEWA 3LCPC 3ICBA 1RJVA 3JTDC 1SNLA 1L2OB 2I18A 3EVUA 3BUNB 1WRLA 2HQWA 1CNPA 1K94A 2L4IA 4Q04A 1B7TZ 1UURA 1CKKA 4CFQA 2PASA 1MHOA 1TCFA 1DGUA 1XK4A 3I5IB 1UUSA 1YTZC 1TOPA 2KAVA 4NQGA 4OV2A 1ZACA 4PE1A 5DKRA 3D10A 3RLZA 1DJIA 1K2HA 1V1FA 1QVIY 4GGFA 1WDCC 3AKAA 1KWOB 1BJFA 2GV5A 4GFTA 2MJWB 3H4SE 2MLFC 1NX2A 1SRAA 1AVSA 3JVTC 4A4BA 2F2OA 3IQOA 4C0KA 1B8LA 2ZRSA 4GNKB 3O6BA 1YX7A 1RFJA 3OB1B 3CLNA 4CIDA 4HREE 3TZ1A 4GUKA 1A2XA 2Q91A 4UPGA 3PLFB 1AJ4A 1KFUL 1NCXA 2PMYA 4F0ZB 2NCPA 2JULA 2BCBA 1IRJA 1RTP1 4USLA 1KSMA 1X02A 2I2RE 3FWBA 3KHEA 3CR2A 4YI8A 1CFCA 2WNDA 2KYFA 4DRWA 3VROA 3TDZA 2EC6B 1F71A 1FBVA 2F33A 4N1GA 4N5XA 3I5IC 2M7NA 2LVJA 2HPSA 1GGZA 4WRIA 2CBLA 1B7TY 4IL1A 2F3YA 2KFFA 2FCEA 1OMVA 2R2IA 4ZCUA 1F70A 2D8NA 1Y6WA 5CSNA 1WRZA 2M1KB 1TN4A 1J55A 1K9UA 3PFVA 4CLNA 2I7AA 2AAOA 1NX0A 1YUUA 3BUXB 5I2OA 1TNQA 1UWOA 4MBEA 3NSIA 1LA0A 1CFDA 1ZOTB 2EGDA 2K2FA 2KBIA 1UP5A 2G9BA 4WQ3A 1U5IA 3O4YA 1RWYA 2BBMA 1D1OA 2BE4A 1V1GA 2WOSA 1ODBA 1OOJA 1BLQA 1CMGA 3ZNIA 1TNXA 1UHIA 3DF0A 3KPXA 5GQQC 4JPZB 3EK7A 3A4UB 1CDLA 4ZCVA 1SCMC 2V53A 1W7IB 3CR4X 1KQVA 3BUWB 4MLWA 4PHMA 1F4OA 1KK8C 1IJ6A 1QLKA 2H61C 5PALA 1F54A 2PSRA 1MR8A 3HCMA 1Y1AA 1CDNA 1IH0A 1UHKA 1TNPA 2OTGB 2SASA 1JFKA 2ZRTA 2H61A 4GGNA 2L4HA 2L51A 2LHLA 1CMFA 2LP2A 1GGWA 5J3XA 2ZFDA 4XJKB 1XFZO 3OX5A 1QV1A 3AAJA 4D1EA 1KSOA 4MZJA 5D69A 1FI6A 1MF8B 5HLVA 5HKWA 2LVKA 1ZFSA 2KAXA 1CDMA 1SL9A 3DVMA 3O2PA 2JTZA 4GPLB 2P6BB 3TDIA 1S1EA 2BL0C 1YRUB 1J7QA 4AQJA 2Y1NA 3PSRA 3DD4A 1QTXA 1QVIZ 4PE0A 3BOWB 2K7BA 1MWNA 1XA5A 1R2UA 3IQQA 3PM8A 1A4PA 1CM1A 2LV7A 3LK0A 1DJHA 1CLBA 4ORAB 4GBAA 3K21A 5HKZA 1S6CA 1M45A 3I5GB 5FYXA 4MN0A 2DOQA
chains in the Genus database with same CATH superfamily
4QJ5B 1T14A 1QIWA 1YUSA 1SYMA 3DVKA 1JBAA 2IS9A 2LLTA 5TNCA 1BODA 4MRYA 2WCEA 1K9KA 1K93D 3CZ0A 1BR1B 1H4BA 1GJYA 5ER5A 1NSHA 1CB1A 3MSEB 2HETA 2L0PA 3R1OA 4FQTA 2ZKMX 1DJWA 1S36A 2OS8B 1IGVA 3I5HB 1G4YR 3PM2A 1JFJA 2KQ6A 1OE9B 1RECA 2K61A 1A75B 2LCPA 4C0LA 5BPJA 4TNCA 3SIAA 4CPVA 1TTXA 1NP8A 2BECA 3GK1A 1FF1A 2KFHA 2LMTA 1B4CA 1H8BA 1EXRA 1N65A 2PYQA 3FS7A 1S3PA 1OOIX 2G2BA 3TDUA 2LM5A 1JUOA 1YVLA 2CCMA 1S6JA 1BOCA 2JU0A 5FI7A 2LMUA 1OOGA 2ZNDA 2JT0A 5KTYA 2JT8A 1M39A 1K8UA 2NCOA 1C7VA 1AJ5A 1MXLC 1XFXO 4BY4A 2O60A 2MHHA 1LXFC 1WY9A 1KWOC 2F2PA 3PATA 2K7DA 5EL2A 4YGEB 3S0FA 2BE6A 4P5OE 1PRWA 3CR5X 4NDCA 1K9PA 5AANA 2WCBA 2LC5A 1SKTA 1QJTA 1NWDA 2NLNA 3NXAA 1DF0A 3EG5B 1ALWA 1SPYA 1LVCD 3DXLA 1L7ZA 4PE4A 3C1VA 2M97A 1L2OC 3SIBA 2LVVA 1DVIA 4JD9A 1QV0A 3CDNA 3VB1A 1HT9A 1LA3A 3WXAA 3EK4A 3B88A 3NSOA 4I5NB 1QX7A 1S5GZ 3TS5B 5I8NA 1EL4A 4YBHB 5D3OA 1NIWA 5KSZA 2I94A 1WDCB 1IIOA 1B8CA 4OKHA 2K0JA 3WHTB 1J1EA 2HF5A 5AXIA 1B1GA 1M46A 3WHUB 2JPTA 1U5IB 1W9ZA 4M2QA 1F4QA 1RROA 5CPVA 1Z2CB 4NDBA 4ETOA 1FPWA 2F3ZA 1QX2A 3D0YA 3SG3A 4MRXA 3SG4A 1SR6C 2RGIA 1AHRA 2JOJA 2K7OA 2AUCA 2H2KA 2M0RA 4M2PA 1M63B 3WNXB 2OS8C 1J7PA 1XYDA 1Y1UA 3A8RA 2JZIA 5FI2A 1OOHA 4YGCB 4PHNA 2M29A 3KEVA 1NYAA 1SSEB 2WC6A 4MZKA 4PDZA 3BQ3A 3BUOB 3B86A 4YGAA 3OX6A 2M49B 4DIRA 4FTGA 4YRUA 4OCIA 1XK4C 2JC2A 4DS7A 2K7CA 3RZSA 3QRXA 2L5YA 3L4AA 3PALA 2COLB 2P70A 3KF9A 1ALVA 3CS1A 1YX8A 1S26D 1IKUA 2LUXA 4GGFC 2WCFA 1CFFA 1PSBA 2CXJA 3LK1A 1UHNA 1DT7B 3OHMB 1DJZA 2LE9B 3EKHA 3M0WA 4OVNF 1OW4A 1TCOB 1VRKA 2PQLA 1CDPA 1S5GY 1C3ZA 3CYZA 3D74A 1NCZA 3GK2A 3IF7A 4WQ2A 3SS3A 5I2QA 1BMOA 2E6WA 3SJSA 3PJIA 3S0EA 3LL8B 3D75A 4QJ3B 3B6XA 1CFCA 1LINA 2JNXA 4C0JA 2HQ8A 5G08A 2M3WA 1PALA 2BL0B 1EG3A 2L5XB 2WORA 1K96A 1F55A 3OBVA 3PN7B 5JJGA 2FCDA 1YR5A 2KQYA 2LHIA 1LKJA 3NSLA 3SS5A 1KFUS 3F45A 1OQPA 4YGBB 3NSKA 3O78A 1OSAA 1XVJA 2KI6C 3CGAA 4R1EA 3DYEA 1JF2A 4NDDA 1KK8B 2GTEA 2LMVA 4JQ0D 3CZTX 3TS5C 2LUCA 5CSFA 3E3RA 3KO0A 1DJYA 1EJ3A 1A75A 2KAYA 3SG2A 1TWOA 3NHIA 5ER4X 4PALA 1KK7Z 3VRNA 1J7OA 1KQMB 3LLEA 5AFPA 4CFRA 2BKIB 2WC5A 1JSAA 1XFWO 3D77A 2A4JA 2Y5IA 4L9MA 1C3YA 2O5GA 5DKQA 4I5KA 1SBJA 4I5LB 2GGMA 3D76A 3OP0A 1XFYO 3TUYC 2KNEA 2KFGA 5AEQA 4F7FA 1NX1A 3I5HC 2JTTA 1C7WA 4MVFA 3O4XA 1AP4A 2JNFA 1N2DA 4YI9A 2MA2A 1YUTA 4GAOA 4MZLA 1N0YA 5CSJA 2L50A 1NPQA 2M7LA 1QXPA 4M2OA 1SY9A 1K95A 2QPTA 3S0GA 1BU3A 2F8PA 1EH2A 1PVBA 1GQMA 2KI6D 4PHJA 2KI4C 3EKJA 3I5FB 1AK8A 1Y1XA 3CTNA 1JWDA 4YGDB 2JXCA 3R1VA 2NZ0A 2QACA 4DUQA 3K1EA 1EG4A 1CM4A 1FI5A 1JF0A 2LANA 5D7FA 2KDHA 3DF0B 1SW8A 1YRTB 1PK0D 1B9AA 3JVTB 1QX5B 2KGBC 3UNWA 1S6IA 2BCXA 2TN4A 4BY5A 2ISDA 1ORGA 1NCYA 1MXEA 3CZ2A 1QATA 1WLZA 1C07A 1OOFA 3BXKA 1DF0B 3SG6A 1SCVA 5F6TA 1IG5A 1G33A 2GGZA 1PVAA 2VRGA 1CLLA 4ICBA 4QJ4B 2BKHB 3I5GC 1PULA 3GK4X 1QASA 3VRPA 1TIZA 1W7JB 3S0BA 3EK8A 1OMRA 1CFPA 3CABA 2JXLA 1QLSA 2FOTA 3DZTA 2LNKA 1OZSA 3N7HA 3NGVA 4PCWA 2QEVA 4E68A 1FW4A 1KFXS 1BR4B 3JTDB 1IWQA 1OZOA 2JT3A 2K60A 1RK9A 4I5JA 2Y1MA 2AMIA 2YGUA 2EC6C 1F8HA 3RM1A 1E8AA 4FQOA 3DVJA 1KQMC 2KHNA 3D0YB 3FIAA 5HKYA 1KFXL 2L98A 1UHJA 2JRFA 3DVEA 1UHHA 1SK6D 3D73A 3R1PA 5DKNA 1WLMA 3VRQA 5K89A 2Y4QA 1JC2A 1DMOA 1PSRA 2KGRA 2KBMA 2SCPA 2QEBA 1CTRA 2JWWA 2K8MB 2KPHA 2PVBA 2B1UA 5B8IB 1J1DA 4HRHA 1DJXA 4PHKA 2EHBA 3SS4A 2LP3A 3PN7C 4DCKA 3AAKA 4AQIA 1QS7A 1CLMA 1IQ3A 1QIVA 2FJUB 2OTGC 3HX4A 4ORCB 1A03A 5AERA 2M1UA 2WC8A 3V2LA 2KLDA 3GOFA 3BOWA 5CSIA 1TUZA 2CNPA 1BF5A 2Q4UA 2KI4B 3I5FC 2NXQA 1M31A 1ZUZA 2OPOA 1J7RA 1SL8A 1IJ5A 1YURA 2E30A 2JQ6A 2L2CA 3FE6A 2M8UA 4OZDA 2BCAA 2KYCA 1OMDA 3VGOA 3AKBA 1TRFA 4MSPA 2MLEC 3EVVA 1KK7Y 1MQ1A 5HLOA 1DGVA 1DTLA 2K2AA 2L2EA 3VRRA 3B87A 4AOMA 2LAPA 4N1FA 1B47A 1KCYA 1ZMZA 1G8IA 2KOTA 2QDIA 1IQ5A 1DJGA 2CTNA 1SL7A 2LLUA 4A4CA 1XFUO 3BYAA 4JKTA 3CWGA 2ZN8A 1XO5A 1HQVA 5I2LA 2WCMA 3ZWHA 3FWCA 3OGNA 4KYNA 1MUXA 1NX3A 3EVRA 2PALA 1R6PA 2KSPA 4U8DA 1TNWA 2M9GA 1SCMB 2ZN9A 4P2YB 4XJKA 5JOLA 1XFVO 1BG1A 1SMGA 2CT9A 2LLSA 2WCHA 2PRUA 3BUMB 3L4LA 3QMEA 4OR9B 4PE7A 3SG7A 1NUBA 1YVHA 2MAZA 3UO9A 5HYDA 1AUIB 4JWQA 2ZNEA 1DELA 1Y0VH 4XYNA 2LVIA 1A29A 2P71A 1K90D 3SG5A 1Q80A 1B8RA 3TUYB 1SR6B 5IBWA 2BBNA 2ERBA 2MRDA 4HSZA 4HRGA 3OB2B 5KU1A 2MBXA 1BT6A 1WRKA 4ORBB 4MEWA 3LCPC 3NHTA 1LS8A 3ICBA 1RJVA 3JTDC 1SNLA 1L2OB 2I18A 3CZ1A 3EVUA 3BUNB 1WRLA 2HQWA 1CNPA 1K94A 2L4IA 4INXA 1B7TZ 3IVTA 1UURA 2WCJA 4Q04A 1CKKA 4CFQA 2PASA 3S0DA 1MHOA 1TCFA 1DGUA 1XK4A 2WCKA 1UUSA 3I5IB 1YTZC 1TOPA 2KAVA 4NQGA 1P28A 1ZACA 4OV2A 4PE1A 3D10A 5DKRA 1DQEA 3RLZA 3S0AA 1DJIA 1K2HA 1V1FA 1QVIY 4GGFA 1WDCC 3AKAA 1KWOB 3L47A 1BJFA 2GV5A 4GFTA 2MJWB 3H4SE 2MLFC 1NX2A 5I94A 1SRAA 1AVSA 3JVTC 2H8VA 4A4BA 2F2OA 3IQOA 4C0KA 1B8LA 2ZRSA 4GNKB 3O6BA 1YX7A 1RFJA 3OB1B 3CLNA 4CIDA 4HREE 3TZ1A 4GUKA 1A2XA 2Q91A 4UPGA 3PLFB 1AJ4A 1KFUL 1NCXA 2PMYA 4F0ZB 2NCPA 2JULA 2BCBA 1IRJA 3D78A 2BNXA 1RTP1 4USLA 1KSMA 1X02A 2I2RE 3FWBA 3KHEA 3CR2A 1TUJA 4YI8A 5FI6A 2WNDA 2KYFA 4DRWA 3VROA 3TDZA 2EC6B 1F71A 1FBVA 2F33A 4N1GA 4N5XA 3I5IC 2M7NA 2LVJA 2HPSA 1GGZA 4WRIA 2CBLA 1XFRA 1B7TY 4IL1A 2F3YA 2KFFA 2FCEA 1OMVA 2R2IA 4ZCUA 1F70A 2D8NA 1Y6WA 5CSNA 1WRZA 2M1KB 1TN4A 1J55A 1K9UA 3PFVA 4CLNA 2I7AA 2AAOA 1NX0A 1YUUA 2WCLA 3BFBA 3BUXB 1TNQA 3Q8IA 1UWOA 4MBEA 5I2OA 3NSIA 1LA0A 1CFDA 1ZOTB 2EGDA 2K2FA 2KBIA 1UP5A 2G9BA 4WQ3A 1U5IA 3O4YA 1RWYA 2BBMA 1D1OA 5DICA 2BE4A 1DC1A 1V1GA 2WOSA 1ODBA 1OOJA 1BLQA 1CMGA 3ZNIA 3BJHA 1TNXA 1UHIA 2QEOA 3DF0A 3KPXA 4JPZB 5GQQC 3EK7A 3A4UB 1CDLA 4ZCVA 1SCMC 3BFHA 2V53A 1W7IB 3CR4X 2KLEA 1KQVA 3BUWB 4MLWA 4PHMA 1F4OA 1KK8C 1IJ6A 1QLKA 2H61C 3B7AA 5PALA 1F54A 2PSRA 1MR8A 3HCMA 1Y1AA 1CDNA 1IH0A 1UHKA 1TNPA 2OTGB 2SASA 1JFKA 2ZRTA 2H61A 4GGNA 2L4HA 2L51A 2LHLA 3BFAA 1CMFA 1Z4HA 1GM0A 2LP2A 1GGWA 4IJ7A 5J3XA 2ZFDA 4XJKB 1XFZO 3OX5A 1QV1A 3AAJA 4D1EA 1KSOA 4MZJA 5D69A 1QWVA 1FI6A 2BAPA 1MF8B 2JPOA 5HLVA 5HKWA 3FE8A 2LVKA 1ZFSA 2KAXA 1CDMA 1SL9A 3DVMA 3O2PA 2JTZA 4GPLB 2P6BB 3TDIA 1S1EA 2BL0C 1YRUB 3FE9A 1J7QA 2QEHA 4AQJA 2Y1NA 4INWA 3PSRA 3DD4A 1QTXA 1QVIZ 4PE0A 3BOWB 2K7BA 1MWNA 1XA5A 1R2UA 3IQQA 3R72A 3DY9A 1DEKA 3PM8A 1A4PA 2FJYA 1CM1A 2LV7A 3LK0A 1DJHA 4PT1A 1CLBA 4ORAB 4GBAA 3K21A 5HL1A 5HKZA 1S6CA 1M45A 3I5GB 5FYXA 4MN0A 2DOQA
chains in the Genus database with same CATH topology
4QJ5B 1JBAA 1QIWA 1YUSA 1SYMA 3DVKA 2IS9A 2LLTA 5TNCA 1BODA 4MRYA 2WCEA 1K9KA 1K93D 1H4BA 1BR1B 1GJYA 5ER5A 1NSHA 1CB1A 3MSEB 2HETA 2L0PA 2ZKMX 1DJWA 1S36A 2OS8B 1IGVA 3I5HB 1G4YR 1JFJA 2KQ6A 1OE9B 1RECA 2K61A 1A75B 2LCPA 4C0LA 5BPJA 4TNCA 3SIAA 4CPVA 1TTXA 1NP8A 2BECA 3GK1A 1FF1A 2KFHA 2LMTA 1B4CA 1H8BA 1EXRA 1N65A 3FS7A 1S3PA 2G2BA 3TDUA 2LM5A 1JUOA 1YVLA 2CCMA 1S6JA 1BOCA 2JU0A 2LMUA 2ZNDA 2JT0A 5KTYA 2JT8A 1M39A 1K8UA 2NCOA 1C7VA 1AJ5A 1MXLC 1XFXO 4BY4A 2O60A 2MHHA 1LXFC 1WY9A 1KWOC 2F2PA 3PATA 2K7DA 4YGEB 2BE6A 4P5OE 1PRWA 3CR5X 4NDCA 1K9PA 5AANA 2WCBA 2LC5A 1SKTA 1QJTA 1NWDA 2NLNA 3NXAA 1DF0A 1ALWA 1SPYA 1LVCD 1L7ZA 4PE4A 3C1VA 2M97A 1L2OC 3SIBA 2LVVA 1DVIA 1QV0A 1HT9A 1LA3A 3WXAA 3EK4A 3NSOA 4I5NB 1QX7A 1S5GZ 3TS5B 5I8NA 1EL4A 4YBHB 1NIWA 5KSZA 2I94A 1WDCB 1B8CA 4OKHA 2K0JA 3WHTB 1J1EA 2HF5A 5AXIA 1B1GA 1M46A 3WHUB 2JPTA 1U5IB 4M2QA 1F4QA 1RROA 5CPVA 4NDBA 4ETOA 1FPWA 2F3ZA 1QX2A 3D0YA 3SG3A 4MRXA 3SG4A 1SR6C 2RGIA 1AHRA 2JOJA 2K7OA 2AUCA 2H2KA 2M0RA 4M2PA 1M63B 3WNXB 2OS8C 1J7PA 1XYDA 1Y1UA 3A8RA 2JZIA 4YGCB 4PHNA 2M29A 3KEVA 1NYAA 4MZKA 4PDZA 3BQ3A 3BUOB 4YGAA 3OX6A 2M49B 4DIRA 4FTGA 4YRUA 4OCIA 1XK4C 2JC2A 4DS7A 2K7CA 3QRXA 3PALA 2COLB 3KF9A 1ALVA 3CS1A 1YX8A 1S26D 1IKUA 2LUXA 4GGFC 2WCFA 1CFFA 1PSBA 2CXJA 3LK1A 1UHNA 1DT7B 3OHMB 1DJZA 2LE9B 3EKHA 3M0WA 4OVNF 1TCOB 1VRKA 1CDPA 1S5GY 3GK2A 3IF7A 4WQ2A 1NCZA 5I2QA 1J7OA 1BMOA 2E6WA 3SJSA 3LL8B 4QJ3B 1LINA 2JNXA 4C0JA 2HQ8A 5G08A 2M3WA 1PALA 2BL0B 1EG3A 2L5XB 2WORA 1K96A 1F55A 3PN7B 5JJGA 2FCDA 1YR5A 2KQYA 2LHIA 1LKJA 3NSLA 1KFUS 3F45A 1OQPA 4YGBB 3NSKA 3O78A 1OSAA 1XVJA 2KI6C 3CGAA 4R1EA 1JF2A 4NDDA 1KK8B 2LMVA 4JQ0D 3CZTX 3TS5C 2LUCA 5CSFA 3E3RA 3KO0A 1DJYA 1EJ3A 1A75A 2KAYA 3SG2A 5ER4X 4PALA 1KK7Z 3VRNA 1KQMB 3LLEA 5AFPA 4CFRA 2BKIB 1JSAA 1XFWO 2A4JA 2Y5IA 4L9MA 2O5GA 5DKQA 4I5KA 1SBJA 4I5LB 2GGMA 3TUYC 3OP0A 1XFYO 2KNEA 2KFGA 5AEQA 1NX1A 3I5HC 2JTTA 1C7WA 4MVFA 1AP4A 2JNFA 1N2DA 4YI9A 2MA2A 1YUTA 4GAOA 4MZLA 1N0YA 5CSJA 2L50A 1NPQA 2M7LA 1QXPA 4M2OA 1SY9A 1K95A 2QPTA 1BU3A 2F8PA 1EH2A 1PVBA 1GQMA 2KI6D 4PHJA 2KI4C 3EKJA 3I5FB 1AK8A 1Y1XA 3CTNA 1JWDA 4YGDB 2JXCA 2NZ0A 2QACA 4DUQA 1EG4A 1CM4A 1FI5A 1JF0A 2LANA 5D7FA 2KDHA 3DF0B 1SW8A 1YRTB 1PK0D 1B9AA 3JVTB 1QX5B 2KGBC 1S6IA 2BCXA 2TN4A 4BY5A 2ISDA 1NCYA 1MXEA 1C07A 1QATA 1WLZA 3BXKA 1DF0B 3SG6A 1SCVA 5F6TA 1IG5A 1G33A 2GGZA 1PVAA 2VRGA 1CLLA 4ICBA 4QJ4B 2BKHB 3I5GC 1PULA 3GK4X 1QASA 3VRPA 1TIZA 1W7JB 3EK8A 1OMRA 1CFPA 2JXLA 1QLSA 2FOTA 2LNKA 1OZSA 4PCWA 4E68A 1FW4A 1KFXS 1BR4B 3JTDB 1IWQA 1OZOA 2JT3A 4I5JA 1RK9A 2Y1MA 2AMIA 2EC6C 1F8HA 3RM1A 1E8AA 4FQOA 3DVJA 1KQMC 2KHNA 3D0YB 3FIAA 5HKYA 1KFXL 2L98A 1UHJA 2JRFA 3DVEA 1UHHA 1SK6D 5DKNA 1WLMA 3VRQA 5K89A 2Y4QA 1JC2A 1DMOA 1PSRA 2KGRA 2KBMA 2SCPA 1CTRA 2JWWA 2K8MB 2PVBA 2B1UA 5B8IB 1J1DA 4HRHA 1DJXA 4PHKA 2EHBA 2LP3A 3PN7C 4DCKA 3AAKA 4AQIA 1QS7A 1CLMA 1IQ3A 1QIVA 2FJUB 2OTGC 3HX4A 4ORCB 1A03A 5AERA 2M1UA 2WC8A 3GOFA 3BOWA 5CSIA 2CNPA 1BF5A 2Q4UA 2KI4B 3I5FC 2NXQA 1M31A 1ZUZA 2OPOA 1J7RA 1SL8A 1IJ5A 1YURA 2E30A 2JQ6A 2M8UA 2BCAA 2KYCA 1OMDA 3VGOA 3AKBA 1TRFA 4MSPA 2MLEC 3EVVA 1KK7Y 1MQ1A 5HLOA 1DGVA 1DTLA 2K2AA 2L2EA 3VRRA 4AOMA 2LAPA 4N1FA 1B47A 1KCYA 1ZMZA 1G8IA 2KOTA 1IQ5A 1DJGA 2CTNA 1SL7A 2LLUA 4A4CA 1XFUO 3BYAA 3CWGA 2ZN8A 1XO5A 1HQVA 5I2LA 3ZWHA 3FWCA 1MUXA 1NX3A 3EVRA 2PALA 1R6PA 2KSPA 4U8DA 1TNWA 2M9GA 1SCMB 2ZN9A 4P2YB 4XJKA 5JOLA 1XFVO 1BG1A 1SMGA 2CT9A 2LLSA 3BUMB 2PRUA 4PE7A 4OR9B 3SG7A 1NUBA 1YVHA 2MAZA 5HYDA 1AUIB 4JWQA 2ZNEA 1Y0VH 4XYNA 2LVIA 1A29A 1K90D 3SG5A 1Q80A 1B8RA 3TUYB 1SR6B 5IBWA 2BBNA 2MRDA 4HSZA 4HRGA 3OB2B 5KU1A 2MBXA 1BT6A 1WRKA 4ORBB 4MEWA 3LCPC 3ICBA 1RJVA 3JTDC 1SNLA 1L2OB 2I18A 3EVUA 3BUNB 1WRLA 2HQWA 1CNPA 1K94A 2L4IA 4Q04A 1B7TZ 1UURA 1CKKA 4CFQA 2PASA 1MHOA 1TCFA 1DGUA 1XK4A 3I5IB 1UUSA 1YTZC 1TOPA 2KAVA 4NQGA 4OV2A 1ZACA 4PE1A 5DKRA 3D10A 3RLZA 1DJIA 1K2HA 1V1FA 1QVIY 4GGFA 1WDCC 3AKAA 1KWOB 1BJFA 2GV5A 4GFTA 2MJWB 3H4SE 2MLFC 1NX2A 1SRAA 1AVSA 3JVTC 4A4BA 2F2OA 3IQOA 4C0KA 1B8LA 2ZRSA 4GNKB 3O6BA 1YX7A 1RFJA 3OB1B 3CLNA 4CIDA 4HREE 3TZ1A 4GUKA 1A2XA 2Q91A 4UPGA 3PLFB 1AJ4A 1KFUL 1NCXA 2PMYA 4F0ZB 2NCPA 2JULA 2BCBA 1IRJA 1RTP1 4USLA 1KSMA 1X02A 2I2RE 3FWBA 3KHEA 3CR2A 4YI8A 1CFCA 2WNDA 2KYFA 4DRWA 3VROA 3TDZA 2EC6B 1F71A 1FBVA 2F33A 4N1GA 4N5XA 3I5IC 2M7NA 2LVJA 2HPSA 1GGZA 4WRIA 2CBLA 1B7TY 4IL1A 2F3YA 2KFFA 2FCEA 1OMVA 2R2IA 4ZCUA 1F70A 2D8NA 1Y6WA 5CSNA 1WRZA 2M1KB 1TN4A 1J55A 1K9UA 3PFVA 4CLNA 2I7AA 2AAOA 1NX0A 1YUUA 3BUXB 5I2OA 1TNQA 1UWOA 4MBEA 3NSIA 1LA0A 1CFDA 1ZOTB 2EGDA 2K2FA 2KBIA 1UP5A 2G9BA 4WQ3A 1U5IA 3O4YA 1RWYA 2BBMA 1D1OA 2BE4A 1V1GA 2WOSA 1ODBA 1OOJA 1BLQA 1CMGA 3ZNIA 1TNXA 1UHIA 3DF0A 3KPXA 5GQQC 4JPZB 3EK7A 3A4UB 1CDLA 4ZCVA 1SCMC 2V53A 1W7IB 3CR4X 1KQVA 3BUWB 4MLWA 4PHMA 1F4OA 1KK8C 1IJ6A 1QLKA 2H61C 5PALA 1F54A 2PSRA 1MR8A 3HCMA 1Y1AA 1CDNA 1IH0A 1UHKA 1TNPA 2OTGB 2SASA 1JFKA 2ZRTA 2H61A 4GGNA 2L4HA 2L51A 2LHLA 1CMFA 2LP2A 1GGWA 5J3XA 2ZFDA 4XJKB 1XFZO 3OX5A 1QV1A 3AAJA 4D1EA 1KSOA 4MZJA 5D69A 1FI6A 1MF8B 5HLVA 5HKWA 2LVKA 1ZFSA 2KAXA 1CDMA 1SL9A 3DVMA 3O2PA 2JTZA 4GPLB 2P6BB 3TDIA 1S1EA 2BL0C 1YRUB 1J7QA 4AQJA 2Y1NA 3PSRA 3DD4A 1QTXA 1QVIZ 4PE0A 3BOWB 2K7BA 1MWNA 1XA5A 1R2UA 3IQQA 3PM8A 1A4PA 1CM1A 2LV7A 3LK0A 1DJHA 1CLBA 4ORAB 4GBAA 3K21A 5HKZA 1S6CA 1M45A 3I5GB 5FYXA 4MN0A 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJ5 B;  1JBA A;  1QIW A;  1YUS A;  1SYM A;  3DVK A;  2IS9 A;  2LLT A;  5TNC A;  1BOD A;  4MRY A;  2WCE A;  1K9K A;  1K93 D;  1H4B A;  1BR1 B;  1GJY A;  5ER5 A;  1NSH A;  1CB1 A;  3MSE B;  2HET A;  2L0P A;  2ZKM X;  1DJW A;  1S36 A;  2OS8 B;  1IGV A;  3I5H B;  1G4Y R;  1JFJ A;  2KQ6 A;  1OE9 B;  1REC A;  2K61 A;  1A75 B;  2LCP A;  4C0L A;  5BPJ A;  4TNC A;  3SIA A;  4CPV A;  1TTX A;  1NP8 A;  2BEC A;  3GK1 A;  1FF1 A;  2KFH A;  2LMT A;  1B4C A;  1H8B A;  1EXR A;  1N65 A;  3FS7 A;  1S3P A;  2G2B A;  3TDU A;  2LM5 A;  1JUO A;  1YVL A;  2CCM A;  1S6J A;  1BOC A;  2JU0 A;  2LMU A;  2ZND A;  2JT0 A;  5KTY A;  2JT8 A;  1M39 A;  1K8U A;  2NCO A;  1C7V A;  1AJ5 A;  1MXL C;  1XFX O;  4BY4 A;  2O60 A;  2MHH A;  1LXF C;  1WY9 A;  1KWO C;  2F2P A;  3PAT A;  2K7D A;  4YGE B;  2BE6 A;  4P5O E;  1PRW A;  3CR5 X;  4NDC A;  1K9P A;  5AAN A;  2WCB A;  2LC5 A;  1SKT A;  1QJT A;  1NWD A;  2NLN A;  3NXA A;  1DF0 A;  1ALW A;  1SPY A;  1LVC D;  1L7Z A;  4PE4 A;  3C1V A;  2M97 A;  1L2O C;  3SIB A;  2LVV A;  1DVI A;  1QV0 A;  1HT9 A;  1LA3 A;  3WXA A;  3EK4 A;  3NSO A;  4I5N B;  1QX7 A;  1S5G Z;  3TS5 B;  5I8N A;  1EL4 A;  4YBH B;  1NIW A;  5KSZ A;  2I94 A;  1WDC B;  1B8C A;  4OKH A;  2K0J A;  3WHT B;  1J1E A;  2HF5 A;  5AXI A;  1B1G A;  1M46 A;  3WHU B;  2JPT A;  1U5I B;  4M2Q A;  1F4Q A;  1RRO A;  5CPV A;  4NDB A;  4ETO A;  1FPW A;  2F3Z A;  1QX2 A;  3D0Y A;  3SG3 A;  4MRX A;  3SG4 A;  1SR6 C;  2RGI A;  1AHR A;  2JOJ A;  2K7O A;  2AUC A;  2H2K A;  2M0R A;  4M2P A;  1M63 B;  3WNX B;  2OS8 C;  1J7P A;  1XYD A;  1Y1U A;  3A8R A;  2JZI A;  4YGC B;  4PHN A;  2M29 A;  3KEV A;  1NYA A;  4MZK A;  4PDZ A;  3BQ3 A;  3BUO B;  4YGA A;  3OX6 A;  2M49 B;  4DIR A;  4FTG A;  4YRU A;  4OCI A;  1XK4 C;  2JC2 A;  4DS7 A;  2K7C A;  3QRX A;  3PAL A;  2COL B;  3KF9 A;  1ALV A;  3CS1 A;  1YX8 A;  1S26 D;  1IKU A;  2LUX A;  4GGF C;  2WCF A;  1CFF A;  1PSB A;  2CXJ A;  3LK1 A;  1UHN A;  1DT7 B;  3OHM B;  1DJZ A;  2LE9 B;  3EKH A;  3M0W A;  4OVN F;  1TCO B;  1VRK A;  1CDP A;  1S5G Y;  3GK2 A;  3IF7 A;  4WQ2 A;  1NCZ A;  5I2Q A;  1J7O A;  1BMO A;  2E6W A;  3SJS A;  3LL8 B;  4QJ3 B;  1LIN A;  2JNX A;  4C0J A;  2HQ8 A;  5G08 A;  2M3W A;  1PAL A;  2BL0 B;  1EG3 A;  2L5X B;  2WOR A;  1K96 A;  1F55 A;  3PN7 B;  5JJG A;  2FCD A;  1YR5 A;  2KQY A;  2LHI A;  1LKJ A;  3NSL A;  1KFU S;  3F45 A;  1OQP A;  4YGB B;  3NSK A;  3O78 A;  1OSA A;  1XVJ A;  2KI6 C;  3CGA A;  4R1E A;  1JF2 A;  4NDD A;  1KK8 B;  2LMV A;  4JQ0 D;  3CZT X;  3TS5 C;  2LUC A;  5CSF A;  3E3R A;  3KO0 A;  1DJY A;  1EJ3 A;  1A75 A;  2KAY A;  3SG2 A;  5ER4 X;  4PAL A;  1KK7 Z;  3VRN A;  1KQM B;  3LLE A;  5AFP A;  4CFR A;  2BKI B;  1JSA A;  1XFW O;  2A4J A;  2Y5I A;  4L9M A;  2O5G A;  5DKQ A;  4I5K A;  1SBJ A;  4I5L B;  2GGM A;  3TUY C;  3OP0 A;  1XFY O;  2KNE A;  2KFG A;  5AEQ A;  1NX1 A;  3I5H C;  2JTT A;  1C7W A;  4MVF A;  1AP4 A;  2JNF A;  1N2D A;  4YI9 A;  2MA2 A;  1YUT A;  4GAO A;  4MZL A;  1N0Y A;  5CSJ A;  2L50 A;  1NPQ A;  2M7L A;  1QXP A;  4M2O A;  1SY9 A;  1K95 A;  2QPT A;  1BU3 A;  2F8P A;  1EH2 A;  1PVB A;  1GQM A;  2KI6 D;  4PHJ A;  2KI4 C;  3EKJ A;  3I5F B;  1AK8 A;  1Y1X A;  3CTN A;  1JWD A;  4YGD B;  2JXC A;  2NZ0 A;  2QAC A;  4DUQ A;  1EG4 A;  1CM4 A;  1FI5 A;  1JF0 A;  2LAN A;  5D7F A;  2KDH A;  3DF0 B;  1SW8 A;  1YRT B;  1PK0 D;  1B9A A;  3JVT B;  1QX5 B;  2KGB C;  1S6I A;  2BCX A;  2TN4 A;  4BY5 A;  2ISD A;  1NCY A;  1MXE A;  1C07 A;  1QAT A;  1WLZ A;  3BXK A;  1DF0 B;  3SG6 A;  1SCV A;  5F6T A;  1IG5 A;  1G33 A;  2GGZ A;  1PVA A;  2VRG A;  1CLL A;  4ICB A;  4QJ4 B;  2BKH B;  3I5G C;  1PUL A;  3GK4 X;  1QAS A;  3VRP A;  1TIZ A;  1W7J B;  3EK8 A;  1OMR A;  1CFP A;  2JXL A;  1QLS A;  2FOT A;  2LNK A;  1OZS A;  4PCW A;  4E68 A;  1FW4 A;  1KFX S;  1BR4 B;  3JTD B;  1IWQ A;  1OZO A;  2JT3 A;  4I5J A;  1RK9 A;  2Y1M A;  2AMI A;  2EC6 C;  1F8H A;  3RM1 A;  1E8A A;  4FQO A;  3DVJ A;  1KQM C;  2KHN A;  3D0Y B;  3FIA A;  5HKY A;  1KFX L;  2L98 A;  1UHJ A;  2JRF A;  3DVE A;  1UHH A;  1SK6 D;  5DKN A;  1WLM A;  3VRQ A;  5K89 A;  2Y4Q A;  1JC2 A;  1DMO A;  1PSR A;  2KGR A;  2KBM A;  2SCP A;  1CTR A;  2JWW A;  2K8M B;  2PVB A;  2B1U A;  5B8I B;  1J1D A;  4HRH A;  1DJX A;  4PHK A;  2EHB A;  2LP3 A;  3PN7 C;  4DCK A;  3AAK A;  4AQI A;  1QS7 A;  1CLM A;  1IQ3 A;  1QIV A;  2FJU B;  2OTG C;  3HX4 A;  4ORC B;  1A03 A;  5AER A;  2M1U A;  2WC8 A;  3GOF A;  3BOW A;  5CSI A;  2CNP A;  1BF5 A;  2Q4U A;  2KI4 B;  3I5F C;  2NXQ A;  1M31 A;  1ZUZ A;  2OPO A;  1J7R A;  1SL8 A;  1IJ5 A;  1YUR A;  2E30 A;  2JQ6 A;  2M8U A;  2BCA A;  2KYC A;  1OMD A;  3VGO A;  3AKB A;  1TRF A;  4MSP A;  2MLE C;  3EVV A;  1KK7 Y;  1MQ1 A;  5HLO A;  1DGV A;  1DTL A;  2K2A A;  2L2E A;  3VRR A;  4AOM A;  2LAP A;  4N1F A;  1B47 A;  1KCY A;  1ZMZ A;  1G8I A;  2KOT A;  1IQ5 A;  1DJG A;  2CTN A;  1SL7 A;  2LLU A;  4A4C A;  1XFU O;  3BYA A;  3CWG A;  2ZN8 A;  1XO5 A;  1HQV A;  5I2L A;  3ZWH A;  3FWC A;  1MUX A;  1NX3 A;  3EVR A;  2PAL A;  1R6P A;  2KSP A;  4U8D A;  1TNW A;  2M9G A;  1SCM B;  2ZN9 A;  4P2Y B;  4XJK A;  5JOL A;  1XFV O;  1BG1 A;  1SMG A;  2CT9 A;  2LLS A;  3BUM B;  2PRU A;  4PE7 A;  4OR9 B;  3SG7 A;  1NUB A;  1YVH A;  2MAZ A;  5HYD A;  1AUI B;  4JWQ A;  2ZNE A;  1Y0V H;  4XYN A;  2LVI A;  1A29 A;  1K90 D;  3SG5 A;  1Q80 A;  1B8R A;  3TUY B;  1SR6 B;  5IBW A;  2BBN A;  2MRD A;  4HSZ A;  4HRG A;  3OB2 B;  5KU1 A;  2MBX A;  1BT6 A;  1WRK A;  4ORB B;  4MEW A;  3LCP C;  3ICB A;  1RJV A;  3JTD C;  1SNL A;  1L2O B;  2I18 A;  3EVU A;  3BUN B;  1WRL A;  2HQW A;  1CNP A;  1K94 A;  2L4I A;  4Q04 A;  1B7T Z;  1UUR A;  1CKK A;  4CFQ A;  2PAS A;  1MHO A;  1TCF A;  1DGU A;  1XK4 A;  3I5I B;  1UUS A;  1YTZ C;  1TOP A;  2KAV A;  4NQG A;  4OV2 A;  1ZAC A;  4PE1 A;  5DKR A;  3D10 A;  3RLZ A;  1DJI A;  1K2H A;  1V1F A;  1QVI Y;  4GGF A;  1WDC C;  3AKA A;  1KWO B;  1BJF A;  2GV5 A;  4GFT A;  2MJW B;  3H4S E;  2MLF C;  1NX2 A;  1SRA A;  1AVS A;  3JVT C;  4A4B A;  2F2O A;  3IQO A;  4C0K A;  1B8L A;  2ZRS A;  4GNK B;  3O6B A;  1YX7 A;  1RFJ A;  3OB1 B;  3CLN A;  4CID A;  4HRE E;  3TZ1 A;  4GUK A;  1A2X A;  2Q91 A;  4UPG A;  3PLF B;  1AJ4 A;  1KFU L;  1NCX A;  2PMY A;  4F0Z B;  2NCP A;  2JUL A;  2BCB A;  1IRJ A;  1RTP 1;  4USL A;  1KSM A;  1X02 A;  2I2R E;  3FWB A;  3KHE A;  3CR2 A;  4YI8 A;  1CFC A;  2WND A;  2KYF A;  4DRW A;  3VRO A;  3TDZ A;  2EC6 B;  1F71 A;  1FBV A;  2F33 A;  4N1G A;  4N5X A;  3I5I C;  2M7N A;  2LVJ A;  2HPS A;  1GGZ A;  4WRI A;  2CBL A;  1B7T Y;  4IL1 A;  2F3Y A;  2KFF A;  2FCE A;  1OMV A;  2R2I A;  4ZCU A;  1F70 A;  2D8N A;  1Y6W A;  5CSN A;  1WRZ A;  2M1K B;  1TN4 A;  1J55 A;  1K9U A;  3PFV A;  4CLN A;  2I7A A;  2AAO A;  1NX0 A;  1YUU A;  3BUX B;  5I2O A;  1TNQ A;  1UWO A;  4MBE A;  3NSI A;  1LA0 A;  1CFD A;  1ZOT B;  2EGD A;  2K2F A;  2KBI A;  1UP5 A;  2G9B A;  4WQ3 A;  1U5I A;  3O4Y A;  1RWY A;  2BBM A;  1D1O A;  2BE4 A;  1V1G A;  2WOS A;  1ODB A;  1OOJ A;  1BLQ A;  1CMG A;  3ZNI A;  1TNX A;  1UHI A;  3DF0 A;  3KPX A;  5GQQ C;  4JPZ B;  3EK7 A;  3A4U B;  1CDL A;  4ZCV A;  1SCM C;  2V53 A;  1W7I B;  3CR4 X;  1KQV A;  3BUW B;  4MLW A;  4PHM A;  1F4O A;  1KK8 C;  1IJ6 A;  1QLK A;  2H61 C;  5PAL A;  1F54 A;  2PSR A;  1MR8 A;  3HCM A;  1Y1A A;  1CDN A;  1IH0 A;  1UHK A;  1TNP A;  2OTG B;  2SAS A;  1JFK A;  2ZRT A;  2H61 A;  4GGN A;  2L4H A;  2L51 A;  2LHL A;  1CMF A;  2LP2 A;  1GGW A;  5J3X A;  2ZFD A;  4XJK B;  1XFZ O;  3OX5 A;  1QV1 A;  3AAJ A;  4D1E A;  1KSO A;  4MZJ A;  5D69 A;  1FI6 A;  1MF8 B;  5HLV A;  5HKW A;  2LVK A;  1ZFS A;  2KAX A;  1CDM A;  1SL9 A;  3DVM A;  3O2P A;  2JTZ A;  4GPL B;  2P6B B;  3TDI A;  1S1E A;  2BL0 C;  1YRU B;  1J7Q A;  4AQJ A;  2Y1N A;  3PSR A;  3DD4 A;  1QTX A;  1QVI Z;  4PE0 A;  3BOW B;  2K7B A;  1MWN A;  1XA5 A;  1R2U A;  3IQQ A;  3PM8 A;  1A4P A;  1CM1 A;  2LV7 A;  3LK0 A;  1DJH A;  1CLB A;  4ORA B;  4GBA A;  3K21 A;  5HKZ A;  1S6C A;  1M45 A;  3I5G B;  5FYX A;  4MN0 A;  2DOQ A; 
#chains in the Genus database with same CATH topology
 4QJ5 B;  1T14 A;  1QIW A;  1YUS A;  1SYM A;  3DVK A;  1JBA A;  2IS9 A;  2LLT A;  5TNC A;  1BOD A;  4MRY A;  2WCE A;  1K9K A;  1K93 D;  3CZ0 A;  1BR1 B;  1H4B A;  1GJY A;  5ER5 A;  1NSH A;  1CB1 A;  3MSE B;  2HET A;  2L0P A;  3R1O A;  4FQT A;  2ZKM X;  1DJW A;  1S36 A;  2OS8 B;  1IGV A;  3I5H B;  1G4Y R;  3PM2 A;  1JFJ A;  2KQ6 A;  1OE9 B;  1REC A;  2K61 A;  1A75 B;  2LCP A;  4C0L A;  5BPJ A;  4TNC A;  3SIA A;  4CPV A;  1TTX A;  1NP8 A;  2BEC A;  3GK1 A;  1FF1 A;  2KFH A;  2LMT A;  1B4C A;  1H8B A;  1EXR A;  1N65 A;  2PYQ A;  3FS7 A;  1S3P A;  1OOI X;  2G2B A;  3TDU A;  2LM5 A;  1JUO A;  1YVL A;  2CCM A;  1S6J A;  1BOC A;  2JU0 A;  5FI7 A;  2LMU A;  1OOG A;  2ZND A;  2JT0 A;  5KTY A;  2JT8 A;  1M39 A;  1K8U A;  2NCO A;  1C7V A;  1AJ5 A;  1MXL C;  1XFX O;  4BY4 A;  2O60 A;  2MHH A;  1LXF C;  1WY9 A;  1KWO C;  2F2P A;  3PAT A;  2K7D A;  5EL2 A;  4YGE B;  3S0F A;  2BE6 A;  4P5O E;  1PRW A;  3CR5 X;  4NDC A;  1K9P A;  5AAN A;  2WCB A;  2LC5 A;  1SKT A;  1QJT A;  1NWD A;  2NLN A;  3NXA A;  1DF0 A;  3EG5 B;  1ALW A;  1SPY A;  1LVC D;  3DXL A;  1L7Z A;  4PE4 A;  3C1V A;  2M97 A;  1L2O C;  3SIB A;  2LVV A;  1DVI A;  4JD9 A;  1QV0 A;  3CDN A;  3VB1 A;  1HT9 A;  1LA3 A;  3WXA A;  3EK4 A;  3B88 A;  3NSO A;  4I5N B;  1QX7 A;  1S5G Z;  3TS5 B;  5I8N A;  1EL4 A;  4YBH B;  5D3O A;  1NIW A;  5KSZ A;  2I94 A;  1WDC B;  1IIO A;  1B8C A;  4OKH A;  2K0J A;  3WHT B;  1J1E A;  2HF5 A;  5AXI A;  1B1G A;  1M46 A;  3WHU B;  2JPT A;  1U5I B;  1W9Z A;  4M2Q A;  1F4Q A;  1RRO A;  5CPV A;  1Z2C B;  4NDB A;  4ETO A;  1FPW A;  2F3Z A;  1QX2 A;  3D0Y A;  3SG3 A;  4MRX A;  3SG4 A;  1SR6 C;  2RGI A;  1AHR A;  2JOJ A;  2K7O A;  2AUC A;  2H2K A;  2M0R A;  4M2P A;  1M63 B;  3WNX B;  2OS8 C;  1J7P A;  1XYD A;  1Y1U A;  3A8R A;  2JZI A;  5FI2 A;  1OOH A;  4YGC B;  4PHN A;  2M29 A;  3KEV A;  1NYA A;  1SSE B;  2WC6 A;  4MZK A;  4PDZ A;  3BQ3 A;  3BUO B;  3B86 A;  4YGA A;  3OX6 A;  2M49 B;  4DIR A;  4FTG A;  4YRU A;  4OCI A;  1XK4 C;  2JC2 A;  4DS7 A;  2K7C A;  3RZS A;  3QRX A;  2L5Y A;  3L4A A;  3PAL A;  2COL B;  2P70 A;  3KF9 A;  1ALV A;  3CS1 A;  1YX8 A;  1S26 D;  1IKU A;  2LUX A;  4GGF C;  2WCF A;  1CFF A;  1PSB A;  2CXJ A;  3LK1 A;  1UHN A;  1DT7 B;  3OHM B;  1DJZ A;  2LE9 B;  3EKH A;  3M0W A;  4OVN F;  1OW4 A;  1TCO B;  1VRK A;  2PQL A;  1CDP A;  1S5G Y;  1C3Z A;  3CYZ A;  3D74 A;  1NCZ A;  3GK2 A;  3IF7 A;  4WQ2 A;  3SS3 A;  5I2Q A;  1BMO A;  2E6W A;  3SJS A;  3PJI A;  3S0E A;  3LL8 B;  3D75 A;  4QJ3 B;  3B6X A;  1CFC A;  1LIN A;  2JNX A;  4C0J A;  2HQ8 A;  5G08 A;  2M3W A;  1PAL A;  2BL0 B;  1EG3 A;  2L5X B;  2WOR A;  1K96 A;  1F55 A;  3OBV A;  3PN7 B;  5JJG A;  2FCD A;  1YR5 A;  2KQY A;  2LHI A;  1LKJ A;  3NSL A;  3SS5 A;  1KFU S;  3F45 A;  1OQP A;  4YGB B;  3NSK A;  3O78 A;  1OSA A;  1XVJ A;  2KI6 C;  3CGA A;  4R1E A;  3DYE A;  1JF2 A;  4NDD A;  1KK8 B;  2GTE A;  2LMV A;  4JQ0 D;  3CZT X;  3TS5 C;  2LUC A;  5CSF A;  3E3R A;  3KO0 A;  1DJY A;  1EJ3 A;  1A75 A;  2KAY A;  3SG2 A;  1TWO A;  3NHI A;  5ER4 X;  4PAL A;  1KK7 Z;  3VRN A;  1J7O A;  1KQM B;  3LLE A;  5AFP A;  4CFR A;  2BKI B;  2WC5 A;  1JSA A;  1XFW O;  3D77 A;  2A4J A;  2Y5I A;  4L9M A;  1C3Y A;  2O5G A;  5DKQ A;  4I5K A;  1SBJ A;  4I5L B;  2GGM A;  3D76 A;  3OP0 A;  1XFY O;  3TUY C;  2KNE A;  2KFG A;  5AEQ A;  4F7F A;  1NX1 A;  3I5H C;  2JTT A;  1C7W A;  4MVF A;  3O4X A;  1AP4 A;  2JNF A;  1N2D A;  4YI9 A;  2MA2 A;  1YUT A;  4GAO A;  4MZL A;  1N0Y A;  5CSJ A;  2L50 A;  1NPQ A;  2M7L A;  1QXP A;  4M2O A;  1SY9 A;  1K95 A;  2QPT A;  3S0G A;  1BU3 A;  2F8P A;  1EH2 A;  1PVB A;  1GQM A;  2KI6 D;  4PHJ A;  2KI4 C;  3EKJ A;  3I5F B;  1AK8 A;  1Y1X A;  3CTN A;  1JWD A;  4YGD B;  2JXC A;  3R1V A;  2NZ0 A;  2QAC A;  4DUQ A;  3K1E A;  1EG4 A;  1CM4 A;  1FI5 A;  1JF0 A;  2LAN A;  5D7F A;  2KDH A;  3DF0 B;  1SW8 A;  1YRT B;  1PK0 D;  1B9A A;  3JVT B;  1QX5 B;  2KGB C;  3UNW A;  1S6I A;  2BCX A;  2TN4 A;  4BY5 A;  2ISD A;  1ORG A;  1NCY A;  1MXE A;  3CZ2 A;  1QAT A;  1WLZ A;  1C07 A;  1OOF A;  3BXK A;  1DF0 B;  3SG6 A;  1SCV A;  5F6T A;  1IG5 A;  1G33 A;  2GGZ A;  1PVA A;  2VRG A;  1CLL A;  4ICB A;  4QJ4 B;  2BKH B;  3I5G C;  1PUL A;  3GK4 X;  1QAS A;  3VRP A;  1TIZ A;  1W7J B;  3S0B A;  3EK8 A;  1OMR A;  1CFP A;  3CAB A;  2JXL A;  1QLS A;  2FOT A;  3DZT A;  2LNK A;  1OZS A;  3N7H A;  3NGV A;  4PCW A;  2QEV A;  4E68 A;  1FW4 A;  1KFX S;  1BR4 B;  3JTD B;  1IWQ A;  1OZO A;  2JT3 A;  2K60 A;  1RK9 A;  4I5J A;  2Y1M A;  2AMI A;  2YGU A;  2EC6 C;  1F8H A;  3RM1 A;  1E8A A;  4FQO A;  3DVJ A;  1KQM C;  2KHN A;  3D0Y B;  3FIA A;  5HKY A;  1KFX L;  2L98 A;  1UHJ A;  2JRF A;  3DVE A;  1UHH A;  1SK6 D;  3D73 A;  3R1P A;  5DKN A;  1WLM A;  3VRQ A;  5K89 A;  2Y4Q A;  1JC2 A;  1DMO A;  1PSR A;  2KGR A;  2KBM A;  2SCP A;  2QEB A;  1CTR A;  2JWW A;  2K8M B;  2KPH A;  2PVB A;  2B1U A;  5B8I B;  1J1D A;  4HRH A;  1DJX A;  4PHK A;  2EHB A;  3SS4 A;  2LP3 A;  3PN7 C;  4DCK A;  3AAK A;  4AQI A;  1QS7 A;  1CLM A;  1IQ3 A;  1QIV A;  2FJU B;  2OTG C;  3HX4 A;  4ORC B;  1A03 A;  5AER A;  2M1U A;  2WC8 A;  3V2L A;  2KLD A;  3GOF A;  3BOW A;  5CSI A;  1TUZ A;  2CNP A;  1BF5 A;  2Q4U A;  2KI4 B;  3I5F C;  2NXQ A;  1M31 A;  1ZUZ A;  2OPO A;  1J7R A;  1SL8 A;  1IJ5 A;  1YUR A;  2E30 A;  2JQ6 A;  2L2C A;  3FE6 A;  2M8U A;  4OZD A;  2BCA A;  2KYC A;  1OMD A;  3VGO A;  3AKB A;  1TRF A;  4MSP A;  2MLE C;  3EVV A;  1KK7 Y;  1MQ1 A;  5HLO A;  1DGV A;  1DTL A;  2K2A A;  2L2E A;  3VRR A;  3B87 A;  4AOM A;  2LAP A;  4N1F A;  1B47 A;  1KCY A;  1ZMZ A;  1G8I A;  2KOT A;  2QDI A;  1IQ5 A;  1DJG A;  2CTN A;  1SL7 A;  2LLU A;  4A4C A;  1XFU O;  3BYA A;  4JKT A;  3CWG A;  2ZN8 A;  1XO5 A;  1HQV A;  5I2L A;  2WCM A;  3ZWH A;  3FWC A;  3OGN A;  4KYN A;  1MUX A;  1NX3 A;  3EVR A;  2PAL A;  1R6P A;  2KSP A;  4U8D A;  1TNW A;  2M9G A;  1SCM B;  2ZN9 A;  4P2Y B;  4XJK A;  5JOL A;  1XFV O;  1BG1 A;  1SMG A;  2CT9 A;  2LLS A;  2WCH A;  2PRU A;  3BUM B;  3L4L A;  3QME A;  4OR9 B;  4PE7 A;  3SG7 A;  1NUB A;  1YVH A;  2MAZ A;  3UO9 A;  5HYD A;  1AUI B;  4JWQ A;  2ZNE A;  1DEL A;  1Y0V H;  4XYN A;  2LVI A;  1A29 A;  2P71 A;  1K90 D;  3SG5 A;  1Q80 A;  1B8R A;  3TUY B;  1SR6 B;  5IBW A;  2BBN A;  2ERB A;  2MRD A;  4HSZ A;  4HRG A;  3OB2 B;  5KU1 A;  2MBX A;  1BT6 A;  1WRK A;  4ORB B;  4MEW A;  3LCP C;  3NHT A;  1LS8 A;  3ICB A;  1RJV A;  3JTD C;  1SNL A;  1L2O B;  2I18 A;  3CZ1 A;  3EVU A;  3BUN B;  1WRL A;  2HQW A;  1CNP A;  1K94 A;  2L4I A;  4INX A;  1B7T Z;  3IVT A;  1UUR A;  2WCJ A;  4Q04 A;  1CKK A;  4CFQ A;  2PAS A;  3S0D A;  1MHO A;  1TCF A;  1DGU A;  1XK4 A;  2WCK A;  1UUS A;  3I5I B;  1YTZ C;  1TOP A;  2KAV A;  4NQG A;  1P28 A;  1ZAC A;  4OV2 A;  4PE1 A;  3D10 A;  5DKR A;  1DQE A;  3RLZ A;  3S0A A;  1DJI A;  1K2H A;  1V1F A;  1QVI Y;  4GGF A;  1WDC C;  3AKA A;  1KWO B;  3L47 A;  1BJF A;  2GV5 A;  4GFT A;  2MJW B;  3H4S E;  2MLF C;  1NX2 A;  5I94 A;  1SRA A;  1AVS A;  3JVT C;  2H8V A;  4A4B A;  2F2O A;  3IQO A;  4C0K A;  1B8L A;  2ZRS A;  4GNK B;  3O6B A;  1YX7 A;  1RFJ A;  3OB1 B;  3CLN A;  4CID A;  4HRE E;  3TZ1 A;  4GUK A;  1A2X A;  2Q91 A;  4UPG A;  3PLF B;  1AJ4 A;  1KFU L;  1NCX A;  2PMY A;  4F0Z B;  2NCP A;  2JUL A;  2BCB A;  1IRJ A;  3D78 A;  2BNX A;  1RTP 1;  4USL A;  1KSM A;  1X02 A;  2I2R E;  3FWB A;  3KHE A;  3CR2 A;  1TUJ A;  4YI8 A;  5FI6 A;  2WND A;  2KYF A;  4DRW A;  3VRO A;  3TDZ A;  2EC6 B;  1F71 A;  1FBV A;  2F33 A;  4N1G A;  4N5X A;  3I5I C;  2M7N A;  2LVJ A;  2HPS A;  1GGZ A;  4WRI A;  2CBL A;  1XFR A;  1B7T Y;  4IL1 A;  2F3Y A;  2KFF A;  2FCE A;  1OMV A;  2R2I A;  4ZCU A;  1F70 A;  2D8N A;  1Y6W A;  5CSN A;  1WRZ A;  2M1K B;  1TN4 A;  1J55 A;  1K9U A;  3PFV A;  4CLN A;  2I7A A;  2AAO A;  1NX0 A;  1YUU A;  2WCL A;  3BFB A;  3BUX B;  1TNQ A;  3Q8I A;  1UWO A;  4MBE A;  5I2O A;  3NSI A;  1LA0 A;  1CFD A;  1ZOT B;  2EGD A;  2K2F A;  2KBI A;  1UP5 A;  2G9B A;  4WQ3 A;  1U5I A;  3O4Y A;  1RWY A;  2BBM A;  1D1O A;  5DIC A;  2BE4 A;  1DC1 A;  1V1G A;  2WOS A;  1ODB A;  1OOJ A;  1BLQ A;  1CMG A;  3ZNI A;  3BJH A;  1TNX A;  1UHI A;  2QEO A;  3DF0 A;  3KPX A;  4JPZ B;  5GQQ C;  3EK7 A;  3A4U B;  1CDL A;  4ZCV A;  1SCM C;  3BFH A;  2V53 A;  1W7I B;  3CR4 X;  2KLE A;  1KQV A;  3BUW B;  4MLW A;  4PHM A;  1F4O A;  1KK8 C;  1IJ6 A;  1QLK A;  2H61 C;  3B7A A;  5PAL A;  1F54 A;  2PSR A;  1MR8 A;  3HCM A;  1Y1A A;  1CDN A;  1IH0 A;  1UHK A;  1TNP A;  2OTG B;  2SAS A;  1JFK A;  2ZRT A;  2H61 A;  4GGN A;  2L4H A;  2L51 A;  2LHL A;  3BFA A;  1CMF A;  1Z4H A;  1GM0 A;  2LP2 A;  1GGW A;  4IJ7 A;  5J3X A;  2ZFD A;  4XJK B;  1XFZ O;  3OX5 A;  1QV1 A;  3AAJ A;  4D1E A;  1KSO A;  4MZJ A;  5D69 A;  1QWV A;  1FI6 A;  2BAP A;  1MF8 B;  2JPO A;  5HLV A;  5HKW A;  3FE8 A;  2LVK A;  1ZFS A;  2KAX A;  1CDM A;  1SL9 A;  3DVM A;  3O2P A;  2JTZ A;  4GPL B;  2P6B B;  3TDI A;  1S1E A;  2BL0 C;  1YRU B;  3FE9 A;  1J7Q A;  2QEH A;  4AQJ A;  2Y1N A;  4INW A;  3PSR A;  3DD4 A;  1QTX A;  1QVI Z;  4PE0 A;  3BOW B;  2K7B A;  1MWN A;  1XA5 A;  1R2U A;  3IQQ A;  3R72 A;  3DY9 A;  1DEK A;  3PM8 A;  1A4P A;  2FJY A;  1CM1 A;  2LV7 A;  3LK0 A;  1DJH A;  4PT1 A;  1CLB A;  4ORA B;  4GBA A;  3K21 A;  5HL1 A;  5HKZ A;  1S6C A;  1M45 A;  3I5G B;  5FYX A;  4MN0 A;  2DOQ A; 
#chains in the Genus database with same CATH homology
 4QJ5 B;  1JBA A;  1QIW A;  1YUS A;  1SYM A;  3DVK A;  2IS9 A;  2LLT A;  5TNC A;  1BOD A;  4MRY A;  2WCE A;  1K9K A;  1K93 D;  1H4B A;  1BR1 B;  1GJY A;  5ER5 A;  1NSH A;  1CB1 A;  3MSE B;  2HET A;  2L0P A;  2ZKM X;  1DJW A;  1S36 A;  2OS8 B;  1IGV A;  3I5H B;  1G4Y R;  1JFJ A;  2KQ6 A;  1OE9 B;  1REC A;  2K61 A;  1A75 B;  2LCP A;  4C0L A;  5BPJ A;  4TNC A;  3SIA A;  4CPV A;  1TTX A;  1NP8 A;  2BEC A;  3GK1 A;  1FF1 A;  2KFH A;  2LMT A;  1B4C A;  1H8B A;  1EXR A;  1N65 A;  3FS7 A;  1S3P A;  2G2B A;  3TDU A;  2LM5 A;  1JUO A;  1YVL A;  2CCM A;  1S6J A;  1BOC A;  2JU0 A;  2LMU A;  2ZND A;  2JT0 A;  5KTY A;  2JT8 A;  1M39 A;  1K8U A;  2NCO A;  1C7V A;  1AJ5 A;  1MXL C;  1XFX O;  4BY4 A;  2O60 A;  2MHH A;  1LXF C;  1WY9 A;  1KWO C;  2F2P A;  3PAT A;  2K7D A;  4YGE B;  2BE6 A;  4P5O E;  1PRW A;  3CR5 X;  4NDC A;  1K9P A;  5AAN A;  2WCB A;  2LC5 A;  1SKT A;  1QJT A;  1NWD A;  2NLN A;  3NXA A;  1DF0 A;  1ALW A;  1SPY A;  1LVC D;  1L7Z A;  4PE4 A;  3C1V A;  2M97 A;  1L2O C;  3SIB A;  2LVV A;  1DVI A;  1QV0 A;  1HT9 A;  1LA3 A;  3WXA A;  3EK4 A;  3NSO A;  4I5N B;  1QX7 A;  1S5G Z;  3TS5 B;  5I8N A;  1EL4 A;  4YBH B;  1NIW A;  5KSZ A;  2I94 A;  1WDC B;  1B8C A;  4OKH A;  2K0J A;  3WHT B;  1J1E A;  2HF5 A;  5AXI A;  1B1G A;  1M46 A;  3WHU B;  2JPT A;  1U5I B;  4M2Q A;  1F4Q A;  1RRO A;  5CPV A;  4NDB A;  4ETO A;  1FPW A;  2F3Z A;  1QX2 A;  3D0Y A;  3SG3 A;  4MRX A;  3SG4 A;  1SR6 C;  2RGI A;  1AHR A;  2JOJ A;  2K7O A;  2AUC A;  2H2K A;  2M0R A;  4M2P A;  1M63 B;  3WNX B;  2OS8 C;  1J7P A;  1XYD A;  1Y1U A;  3A8R A;  2JZI A;  4YGC B;  4PHN A;  2M29 A;  3KEV A;  1NYA A;  4MZK A;  4PDZ A;  3BQ3 A;  3BUO B;  4YGA A;  3OX6 A;  2M49 B;  4DIR A;  4FTG A;  4YRU A;  4OCI A;  1XK4 C;  2JC2 A;  4DS7 A;  2K7C A;  3QRX A;  3PAL A;  2COL B;  3KF9 A;  1ALV A;  3CS1 A;  1YX8 A;  1S26 D;  1IKU A;  2LUX A;  4GGF C;  2WCF A;  1CFF A;  1PSB A;  2CXJ A;  3LK1 A;  1UHN A;  1DT7 B;  3OHM B;  1DJZ A;  2LE9 B;  3EKH A;  3M0W A;  4OVN F;  1TCO B;  1VRK A;  1CDP A;  1S5G Y;  3GK2 A;  3IF7 A;  4WQ2 A;  1NCZ A;  5I2Q A;  1J7O A;  1BMO A;  2E6W A;  3SJS A;  3LL8 B;  4QJ3 B;  1LIN A;  2JNX A;  4C0J A;  2HQ8 A;  5G08 A;  2M3W A;  1PAL A;  2BL0 B;  1EG3 A;  2L5X B;  2WOR A;  1K96 A;  1F55 A;  3PN7 B;  5JJG A;  2FCD A;  1YR5 A;  2KQY A;  2LHI A;  1LKJ A;  3NSL A;  1KFU S;  3F45 A;  1OQP A;  4YGB B;  3NSK A;  3O78 A;  1OSA A;  1XVJ A;  2KI6 C;  3CGA A;  4R1E A;  1JF2 A;  4NDD A;  1KK8 B;  2LMV A;  4JQ0 D;  3CZT X;  3TS5 C;  2LUC A;  5CSF A;  3E3R A;  3KO0 A;  1DJY A;  1EJ3 A;  1A75 A;  2KAY A;  3SG2 A;  5ER4 X;  4PAL A;  1KK7 Z;  3VRN A;  1KQM B;  3LLE A;  5AFP A;  4CFR A;  2BKI B;  1JSA A;  1XFW O;  2A4J A;  2Y5I A;  4L9M A;  2O5G A;  5DKQ A;  4I5K A;  1SBJ A;  4I5L B;  2GGM A;  3TUY C;  3OP0 A;  1XFY O;  2KNE A;  2KFG A;  5AEQ A;  1NX1 A;  3I5H C;  2JTT A;  1C7W A;  4MVF A;  1AP4 A;  2JNF A;  1N2D A;  4YI9 A;  2MA2 A;  1YUT A;  4GAO A;  4MZL A;  1N0Y A;  5CSJ A;  2L50 A;  1NPQ A;  2M7L A;  1QXP A;  4M2O A;  1SY9 A;  1K95 A;  2QPT A;  1BU3 A;  2F8P A;  1EH2 A;  1PVB A;  1GQM A;  2KI6 D;  4PHJ A;  2KI4 C;  3EKJ A;  3I5F B;  1AK8 A;  1Y1X A;  3CTN A;  1JWD A;  4YGD B;  2JXC A;  2NZ0 A;  2QAC A;  4DUQ A;  1EG4 A;  1CM4 A;  1FI5 A;  1JF0 A;  2LAN A;  5D7F A;  2KDH A;  3DF0 B;  1SW8 A;  1YRT B;  1PK0 D;  1B9A A;  3JVT B;  1QX5 B;  2KGB C;  1S6I A;  2BCX A;  2TN4 A;  4BY5 A;  2ISD A;  1NCY A;  1MXE A;  1C07 A;  1QAT A;  1WLZ A;  3BXK A;  1DF0 B;  3SG6 A;  1SCV A;  5F6T A;  1IG5 A;  1G33 A;  2GGZ A;  1PVA A;  2VRG A;  1CLL A;  4ICB A;  4QJ4 B;  2BKH B;  3I5G C;  1PUL A;  3GK4 X;  1QAS A;  3VRP A;  1TIZ A;  1W7J B;  3EK8 A;  1OMR A;  1CFP A;  2JXL A;  1QLS A;  2FOT A;  2LNK A;  1OZS A;  4PCW A;  4E68 A;  1FW4 A;  1KFX S;  1BR4 B;  3JTD B;  1IWQ A;  1OZO A;  2JT3 A;  4I5J A;  1RK9 A;  2Y1M A;  2AMI A;  2EC6 C;  1F8H A;  3RM1 A;  1E8A A;  4FQO A;  3DVJ A;  1KQM C;  2KHN A;  3D0Y B;  3FIA A;  5HKY A;  1KFX L;  2L98 A;  1UHJ A;  2JRF A;  3DVE A;  1UHH A;  1SK6 D;  5DKN A;  1WLM A;  3VRQ A;  5K89 A;  2Y4Q A;  1JC2 A;  1DMO A;  1PSR A;  2KGR A;  2KBM A;  2SCP A;  1CTR A;  2JWW A;  2K8M B;  2PVB A;  2B1U A;  5B8I B;  1J1D A;  4HRH A;  1DJX A;  4PHK A;  2EHB A;  2LP3 A;  3PN7 C;  4DCK A;  3AAK A;  4AQI A;  1QS7 A;  1CLM A;  1IQ3 A;  1QIV A;  2FJU B;  2OTG C;  3HX4 A;  4ORC B;  1A03 A;  5AER A;  2M1U A;  2WC8 A;  3GOF A;  3BOW A;  5CSI A;  2CNP A;  1BF5 A;  2Q4U A;  2KI4 B;  3I5F C;  2NXQ A;  1M31 A;  1ZUZ A;  2OPO A;  1J7R A;  1SL8 A;  1IJ5 A;  1YUR A;  2E30 A;  2JQ6 A;  2M8U A;  2BCA A;  2KYC A;  1OMD A;  3VGO A;  3AKB A;  1TRF A;  4MSP A;  2MLE C;  3EVV A;  1KK7 Y;  1MQ1 A;  5HLO A;  1DGV A;  1DTL A;  2K2A A;  2L2E A;  3VRR A;  4AOM A;  2LAP A;  4N1F A;  1B47 A;  1KCY A;  1ZMZ A;  1G8I A;  2KOT A;  1IQ5 A;  1DJG A;  2CTN A;  1SL7 A;  2LLU A;  4A4C A;  1XFU O;  3BYA A;  3CWG A;  2ZN8 A;  1XO5 A;  1HQV A;  5I2L A;  3ZWH A;  3FWC A;  1MUX A;  1NX3 A;  3EVR A;  2PAL A;  1R6P A;  2KSP A;  4U8D A;  1TNW A;  2M9G A;  1SCM B;  2ZN9 A;  4P2Y B;  4XJK A;  5JOL A;  1XFV O;  1BG1 A;  1SMG A;  2CT9 A;  2LLS A;  3BUM B;  2PRU A;  4PE7 A;  4OR9 B;  3SG7 A;  1NUB A;  1YVH A;  2MAZ A;  5HYD A;  1AUI B;  4JWQ A;  2ZNE A;  1Y0V H;  4XYN A;  2LVI A;  1A29 A;  1K90 D;  3SG5 A;  1Q80 A;  1B8R A;  3TUY B;  1SR6 B;  5IBW A;  2BBN A;  2MRD A;  4HSZ A;  4HRG A;  3OB2 B;  5KU1 A;  2MBX A;  1BT6 A;  1WRK A;  4ORB B;  4MEW A;  3LCP C;  3ICB A;  1RJV A;  3JTD C;  1SNL A;  1L2O B;  2I18 A;  3EVU A;  3BUN B;  1WRL A;  2HQW A;  1CNP A;  1K94 A;  2L4I A;  4Q04 A;  1B7T Z;  1UUR A;  1CKK A;  4CFQ A;  2PAS A;  1MHO A;  1TCF A;  1DGU A;  1XK4 A;  3I5I B;  1UUS A;  1YTZ C;  1TOP A;  2KAV A;  4NQG A;  4OV2 A;  1ZAC A;  4PE1 A;  5DKR A;  3D10 A;  3RLZ A;  1DJI A;  1K2H A;  1V1F A;  1QVI Y;  4GGF A;  1WDC C;  3AKA A;  1KWO B;  1BJF A;  2GV5 A;  4GFT A;  2MJW B;  3H4S E;  2MLF C;  1NX2 A;  1SRA A;  1AVS A;  3JVT C;  4A4B A;  2F2O A;  3IQO A;  4C0K A;  1B8L A;  2ZRS A;  4GNK B;  3O6B A;  1YX7 A;  1RFJ A;  3OB1 B;  3CLN A;  4CID A;  4HRE E;  3TZ1 A;  4GUK A;  1A2X A;  2Q91 A;  4UPG A;  3PLF B;  1AJ4 A;  1KFU L;  1NCX A;  2PMY A;  4F0Z B;  2NCP A;  2JUL A;  2BCB A;  1IRJ A;  1RTP 1;  4USL A;  1KSM A;  1X02 A;  2I2R E;  3FWB A;  3KHE A;  3CR2 A;  4YI8 A;  1CFC A;  2WND A;  2KYF A;  4DRW A;  3VRO A;  3TDZ A;  2EC6 B;  1F71 A;  1FBV A;  2F33 A;  4N1G A;  4N5X A;  3I5I C;  2M7N A;  2LVJ A;  2HPS A;  1GGZ A;  4WRI A;  2CBL A;  1B7T Y;  4IL1 A;  2F3Y A;  2KFF A;  2FCE A;  1OMV A;  2R2I A;  4ZCU A;  1F70 A;  2D8N A;  1Y6W A;  5CSN A;  1WRZ A;  2M1K B;  1TN4 A;  1J55 A;  1K9U A;  3PFV A;  4CLN A;  2I7A A;  2AAO A;  1NX0 A;  1YUU A;  3BUX B;  5I2O A;  1TNQ A;  1UWO A;  4MBE A;  3NSI A;  1LA0 A;  1CFD A;  1ZOT B;  2EGD A;  2K2F A;  2KBI A;  1UP5 A;  2G9B A;  4WQ3 A;  1U5I A;  3O4Y A;  1RWY A;  2BBM A;  1D1O A;  2BE4 A;  1V1G A;  2WOS A;  1ODB A;  1OOJ A;  1BLQ A;  1CMG A;  3ZNI A;  1TNX A;  1UHI A;  3DF0 A;  3KPX A;  5GQQ C;  4JPZ B;  3EK7 A;  3A4U B;  1CDL A;  4ZCV A;  1SCM C;  2V53 A;  1W7I B;  3CR4 X;  1KQV A;  3BUW B;  4MLW A;  4PHM A;  1F4O A;  1KK8 C;  1IJ6 A;  1QLK A;  2H61 C;  5PAL A;  1F54 A;  2PSR A;  1MR8 A;  3HCM A;  1Y1A A;  1CDN A;  1IH0 A;  1UHK A;  1TNP A;  2OTG B;  2SAS A;  1JFK A;  2ZRT A;  2H61 A;  4GGN A;  2L4H A;  2L51 A;  2LHL A;  1CMF A;  2LP2 A;  1GGW A;  5J3X A;  2ZFD A;  4XJK B;  1XFZ O;  3OX5 A;  1QV1 A;  3AAJ A;  4D1E A;  1KSO A;  4MZJ A;  5D69 A;  1FI6 A;  1MF8 B;  5HLV A;  5HKW A;  2LVK A;  1ZFS A;  2KAX A;  1CDM A;  1SL9 A;  3DVM A;  3O2P A;  2JTZ A;  4GPL B;  2P6B B;  3TDI A;  1S1E A;  2BL0 C;  1YRU B;  1J7Q A;  4AQJ A;  2Y1N A;  3PSR A;  3DD4 A;  1QTX A;  1QVI Z;  4PE0 A;  3BOW B;  2K7B A;  1MWN A;  1XA5 A;  1R2U A;  3IQQ A;  3PM8 A;  1A4P A;  1CM1 A;  2LV7 A;  3LK0 A;  1DJH A;  1CLB A;  4ORA B;  4GBA A;  3K21 A;  5HKZ A;  1S6C A;  1M45 A;  3I5G B;  5FYX A;  4MN0 A;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...