1J7RA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
LGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium Vector Protein
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7rA00
2AUCA 1V1GA 1OMDA 1J7QA 1F55A 1K8UA 2KAXA 2O5GA 1IQ5A 5B8IB 1A2XA 3I5FB 1TCFA 2LMUA 3MSEB 2KHNA 1A4PA 1KFUL 1NX2A 1DF0A 1KFXS 2COLB 2JTTA 2P6BB 2ZNDA 3NSKA 4NDCA 1QTXA 1QV0A 1DJGA 1R6PA 3SG2A 2LVVA 1ODBA 4DS7A 1EH2A 2MRDA 5JJGA 4MEWA 2JT8A 3EK4A 1PSBA 1ZUZA 1SMGA 1CLLA 4YGBB 4OV2A 1K9KA 4HRHA 5BPJA 4PE0A 3EVVA 2F2PA 1SRAA 2LUCA 2WNDA 5I2QA 1YTZC 2BL0B 3A8RA 2M29A 4MSPA 1LXFC 2OS8C 3PN7B 1SL8A 1CTRA 1W7IB 1LINA 1ZACA 3CR5X 3TDUA 2E6WA 2K2FA 2NXQA 1Y6WA 3RLZA 3SG5A 4AQIA 1JWDA 5F6TA 2CXJA 4XYNA 2JRFA 1NYAA 4YGAA 1JSAA 1OZSA 2ZKMX 1QX2A 3HCMA 1QX5B 3SJSA 1JC2A 2JWWA 1LKJA 1V1FA 1KK7Z 1YX8A 1A03A 4GAOA 1B47A 1KK8C 2NCOA 4JQ0D 1M45A 3I5GB 2BECA 3CGAA 1SW8A 1WRLA 1K96A 1F4QA 2JC2A 2LVKA 2M0RA 3H4SE 5ER4X 2JXLA 1NPQA 1E8AA 4NQGA 1AHRA 1QVIY 4GBAA 3KHEA 2BBNA 1DJYA 4XJKB 1SYMA 1L2OB 1M63B 3BUWB 5AFPA 2I18A 1TCOB 1KQMB 1OMVA 2BKIB 2JULA 2L5XB 1QXPA 3I5HC 3IQOA 4MN0A 1KQVA 1W7JB 1CDLA 2LLUA 3BUMB 1G33A 3K21A 1J7RA 5I2LA 2LP2A 1FBVA 1FF1A 2KFHA 1XFXO 2BE6A 1XVJA 1YRTB 1XA5A 4ICBA 3VRRA 1B8LA 1QASA 2M7LA 2L50A 1UP5A 4CPVA 1EG4A 2LLSA 1WDCB 4P2YB 2RGIA 1QIWA 2K7CA 3VRPA 2KFFA 1H4BA 1OMRA 1RK9A 3WHUB 2M3WA 4C0JA 2Q91A 1RWYA 3TUYC 1PULA 1G4YR 2LVJA 1FW4A 2ISDA 4QJ3B 1ZOTB 1BOCA 3QRXA 2HQ8A 2F2OA 2AMIA 1JBAA 5DKRA 2JOJA 2GGMA 1C7WA 1GQMA 3D10A 2QACA 3KO0A 2L2EA 1J7OA 1CM4A 1HT9A 1NP8A 1YVLA 2KFGA 4PE1A 1JFJA 2JZIA 1IRJA 1Y1XA 2MA2A 3LL8B 1NCZA 2KGBC 1LA0A 1QS7A 2K0JA 2KYCA 2JXCA 3OHMB 2HF5A 3TDIA 3GK4X 1ZFSA 4M2PA 3O78A 3VRNA 2MJWB 5J3XA 1XFZO 3JTDC 1M31A 2NZ0A 4GGNA 1H8BA 3AAJA 2EHBA 2LHLA 1YX7A 2F8PA 4GUKA 1YRUB 3BUNB 2OPOA 4PHNA 4MZKA 4HSZA 5D7FA 1IQ3A 2PSRA 1FPWA 1WRZA 2D8NA 1J1EA 2MHHA 1Q80A 2LLTA 2JPTA 2KQYA 1XFVO 3F45A 2KI6C 1JFKA 2WCEA 4AQJA 4MRYA 4PALA 2ZN8A 1N65A 4HREE 4YRUA 5HKYA 1UHNA 1G8IA 4OR9B 1IJ6A 1AK8A 1IG5A 2FCDA 2WCBA 4MVFA 1NCXA 3O4YA 2O60A 2L51A 3VRQA 5AEQA 2M1KB 2OS8B 3RM1A 4CLNA 2M97A 3EK8A 3KPXA 1UURA 1XO5A 2M49B 3CZTX 5DKQA 3LCPC 2FOTA 1OSAA 1X02A 1AVSA 3DD4A 1OE9B 5AANA 1K90D 2BE4A 4FQOA 2LMVA 3FS7A 2A4JA 1KFXL 4JWQA 3A4UB 1S26D 2PALA 1JUOA 3NXAA 4MZLA 1HQVA 1KK8B 1QLSA 2OTGC 1SCMC 1WLZA 2GV5A 1SL9A 2MAZA 1A75B 1IKUA 1CNPA 3TDZA 3EKHA 1UHJA 4CIDA 5HLVA 3CR2A 2DOQA 1QLKA 1TRFA 2LV7A 1D1OA 5ER5A 5K89A 2L98A 2H61C 3FWBA 4I5KA 3PFVA 2K61A 1FI5A 1ALVA 1BT6A 1EL4A 2LUXA 1B8RA 2KI4C 3WXAA 2CBLA 2LM5A 2BCXA 3HX4A 3I5HB 3PATA 4ZCVA 1AJ4A 1BJFA 2GGZA 3AKAA 3SG6A 5CSJA 3I5IC 2IS9A 2H61A 2R2IA 3GK2A 3PLFB 4MLWA 1AUIB 1M39A 1MF8B 3SG7A 1CDNA 3PM8A 2PMYA 2K7DA 4N5XA 1BG1A 3TS5C 1PK0D 2LMTA 3TZ1A 2CCMA 1Y1AA 3NSOA 4F0ZB 5TNCA 2CNPA 1SR6C 1M46A 1NWDA 2KBMA 4BY5A 1A75A 1KK7Y 4BY4A 3CR4X 1J55A 1B7TZ 4MZJA 3TUYB 1DJIA 4N1GA 1BODA 3CTNA 1TN4A 1B4CA 1XK4C 1RFJA 2MLEC 1MWNA 2EC6C 4JPZB 3O2PA 3LK0A 2BCAA 1BMOA 2KSPA 5CSFA 1YR5A 4MRXA 3CWGA 1YUTA 4N1FA 1SCVA 1DVIA 3C1VA 4PE4A 1YURA 1MHOA 3D0YA 3FIAA 1F4OA 1GJYA 1NIWA 1XK4A 4GGFC 2CTNA 4YI9A 1B7TY 1GGWA 2ZN9A 3BOWB 1DTLA 2KQ6A 1U5IA 3OP0A 2KI6D 3ZWHA 1S5GZ 1XFYO 2F33A 4ORCB 1BF5A 2JNFA 3OB2B 1QX7A 4WQ2A 4D1EA 4GGFA 1SBJA 2BBMA 2BKHB 4ORAB 2K2AA 3JTDB 1SL7A 1QATA 5IBWA 1Y0VH 2I7AA 4UPGA 4USLA 4IL1A 2L4HA 3EK7A 1ALWA 1DJWA 2EGDA 2FCEA 1F54A 2LCPA 3DF0A 2F3ZA 3KEVA 1UHIA 1NUBA 1J1DA 4NDDA 1ZMZA 5DKNA 1NX0A 5HKZA 3NSIA 4I5JA 2L4IA 4WRIA 2PVBA 1DMOA 1DJXA 1KWOB 2HPSA 1MUXA 4DIRA 1VRKA 1NSHA 1B9AA 4AOMA 2H2KA 2Y1MA 5I2OA 1S36A 1TNXA 3BOWA 1UHHA 2ZNEA 1TTXA 1PVAA 2LANA 4OVNF 4DRWA 2F3YA 5KU1A 4GNKB 2LE9B 2JT0A 4DUQA 3FWCA 3GOFA 2HETA 4HRGA 1K94A 2G2BA 2NCPA 1OZOA 1OOJA 2M9GA 1KCYA 1C7VA 2QPTA 3EVRA 2OTGB 1SCMB 1B8CA 2JT3A 1KWOC 1QVIZ 4OCIA 3OX5A 1IJ5A 2KNEA 3IQQA 2LP3A 1AJ5A 3LLEA 3BUXB 4M2QA 3VGOA 1YUSA 1XFWO 4OKHA 1K9PA 1N2DA 1S3PA 4Q04A 4ZCUA 1LVCD 3JVTC 1DT7B 3BYAA 3SG4A 2I2RE 1A29A 1B1GA 2HQWA 3CLNA 1KSOA 2KI4B 2Y4QA 5HLOA 1KFUS 3IF7A 5CPVA 4CFRA 2ZFDA 4PHKA 5JOLA 1CFCA 2LAPA 1UUSA 3I5IB 2WC8A 1CFPA 2K7OA 3DVEA 1F71A 3EVUA 2WCFA 2KYFA 3SIBA 1SPYA 4QJ4B 2KGRA 1R2UA 3NSLA 2Y1NA 1WRKA 5D69A 2K7BA 3TS5B 1PRWA 2KAVA 1QIVA 5I8NA 1CLMA 1NX3A 4PDZA 5G08A 1SR6B 1IWQA 4I5NB 4A4BA 1KSMA 3O6BA 4YGCB 1CB1A 4R1EA 3D0YB 1SKTA 1BR1B 2SASA 1F8HA 2JQ6A 1UHKA 3PSRA 2VRGA 1L7ZA 2EC6B 1CM1A 3BXKA 1WY9A 2M1UA 4YGDB 3LK1A 2PRUA 2AAOA 1U5IB 1NCYA 1TIZA 2TN4A 3I5FC 1XYDA 1IH0A 2ZRSA 3GK1A 3KF9A 1SY9A 2V53A 4PE7A 3SIAA 1AP4A 2KDHA 3WHTB 2JTZA 4C0KA 1DJHA 2JU0A 3DVJA 1RJVA 1CFFA 1IGVA 1SK6D 1MR8A 1SNLA 1RROA 1RECA 2ZRTA 1PALA 4YBHB 5GQQC 2KOTA 3DF0B 2KAYA 1EJ3A 3AKBA 2K8MB 1FI6A 1CMFA 3CS1A 3OX6A 1PSRA 3DVMA 4PHJA 2BL0C 5FYXA 4P5OE 1CDMA 3PN7C 1MXLC 4FTGA 4QJ5B 1K9UA 1WLMA 2M8UA 4DCKA 2L0PA 1QV1A 1CKKA 2LNKA 3WNXB 1C07A 1DGVA 5CSNA 4NDBA 4E68A 1LA3A 4YGEB 4ETOA 2PASA 4I5LB 2JNXA 2NLNA 5KSZA 1K93D 1GGZA 2Y5IA 5AXIA 4TNCA 5PALA 3ZNIA 2I94A 2KBIA 3I5GC 2FJUB 1UWOA 1S5GY 4GPLB 1JF0A 1MXEA 2SCPA 4M2OA 3SG3A 1MQ1A 1TNQA 3VROA 4CFQA 5KTYA 2WORA 1J7PA 1F70A 1DJZA 2MBXA 1TOPA 2BCBA 4C0LA 3PALA 1BLQA 1L2OC 1RTP1 3BQ3A 1YVHA 1KQMC 4MBEA 4ORBB 2WOSA 4PHMA 2E30A 4YI8A 1K2HA 1Y1UA 1BU3A 4XJKA 4A4CA 1NX1A 3M0WA 3JVTB 2MLFC 1EG3A 1TNPA 3DVKA 5HYDA 1JF2A 1CMGA 3AAKA 4WQ3A 1WDCC 1BR4B 1K95A 2LHIA 4PCWA 1QJTA 4GFTA 1PVBA 1EXRA 1S6CA 2G9BA 1DF0B 1CDPA 1XFUO 2LC5A 1CFDA 5CSIA 1S6JA 1S1EA 1S6IA 1YUUA 1N0YA 2Q4UA 5HKWA 3E3RA 3ICBA 5AERA 2M7NA 3BUOB 4L9MA 4U8DA 2LVIA 1CLBA 1DGUA 2CT9A 2B1UA 3OB1B 1OQPA 1TNWA 3EKJA
chains in the Genus database with same CATH superfamily
2AUCA 1V1GA 1OMDA 1J7QA 1F55A 1K8UA 2KAXA 2O5GA 1IQ5A 5B8IB 1A2XA 4FQTA 3I5FB 1TCFA 2LMUA 3MSEB 2KHNA 4INWA 3SS5A 1OOFA 1A4PA 1KFUL 1NX2A 1DF0A 1KFXS 2COLB 2JTTA 2P6BB 1DEKA 2ZNDA 3NSKA 1DC1A 4NDCA 1QTXA 1QV0A 1DJGA 1R6PA 3SG2A 2LVVA 1ODBA 3R1OA 3NHTA 3R72A 4DS7A 2MRDA 1EH2A 5JJGA 4OZDA 4MEWA 2JT8A 3EK4A 1PSBA 1ZUZA 1SMGA 1CLLA 4YGBB 4OV2A 1K9KA 3OBVA 4HRHA 5BPJA 4PE0A 3EVVA 2F2PA 1SRAA 3N7HA 2LUCA 2WNDA 5I2QA 1YTZC 2BL0B 3A8RA 2M29A 4MSPA 1LXFC 2OS8C 3PN7B 1SL8A 1CTRA 1W7IB 1LINA 1ZACA 2ERBA 3CR5X 2E6WA 3TDUA 2K2FA 2NXQA 1Y6WA 3RLZA 3S0AA 3SG5A 4AQIA 1JWDA 5F6TA 2CXJA 4XYNA 2JRFA 1NYAA 2FJYA 4YGAA 1JSAA 1OZSA 2ZKMX 1QX2A 3HCMA 1QX5B 3SJSA 5FI2A 2JWWA 1LKJA 1V1FA 1KK7Z 1YX8A 2YGUA 4GAOA 1A03A 1B47A 1KK8C 2NCOA 4JQ0D 1M45A 3I5GB 2BECA 3CGAA 1W9ZA 3DZTA 1SSEB 1SW8A 1WRLA 1K96A 1F4QA 2JC2A 2LVKA 2M0RA 3H4SE 4INXA 2JXLA 1NPQA 1E8AA 4NQGA 1AHRA 1QVIY 4GBAA 3KHEA 1QWVA 2BBNA 1DJYA 4XJKB 1SYMA 1L2OB 1M63B 3BUWB 5AFPA 2I18A 1TCOB 1Z4HA 1KQMB 1OMVA 2BKIB 1TWOA 2JULA 1QXPA 2L5XB 3I5HC 3IQOA 4MN0A 1KQVA 1W7JB 1CDLA 2LLUA 3BUMB 1G33A 3K21A 1J7RA 5I2LA 2LP2A 1FBVA 1FF1A 2KFHA 1XFXO 2BE6A 1XVJA 1YRTB 1XA5A 4ICBA 3VRRA 1B8LA 1DQEA 3FE6A 1QASA 2M7LA 2L50A 1UP5A 4CPVA 1EG4A 2LLSA 3D74A 1WDCB 4P2YB 2RGIA 1QIWA 2K7CA 4JKTA 3VRPA 4IJ7A 5I2OA 2KFFA 1H4BA 1OMRA 3S0BA 3CYZA 1RK9A 3WHUB 2M3WA 4C0JA 2Q91A 1RWYA 3TUYC 1PULA 1G4YR 2LVJA 1FW4A 3BFAA 2ISDA 4QJ3B 1ZOTB 1BOCA 3QRXA 2HQ8A 2F2OA 2AMIA 1JBAA 5DKRA 2JOJA 2GGMA 3QMEA 3CZ0A 1C7WA 1GQMA 3D10A 2QACA 3KO0A 2L2EA 1J7OA 1CM4A 1HT9A 1NP8A 1YVLA 2KFGA 4PE1A 1JFJA 2JZIA 1IRJA 1Y1XA 2MA2A 3LL8B 1NCZA 2KGBC 1LA0A 1QS7A 2K0JA 2KYCA 2JXCA 3OHMB 2HF5A 3TDIA 3GK4X 1ZFSA 4M2PA 3O78A 3VRNA 2MJWB 5J3XA 1XFZO 3JTDC 1M31A 3SS3A 2NZ0A 4GGNA 1H8BA 3AAJA 2EHBA 3NHIA 1XFRA 2LHLA 1YX7A 2F8PA 4GUKA 1YRUB 2JPOA 2OPOA 3BUNB 4MZKA 4HSZA 4PHNA 5D7FA 1IQ3A 2PSRA 1FPWA 1WRZA 2D8NA 1J1EA 2MHHA 3L4LA 1Q80A 2LLTA 2JPTA 2KQYA 1XFVO 3F45A 1T14A 2KI6C 1JFKA 2WCEA 4AQJA 4F7FA 4MRYA 4PALA 2ZN8A 1N65A 4HREE 4YRUA 5HKYA 1UHNA 1G8IA 4OR9B 1IJ6A 1AK8A 1IG5A 2FCDA 2WCBA 4MVFA 1NCXA 3O4YA 2O60A 2L51A 3VRQA 5AEQA 2M1KB 2OS8B 3RM1A 4CLNA 1C3ZA 2M97A 3EK8A 3KPXA 1UURA 1XO5A 2M49B 3CZTX 5DKQA 3LCPC 2WCKA 2FOTA 1OSAA 1X02A 1AVSA 3DD4A 1OE9B 5AANA 1K90D 2BE4A 4FQOA 2LMVA 2QEBA 3FS7A 2A4JA 1KFXL 4JWQA 3A4UB 1S26D 2PALA 1JUOA 3NXAA 4MZLA 1HQVA 1KK8B 1QLSA 2OTGC 2QEVA 1SCMC 1WLZA 2GV5A 1SL9A 1OOGA 1A75B 2MAZA 1IKUA 1CNPA 3TDZA 3EKHA 1JC2A 3V2LA 1UHJA 4CIDA 5HLVA 3CR2A 2DOQA 1GM0A 1QLKA 1TRFA 2LV7A 1D1OA 5ER5A 5K89A 3B7AA 2L98A 2H61C 3FWBA 4I5KA 3D76A 1C3YA 3PFVA 2K61A 1FI5A 1ALVA 1BT6A 1EL4A 2LUXA 3S0DA 1B8RA 2KI4C 3WXAA 2CBLA 2LM5A 2BCXA 3HX4A 3I5HB 3PATA 4ZCVA 1AJ4A 1BJFA 2GGZA 2H8VA 3AKAA 3CDNA 3O4XA 3SG6A 3EG5B 5CSJA 2WCHA 3I5IC 2IS9A 2H61A 2R2IA 3GK2A 3PLFB 4MLWA 1AUIB 1M39A 1MF8B 3SG7A 3IVTA 1CDNA 3PM8A 2PMYA 2P70A 2K7DA 4N5XA 1BG1A 3TS5C 1PK0D 2LMTA 3TZ1A 2CCMA 1Y1AA 3NSOA 4F0ZB 5TNCA 2CNPA 1SR6C 1M46A 1NWDA 2KBMA 4BY5A 1A75A 1KK7Y 4BY4A 3CR4X 1J55A 3B88A 1B7TZ 4MZJA 3PJIA 3TUYB 3CZ2A 1DJIA 4N1GA 1BODA 3CTNA 3D77A 1TN4A 1B4CA 1XK4C 1RFJA 2KLEA 1OW4A 2MLEC 5EL2A 1MWNA 2EC6C 4JPZB 3FE8A 3O2PA 3LK0A 2BCAA 1BMOA 5FI7A 2KSPA 5CSFA 1YR5A 4MRXA 3CWGA 1YUTA 2BNXA 4N1FA 1SCVA 1DVIA 3C1VA 4PE4A 1YURA 1MHOA 3D0YA 3FIAA 3UO9A 1F4OA 1GJYA 1NIWA 1XK4A 4GGFC 2CTNA 4YI9A 1B7TY 1GGWA 2ZN9A 3BOWB 1DTLA 2KQ6A 1U5IA 3CZ1A 2KI6D 3OP0A 1S5GZ 3ZWHA 3D73A 1XFYO 2F33A 4ORCB 2QEHA 1BF5A 2JNFA 2WCMA 3OB2B 1QX7A 4WQ2A 4D1EA 4GGFA 1SBJA 2BBMA 2BKHB 4ORAB 2K2AA 3JTDB 1SL7A 1QATA 5IBWA 1Y0VH 2I7AA 4UPGA 4USLA 4IL1A 2L4HA 3EK7A 1ALWA 1DJWA 2EGDA 2FCEA 1F54A 1TUJA 2LCPA 3DF0A 2F3ZA 3KEVA 1UHIA 1NUBA 1J1DA 4NDDA 3B6XA 1ZMZA 5DKNA 1NX0A 5HKZA 3NSIA 3S0FA 2WC5A 2L4IA 4I5JA 4WRIA 3Q8IA 2PVBA 1DMOA 1DJXA 1KWOB 2HPSA 1MUXA 4DIRA 1VRKA 1NSHA 1B9AA 2WCLA 2H2KA 2Y1MA 4JD9A 1S36A 1TNXA 3BOWA 3DXLA 1UHHA 4AOMA 2ZNEA 3R1VA 1TTXA 1PVAA 2LANA 4OVNF 4DRWA 2F3YA 2QEOA 5KU1A 4GNKB 2LE9B 2JT0A 4DUQA 3FWCA 3GOFA 3S0GA 1IIOA 2HETA 3CABA 4HRGA 1K94A 2G2BA 2NCPA 1OZOA 1OOJA 2WC6A 2M9GA 1KCYA 3S0EA 1C7VA 2QPTA 3EVRA 2OTGB 1SCMB 1B8CA 2JT3A 1KWOC 1QVIZ 4OCIA 3OX5A 1IJ5A 2KNEA 3IQQA 2L5YA 2LP3A 1AJ5A 5ER4X 3LLEA 3BUXB 4M2QA 3VGOA 1YUSA 1XFWO 4OKHA 1K9PA 1N2DA 1S3PA 4Q04A 4ZCUA 1LVCD 3JVTC 1DT7B 3BYAA 3SG4A 2I2RE 1A29A 1B1GA 5D3OA 2HQWA 3CLNA 3L47A 1KSOA 2KI4B 2Y4QA 5HLOA 1KFUS 2WCJA 3IF7A 5CPVA 3PM2A 1ORGA 2ZFDA 4PHKA 5JOLA 4CFRA 1CFCA 2LAPA 1UUSA 3I5IB 2WC8A 1CFPA 2K7OA 3D78A 3DVEA 1F71A 3EVUA 2WCFA 2KYFA 3SIBA 2GTEA 3BJHA 1SPYA 4QJ4B 2KGRA 1R2UA 3B86A 2Y1NA 3NSLA 1WRKA 5D69A 2K7BA 3TS5B 1PRWA 2KAVA 1QIVA 3DY9A 1CLMA 1NX3A 5I8NA 2QDIA 4PDZA 5G08A 1SR6B 1IWQA 4I5NB 4A4BA 1KSMA 3O6BA 4YGCB 1CB1A 4R1EA 3D0YB 1OOHA 1SKTA 1BR1B 5DICA 2SASA 1F8HA 2JQ6A 1UHKA 3PSRA 3R1PA 2VRGA 1L7ZA 2EC6B 1CM1A 3BXKA 1WY9A 2M1UA 4YGDB 3LK1A 2PRUA 2AAOA 1U5IB 3FE9A 1NCYA 1TIZA 2TN4A 3I5FC 3B87A 1XYDA 3K1EA 3L4AA 1IH0A 1Z2CB 2ZRSA 3GK1A 3KF9A 1SY9A 2V53A 4PE7A 2KLDA 3SIAA 1DELA 2BAPA 1AP4A 2KDHA 3WHTB 2JTZA 2L2CA 1DJHA 2JU0A 4C0KA 3DVJA 1RJVA 1CFFA 1TUZA 1IGVA 1SK6D 1MR8A 1SNLA 1RROA 1RECA 2ZRTA 1PALA 4YBHB 5GQQC 2KOTA 3DF0B 2KAYA 1EJ3A 3AKBA 2K8MB 1FI6A 1CMFA 3CS1A 3OX6A 3NGVA 3BFHA 1PSRA 3DVMA 4PHJA 2BL0C 5FYXA 4P5OE 1CDMA 3PN7C 1MXLC 4FTGA 4QJ5B 1OOIX 1K9UA 1WLMA 2KPHA 2M8UA 4DCKA 2L0PA 1QV1A 3BFBA 2PYQA 2LNKA 3WNXB 1C07A 1DGVA 5CSNA 4NDBA 1CKKA 4E68A 1LA3A 4YGEB 4ETOA 2PASA 4I5LB 2JNXA 2NLNA 5KSZA 1K93D 1GGZA 2Y5IA 2PQLA 4TNCA 5AXIA 5PALA 3ZNIA 2I94A 2K60A 2KBIA 3I5GC 2FJUB 1UWOA 3DYEA 1S5GY 3D75A 4GPLB 1JF0A 1MXEA 2SCPA 4M2OA 3SG3A 1MQ1A 1TNQA 3VROA 4CFQA 5KTYA 2WORA 1J7PA 5HL1A 1F70A 3VB1A 1DJZA 2MBXA 1TOPA 2BCBA 4C0LA 3PALA 1BLQA 1L2OC 4PT1A 1RTP1 3UNWA 5I94A 3BQ3A 1YVHA 1KQMC 4MBEA 4KYNA 4ORBB 2WOSA 4PHMA 2E30A 4YI8A 1K2HA 1Y1UA 1BU3A 4XJKA 4A4CA 1NX1A 3M0WA 3JVTB 2MLFC 3RZSA 1EG3A 1TNPA 3DVKA 5HYDA 1JF2A 1CMGA 3AAKA 4WQ3A 1WDCC 1BR4B 1K95A 2LHIA 4PCWA 1QJTA 2P71A 4GFTA 1PVBA 1EXRA 1S6CA 2G9BA 1DF0B 1CDPA 1LS8A 1XFUO 2LC5A 1CFDA 5CSIA 1S6JA 1S1EA 1P28A 3SS4A 1S6IA 1YUUA 1N0YA 2Q4UA 5FI6A 3E3RA 5HKWA 3ICBA 5AERA 3OGNA 2M7NA 3BUOB 4L9MA 4U8DA 2LVIA 1CLBA 1DGUA 2CT9A 2B1UA 3OB1B 1OQPA 1TNWA 3EKJA
chains in the Genus database with same CATH topology
2AUCA 1V1GA 1OMDA 1J7QA 1F55A 1K8UA 2KAXA 2O5GA 1IQ5A 5B8IB 1A2XA 3I5FB 1TCFA 2LMUA 3MSEB 2KHNA 1A4PA 1KFUL 1NX2A 1DF0A 1KFXS 2COLB 2JTTA 2P6BB 2ZNDA 3NSKA 4NDCA 1QTXA 1QV0A 1DJGA 1R6PA 3SG2A 2LVVA 1ODBA 4DS7A 1EH2A 2MRDA 5JJGA 4MEWA 2JT8A 3EK4A 1PSBA 1ZUZA 1SMGA 1CLLA 4YGBB 4OV2A 1K9KA 4HRHA 5BPJA 4PE0A 3EVVA 2F2PA 1SRAA 2LUCA 2WNDA 5I2QA 1YTZC 2BL0B 3A8RA 2M29A 4MSPA 1LXFC 2OS8C 3PN7B 1SL8A 1CTRA 1W7IB 1LINA 1ZACA 3CR5X 3TDUA 2E6WA 2K2FA 2NXQA 1Y6WA 3RLZA 3SG5A 4AQIA 1JWDA 5F6TA 2CXJA 4XYNA 2JRFA 1NYAA 4YGAA 1JSAA 1OZSA 2ZKMX 1QX2A 3HCMA 1QX5B 3SJSA 1JC2A 2JWWA 1LKJA 1V1FA 1KK7Z 1YX8A 1A03A 4GAOA 1B47A 1KK8C 2NCOA 4JQ0D 1M45A 3I5GB 2BECA 3CGAA 1SW8A 1WRLA 1K96A 1F4QA 2JC2A 2LVKA 2M0RA 3H4SE 5ER4X 2JXLA 1NPQA 1E8AA 4NQGA 1AHRA 1QVIY 4GBAA 3KHEA 2BBNA 1DJYA 4XJKB 1SYMA 1L2OB 1M63B 3BUWB 5AFPA 2I18A 1TCOB 1KQMB 1OMVA 2BKIB 2JULA 2L5XB 1QXPA 3I5HC 3IQOA 4MN0A 1KQVA 1W7JB 1CDLA 2LLUA 3BUMB 1G33A 3K21A 1J7RA 5I2LA 2LP2A 1FBVA 1FF1A 2KFHA 1XFXO 2BE6A 1XVJA 1YRTB 1XA5A 4ICBA 3VRRA 1B8LA 1QASA 2M7LA 2L50A 1UP5A 4CPVA 1EG4A 2LLSA 1WDCB 4P2YB 2RGIA 1QIWA 2K7CA 3VRPA 2KFFA 1H4BA 1OMRA 1RK9A 3WHUB 2M3WA 4C0JA 2Q91A 1RWYA 3TUYC 1PULA 1G4YR 2LVJA 1FW4A 2ISDA 4QJ3B 1ZOTB 1BOCA 3QRXA 2HQ8A 2F2OA 2AMIA 1JBAA 5DKRA 2JOJA 2GGMA 1C7WA 1GQMA 3D10A 2QACA 3KO0A 2L2EA 1J7OA 1CM4A 1HT9A 1NP8A 1YVLA 2KFGA 4PE1A 1JFJA 2JZIA 1IRJA 1Y1XA 2MA2A 3LL8B 1NCZA 2KGBC 1LA0A 1QS7A 2K0JA 2KYCA 2JXCA 3OHMB 2HF5A 3TDIA 3GK4X 1ZFSA 4M2PA 3O78A 3VRNA 2MJWB 5J3XA 1XFZO 3JTDC 1M31A 2NZ0A 4GGNA 1H8BA 3AAJA 2EHBA 2LHLA 1YX7A 2F8PA 4GUKA 1YRUB 3BUNB 2OPOA 4PHNA 4MZKA 4HSZA 5D7FA 1IQ3A 2PSRA 1FPWA 1WRZA 2D8NA 1J1EA 2MHHA 1Q80A 2LLTA 2JPTA 2KQYA 1XFVO 3F45A 2KI6C 1JFKA 2WCEA 4AQJA 4MRYA 4PALA 2ZN8A 1N65A 4HREE 4YRUA 5HKYA 1UHNA 1G8IA 4OR9B 1IJ6A 1AK8A 1IG5A 2FCDA 2WCBA 4MVFA 1NCXA 3O4YA 2O60A 2L51A 3VRQA 5AEQA 2M1KB 2OS8B 3RM1A 4CLNA 2M97A 3EK8A 3KPXA 1UURA 1XO5A 2M49B 3CZTX 5DKQA 3LCPC 2FOTA 1OSAA 1X02A 1AVSA 3DD4A 1OE9B 5AANA 1K90D 2BE4A 4FQOA 2LMVA 3FS7A 2A4JA 1KFXL 4JWQA 3A4UB 1S26D 2PALA 1JUOA 3NXAA 4MZLA 1HQVA 1KK8B 1QLSA 2OTGC 1SCMC 1WLZA 2GV5A 1SL9A 2MAZA 1A75B 1IKUA 1CNPA 3TDZA 3EKHA 1UHJA 4CIDA 5HLVA 3CR2A 2DOQA 1QLKA 1TRFA 2LV7A 1D1OA 5ER5A 5K89A 2L98A 2H61C 3FWBA 4I5KA 3PFVA 2K61A 1FI5A 1ALVA 1BT6A 1EL4A 2LUXA 1B8RA 2KI4C 3WXAA 2CBLA 2LM5A 2BCXA 3HX4A 3I5HB 3PATA 4ZCVA 1AJ4A 1BJFA 2GGZA 3AKAA 3SG6A 5CSJA 3I5IC 2IS9A 2H61A 2R2IA 3GK2A 3PLFB 4MLWA 1AUIB 1M39A 1MF8B 3SG7A 1CDNA 3PM8A 2PMYA 2K7DA 4N5XA 1BG1A 3TS5C 1PK0D 2LMTA 3TZ1A 2CCMA 1Y1AA 3NSOA 4F0ZB 5TNCA 2CNPA 1SR6C 1M46A 1NWDA 2KBMA 4BY5A 1A75A 1KK7Y 4BY4A 3CR4X 1J55A 1B7TZ 4MZJA 3TUYB 1DJIA 4N1GA 1BODA 3CTNA 1TN4A 1B4CA 1XK4C 1RFJA 2MLEC 1MWNA 2EC6C 4JPZB 3O2PA 3LK0A 2BCAA 1BMOA 2KSPA 5CSFA 1YR5A 4MRXA 3CWGA 1YUTA 4N1FA 1SCVA 1DVIA 3C1VA 4PE4A 1YURA 1MHOA 3D0YA 3FIAA 1F4OA 1GJYA 1NIWA 1XK4A 4GGFC 2CTNA 4YI9A 1B7TY 1GGWA 2ZN9A 3BOWB 1DTLA 2KQ6A 1U5IA 3OP0A 2KI6D 3ZWHA 1S5GZ 1XFYO 2F33A 4ORCB 1BF5A 2JNFA 3OB2B 1QX7A 4WQ2A 4D1EA 4GGFA 1SBJA 2BBMA 2BKHB 4ORAB 2K2AA 3JTDB 1SL7A 1QATA 5IBWA 1Y0VH 2I7AA 4UPGA 4USLA 4IL1A 2L4HA 3EK7A 1ALWA 1DJWA 2EGDA 2FCEA 1F54A 2LCPA 3DF0A 2F3ZA 3KEVA 1UHIA 1NUBA 1J1DA 4NDDA 1ZMZA 5DKNA 1NX0A 5HKZA 3NSIA 4I5JA 2L4IA 4WRIA 2PVBA 1DMOA 1DJXA 1KWOB 2HPSA 1MUXA 4DIRA 1VRKA 1NSHA 1B9AA 4AOMA 2H2KA 2Y1MA 5I2OA 1S36A 1TNXA 3BOWA 1UHHA 2ZNEA 1TTXA 1PVAA 2LANA 4OVNF 4DRWA 2F3YA 5KU1A 4GNKB 2LE9B 2JT0A 4DUQA 3FWCA 3GOFA 2HETA 4HRGA 1K94A 2G2BA 2NCPA 1OZOA 1OOJA 2M9GA 1KCYA 1C7VA 2QPTA 3EVRA 2OTGB 1SCMB 1B8CA 2JT3A 1KWOC 1QVIZ 4OCIA 3OX5A 1IJ5A 2KNEA 3IQQA 2LP3A 1AJ5A 3LLEA 3BUXB 4M2QA 3VGOA 1YUSA 1XFWO 4OKHA 1K9PA 1N2DA 1S3PA 4Q04A 4ZCUA 1LVCD 3JVTC 1DT7B 3BYAA 3SG4A 2I2RE 1A29A 1B1GA 2HQWA 3CLNA 1KSOA 2KI4B 2Y4QA 5HLOA 1KFUS 3IF7A 5CPVA 4CFRA 2ZFDA 4PHKA 5JOLA 1CFCA 2LAPA 1UUSA 3I5IB 2WC8A 1CFPA 2K7OA 3DVEA 1F71A 3EVUA 2WCFA 2KYFA 3SIBA 1SPYA 4QJ4B 2KGRA 1R2UA 3NSLA 2Y1NA 1WRKA 5D69A 2K7BA 3TS5B 1PRWA 2KAVA 1QIVA 5I8NA 1CLMA 1NX3A 4PDZA 5G08A 1SR6B 1IWQA 4I5NB 4A4BA 1KSMA 3O6BA 4YGCB 1CB1A 4R1EA 3D0YB 1SKTA 1BR1B 2SASA 1F8HA 2JQ6A 1UHKA 3PSRA 2VRGA 1L7ZA 2EC6B 1CM1A 3BXKA 1WY9A 2M1UA 4YGDB 3LK1A 2PRUA 2AAOA 1U5IB 1NCYA 1TIZA 2TN4A 3I5FC 1XYDA 1IH0A 2ZRSA 3GK1A 3KF9A 1SY9A 2V53A 4PE7A 3SIAA 1AP4A 2KDHA 3WHTB 2JTZA 4C0KA 1DJHA 2JU0A 3DVJA 1RJVA 1CFFA 1IGVA 1SK6D 1MR8A 1SNLA 1RROA 1RECA 2ZRTA 1PALA 4YBHB 5GQQC 2KOTA 3DF0B 2KAYA 1EJ3A 3AKBA 2K8MB 1FI6A 1CMFA 3CS1A 3OX6A 1PSRA 3DVMA 4PHJA 2BL0C 5FYXA 4P5OE 1CDMA 3PN7C 1MXLC 4FTGA 4QJ5B 1K9UA 1WLMA 2M8UA 4DCKA 2L0PA 1QV1A 1CKKA 2LNKA 3WNXB 1C07A 1DGVA 5CSNA 4NDBA 4E68A 1LA3A 4YGEB 4ETOA 2PASA 4I5LB 2JNXA 2NLNA 5KSZA 1K93D 1GGZA 2Y5IA 5AXIA 4TNCA 5PALA 3ZNIA 2I94A 2KBIA 3I5GC 2FJUB 1UWOA 1S5GY 4GPLB 1JF0A 1MXEA 2SCPA 4M2OA 3SG3A 1MQ1A 1TNQA 3VROA 4CFQA 5KTYA 2WORA 1J7PA 1F70A 1DJZA 2MBXA 1TOPA 2BCBA 4C0LA 3PALA 1BLQA 1L2OC 1RTP1 3BQ3A 1YVHA 1KQMC 4MBEA 4ORBB 2WOSA 4PHMA 2E30A 4YI8A 1K2HA 1Y1UA 1BU3A 4XJKA 4A4CA 1NX1A 3M0WA 3JVTB 2MLFC 1EG3A 1TNPA 3DVKA 5HYDA 1JF2A 1CMGA 3AAKA 4WQ3A 1WDCC 1BR4B 1K95A 2LHIA 4PCWA 1QJTA 4GFTA 1PVBA 1EXRA 1S6CA 2G9BA 1DF0B 1CDPA 1XFUO 2LC5A 1CFDA 5CSIA 1S6JA 1S1EA 1S6IA 1YUUA 1N0YA 2Q4UA 5HKWA 3E3RA 3ICBA 5AERA 2M7NA 3BUOB 4L9MA 4U8DA 2LVIA 1CLBA 1DGUA 2CT9A 2B1UA 3OB1B 1OQPA 1TNWA 3EKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUC A;  1V1G A;  1OMD A;  1J7Q A;  1F55 A;  1K8U A;  2KAX A;  2O5G A;  1IQ5 A;  5B8I B;  1A2X A;  3I5F B;  1TCF A;  2LMU A;  3MSE B;  2KHN A;  1A4P A;  1KFU L;  1NX2 A;  1DF0 A;  1KFX S;  2COL B;  2JTT A;  2P6B B;  2ZND A;  3NSK A;  4NDC A;  1QTX A;  1QV0 A;  1DJG A;  1R6P A;  3SG2 A;  2LVV A;  1ODB A;  4DS7 A;  1EH2 A;  2MRD A;  5JJG A;  4MEW A;  2JT8 A;  3EK4 A;  1PSB A;  1ZUZ A;  1SMG A;  1CLL A;  4YGB B;  4OV2 A;  1K9K A;  4HRH A;  5BPJ A;  4PE0 A;  3EVV A;  2F2P A;  1SRA A;  2LUC A;  2WND A;  5I2Q A;  1YTZ C;  2BL0 B;  3A8R A;  2M29 A;  4MSP A;  1LXF C;  2OS8 C;  3PN7 B;  1SL8 A;  1CTR A;  1W7I B;  1LIN A;  1ZAC A;  3CR5 X;  3TDU A;  2E6W A;  2K2F A;  2NXQ A;  1Y6W A;  3RLZ A;  3SG5 A;  4AQI A;  1JWD A;  5F6T A;  2CXJ A;  4XYN A;  2JRF A;  1NYA A;  4YGA A;  1JSA A;  1OZS A;  2ZKM X;  1QX2 A;  3HCM A;  1QX5 B;  3SJS A;  1JC2 A;  2JWW A;  1LKJ A;  1V1F A;  1KK7 Z;  1YX8 A;  1A03 A;  4GAO A;  1B47 A;  1KK8 C;  2NCO A;  4JQ0 D;  1M45 A;  3I5G B;  2BEC A;  3CGA A;  1SW8 A;  1WRL A;  1K96 A;  1F4Q A;  2JC2 A;  2LVK A;  2M0R A;  3H4S E;  5ER4 X;  2JXL A;  1NPQ A;  1E8A A;  4NQG A;  1AHR A;  1QVI Y;  4GBA A;  3KHE A;  2BBN A;  1DJY A;  4XJK B;  1SYM A;  1L2O B;  1M63 B;  3BUW B;  5AFP A;  2I18 A;  1TCO B;  1KQM B;  1OMV A;  2BKI B;  2JUL A;  2L5X B;  1QXP A;  3I5H C;  3IQO A;  4MN0 A;  1KQV A;  1W7J B;  1CDL A;  2LLU A;  3BUM B;  1G33 A;  3K21 A;  1J7R A;  5I2L A;  2LP2 A;  1FBV A;  1FF1 A;  2KFH A;  1XFX O;  2BE6 A;  1XVJ A;  1YRT B;  1XA5 A;  4ICB A;  3VRR A;  1B8L A;  1QAS A;  2M7L A;  2L50 A;  1UP5 A;  4CPV A;  1EG4 A;  2LLS A;  1WDC B;  4P2Y B;  2RGI A;  1QIW A;  2K7C A;  3VRP A;  2KFF A;  1H4B A;  1OMR A;  1RK9 A;  3WHU B;  2M3W A;  4C0J A;  2Q91 A;  1RWY A;  3TUY C;  1PUL A;  1G4Y R;  2LVJ A;  1FW4 A;  2ISD A;  4QJ3 B;  1ZOT B;  1BOC A;  3QRX A;  2HQ8 A;  2F2O A;  2AMI A;  1JBA A;  5DKR A;  2JOJ A;  2GGM A;  1C7W A;  1GQM A;  3D10 A;  2QAC A;  3KO0 A;  2L2E A;  1J7O A;  1CM4 A;  1HT9 A;  1NP8 A;  1YVL A;  2KFG A;  4PE1 A;  1JFJ A;  2JZI A;  1IRJ A;  1Y1X A;  2MA2 A;  3LL8 B;  1NCZ A;  2KGB C;  1LA0 A;  1QS7 A;  2K0J A;  2KYC A;  2JXC A;  3OHM B;  2HF5 A;  3TDI A;  3GK4 X;  1ZFS A;  4M2P A;  3O78 A;  3VRN A;  2MJW B;  5J3X A;  1XFZ O;  3JTD C;  1M31 A;  2NZ0 A;  4GGN A;  1H8B A;  3AAJ A;  2EHB A;  2LHL A;  1YX7 A;  2F8P A;  4GUK A;  1YRU B;  3BUN B;  2OPO A;  4PHN A;  4MZK A;  4HSZ A;  5D7F A;  1IQ3 A;  2PSR A;  1FPW A;  1WRZ A;  2D8N A;  1J1E A;  2MHH A;  1Q80 A;  2LLT A;  2JPT A;  2KQY A;  1XFV O;  3F45 A;  2KI6 C;  1JFK A;  2WCE A;  4AQJ A;  4MRY A;  4PAL A;  2ZN8 A;  1N65 A;  4HRE E;  4YRU A;  5HKY A;  1UHN A;  1G8I A;  4OR9 B;  1IJ6 A;  1AK8 A;  1IG5 A;  2FCD A;  2WCB A;  4MVF A;  1NCX A;  3O4Y A;  2O60 A;  2L51 A;  3VRQ A;  5AEQ A;  2M1K B;  2OS8 B;  3RM1 A;  4CLN A;  2M97 A;  3EK8 A;  3KPX A;  1UUR A;  1XO5 A;  2M49 B;  3CZT X;  5DKQ A;  3LCP C;  2FOT A;  1OSA A;  1X02 A;  1AVS A;  3DD4 A;  1OE9 B;  5AAN A;  1K90 D;  2BE4 A;  4FQO A;  2LMV A;  3FS7 A;  2A4J A;  1KFX L;  4JWQ A;  3A4U B;  1S26 D;  2PAL A;  1JUO A;  3NXA A;  4MZL A;  1HQV A;  1KK8 B;  1QLS A;  2OTG C;  1SCM C;  1WLZ A;  2GV5 A;  1SL9 A;  2MAZ A;  1A75 B;  1IKU A;  1CNP A;  3TDZ A;  3EKH A;  1UHJ A;  4CID A;  5HLV A;  3CR2 A;  2DOQ A;  1QLK A;  1TRF A;  2LV7 A;  1D1O A;  5ER5 A;  5K89 A;  2L98 A;  2H61 C;  3FWB A;  4I5K A;  3PFV A;  2K61 A;  1FI5 A;  1ALV A;  1BT6 A;  1EL4 A;  2LUX A;  1B8R A;  2KI4 C;  3WXA A;  2CBL A;  2LM5 A;  2BCX A;  3HX4 A;  3I5H B;  3PAT A;  4ZCV A;  1AJ4 A;  1BJF A;  2GGZ A;  3AKA A;  3SG6 A;  5CSJ A;  3I5I C;  2IS9 A;  2H61 A;  2R2I A;  3GK2 A;  3PLF B;  4MLW A;  1AUI B;  1M39 A;  1MF8 B;  3SG7 A;  1CDN A;  3PM8 A;  2PMY A;  2K7D A;  4N5X A;  1BG1 A;  3TS5 C;  1PK0 D;  2LMT A;  3TZ1 A;  2CCM A;  1Y1A A;  3NSO A;  4F0Z B;  5TNC A;  2CNP A;  1SR6 C;  1M46 A;  1NWD A;  2KBM A;  4BY5 A;  1A75 A;  1KK7 Y;  4BY4 A;  3CR4 X;  1J55 A;  1B7T Z;  4MZJ A;  3TUY B;  1DJI A;  4N1G A;  1BOD A;  3CTN A;  1TN4 A;  1B4C A;  1XK4 C;  1RFJ A;  2MLE C;  1MWN A;  2EC6 C;  4JPZ B;  3O2P A;  3LK0 A;  2BCA A;  1BMO A;  2KSP A;  5CSF A;  1YR5 A;  4MRX A;  3CWG A;  1YUT A;  4N1F A;  1SCV A;  1DVI A;  3C1V A;  4PE4 A;  1YUR A;  1MHO A;  3D0Y A;  3FIA A;  1F4O A;  1GJY A;  1NIW A;  1XK4 A;  4GGF C;  2CTN A;  4YI9 A;  1B7T Y;  1GGW A;  2ZN9 A;  3BOW B;  1DTL A;  2KQ6 A;  1U5I A;  3OP0 A;  2KI6 D;  3ZWH A;  1S5G Z;  1XFY O;  2F33 A;  4ORC B;  1BF5 A;  2JNF A;  3OB2 B;  1QX7 A;  4WQ2 A;  4D1E A;  4GGF A;  1SBJ A;  2BBM A;  2BKH B;  4ORA B;  2K2A A;  3JTD B;  1SL7 A;  1QAT A;  5IBW A;  1Y0V H;  2I7A A;  4UPG A;  4USL A;  4IL1 A;  2L4H A;  3EK7 A;  1ALW A;  1DJW A;  2EGD A;  2FCE A;  1F54 A;  2LCP A;  3DF0 A;  2F3Z A;  3KEV A;  1UHI A;  1NUB A;  1J1D A;  4NDD A;  1ZMZ A;  5DKN A;  1NX0 A;  5HKZ A;  3NSI A;  4I5J A;  2L4I A;  4WRI A;  2PVB A;  1DMO A;  1DJX A;  1KWO B;  2HPS A;  1MUX A;  4DIR A;  1VRK A;  1NSH A;  1B9A A;  4AOM A;  2H2K A;  2Y1M A;  5I2O A;  1S36 A;  1TNX A;  3BOW A;  1UHH A;  2ZNE A;  1TTX A;  1PVA A;  2LAN A;  4OVN F;  4DRW A;  2F3Y A;  5KU1 A;  4GNK B;  2LE9 B;  2JT0 A;  4DUQ A;  3FWC A;  3GOF A;  2HET A;  4HRG A;  1K94 A;  2G2B A;  2NCP A;  1OZO A;  1OOJ A;  2M9G A;  1KCY A;  1C7V A;  2QPT A;  3EVR A;  2OTG B;  1SCM B;  1B8C A;  2JT3 A;  1KWO C;  1QVI Z;  4OCI A;  3OX5 A;  1IJ5 A;  2KNE A;  3IQQ A;  2LP3 A;  1AJ5 A;  3LLE A;  3BUX B;  4M2Q A;  3VGO A;  1YUS A;  1XFW O;  4OKH A;  1K9P A;  1N2D A;  1S3P A;  4Q04 A;  4ZCU A;  1LVC D;  3JVT C;  1DT7 B;  3BYA A;  3SG4 A;  2I2R E;  1A29 A;  1B1G A;  2HQW A;  3CLN A;  1KSO A;  2KI4 B;  2Y4Q A;  5HLO A;  1KFU S;  3IF7 A;  5CPV A;  4CFR A;  2ZFD A;  4PHK A;  5JOL A;  1CFC A;  2LAP A;  1UUS A;  3I5I B;  2WC8 A;  1CFP A;  2K7O A;  3DVE A;  1F71 A;  3EVU A;  2WCF A;  2KYF A;  3SIB A;  1SPY A;  4QJ4 B;  2KGR A;  1R2U A;  3NSL A;  2Y1N A;  1WRK A;  5D69 A;  2K7B A;  3TS5 B;  1PRW A;  2KAV A;  1QIV A;  5I8N A;  1CLM A;  1NX3 A;  4PDZ A;  5G08 A;  1SR6 B;  1IWQ A;  4I5N B;  4A4B A;  1KSM A;  3O6B A;  4YGC B;  1CB1 A;  4R1E A;  3D0Y B;  1SKT A;  1BR1 B;  2SAS A;  1F8H A;  2JQ6 A;  1UHK A;  3PSR A;  2VRG A;  1L7Z A;  2EC6 B;  1CM1 A;  3BXK A;  1WY9 A;  2M1U A;  4YGD B;  3LK1 A;  2PRU A;  2AAO A;  1U5I B;  1NCY A;  1TIZ A;  2TN4 A;  3I5F C;  1XYD A;  1IH0 A;  2ZRS A;  3GK1 A;  3KF9 A;  1SY9 A;  2V53 A;  4PE7 A;  3SIA A;  1AP4 A;  2KDH A;  3WHT B;  2JTZ A;  4C0K A;  1DJH A;  2JU0 A;  3DVJ A;  1RJV A;  1CFF A;  1IGV A;  1SK6 D;  1MR8 A;  1SNL A;  1RRO A;  1REC A;  2ZRT A;  1PAL A;  4YBH B;  5GQQ C;  2KOT A;  3DF0 B;  2KAY A;  1EJ3 A;  3AKB A;  2K8M B;  1FI6 A;  1CMF A;  3CS1 A;  3OX6 A;  1PSR A;  3DVM A;  4PHJ A;  2BL0 C;  5FYX A;  4P5O E;  1CDM A;  3PN7 C;  1MXL C;  4FTG A;  4QJ5 B;  1K9U A;  1WLM A;  2M8U A;  4DCK A;  2L0P A;  1QV1 A;  1CKK A;  2LNK A;  3WNX B;  1C07 A;  1DGV A;  5CSN A;  4NDB A;  4E68 A;  1LA3 A;  4YGE B;  4ETO A;  2PAS A;  4I5L B;  2JNX A;  2NLN A;  5KSZ A;  1K93 D;  1GGZ A;  2Y5I A;  5AXI A;  4TNC A;  5PAL A;  3ZNI A;  2I94 A;  2KBI A;  3I5G C;  2FJU B;  1UWO A;  1S5G Y;  4GPL B;  1JF0 A;  1MXE A;  2SCP A;  4M2O A;  3SG3 A;  1MQ1 A;  1TNQ A;  3VRO A;  4CFQ A;  5KTY A;  2WOR A;  1J7P A;  1F70 A;  1DJZ A;  2MBX A;  1TOP A;  2BCB A;  4C0L A;  3PAL A;  1BLQ A;  1L2O C;  1RTP 1;  3BQ3 A;  1YVH A;  1KQM C;  4MBE A;  4ORB B;  2WOS A;  4PHM A;  2E30 A;  4YI8 A;  1K2H A;  1Y1U A;  1BU3 A;  4XJK A;  4A4C A;  1NX1 A;  3M0W A;  3JVT B;  2MLF C;  1EG3 A;  1TNP A;  3DVK A;  5HYD A;  1JF2 A;  1CMG A;  3AAK A;  4WQ3 A;  1WDC C;  1BR4 B;  1K95 A;  2LHI A;  4PCW A;  1QJT A;  4GFT A;  1PVB A;  1EXR A;  1S6C A;  2G9B A;  1DF0 B;  1CDP A;  1XFU O;  2LC5 A;  1CFD A;  5CSI A;  1S6J A;  1S1E A;  1S6I A;  1YUU A;  1N0Y A;  2Q4U A;  5HKW A;  3E3R A;  3ICB A;  5AER A;  2M7N A;  3BUO B;  4L9M A;  4U8D A;  2LVI A;  1CLB A;  1DGU A;  2CT9 A;  2B1U A;  3OB1 B;  1OQP A;  1TNW A;  3EKJ A; 
#chains in the Genus database with same CATH topology
 2AUC A;  1V1G A;  1OMD A;  1J7Q A;  1F55 A;  1K8U A;  2KAX A;  2O5G A;  1IQ5 A;  5B8I B;  1A2X A;  4FQT A;  3I5F B;  1TCF A;  2LMU A;  3MSE B;  2KHN A;  4INW A;  3SS5 A;  1OOF A;  1A4P A;  1KFU L;  1NX2 A;  1DF0 A;  1KFX S;  2COL B;  2JTT A;  2P6B B;  1DEK A;  2ZND A;  3NSK A;  1DC1 A;  4NDC A;  1QTX A;  1QV0 A;  1DJG A;  1R6P A;  3SG2 A;  2LVV A;  1ODB A;  3R1O A;  3NHT A;  3R72 A;  4DS7 A;  2MRD A;  1EH2 A;  5JJG A;  4OZD A;  4MEW A;  2JT8 A;  3EK4 A;  1PSB A;  1ZUZ A;  1SMG A;  1CLL A;  4YGB B;  4OV2 A;  1K9K A;  3OBV A;  4HRH A;  5BPJ A;  4PE0 A;  3EVV A;  2F2P A;  1SRA A;  3N7H A;  2LUC A;  2WND A;  5I2Q A;  1YTZ C;  2BL0 B;  3A8R A;  2M29 A;  4MSP A;  1LXF C;  2OS8 C;  3PN7 B;  1SL8 A;  1CTR A;  1W7I B;  1LIN A;  1ZAC A;  2ERB A;  3CR5 X;  2E6W A;  3TDU A;  2K2F A;  2NXQ A;  1Y6W A;  3RLZ A;  3S0A A;  3SG5 A;  4AQI A;  1JWD A;  5F6T A;  2CXJ A;  4XYN A;  2JRF A;  1NYA A;  2FJY A;  4YGA A;  1JSA A;  1OZS A;  2ZKM X;  1QX2 A;  3HCM A;  1QX5 B;  3SJS A;  5FI2 A;  2JWW A;  1LKJ A;  1V1F A;  1KK7 Z;  1YX8 A;  2YGU A;  4GAO A;  1A03 A;  1B47 A;  1KK8 C;  2NCO A;  4JQ0 D;  1M45 A;  3I5G B;  2BEC A;  3CGA A;  1W9Z A;  3DZT A;  1SSE B;  1SW8 A;  1WRL A;  1K96 A;  1F4Q A;  2JC2 A;  2LVK A;  2M0R A;  3H4S E;  4INX A;  2JXL A;  1NPQ A;  1E8A A;  4NQG A;  1AHR A;  1QVI Y;  4GBA A;  3KHE A;  1QWV A;  2BBN A;  1DJY A;  4XJK B;  1SYM A;  1L2O B;  1M63 B;  3BUW B;  5AFP A;  2I18 A;  1TCO B;  1Z4H A;  1KQM B;  1OMV A;  2BKI B;  1TWO A;  2JUL A;  1QXP A;  2L5X B;  3I5H C;  3IQO A;  4MN0 A;  1KQV A;  1W7J B;  1CDL A;  2LLU A;  3BUM B;  1G33 A;  3K21 A;  1J7R A;  5I2L A;  2LP2 A;  1FBV A;  1FF1 A;  2KFH A;  1XFX O;  2BE6 A;  1XVJ A;  1YRT B;  1XA5 A;  4ICB A;  3VRR A;  1B8L A;  1DQE A;  3FE6 A;  1QAS A;  2M7L A;  2L50 A;  1UP5 A;  4CPV A;  1EG4 A;  2LLS A;  3D74 A;  1WDC B;  4P2Y B;  2RGI A;  1QIW A;  2K7C A;  4JKT A;  3VRP A;  4IJ7 A;  5I2O A;  2KFF A;  1H4B A;  1OMR A;  3S0B A;  3CYZ A;  1RK9 A;  3WHU B;  2M3W A;  4C0J A;  2Q91 A;  1RWY A;  3TUY C;  1PUL A;  1G4Y R;  2LVJ A;  1FW4 A;  3BFA A;  2ISD A;  4QJ3 B;  1ZOT B;  1BOC A;  3QRX A;  2HQ8 A;  2F2O A;  2AMI A;  1JBA A;  5DKR A;  2JOJ A;  2GGM A;  3QME A;  3CZ0 A;  1C7W A;  1GQM A;  3D10 A;  2QAC A;  3KO0 A;  2L2E A;  1J7O A;  1CM4 A;  1HT9 A;  1NP8 A;  1YVL A;  2KFG A;  4PE1 A;  1JFJ A;  2JZI A;  1IRJ A;  1Y1X A;  2MA2 A;  3LL8 B;  1NCZ A;  2KGB C;  1LA0 A;  1QS7 A;  2K0J A;  2KYC A;  2JXC A;  3OHM B;  2HF5 A;  3TDI A;  3GK4 X;  1ZFS A;  4M2P A;  3O78 A;  3VRN A;  2MJW B;  5J3X A;  1XFZ O;  3JTD C;  1M31 A;  3SS3 A;  2NZ0 A;  4GGN A;  1H8B A;  3AAJ A;  2EHB A;  3NHI A;  1XFR A;  2LHL A;  1YX7 A;  2F8P A;  4GUK A;  1YRU B;  2JPO A;  2OPO A;  3BUN B;  4MZK A;  4HSZ A;  4PHN A;  5D7F A;  1IQ3 A;  2PSR A;  1FPW A;  1WRZ A;  2D8N A;  1J1E A;  2MHH A;  3L4L A;  1Q80 A;  2LLT A;  2JPT A;  2KQY A;  1XFV O;  3F45 A;  1T14 A;  2KI6 C;  1JFK A;  2WCE A;  4AQJ A;  4F7F A;  4MRY A;  4PAL A;  2ZN8 A;  1N65 A;  4HRE E;  4YRU A;  5HKY A;  1UHN A;  1G8I A;  4OR9 B;  1IJ6 A;  1AK8 A;  1IG5 A;  2FCD A;  2WCB A;  4MVF A;  1NCX A;  3O4Y A;  2O60 A;  2L51 A;  3VRQ A;  5AEQ A;  2M1K B;  2OS8 B;  3RM1 A;  4CLN A;  1C3Z A;  2M97 A;  3EK8 A;  3KPX A;  1UUR A;  1XO5 A;  2M49 B;  3CZT X;  5DKQ A;  3LCP C;  2WCK A;  2FOT A;  1OSA A;  1X02 A;  1AVS A;  3DD4 A;  1OE9 B;  5AAN A;  1K90 D;  2BE4 A;  4FQO A;  2LMV A;  2QEB A;  3FS7 A;  2A4J A;  1KFX L;  4JWQ A;  3A4U B;  1S26 D;  2PAL A;  1JUO A;  3NXA A;  4MZL A;  1HQV A;  1KK8 B;  1QLS A;  2OTG C;  2QEV A;  1SCM C;  1WLZ A;  2GV5 A;  1SL9 A;  1OOG A;  1A75 B;  2MAZ A;  1IKU A;  1CNP A;  3TDZ A;  3EKH A;  1JC2 A;  3V2L A;  1UHJ A;  4CID A;  5HLV A;  3CR2 A;  2DOQ A;  1GM0 A;  1QLK A;  1TRF A;  2LV7 A;  1D1O A;  5ER5 A;  5K89 A;  3B7A A;  2L98 A;  2H61 C;  3FWB A;  4I5K A;  3D76 A;  1C3Y A;  3PFV A;  2K61 A;  1FI5 A;  1ALV A;  1BT6 A;  1EL4 A;  2LUX A;  3S0D A;  1B8R A;  2KI4 C;  3WXA A;  2CBL A;  2LM5 A;  2BCX A;  3HX4 A;  3I5H B;  3PAT A;  4ZCV A;  1AJ4 A;  1BJF A;  2GGZ A;  2H8V A;  3AKA A;  3CDN A;  3O4X A;  3SG6 A;  3EG5 B;  5CSJ A;  2WCH A;  3I5I C;  2IS9 A;  2H61 A;  2R2I A;  3GK2 A;  3PLF B;  4MLW A;  1AUI B;  1M39 A;  1MF8 B;  3SG7 A;  3IVT A;  1CDN A;  3PM8 A;  2PMY A;  2P70 A;  2K7D A;  4N5X A;  1BG1 A;  3TS5 C;  1PK0 D;  2LMT A;  3TZ1 A;  2CCM A;  1Y1A A;  3NSO A;  4F0Z B;  5TNC A;  2CNP A;  1SR6 C;  1M46 A;  1NWD A;  2KBM A;  4BY5 A;  1A75 A;  1KK7 Y;  4BY4 A;  3CR4 X;  1J55 A;  3B88 A;  1B7T Z;  4MZJ A;  3PJI A;  3TUY B;  3CZ2 A;  1DJI A;  4N1G A;  1BOD A;  3CTN A;  3D77 A;  1TN4 A;  1B4C A;  1XK4 C;  1RFJ A;  2KLE A;  1OW4 A;  2MLE C;  5EL2 A;  1MWN A;  2EC6 C;  4JPZ B;  3FE8 A;  3O2P A;  3LK0 A;  2BCA A;  1BMO A;  5FI7 A;  2KSP A;  5CSF A;  1YR5 A;  4MRX A;  3CWG A;  1YUT A;  2BNX A;  4N1F A;  1SCV A;  1DVI A;  3C1V A;  4PE4 A;  1YUR A;  1MHO A;  3D0Y A;  3FIA A;  3UO9 A;  1F4O A;  1GJY A;  1NIW A;  1XK4 A;  4GGF C;  2CTN A;  4YI9 A;  1B7T Y;  1GGW A;  2ZN9 A;  3BOW B;  1DTL A;  2KQ6 A;  1U5I A;  3CZ1 A;  2KI6 D;  3OP0 A;  1S5G Z;  3ZWH A;  3D73 A;  1XFY O;  2F33 A;  4ORC B;  2QEH A;  1BF5 A;  2JNF A;  2WCM A;  3OB2 B;  1QX7 A;  4WQ2 A;  4D1E A;  4GGF A;  1SBJ A;  2BBM A;  2BKH B;  4ORA B;  2K2A A;  3JTD B;  1SL7 A;  1QAT A;  5IBW A;  1Y0V H;  2I7A A;  4UPG A;  4USL A;  4IL1 A;  2L4H A;  3EK7 A;  1ALW A;  1DJW A;  2EGD A;  2FCE A;  1F54 A;  1TUJ A;  2LCP A;  3DF0 A;  2F3Z A;  3KEV A;  1UHI A;  1NUB A;  1J1D A;  4NDD A;  3B6X A;  1ZMZ A;  5DKN A;  1NX0 A;  5HKZ A;  3NSI A;  3S0F A;  2WC5 A;  2L4I A;  4I5J A;  4WRI A;  3Q8I A;  2PVB A;  1DMO A;  1DJX A;  1KWO B;  2HPS A;  1MUX A;  4DIR A;  1VRK A;  1NSH A;  1B9A A;  2WCL A;  2H2K A;  2Y1M A;  4JD9 A;  1S36 A;  1TNX A;  3BOW A;  3DXL A;  1UHH A;  4AOM A;  2ZNE A;  3R1V A;  1TTX A;  1PVA A;  2LAN A;  4OVN F;  4DRW A;  2F3Y A;  2QEO A;  5KU1 A;  4GNK B;  2LE9 B;  2JT0 A;  4DUQ A;  3FWC A;  3GOF A;  3S0G A;  1IIO A;  2HET A;  3CAB A;  4HRG A;  1K94 A;  2G2B A;  2NCP A;  1OZO A;  1OOJ A;  2WC6 A;  2M9G A;  1KCY A;  3S0E A;  1C7V A;  2QPT A;  3EVR A;  2OTG B;  1SCM B;  1B8C A;  2JT3 A;  1KWO C;  1QVI Z;  4OCI A;  3OX5 A;  1IJ5 A;  2KNE A;  3IQQ A;  2L5Y A;  2LP3 A;  1AJ5 A;  5ER4 X;  3LLE A;  3BUX B;  4M2Q A;  3VGO A;  1YUS A;  1XFW O;  4OKH A;  1K9P A;  1N2D A;  1S3P A;  4Q04 A;  4ZCU A;  1LVC D;  3JVT C;  1DT7 B;  3BYA A;  3SG4 A;  2I2R E;  1A29 A;  1B1G A;  5D3O A;  2HQW A;  3CLN A;  3L47 A;  1KSO A;  2KI4 B;  2Y4Q A;  5HLO A;  1KFU S;  2WCJ A;  3IF7 A;  5CPV A;  3PM2 A;  1ORG A;  2ZFD A;  4PHK A;  5JOL A;  4CFR A;  1CFC A;  2LAP A;  1UUS A;  3I5I B;  2WC8 A;  1CFP A;  2K7O A;  3D78 A;  3DVE A;  1F71 A;  3EVU A;  2WCF A;  2KYF A;  3SIB A;  2GTE A;  3BJH A;  1SPY A;  4QJ4 B;  2KGR A;  1R2U A;  3B86 A;  2Y1N A;  3NSL A;  1WRK A;  5D69 A;  2K7B A;  3TS5 B;  1PRW A;  2KAV A;  1QIV A;  3DY9 A;  1CLM A;  1NX3 A;  5I8N A;  2QDI A;  4PDZ A;  5G08 A;  1SR6 B;  1IWQ A;  4I5N B;  4A4B A;  1KSM A;  3O6B A;  4YGC B;  1CB1 A;  4R1E A;  3D0Y B;  1OOH A;  1SKT A;  1BR1 B;  5DIC A;  2SAS A;  1F8H A;  2JQ6 A;  1UHK A;  3PSR A;  3R1P A;  2VRG A;  1L7Z A;  2EC6 B;  1CM1 A;  3BXK A;  1WY9 A;  2M1U A;  4YGD B;  3LK1 A;  2PRU A;  2AAO A;  1U5I B;  3FE9 A;  1NCY A;  1TIZ A;  2TN4 A;  3I5F C;  3B87 A;  1XYD A;  3K1E A;  3L4A A;  1IH0 A;  1Z2C B;  2ZRS A;  3GK1 A;  3KF9 A;  1SY9 A;  2V53 A;  4PE7 A;  2KLD A;  3SIA A;  1DEL A;  2BAP A;  1AP4 A;  2KDH A;  3WHT B;  2JTZ A;  2L2C A;  1DJH A;  2JU0 A;  4C0K A;  3DVJ A;  1RJV A;  1CFF A;  1TUZ A;  1IGV A;  1SK6 D;  1MR8 A;  1SNL A;  1RRO A;  1REC A;  2ZRT A;  1PAL A;  4YBH B;  5GQQ C;  2KOT A;  3DF0 B;  2KAY A;  1EJ3 A;  3AKB A;  2K8M B;  1FI6 A;  1CMF A;  3CS1 A;  3OX6 A;  3NGV A;  3BFH A;  1PSR A;  3DVM A;  4PHJ A;  2BL0 C;  5FYX A;  4P5O E;  1CDM A;  3PN7 C;  1MXL C;  4FTG A;  4QJ5 B;  1OOI X;  1K9U A;  1WLM A;  2KPH A;  2M8U A;  4DCK A;  2L0P A;  1QV1 A;  3BFB A;  2PYQ A;  2LNK A;  3WNX B;  1C07 A;  1DGV A;  5CSN A;  4NDB A;  1CKK A;  4E68 A;  1LA3 A;  4YGE B;  4ETO A;  2PAS A;  4I5L B;  2JNX A;  2NLN A;  5KSZ A;  1K93 D;  1GGZ A;  2Y5I A;  2PQL A;  4TNC A;  5AXI A;  5PAL A;  3ZNI A;  2I94 A;  2K60 A;  2KBI A;  3I5G C;  2FJU B;  1UWO A;  3DYE A;  1S5G Y;  3D75 A;  4GPL B;  1JF0 A;  1MXE A;  2SCP A;  4M2O A;  3SG3 A;  1MQ1 A;  1TNQ A;  3VRO A;  4CFQ A;  5KTY A;  2WOR A;  1J7P A;  5HL1 A;  1F70 A;  3VB1 A;  1DJZ A;  2MBX A;  1TOP A;  2BCB A;  4C0L A;  3PAL A;  1BLQ A;  1L2O C;  4PT1 A;  1RTP 1;  3UNW A;  5I94 A;  3BQ3 A;  1YVH A;  1KQM C;  4MBE A;  4KYN A;  4ORB B;  2WOS A;  4PHM A;  2E30 A;  4YI8 A;  1K2H A;  1Y1U A;  1BU3 A;  4XJK A;  4A4C A;  1NX1 A;  3M0W A;  3JVT B;  2MLF C;  3RZS A;  1EG3 A;  1TNP A;  3DVK A;  5HYD A;  1JF2 A;  1CMG A;  3AAK A;  4WQ3 A;  1WDC C;  1BR4 B;  1K95 A;  2LHI A;  4PCW A;  1QJT A;  2P71 A;  4GFT A;  1PVB A;  1EXR A;  1S6C A;  2G9B A;  1DF0 B;  1CDP A;  1LS8 A;  1XFU O;  2LC5 A;  1CFD A;  5CSI A;  1S6J A;  1S1E A;  1P28 A;  3SS4 A;  1S6I A;  1YUU A;  1N0Y A;  2Q4U A;  5FI6 A;  3E3R A;  5HKW A;  3ICB A;  5AER A;  3OGN A;  2M7N A;  3BUO B;  4L9M A;  4U8D A;  2LVI A;  1CLB A;  1DGU A;  2CT9 A;  2B1U A;  3OB1 B;  1OQP A;  1TNW A;  3EKJ A; 
#chains in the Genus database with same CATH homology
 2AUC A;  1V1G A;  1OMD A;  1J7Q A;  1F55 A;  1K8U A;  2KAX A;  2O5G A;  1IQ5 A;  5B8I B;  1A2X A;  3I5F B;  1TCF A;  2LMU A;  3MSE B;  2KHN A;  1A4P A;  1KFU L;  1NX2 A;  1DF0 A;  1KFX S;  2COL B;  2JTT A;  2P6B B;  2ZND A;  3NSK A;  4NDC A;  1QTX A;  1QV0 A;  1DJG A;  1R6P A;  3SG2 A;  2LVV A;  1ODB A;  4DS7 A;  1EH2 A;  2MRD A;  5JJG A;  4MEW A;  2JT8 A;  3EK4 A;  1PSB A;  1ZUZ A;  1SMG A;  1CLL A;  4YGB B;  4OV2 A;  1K9K A;  4HRH A;  5BPJ A;  4PE0 A;  3EVV A;  2F2P A;  1SRA A;  2LUC A;  2WND A;  5I2Q A;  1YTZ C;  2BL0 B;  3A8R A;  2M29 A;  4MSP A;  1LXF C;  2OS8 C;  3PN7 B;  1SL8 A;  1CTR A;  1W7I B;  1LIN A;  1ZAC A;  3CR5 X;  3TDU A;  2E6W A;  2K2F A;  2NXQ A;  1Y6W A;  3RLZ A;  3SG5 A;  4AQI A;  1JWD A;  5F6T A;  2CXJ A;  4XYN A;  2JRF A;  1NYA A;  4YGA A;  1JSA A;  1OZS A;  2ZKM X;  1QX2 A;  3HCM A;  1QX5 B;  3SJS A;  1JC2 A;  2JWW A;  1LKJ A;  1V1F A;  1KK7 Z;  1YX8 A;  1A03 A;  4GAO A;  1B47 A;  1KK8 C;  2NCO A;  4JQ0 D;  1M45 A;  3I5G B;  2BEC A;  3CGA A;  1SW8 A;  1WRL A;  1K96 A;  1F4Q A;  2JC2 A;  2LVK A;  2M0R A;  3H4S E;  5ER4 X;  2JXL A;  1NPQ A;  1E8A A;  4NQG A;  1AHR A;  1QVI Y;  4GBA A;  3KHE A;  2BBN A;  1DJY A;  4XJK B;  1SYM A;  1L2O B;  1M63 B;  3BUW B;  5AFP A;  2I18 A;  1TCO B;  1KQM B;  1OMV A;  2BKI B;  2JUL A;  2L5X B;  1QXP A;  3I5H C;  3IQO A;  4MN0 A;  1KQV A;  1W7J B;  1CDL A;  2LLU A;  3BUM B;  1G33 A;  3K21 A;  1J7R A;  5I2L A;  2LP2 A;  1FBV A;  1FF1 A;  2KFH A;  1XFX O;  2BE6 A;  1XVJ A;  1YRT B;  1XA5 A;  4ICB A;  3VRR A;  1B8L A;  1QAS A;  2M7L A;  2L50 A;  1UP5 A;  4CPV A;  1EG4 A;  2LLS A;  1WDC B;  4P2Y B;  2RGI A;  1QIW A;  2K7C A;  3VRP A;  2KFF A;  1H4B A;  1OMR A;  1RK9 A;  3WHU B;  2M3W A;  4C0J A;  2Q91 A;  1RWY A;  3TUY C;  1PUL A;  1G4Y R;  2LVJ A;  1FW4 A;  2ISD A;  4QJ3 B;  1ZOT B;  1BOC A;  3QRX A;  2HQ8 A;  2F2O A;  2AMI A;  1JBA A;  5DKR A;  2JOJ A;  2GGM A;  1C7W A;  1GQM A;  3D10 A;  2QAC A;  3KO0 A;  2L2E A;  1J7O A;  1CM4 A;  1HT9 A;  1NP8 A;  1YVL A;  2KFG A;  4PE1 A;  1JFJ A;  2JZI A;  1IRJ A;  1Y1X A;  2MA2 A;  3LL8 B;  1NCZ A;  2KGB C;  1LA0 A;  1QS7 A;  2K0J A;  2KYC A;  2JXC A;  3OHM B;  2HF5 A;  3TDI A;  3GK4 X;  1ZFS A;  4M2P A;  3O78 A;  3VRN A;  2MJW B;  5J3X A;  1XFZ O;  3JTD C;  1M31 A;  2NZ0 A;  4GGN A;  1H8B A;  3AAJ A;  2EHB A;  2LHL A;  1YX7 A;  2F8P A;  4GUK A;  1YRU B;  3BUN B;  2OPO A;  4PHN A;  4MZK A;  4HSZ A;  5D7F A;  1IQ3 A;  2PSR A;  1FPW A;  1WRZ A;  2D8N A;  1J1E A;  2MHH A;  1Q80 A;  2LLT A;  2JPT A;  2KQY A;  1XFV O;  3F45 A;  2KI6 C;  1JFK A;  2WCE A;  4AQJ A;  4MRY A;  4PAL A;  2ZN8 A;  1N65 A;  4HRE E;  4YRU A;  5HKY A;  1UHN A;  1G8I A;  4OR9 B;  1IJ6 A;  1AK8 A;  1IG5 A;  2FCD A;  2WCB A;  4MVF A;  1NCX A;  3O4Y A;  2O60 A;  2L51 A;  3VRQ A;  5AEQ A;  2M1K B;  2OS8 B;  3RM1 A;  4CLN A;  2M97 A;  3EK8 A;  3KPX A;  1UUR A;  1XO5 A;  2M49 B;  3CZT X;  5DKQ A;  3LCP C;  2FOT A;  1OSA A;  1X02 A;  1AVS A;  3DD4 A;  1OE9 B;  5AAN A;  1K90 D;  2BE4 A;  4FQO A;  2LMV A;  3FS7 A;  2A4J A;  1KFX L;  4JWQ A;  3A4U B;  1S26 D;  2PAL A;  1JUO A;  3NXA A;  4MZL A;  1HQV A;  1KK8 B;  1QLS A;  2OTG C;  1SCM C;  1WLZ A;  2GV5 A;  1SL9 A;  2MAZ A;  1A75 B;  1IKU A;  1CNP A;  3TDZ A;  3EKH A;  1UHJ A;  4CID A;  5HLV A;  3CR2 A;  2DOQ A;  1QLK A;  1TRF A;  2LV7 A;  1D1O A;  5ER5 A;  5K89 A;  2L98 A;  2H61 C;  3FWB A;  4I5K A;  3PFV A;  2K61 A;  1FI5 A;  1ALV A;  1BT6 A;  1EL4 A;  2LUX A;  1B8R A;  2KI4 C;  3WXA A;  2CBL A;  2LM5 A;  2BCX A;  3HX4 A;  3I5H B;  3PAT A;  4ZCV A;  1AJ4 A;  1BJF A;  2GGZ A;  3AKA A;  3SG6 A;  5CSJ A;  3I5I C;  2IS9 A;  2H61 A;  2R2I A;  3GK2 A;  3PLF B;  4MLW A;  1AUI B;  1M39 A;  1MF8 B;  3SG7 A;  1CDN A;  3PM8 A;  2PMY A;  2K7D A;  4N5X A;  1BG1 A;  3TS5 C;  1PK0 D;  2LMT A;  3TZ1 A;  2CCM A;  1Y1A A;  3NSO A;  4F0Z B;  5TNC A;  2CNP A;  1SR6 C;  1M46 A;  1NWD A;  2KBM A;  4BY5 A;  1A75 A;  1KK7 Y;  4BY4 A;  3CR4 X;  1J55 A;  1B7T Z;  4MZJ A;  3TUY B;  1DJI A;  4N1G A;  1BOD A;  3CTN A;  1TN4 A;  1B4C A;  1XK4 C;  1RFJ A;  2MLE C;  1MWN A;  2EC6 C;  4JPZ B;  3O2P A;  3LK0 A;  2BCA A;  1BMO A;  2KSP A;  5CSF A;  1YR5 A;  4MRX A;  3CWG A;  1YUT A;  4N1F A;  1SCV A;  1DVI A;  3C1V A;  4PE4 A;  1YUR A;  1MHO A;  3D0Y A;  3FIA A;  1F4O A;  1GJY A;  1NIW A;  1XK4 A;  4GGF C;  2CTN A;  4YI9 A;  1B7T Y;  1GGW A;  2ZN9 A;  3BOW B;  1DTL A;  2KQ6 A;  1U5I A;  3OP0 A;  2KI6 D;  3ZWH A;  1S5G Z;  1XFY O;  2F33 A;  4ORC B;  1BF5 A;  2JNF A;  3OB2 B;  1QX7 A;  4WQ2 A;  4D1E A;  4GGF A;  1SBJ A;  2BBM A;  2BKH B;  4ORA B;  2K2A A;  3JTD B;  1SL7 A;  1QAT A;  5IBW A;  1Y0V H;  2I7A A;  4UPG A;  4USL A;  4IL1 A;  2L4H A;  3EK7 A;  1ALW A;  1DJW A;  2EGD A;  2FCE A;  1F54 A;  2LCP A;  3DF0 A;  2F3Z A;  3KEV A;  1UHI A;  1NUB A;  1J1D A;  4NDD A;  1ZMZ A;  5DKN A;  1NX0 A;  5HKZ A;  3NSI A;  4I5J A;  2L4I A;  4WRI A;  2PVB A;  1DMO A;  1DJX A;  1KWO B;  2HPS A;  1MUX A;  4DIR A;  1VRK A;  1NSH A;  1B9A A;  4AOM A;  2H2K A;  2Y1M A;  5I2O A;  1S36 A;  1TNX A;  3BOW A;  1UHH A;  2ZNE A;  1TTX A;  1PVA A;  2LAN A;  4OVN F;  4DRW A;  2F3Y A;  5KU1 A;  4GNK B;  2LE9 B;  2JT0 A;  4DUQ A;  3FWC A;  3GOF A;  2HET A;  4HRG A;  1K94 A;  2G2B A;  2NCP A;  1OZO A;  1OOJ A;  2M9G A;  1KCY A;  1C7V A;  2QPT A;  3EVR A;  2OTG B;  1SCM B;  1B8C A;  2JT3 A;  1KWO C;  1QVI Z;  4OCI A;  3OX5 A;  1IJ5 A;  2KNE A;  3IQQ A;  2LP3 A;  1AJ5 A;  3LLE A;  3BUX B;  4M2Q A;  3VGO A;  1YUS A;  1XFW O;  4OKH A;  1K9P A;  1N2D A;  1S3P A;  4Q04 A;  4ZCU A;  1LVC D;  3JVT C;  1DT7 B;  3BYA A;  3SG4 A;  2I2R E;  1A29 A;  1B1G A;  2HQW A;  3CLN A;  1KSO A;  2KI4 B;  2Y4Q A;  5HLO A;  1KFU S;  3IF7 A;  5CPV A;  4CFR A;  2ZFD A;  4PHK A;  5JOL A;  1CFC A;  2LAP A;  1UUS A;  3I5I B;  2WC8 A;  1CFP A;  2K7O A;  3DVE A;  1F71 A;  3EVU A;  2WCF A;  2KYF A;  3SIB A;  1SPY A;  4QJ4 B;  2KGR A;  1R2U A;  3NSL A;  2Y1N A;  1WRK A;  5D69 A;  2K7B A;  3TS5 B;  1PRW A;  2KAV A;  1QIV A;  5I8N A;  1CLM A;  1NX3 A;  4PDZ A;  5G08 A;  1SR6 B;  1IWQ A;  4I5N B;  4A4B A;  1KSM A;  3O6B A;  4YGC B;  1CB1 A;  4R1E A;  3D0Y B;  1SKT A;  1BR1 B;  2SAS A;  1F8H A;  2JQ6 A;  1UHK A;  3PSR A;  2VRG A;  1L7Z A;  2EC6 B;  1CM1 A;  3BXK A;  1WY9 A;  2M1U A;  4YGD B;  3LK1 A;  2PRU A;  2AAO A;  1U5I B;  1NCY A;  1TIZ A;  2TN4 A;  3I5F C;  1XYD A;  1IH0 A;  2ZRS A;  3GK1 A;  3KF9 A;  1SY9 A;  2V53 A;  4PE7 A;  3SIA A;  1AP4 A;  2KDH A;  3WHT B;  2JTZ A;  4C0K A;  1DJH A;  2JU0 A;  3DVJ A;  1RJV A;  1CFF A;  1IGV A;  1SK6 D;  1MR8 A;  1SNL A;  1RRO A;  1REC A;  2ZRT A;  1PAL A;  4YBH B;  5GQQ C;  2KOT A;  3DF0 B;  2KAY A;  1EJ3 A;  3AKB A;  2K8M B;  1FI6 A;  1CMF A;  3CS1 A;  3OX6 A;  1PSR A;  3DVM A;  4PHJ A;  2BL0 C;  5FYX A;  4P5O E;  1CDM A;  3PN7 C;  1MXL C;  4FTG A;  4QJ5 B;  1K9U A;  1WLM A;  2M8U A;  4DCK A;  2L0P A;  1QV1 A;  1CKK A;  2LNK A;  3WNX B;  1C07 A;  1DGV A;  5CSN A;  4NDB A;  4E68 A;  1LA3 A;  4YGE B;  4ETO A;  2PAS A;  4I5L B;  2JNX A;  2NLN A;  5KSZ A;  1K93 D;  1GGZ A;  2Y5I A;  5AXI A;  4TNC A;  5PAL A;  3ZNI A;  2I94 A;  2KBI A;  3I5G C;  2FJU B;  1UWO A;  1S5G Y;  4GPL B;  1JF0 A;  1MXE A;  2SCP A;  4M2O A;  3SG3 A;  1MQ1 A;  1TNQ A;  3VRO A;  4CFQ A;  5KTY A;  2WOR A;  1J7P A;  1F70 A;  1DJZ A;  2MBX A;  1TOP A;  2BCB A;  4C0L A;  3PAL A;  1BLQ A;  1L2O C;  1RTP 1;  3BQ3 A;  1YVH A;  1KQM C;  4MBE A;  4ORB B;  2WOS A;  4PHM A;  2E30 A;  4YI8 A;  1K2H A;  1Y1U A;  1BU3 A;  4XJK A;  4A4C A;  1NX1 A;  3M0W A;  3JVT B;  2MLF C;  1EG3 A;  1TNP A;  3DVK A;  5HYD A;  1JF2 A;  1CMG A;  3AAK A;  4WQ3 A;  1WDC C;  1BR4 B;  1K95 A;  2LHI A;  4PCW A;  1QJT A;  4GFT A;  1PVB A;  1EXR A;  1S6C A;  2G9B A;  1DF0 B;  1CDP A;  1XFU O;  2LC5 A;  1CFD A;  5CSI A;  1S6J A;  1S1E A;  1S6I A;  1YUU A;  1N0Y A;  2Q4U A;  5HKW A;  3E3R A;  3ICB A;  5AER A;  2M7N A;  3BUO B;  4L9M A;  4U8D A;  2LVI A;  1CLB A;  1DGU A;  2CT9 A;  2B1U A;  3OB1 B;  1OQP A;  1TNW A;  3EKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...