2L5XB

Solution structure of il1a-s100a13 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 alpha
publication title The IL1alpha-S100A13 heterotetrameric complex structure: a component in the non-classical pathway for interleukin 1alpha secretion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/transport protein
total genus 22
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l5xB00
1QX2A 2LMUA 4ZCVA 4WRIA 1F54A 4MZJA 4JPZB 1NCXA 3NXAA 3WHUB 2ZRSA 5GQQC 1BF5A 1F4OA 1RTP1 1K9UA 1JFKA 1PVAA 1JF0A 4DRWA 1B8CA 2B1UA 2L4IA 1K8UA 1ZUZA 1S36A 3I5IB 2Q4UA 1IGVA 1S6IA 1XFXO 1RK9A 1N0YA 1SCVA 1CB1A 4NDBA 4YGAA 1IKUA 3JVTB 1KQVA 2OS8B 3ICBA 1C07A 5I2LA 1A75B 3JVTC 2OS8C 1EG4A 2JNXA 2LUXA 1J1DA 4ORBB 1F70A 2O5GA 1DGUA 3BXKA 2I2RE 3CS1A 4PE7A 3O78A 5F6TA 2ISDA 2Y5IA 1WRKA 1PSRA 1B7TY 4U8DA 4YGBB 2WNDA 3VRRA 2LLSA 1NYAA 2CT9A 3O2PA 3GK1A 1KFXS 2JNFA 2PRUA 2K2AA 2K7BA 2WORA 3SIAA 1WDCB 3AKAA 1KFUS 5DKQA 4ICBA 1Y1XA 1SPYA 1WDCC 2K8MB 2KNEA 3VRNA 2KDHA 1MQ1A 4A4CA 1LA3A 1SYMA 2WCEA 1DGVA 3OX5A 1PULA 1CM1A 1DT7B 3TS5B 2BCXA 2WCFA 3VGOA 2KAVA 4I5JA 1IQ3A 2BBMA 2JTTA 4PHJA 5PALA 2AMIA 2BKIB 1TIZA 2I18A 2FCEA 3LLEA 5G08A 5HKWA 3HX4A 1ZOTB 3IF7A 1TNWA 3MSEB 4P5OE 3GK4X 3E3RA 1QATA 1S5GZ 1UP5A 3CTNA 1RECA 1S26D 3FWCA 1OOJA 1M63B 5DKRA 1NUBA 4PHMA 2M8UA 1CDNA 5BPJA 4OVNF 2BECA 3AKBA 3SG6A 1CDPA 3TDUA 1FI5A 4AQJA 1QX7A 3SJSA 2L98A 1CNPA 2FCDA 1DJYA 3NSOA 5CSNA 2K61A 1IJ5A 2L50A 1J7QA 1WY9A 1QASA 1QLKA 3CGAA 4GGNA 4BY4A 1SKTA 2JTZA 4YGCB 2JXCA 2LV7A 4OCIA 5HKYA 1W7JB 2M49B 1QV0A 3I5FB 1MWNA 1YR5A 3LK1A 2G9BA 2F2OA 3OB2B 3JTDB 3H4SE 1IWQA 4AOMA 1N65A 4GGFA 1KK7Z 1KWOB 2BE6A 1S5GY 2F3YA 5JJGA 1D1OA 2A4JA 1EXRA 2K7OA 1OZSA 2ZN9A 3EVUA 2HPSA 4P2YB 1UHIA 2COLB 1CTRA 2KSPA 1WRLA 1UHHA 1LVCD 5B8IB 1IJ6A 1V1GA 4MLWA 2QACA 4C0KA 2HETA 2HQWA 1TOPA 4GUKA 1OMVA 4YGEB 1MXLC 3ZWHA 3BOWB 1OMDA 2M1UA 4CPVA 1DJWA 2L4HA 3AAJA 1YTZC 5CSIA 1KK7Y 2MBXA 4YI9A 2KI4C 4PE1A 4PHNA 1B47A 1BR1B 3NSLA 1JFJA 1FW4A 2KYCA 3D0YA 4MSPA 3VRQA 1KQMB 2EHBA 2FOTA 1TNQA 1DVIA 1KQMC 1KSOA 1Y0VH 2LMTA 3KHEA 3CR5X 4PE0A 1KCYA 1CFPA 1F8HA 1SMGA 1UURA 1B9AA 2G2BA 2CTNA 3PM8A 4GAOA 4ZCUA 2ZNDA 1XYDA 4YBHB 3AAKA 4WQ2A 1YUUA 3VROA 1XA5A 1YX7A 1XK4A 1BODA 2KGRA 2HQ8A 1KSMA 1MR8A 1MXEA 1SBJA 2OTGC 2LE9B 1KFXL 5JOLA 5HKZA 4MBEA 2LHLA 1K96A 1MUXA 2NLNA 1IH0A 3SG3A 1F71A 3DVMA 5D7FA 3CZTX 3OP0A 1OSAA 1J7RA 1H4BA 2ZN8A 1YX8A 3FWBA 1AP4A 4GGFC 3C1VA 5K89A 1CFCA 1SL9A 1DJGA 1TCOB 2BE4A 3I5GC 5HYDA 1B8LA 1A03A 1YURA 2LVVA 3BUMB 4MRXA 3NSKA 1NCYA 2KQYA 1EH2A 2M97A 1NCZA 3M0WA 2Y1MA 3DF0A 2KHNA 1K94A 1SR6B 2LVJA 3A4UB 3CLNA 5AERA 1K2HA 1PVBA 1M46A 1AUIB 2JQ6A 2LM5A 1SR6C 2NXQA 2ZNEA 1S6CA 5TNCA 4MRYA 1N2DA 2SCPA 4XJKB 3PN7C 1TN4A 1Q80A 4WQ3A 3BUWB 1CKKA 3EVVA 2L51A 2K7CA 1H8BA 3BQ3A 1NX3A 1SL7A 3DVEA 2F2PA 1UUSA 2F3ZA 3EK7A 4CFQA 4FQOA 4E68A 1BLQA 2D8NA 5I8NA 1SL8A 4F0ZB 1IRJA 1QIVA 2DOQA 1BG1A 4QJ5B 1ALWA 1W7IB 4PCWA 2KAXA 1JWDA 1QX5B 3EKHA 1U5IB 4DCKA 2KFFA 3OX6A 1BU3A 1PK0D 1UWOA 2MRDA 3TUYB 5I2QA 1QVIZ 3PLFB 1XK4C 2JT8A 2ZRTA 1J1EA 3TUYC 2MLFC 2EC6B 1DJZA 1E8AA 1SW8A 4CFRA 1S6JA 1CM4A 2EC6C 4GPLB 1CLMA 2V53A 2ZKMX 3FS7A 4USLA 4BY5A 2F8PA 1TNPA 1BMOA 1BT6A 1NPQA 1XFZO 2CXJA 1IG5A 5AXIA 1SK6D 1EJ3A 1YUSA 1DTLA 3K21A 1S1EA 2KYFA 2L5XB 3FIAA 5FYXA 3SG4A 2JT0A 1ALVA 1HQVA 1XVJA 2JXLA 1KK8C 1OQPA 1PALA 2NZ0A 2M7LA 4D1EA 1QLSA 2GGMA 3BYAA 4HSZA 4MVFA 1XFVO 2KI6D 1DF0A 2LUCA 1CMFA 2BL0C 2M0RA 1AHRA 2LAPA 2I94A 1LINA 2KBIA 5AEQA 1WLZA 3OHMB 1L7ZA 5AANA 1RFJA 3TDZA 2KQ6A 3KF9A 3BUNB 1GGWA 1V1FA 1XO5A 2LNKA 2JWWA 1A2XA 2LANA 2BCAA 2GGZA 2H2KA 3GK2A 1GGZA 2KI4B 2WOSA 4M2QA 2SASA 1GJYA 3BUOB 2LMVA 1CDMA 2OPOA 3F45A 4C0LA 1A75A 5KSZA 3HCMA 2CNPA 4M2OA 2KI6C 3A8RA 2GV5A 1B1GA 1SNLA 1DJXA 1HT9A 1X02A 3KPXA 1JUOA 1ZACA 1GQMA 2PALA 1CFDA 2M3WA 5CSJA 1UHKA 2PSRA 3LL8B 2FJUB 1FF1A 2Y4QA 2M1KB 1EG3A 4MEWA 2OTGB 4OV2A 4A4BA 1A4PA 4ETOA 3PATA 2WCBA 3PALA 2K7DA 1R2UA 3I5HB 1JSAA 1PSBA 3SG2A 1KFUL 2JRFA 1UHJA 2LP2A 2TN4A 3VRPA 3I5HC 4HRHA 1YRUB 2MLEC 4R1EA 1WLMA 3EKJA 1LKJA 1G33A 1QIWA 1YRTB 1YVLA 2BCBA 2LLTA 1FBVA 2HF5A 3I5GB 3PFVA 1JBAA 1JC2A 1NIWA 3CR2A 4GFTA 1M39A 3RLZA 1CMGA 2LHIA 2L0PA 4I5LB 1QS7A 2E30A 1B7TZ 4HREE 1XFUO 3NSIA 2BKHB 3ZNIA 1K9PA 2WC8A 1MHOA 4YI8A 3LCPC 1K95A 1QTXA 3PN7B 2LC5A 4MZKA 4I5KA 2P6BB 3O6BA 2Y1NA 1NP8A 3I5IC 2H61A 4NDDA 5J3XA 4DS7A 1M45A 2MAZA 1TNXA 4UPGA 2F33A 3IQOA 2AAOA 4YRUA 4OR9B 1OE9B 3SG7A 1SY9A 3D0YB 2PMYA 4N1GA 1F4QA 1BJFA 1UHNA 1SRAA 4MN0A 1ZMZA 2M7NA 1WRZA 3OB1B 4YGDB 2LVIA 2E6WA 4Q04A 2MHHA 2R2IA 2CCMA 3CWGA 5D69A 4AQIA 2L2EA 1BOCA 1XFYO 1XFWO 2VRGA 4QJ4B 1AJ5A 1RWYA 1F55A 1TTXA 5HLOA 4FTGA 1S3PA 2IS9A 2O60A 3TDIA 3EK8A 1G4YR 1SCMB 1L2OB 3PSRA 5ER5A 2KAYA 2M29A 4M2PA 1SCMC 2JPTA 1C7VA 1L2OC 1NX0A 4PALA 3GOFA 4L9MA 4NDCA 2M9GA 4DUQA 3SIBA 3TS5C 1G8IA 1OZOA 3BOWA 2JOJA 2KFHA 3EVRA 4HRGA 1KK8B 1TRFA 1ZFSA 4ORAB 3WXAA 4CLNA 2BBNA 3LK0A 3KO0A 2KGBC 4PDZA 2K2FA 2MA2A 3EK4A 2BL0B 1RJVA 1Y1UA 3WHTB 1RROA 1TCFA 1NX2A 4JWQA 4NQGA 1YUTA 3DF0B 1J7OA 1QVIY 2RGIA 1J55A 2MJWB 4DIRA 4MZLA 4IL1A 2JT3A 2EGDA 1NWDA 2I7AA 3QRXA 2LVKA 4ORCB 2LCPA 3IQQA 3RM1A 1FPWA 1ODBA 1CFFA 1NSHA 2H61C 3DVKA 1Y6WA 1OMRA 1B8RA 5KU1A 3DD4A 1AJ4A 1QV1A 3I5FC 1M31A 1IQ5A 1C7WA 5DKNA 1A29A 2LLUA 2PASA 3JTDC 2JU0A 3D10A 3DVJA 1QJTA 5IBWA 2PVBA 2JC2A 1KWOC 4OKHA 1NX1A 2KOTA 1QXPA 4GNKB 5I2OA 4GBAA 3WNXB 4N5XA 3SG5A 1K93D 4PE4A 2QPTA 1JF2A 2NCOA 4JQ0D 4N1FA 1BR4B 5ER4X 4CIDA 1DJHA 5KTYA 1VRKA 1LXFC 1EL4A 1DMOA 2AUCA 1LA0A 4XJKA 3TZ1A 1DJIA 4XYNA 1K90D 1B4CA 1AK8A 3BUXB 1J7PA 1K9KA 1YVHA 3KEVA 1MF8B 1PRWA 1R6PA 2KBMA 2ZFDA 1CLBA 4TNCA 2CBLA 2LP3A 5CPVA 1CDLA 4I5NB 1FI6A 3O4YA 5AFPA 1DF0B 3CR4X 1AVSA 2Q91A 2JULA 2JZIA 4C0JA 2K0JA 1U5IA 2KFGA 4PHKA 5CSFA 4QJ3B 5HLVA 2NCPA 1CLLA 1Y1AA
chains in the Genus database with same CATH superfamily
1QX2A 2LMUA 4ZCVA 4WRIA 1F54A 4MZJA 4JPZB 1NCXA 3NXAA 3WHUB 2ZRSA 5GQQC 1BF5A 1F4OA 1RTP1 1K9UA 1JFKA 1OOGA 1PVAA 1JF0A 3QMEA 1B8CA 4DRWA 2B1UA 2L4IA 1K8UA 1TUZA 1S36A 1ZUZA 3I5IB 2Q4UA 1IGVA 5DICA 1S6IA 1XFXO 1RK9A 1N0YA 1SCVA 3FE6A 4NDBA 1CB1A 2KLDA 4YGAA 1IKUA 3JVTB 1KQVA 2OS8B 3ICBA 1C07A 5I2LA 1A75B 3JVTC 2OS8C 3B6XA 1EG4A 2JNXA 2LUXA 1J1DA 4ORBB 1F70A 2O5GA 3B86A 1OOFA 1DGUA 3BXKA 2I2RE 3CS1A 4PE7A 3O78A 5F6TA 2ISDA 2Y5IA 1WRKA 1PSRA 1B7TY 4U8DA 4YGBB 2WNDA 3VRRA 2LLSA 1NYAA 2CT9A 3O2PA 3GK1A 1KFXS 2JNFA 2PRUA 2K2AA 2K7BA 2WORA 3FE8A 3SIAA 2KPHA 1DC1A 1WDCB 1LS8A 3AKAA 3BFBA 4IJ7A 1KFUS 5DKQA 4ICBA 1Y1XA 1SPYA 4F7FA 1WDCC 2K8MB 2KNEA 3Q8IA 3VRNA 2KDHA 1MQ1A 4A4CA 1LA3A 1SYMA 2WCEA 1DGVA 3OX5A 1PULA 1CM1A 1DT7B 3TS5B 2BCXA 2WCFA 3VGOA 2KAVA 4I5JA 1IQ3A 3R1OA 2BBMA 2JTTA 3D75A 4PHJA 5PALA 2AMIA 2BKIB 1TIZA 2I18A 2FCEA 3LLEA 5G08A 5HKWA 3HX4A 1ZOTB 3IF7A 1TNWA 3MSEB 2WCKA 4P5OE 3GK4X 3E3RA 1QATA 1S5GZ 1C3YA 1UP5A 3CTNA 1DELA 1RECA 1S26D 1SSEB 3FWCA 3R1PA 1OOJA 1M63B 2QEBA 5DKRA 1NUBA 4PHMA 2M8UA 1CDNA 1T14A 1OW4A 5BPJA 4OVNF 2BECA 3AKBA 3SG6A 1CDPA 3TDUA 1FI5A 4AQJA 1QX7A 3SJSA 2L98A 1CNPA 2FCDA 1DJYA 3NSOA 5CSNA 2K61A 1IJ5A 2L50A 3L4LA 1WY9A 1J7QA 1QASA 1QLKA 3CGAA 4GGNA 4BY4A 1SKTA 2JTZA 4YGCB 2JXCA 2LV7A 4OCIA 2WCMA 5HKYA 1W7JB 2M49B 1QV0A 3B88A 3I5FB 1MWNA 1YR5A 3LK1A 2G9BA 2F2OA 3DXLA 3OB2B 3JTDB 3H4SE 1IWQA 4AOMA 1N65A 4GGFA 1KK7Z 1KWOB 2BE6A 1S5GY 2F3YA 5JJGA 1D1OA 2P70A 2PQLA 2A4JA 1EXRA 2K7OA 1OZSA 2ZN9A 3EVUA 2HPSA 4P2YB 1UHIA 2COLB 1CTRA 2KSPA 1WRLA 1UHHA 1LVCD 5B8IB 1IJ6A 1V1GA 4MLWA 2QACA 4C0KA 3D73A 2HETA 2HQWA 1TOPA 4GUKA 3SS4A 1OMVA 4YGEB 1MXLC 3ZWHA 3BFHA 3BOWB 1OMDA 2M1UA 4CPVA 1DJWA 2L4HA 3AAJA 1YTZC 5CSIA 1KK7Y 2MBXA 4YI9A 2KI4C 4PE1A 4PHNA 1B47A 1BR1B 3NSLA 1JFJA 1FW4A 2KYCA 3D0YA 4MSPA 3VRQA 1KQMB 2EHBA 3S0EA 3L4AA 2FOTA 1TNQA 1DVIA 1KQMC 1KSOA 1Y0VH 2LMTA 3KHEA 2YGUA 3CR5X 4PE0A 1KCYA 1CFPA 3CZ1A 1F8HA 1SMGA 1UURA 1B9AA 2G2BA 2CTNA 3PM8A 4GAOA 4ZCUA 2ZNDA 4KYNA 2JPOA 1XYDA 4YBHB 2QDIA 3AAKA 1YUUA 4WQ2A 3VROA 1XA5A 1YX7A 1XK4A 3B7AA 1BODA 2KGRA 2HQ8A 1KSMA 1MR8A 1MXEA 1SBJA 2OTGC 2LE9B 1QWVA 1KFXL 5JOLA 5HKZA 5I94A 3S0AA 4MBEA 2LHLA 1K96A 1MUXA 2NLNA 5FI2A 1IH0A 3SG3A 1F71A 3DVMA 5D7FA 3CZTX 1DQEA 3OP0A 1OSAA 1J7RA 1H4BA 2ZN8A 1YX8A 3FWBA 1AP4A 4GGFC 3C1VA 5K89A 1CFCA 1SL9A 1DJGA 1TCOB 2BE4A 3I5GC 3V2LA 5HL1A 5HYDA 3RZSA 2GTEA 1B8LA 1A03A 1YURA 2LVVA 3BUMB 4MRXA 3NSKA 1NCYA 1TWOA 2KQYA 1EH2A 1GM0A 2M97A 1NCZA 3M0WA 2Y1MA 3DF0A 3S0BA 2KHNA 1K94A 1SR6B 2LVJA 3A4UB 3CLNA 5AERA 1K2HA 1PVBA 3FE9A 1M46A 1AUIB 2JQ6A 2LM5A 1SR6C 2NXQA 2ZNEA 1S6CA 5TNCA 4MRYA 1N2DA 2SCPA 4XJKB 3PN7C 1TN4A 3PM2A 1Q80A 4WQ3A 3BUWB 1CKKA 3S0GA 3EVVA 4INWA 2L51A 2K7CA 1H8BA 3BQ3A 1NX3A 1SL7A 3DVEA 2F2PA 1UUSA 2F3ZA 3EK7A 4CFQA 4FQOA 4E68A 1BLQA 2D8NA 3D76A 5I8NA 1SL8A 4F0ZB 1IRJA 1QIVA 2DOQA 1BG1A 4QJ5B 1ALWA 1W7IB 4PCWA 2KAXA 1JWDA 1QX5B 3EKHA 2WCHA 1U5IB 4DCKA 5FI6A 2KFFA 3OX6A 1BU3A 1PK0D 1UWOA 2MRDA 3TUYB 5I2QA 1QVIZ 3PLFB 1XK4C 2JT8A 2ZRTA 1J1EA 3TUYC 2MLFC 2EC6B 1DJZA 1E8AA 1SW8A 3CDNA 4CFRA 1S6JA 1CM4A 2EC6C 4GPLB 1CLMA 2V53A 2ZKMX 3FS7A 4USLA 4BY5A 2F8PA 1TNPA 1BMOA 1BT6A 3IVTA 1NPQA 1XFZO 2CXJA 1IG5A 5AXIA 1P28A 1YUSA 1EJ3A 1DTLA 1SK6D 3K21A 1S1EA 2KYFA 2L5XB 3FIAA 5FYXA 3SG4A 2JT0A 1ALVA 1HQVA 1XVJA 2JXLA 2WC6A 1KK8C 1OQPA 1PALA 2NZ0A 3NGVA 3R72A 2M7LA 1QLSA 4D1EA 2GGMA 3BYAA 3OGNA 4HSZA 4MVFA 1XFVO 2KI6D 3R1VA 1DF0A 2LUCA 1CMFA 2BL0C 3CZ0A 3D78A 2M0RA 3NHTA 1AHRA 2LAPA 2I94A 3K1EA 1LINA 2FJYA 5D3OA 2KBIA 5AEQA 3N7HA 1WLZA 2L2CA 3OHMB 1L7ZA 5AANA 4OZDA 1RFJA 3TDZA 2KQ6A 3KF9A 3BUNB 1GGWA 1V1FA 1XO5A 2LNKA 1IIOA 2JWWA 1A2XA 2LANA 2BCAA 2WC5A 2GGZA 2H2KA 3GK2A 1GGZA 2KI4B 2WOSA 4M2QA 2SASA 1GJYA 3BUOB 2LMVA 1CDMA 2OPOA 3F45A 4C0LA 1A75A 5KSZA 1ORGA 3HCMA 2CNPA 4M2OA 2KI6C 3A8RA 2GV5A 3VB1A 1B1GA 1SNLA 1DJXA 1HT9A 1X02A 3KPXA 1JUOA 3OBVA 1ZACA 1GQMA 2PALA 1CFDA 2M3WA 5CSJA 1UHKA 2PSRA 3LL8B 2FJUB 1FF1A 2Y4QA 2M1KB 1EG3A 4MEWA 4JD9A 2OTGB 4OV2A 4A4BA 1A4PA 3PJIA 4ETOA 3BJHA 1TUJA 4JKTA 3UO9A 3PATA 2WCBA 3PALA 2K7DA 3NHIA 1R2UA 3I5HB 1JSAA 1PSBA 3SG2A 1KFUL 2JRFA 1UHJA 2LP2A 2TN4A 3VRPA 3I5HC 4HRHA 1YRUB 2MLEC 4R1EA 2QEOA 1WLMA 3EKJA 1LKJA 1G33A 1QIWA 1YRTB 1YVLA 2BCBA 5FI7A 2LLTA 1FBVA 2HF5A 3I5GB 3PFVA 1JBAA 1JC2A 1NIWA 3CR2A 4GFTA 1M39A 1OOHA 3RLZA 1CMGA 2LHIA 2L0PA 4I5LB 1QS7A 2E30A 1B7TZ 4HREE 3SS3A 1XFUO 3NSIA 2BKHB 3ZNIA 1K9PA 2WC8A 1OOIX 1MHOA 4YI8A 3LCPC 2WCLA 1K95A 1QTXA 3PN7B 2LC5A 4MZKA 4I5KA 2P6BB 3O6BA 2Y1NA 1NP8A 3I5IC 2H61A 4FQTA 4NDDA 5J3XA 2BNXA 1M45A 4DS7A 3SS5A 2MAZA 1TNXA 4UPGA 2F33A 3IQOA 2AAOA 3UNWA 4YRUA 4OR9B 1OE9B 3L47A 3SG7A 1SY9A 1Z2CB 3D0YB 2PMYA 4N1GA 1F4QA 1BJFA 1UHNA 1SRAA 3DYEA 1ZMZA 4MN0A 2M7NA 2H8VA 1WRZA 2L5YA 1W9ZA 2P71A 2LVIA 3OB1B 2ERBA 4YGDB 2E6WA 3BFAA 4Q04A 2MHHA 2R2IA 2CCMA 3CWGA 5D69A 4AQIA 2BAPA 2L2EA 1BOCA 1XFYO 1XFWO 2VRGA 4QJ4B 1AJ5A 1RWYA 1F55A 1TTXA 5HLOA 4FTGA 1S3PA 2IS9A 2O60A 5EL2A 3TDIA 1Z4HA 3EK8A 1G4YR 1SCMB 1L2OB 3PSRA 5ER5A 2KAYA 3CYZA 2M29A 4M2PA 1SCMC 2JPTA 1C7VA 1L2OC 1NX0A 4PALA 3GOFA 4L9MA 4NDCA 2M9GA 4DUQA 3SIBA 3TS5C 1G8IA 1OZOA 3BOWA 2JOJA 2KFHA 3EVRA 4HRGA 1KK8B 2K60A 2QEVA 1TRFA 1ZFSA 4ORAB 3WXAA 4PT1A 4CLNA 2BBNA 3LK0A 3KO0A 2KGBC 4PDZA 2K2FA 2MA2A 3B87A 3EG5B 3EK4A 2BL0B 1RJVA 1Y1UA 3WHTB 1RROA 1TCFA 1NX2A 4JWQA 4NQGA 1YUTA 3DF0B 1J7OA 1QVIY 2RGIA 1J55A 2MJWB 4DIRA 3S0FA 3CZ2A 4MZLA 4IL1A 2JT3A 1DEKA 2EGDA 1NWDA 2I7AA 3QRXA 2LVKA 4ORCB 2LCPA 3IQQA 3RM1A 1FPWA 1ODBA 1CFFA 1NSHA 3O4XA 3DY9A 2H61C 3DVKA 1Y6WA 1OMRA 1B8RA 5KU1A 3DD4A 1AJ4A 1QV1A 3I5FC 1M31A 1IQ5A 1C7WA 5DKNA 1A29A 2LLUA 2PASA 3JTDC 2JU0A 3D10A 3DVJA 1QJTA 5IBWA 2PYQA 2PVBA 2JC2A 1KWOC 3DZTA 1XFRA 3D77A 4OKHA 2QEHA 1NX1A 2KOTA 1QXPA 4GNKB 5I2OA 4GBAA 3WNXB 4N5XA 3SG5A 1K93D 4PE4A 2QPTA 1JF2A 2NCOA 4JQ0D 4N1FA 1BR4B 5ER4X 4CIDA 1DJHA 5KTYA 1VRKA 1LXFC 1EL4A 1DMOA 2AUCA 1LA0A 3CABA 4XJKA 3TZ1A 1DJIA 4XYNA 1K90D 1B4CA 1AK8A 3BUXB 3D74A 1K9KA 1J7PA 1YVHA 1C3ZA 3KEVA 1MF8B 3S0DA 1PRWA 1R6PA 2KBMA 2ZFDA 1CLBA 4TNCA 2CBLA 2LP3A 5CPVA 1CDLA 4I5NB 1FI6A 2KLEA 3O4YA 5AFPA 1DF0B 3CR4X 1AVSA 2Q91A 2JULA 2JZIA 4C0JA 2K0JA 1U5IA 2KFGA 2WCJA 4INXA 4PHKA 4QJ3B 5CSFA 5HLVA 2NCPA 1CLLA 1Y1AA
chains in the Genus database with same CATH topology
1QX2A 2LMUA 4ZCVA 4WRIA 1F54A 4MZJA 4JPZB 1NCXA 3NXAA 3WHUB 2ZRSA 5GQQC 1BF5A 1F4OA 1RTP1 1K9UA 1JFKA 1PVAA 1JF0A 4DRWA 1B8CA 2B1UA 2L4IA 1K8UA 1ZUZA 1S36A 3I5IB 2Q4UA 1IGVA 1S6IA 1XFXO 1RK9A 1N0YA 1SCVA 1CB1A 4NDBA 4YGAA 1IKUA 3JVTB 1KQVA 2OS8B 3ICBA 1C07A 5I2LA 1A75B 3JVTC 2OS8C 1EG4A 2JNXA 2LUXA 1J1DA 4ORBB 1F70A 2O5GA 1DGUA 3BXKA 2I2RE 3CS1A 4PE7A 3O78A 5F6TA 2ISDA 2Y5IA 1WRKA 1PSRA 1B7TY 4U8DA 4YGBB 2WNDA 3VRRA 2LLSA 1NYAA 2CT9A 3O2PA 3GK1A 1KFXS 2JNFA 2PRUA 2K2AA 2K7BA 2WORA 3SIAA 1WDCB 3AKAA 1KFUS 5DKQA 4ICBA 1Y1XA 1SPYA 1WDCC 2K8MB 2KNEA 3VRNA 2KDHA 1MQ1A 4A4CA 1LA3A 1SYMA 2WCEA 1DGVA 3OX5A 1PULA 1CM1A 1DT7B 3TS5B 2BCXA 2WCFA 3VGOA 2KAVA 4I5JA 1IQ3A 2BBMA 2JTTA 4PHJA 5PALA 2AMIA 2BKIB 1TIZA 2I18A 2FCEA 3LLEA 5G08A 5HKWA 3HX4A 1ZOTB 3IF7A 1TNWA 3MSEB 4P5OE 3GK4X 3E3RA 1QATA 1S5GZ 1UP5A 3CTNA 1RECA 1S26D 3FWCA 1OOJA 1M63B 5DKRA 1NUBA 4PHMA 2M8UA 1CDNA 5BPJA 4OVNF 2BECA 3AKBA 3SG6A 1CDPA 3TDUA 1FI5A 4AQJA 1QX7A 3SJSA 2L98A 1CNPA 2FCDA 1DJYA 3NSOA 5CSNA 2K61A 1IJ5A 2L50A 1J7QA 1WY9A 1QASA 1QLKA 3CGAA 4GGNA 4BY4A 1SKTA 2JTZA 4YGCB 2JXCA 2LV7A 4OCIA 5HKYA 1W7JB 2M49B 1QV0A 3I5FB 1MWNA 1YR5A 3LK1A 2G9BA 2F2OA 3OB2B 3JTDB 3H4SE 1IWQA 4AOMA 1N65A 4GGFA 1KK7Z 1KWOB 2BE6A 1S5GY 2F3YA 5JJGA 1D1OA 2A4JA 1EXRA 2K7OA 1OZSA 2ZN9A 3EVUA 2HPSA 4P2YB 1UHIA 2COLB 1CTRA 2KSPA 1WRLA 1UHHA 1LVCD 5B8IB 1IJ6A 1V1GA 4MLWA 2QACA 4C0KA 2HETA 2HQWA 1TOPA 4GUKA 1OMVA 4YGEB 1MXLC 3ZWHA 3BOWB 1OMDA 2M1UA 4CPVA 1DJWA 2L4HA 3AAJA 1YTZC 5CSIA 1KK7Y 2MBXA 4YI9A 2KI4C 4PE1A 4PHNA 1B47A 1BR1B 3NSLA 1JFJA 1FW4A 2KYCA 3D0YA 4MSPA 3VRQA 1KQMB 2EHBA 2FOTA 1TNQA 1DVIA 1KQMC 1KSOA 1Y0VH 2LMTA 3KHEA 3CR5X 4PE0A 1KCYA 1CFPA 1F8HA 1SMGA 1UURA 1B9AA 2G2BA 2CTNA 3PM8A 4GAOA 4ZCUA 2ZNDA 1XYDA 4YBHB 3AAKA 4WQ2A 1YUUA 3VROA 1XA5A 1YX7A 1XK4A 1BODA 2KGRA 2HQ8A 1KSMA 1MR8A 1MXEA 1SBJA 2OTGC 2LE9B 1KFXL 5JOLA 5HKZA 4MBEA 2LHLA 1K96A 1MUXA 2NLNA 1IH0A 3SG3A 1F71A 3DVMA 5D7FA 3CZTX 3OP0A 1OSAA 1J7RA 1H4BA 2ZN8A 1YX8A 3FWBA 1AP4A 4GGFC 3C1VA 5K89A 1CFCA 1SL9A 1DJGA 1TCOB 2BE4A 3I5GC 5HYDA 1B8LA 1A03A 1YURA 2LVVA 3BUMB 4MRXA 3NSKA 1NCYA 2KQYA 1EH2A 2M97A 1NCZA 3M0WA 2Y1MA 3DF0A 2KHNA 1K94A 1SR6B 2LVJA 3A4UB 3CLNA 5AERA 1K2HA 1PVBA 1M46A 1AUIB 2JQ6A 2LM5A 1SR6C 2NXQA 2ZNEA 1S6CA 5TNCA 4MRYA 1N2DA 2SCPA 4XJKB 3PN7C 1TN4A 1Q80A 4WQ3A 3BUWB 1CKKA 3EVVA 2L51A 2K7CA 1H8BA 3BQ3A 1NX3A 1SL7A 3DVEA 2F2PA 1UUSA 2F3ZA 3EK7A 4CFQA 4FQOA 4E68A 1BLQA 2D8NA 5I8NA 1SL8A 4F0ZB 1IRJA 1QIVA 2DOQA 1BG1A 4QJ5B 1ALWA 1W7IB 4PCWA 2KAXA 1JWDA 1QX5B 3EKHA 1U5IB 4DCKA 2KFFA 3OX6A 1BU3A 1PK0D 1UWOA 2MRDA 3TUYB 5I2QA 1QVIZ 3PLFB 1XK4C 2JT8A 2ZRTA 1J1EA 3TUYC 2MLFC 2EC6B 1DJZA 1E8AA 1SW8A 4CFRA 1S6JA 1CM4A 2EC6C 4GPLB 1CLMA 2V53A 2ZKMX 3FS7A 4USLA 4BY5A 2F8PA 1TNPA 1BMOA 1BT6A 1NPQA 1XFZO 2CXJA 1IG5A 5AXIA 1SK6D 1EJ3A 1YUSA 1DTLA 3K21A 1S1EA 2KYFA 2L5XB 3FIAA 5FYXA 3SG4A 2JT0A 1ALVA 1HQVA 1XVJA 2JXLA 1KK8C 1OQPA 1PALA 2NZ0A 2M7LA 4D1EA 1QLSA 2GGMA 3BYAA 4HSZA 4MVFA 1XFVO 2KI6D 1DF0A 2LUCA 1CMFA 2BL0C 2M0RA 1AHRA 2LAPA 2I94A 1LINA 2KBIA 5AEQA 1WLZA 3OHMB 1L7ZA 5AANA 1RFJA 3TDZA 2KQ6A 3KF9A 3BUNB 1GGWA 1V1FA 1XO5A 2LNKA 2JWWA 1A2XA 2LANA 2BCAA 2GGZA 2H2KA 3GK2A 1GGZA 2KI4B 2WOSA 4M2QA 2SASA 1GJYA 3BUOB 2LMVA 1CDMA 2OPOA 3F45A 4C0LA 1A75A 5KSZA 3HCMA 2CNPA 4M2OA 2KI6C 3A8RA 2GV5A 1B1GA 1SNLA 1DJXA 1HT9A 1X02A 3KPXA 1JUOA 1ZACA 1GQMA 2PALA 1CFDA 2M3WA 5CSJA 1UHKA 2PSRA 3LL8B 2FJUB 1FF1A 2Y4QA 2M1KB 1EG3A 4MEWA 2OTGB 4OV2A 4A4BA 1A4PA 4ETOA 3PATA 2WCBA 3PALA 2K7DA 1R2UA 3I5HB 1JSAA 1PSBA 3SG2A 1KFUL 2JRFA 1UHJA 2LP2A 2TN4A 3VRPA 3I5HC 4HRHA 1YRUB 2MLEC 4R1EA 1WLMA 3EKJA 1LKJA 1G33A 1QIWA 1YRTB 1YVLA 2BCBA 2LLTA 1FBVA 2HF5A 3I5GB 3PFVA 1JBAA 1JC2A 1NIWA 3CR2A 4GFTA 1M39A 3RLZA 1CMGA 2LHIA 2L0PA 4I5LB 1QS7A 2E30A 1B7TZ 4HREE 1XFUO 3NSIA 2BKHB 3ZNIA 1K9PA 2WC8A 1MHOA 4YI8A 3LCPC 1K95A 1QTXA 3PN7B 2LC5A 4MZKA 4I5KA 2P6BB 3O6BA 2Y1NA 1NP8A 3I5IC 2H61A 4NDDA 5J3XA 4DS7A 1M45A 2MAZA 1TNXA 4UPGA 2F33A 3IQOA 2AAOA 4YRUA 4OR9B 1OE9B 3SG7A 1SY9A 3D0YB 2PMYA 4N1GA 1F4QA 1BJFA 1UHNA 1SRAA 4MN0A 1ZMZA 2M7NA 1WRZA 3OB1B 4YGDB 2LVIA 2E6WA 4Q04A 2MHHA 2R2IA 2CCMA 3CWGA 5D69A 4AQIA 2L2EA 1BOCA 1XFYO 1XFWO 2VRGA 4QJ4B 1AJ5A 1RWYA 1F55A 1TTXA 5HLOA 4FTGA 1S3PA 2IS9A 2O60A 3TDIA 3EK8A 1G4YR 1SCMB 1L2OB 3PSRA 5ER5A 2KAYA 2M29A 4M2PA 1SCMC 2JPTA 1C7VA 1L2OC 1NX0A 4PALA 3GOFA 4L9MA 4NDCA 2M9GA 4DUQA 3SIBA 3TS5C 1G8IA 1OZOA 3BOWA 2JOJA 2KFHA 3EVRA 4HRGA 1KK8B 1TRFA 1ZFSA 4ORAB 3WXAA 4CLNA 2BBNA 3LK0A 3KO0A 2KGBC 4PDZA 2K2FA 2MA2A 3EK4A 2BL0B 1RJVA 1Y1UA 3WHTB 1RROA 1TCFA 1NX2A 4JWQA 4NQGA 1YUTA 3DF0B 1J7OA 1QVIY 2RGIA 1J55A 2MJWB 4DIRA 4MZLA 4IL1A 2JT3A 2EGDA 1NWDA 2I7AA 3QRXA 2LVKA 4ORCB 2LCPA 3IQQA 3RM1A 1FPWA 1ODBA 1CFFA 1NSHA 2H61C 3DVKA 1Y6WA 1OMRA 1B8RA 5KU1A 3DD4A 1AJ4A 1QV1A 3I5FC 1M31A 1IQ5A 1C7WA 5DKNA 1A29A 2LLUA 2PASA 3JTDC 2JU0A 3D10A 3DVJA 1QJTA 5IBWA 2PVBA 2JC2A 1KWOC 4OKHA 1NX1A 2KOTA 1QXPA 4GNKB 5I2OA 4GBAA 3WNXB 4N5XA 3SG5A 1K93D 4PE4A 2QPTA 1JF2A 2NCOA 4JQ0D 4N1FA 1BR4B 5ER4X 4CIDA 1DJHA 5KTYA 1VRKA 1LXFC 1EL4A 1DMOA 2AUCA 1LA0A 4XJKA 3TZ1A 1DJIA 4XYNA 1K90D 1B4CA 1AK8A 3BUXB 1J7PA 1K9KA 1YVHA 3KEVA 1MF8B 1PRWA 1R6PA 2KBMA 2ZFDA 1CLBA 4TNCA 2CBLA 2LP3A 5CPVA 1CDLA 4I5NB 1FI6A 3O4YA 5AFPA 1DF0B 3CR4X 1AVSA 2Q91A 2JULA 2JZIA 4C0JA 2K0JA 1U5IA 2KFGA 4PHKA 5CSFA 4QJ3B 5HLVA 2NCPA 1CLLA 1Y1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX2 A;  2LMU A;  4ZCV A;  4WRI A;  1F54 A;  4MZJ A;  4JPZ B;  1NCX A;  3NXA A;  3WHU B;  2ZRS A;  5GQQ C;  1BF5 A;  1F4O A;  1RTP 1;  1K9U A;  1JFK A;  1PVA A;  1JF0 A;  4DRW A;  1B8C A;  2B1U A;  2L4I A;  1K8U A;  1ZUZ A;  1S36 A;  3I5I B;  2Q4U A;  1IGV A;  1S6I A;  1XFX O;  1RK9 A;  1N0Y A;  1SCV A;  1CB1 A;  4NDB A;  4YGA A;  1IKU A;  3JVT B;  1KQV A;  2OS8 B;  3ICB A;  1C07 A;  5I2L A;  1A75 B;  3JVT C;  2OS8 C;  1EG4 A;  2JNX A;  2LUX A;  1J1D A;  4ORB B;  1F70 A;  2O5G A;  1DGU A;  3BXK A;  2I2R E;  3CS1 A;  4PE7 A;  3O78 A;  5F6T A;  2ISD A;  2Y5I A;  1WRK A;  1PSR A;  1B7T Y;  4U8D A;  4YGB B;  2WND A;  3VRR A;  2LLS A;  1NYA A;  2CT9 A;  3O2P A;  3GK1 A;  1KFX S;  2JNF A;  2PRU A;  2K2A A;  2K7B A;  2WOR A;  3SIA A;  1WDC B;  3AKA A;  1KFU S;  5DKQ A;  4ICB A;  1Y1X A;  1SPY A;  1WDC C;  2K8M B;  2KNE A;  3VRN A;  2KDH A;  1MQ1 A;  4A4C A;  1LA3 A;  1SYM A;  2WCE A;  1DGV A;  3OX5 A;  1PUL A;  1CM1 A;  1DT7 B;  3TS5 B;  2BCX A;  2WCF A;  3VGO A;  2KAV A;  4I5J A;  1IQ3 A;  2BBM A;  2JTT A;  4PHJ A;  5PAL A;  2AMI A;  2BKI B;  1TIZ A;  2I18 A;  2FCE A;  3LLE A;  5G08 A;  5HKW A;  3HX4 A;  1ZOT B;  3IF7 A;  1TNW A;  3MSE B;  4P5O E;  3GK4 X;  3E3R A;  1QAT A;  1S5G Z;  1UP5 A;  3CTN A;  1REC A;  1S26 D;  3FWC A;  1OOJ A;  1M63 B;  5DKR A;  1NUB A;  4PHM A;  2M8U A;  1CDN A;  5BPJ A;  4OVN F;  2BEC A;  3AKB A;  3SG6 A;  1CDP A;  3TDU A;  1FI5 A;  4AQJ A;  1QX7 A;  3SJS A;  2L98 A;  1CNP A;  2FCD A;  1DJY A;  3NSO A;  5CSN A;  2K61 A;  1IJ5 A;  2L50 A;  1J7Q A;  1WY9 A;  1QAS A;  1QLK A;  3CGA A;  4GGN A;  4BY4 A;  1SKT A;  2JTZ A;  4YGC B;  2JXC A;  2LV7 A;  4OCI A;  5HKY A;  1W7J B;  2M49 B;  1QV0 A;  3I5F B;  1MWN A;  1YR5 A;  3LK1 A;  2G9B A;  2F2O A;  3OB2 B;  3JTD B;  3H4S E;  1IWQ A;  4AOM A;  1N65 A;  4GGF A;  1KK7 Z;  1KWO B;  2BE6 A;  1S5G Y;  2F3Y A;  5JJG A;  1D1O A;  2A4J A;  1EXR A;  2K7O A;  1OZS A;  2ZN9 A;  3EVU A;  2HPS A;  4P2Y B;  1UHI A;  2COL B;  1CTR A;  2KSP A;  1WRL A;  1UHH A;  1LVC D;  5B8I B;  1IJ6 A;  1V1G A;  4MLW A;  2QAC A;  4C0K A;  2HET A;  2HQW A;  1TOP A;  4GUK A;  1OMV A;  4YGE B;  1MXL C;  3ZWH A;  3BOW B;  1OMD A;  2M1U A;  4CPV A;  1DJW A;  2L4H A;  3AAJ A;  1YTZ C;  5CSI A;  1KK7 Y;  2MBX A;  4YI9 A;  2KI4 C;  4PE1 A;  4PHN A;  1B47 A;  1BR1 B;  3NSL A;  1JFJ A;  1FW4 A;  2KYC A;  3D0Y A;  4MSP A;  3VRQ A;  1KQM B;  2EHB A;  2FOT A;  1TNQ A;  1DVI A;  1KQM C;  1KSO A;  1Y0V H;  2LMT A;  3KHE A;  3CR5 X;  4PE0 A;  1KCY A;  1CFP A;  1F8H A;  1SMG A;  1UUR A;  1B9A A;  2G2B A;  2CTN A;  3PM8 A;  4GAO A;  4ZCU A;  2ZND A;  1XYD A;  4YBH B;  3AAK A;  4WQ2 A;  1YUU A;  3VRO A;  1XA5 A;  1YX7 A;  1XK4 A;  1BOD A;  2KGR A;  2HQ8 A;  1KSM A;  1MR8 A;  1MXE A;  1SBJ A;  2OTG C;  2LE9 B;  1KFX L;  5JOL A;  5HKZ A;  4MBE A;  2LHL A;  1K96 A;  1MUX A;  2NLN A;  1IH0 A;  3SG3 A;  1F71 A;  3DVM A;  5D7F A;  3CZT X;  3OP0 A;  1OSA A;  1J7R A;  1H4B A;  2ZN8 A;  1YX8 A;  3FWB A;  1AP4 A;  4GGF C;  3C1V A;  5K89 A;  1CFC A;  1SL9 A;  1DJG A;  1TCO B;  2BE4 A;  3I5G C;  5HYD A;  1B8L A;  1A03 A;  1YUR A;  2LVV A;  3BUM B;  4MRX A;  3NSK A;  1NCY A;  2KQY A;  1EH2 A;  2M97 A;  1NCZ A;  3M0W A;  2Y1M A;  3DF0 A;  2KHN A;  1K94 A;  1SR6 B;  2LVJ A;  3A4U B;  3CLN A;  5AER A;  1K2H A;  1PVB A;  1M46 A;  1AUI B;  2JQ6 A;  2LM5 A;  1SR6 C;  2NXQ A;  2ZNE A;  1S6C A;  5TNC A;  4MRY A;  1N2D A;  2SCP A;  4XJK B;  3PN7 C;  1TN4 A;  1Q80 A;  4WQ3 A;  3BUW B;  1CKK A;  3EVV A;  2L51 A;  2K7C A;  1H8B A;  3BQ3 A;  1NX3 A;  1SL7 A;  3DVE A;  2F2P A;  1UUS A;  2F3Z A;  3EK7 A;  4CFQ A;  4FQO A;  4E68 A;  1BLQ A;  2D8N A;  5I8N A;  1SL8 A;  4F0Z B;  1IRJ A;  1QIV A;  2DOQ A;  1BG1 A;  4QJ5 B;  1ALW A;  1W7I B;  4PCW A;  2KAX A;  1JWD A;  1QX5 B;  3EKH A;  1U5I B;  4DCK A;  2KFF A;  3OX6 A;  1BU3 A;  1PK0 D;  1UWO A;  2MRD A;  3TUY B;  5I2Q A;  1QVI Z;  3PLF B;  1XK4 C;  2JT8 A;  2ZRT A;  1J1E A;  3TUY C;  2MLF C;  2EC6 B;  1DJZ A;  1E8A A;  1SW8 A;  4CFR A;  1S6J A;  1CM4 A;  2EC6 C;  4GPL B;  1CLM A;  2V53 A;  2ZKM X;  3FS7 A;  4USL A;  4BY5 A;  2F8P A;  1TNP A;  1BMO A;  1BT6 A;  1NPQ A;  1XFZ O;  2CXJ A;  1IG5 A;  5AXI A;  1SK6 D;  1EJ3 A;  1YUS A;  1DTL A;  3K21 A;  1S1E A;  2KYF A;  2L5X B;  3FIA A;  5FYX A;  3SG4 A;  2JT0 A;  1ALV A;  1HQV A;  1XVJ A;  2JXL A;  1KK8 C;  1OQP A;  1PAL A;  2NZ0 A;  2M7L A;  4D1E A;  1QLS A;  2GGM A;  3BYA A;  4HSZ A;  4MVF A;  1XFV O;  2KI6 D;  1DF0 A;  2LUC A;  1CMF A;  2BL0 C;  2M0R A;  1AHR A;  2LAP A;  2I94 A;  1LIN A;  2KBI A;  5AEQ A;  1WLZ A;  3OHM B;  1L7Z A;  5AAN A;  1RFJ A;  3TDZ A;  2KQ6 A;  3KF9 A;  3BUN B;  1GGW A;  1V1F A;  1XO5 A;  2LNK A;  2JWW A;  1A2X A;  2LAN A;  2BCA A;  2GGZ A;  2H2K A;  3GK2 A;  1GGZ A;  2KI4 B;  2WOS A;  4M2Q A;  2SAS A;  1GJY A;  3BUO B;  2LMV A;  1CDM A;  2OPO A;  3F45 A;  4C0L A;  1A75 A;  5KSZ A;  3HCM A;  2CNP A;  4M2O A;  2KI6 C;  3A8R A;  2GV5 A;  1B1G A;  1SNL A;  1DJX A;  1HT9 A;  1X02 A;  3KPX A;  1JUO A;  1ZAC A;  1GQM A;  2PAL A;  1CFD A;  2M3W A;  5CSJ A;  1UHK A;  2PSR A;  3LL8 B;  2FJU B;  1FF1 A;  2Y4Q A;  2M1K B;  1EG3 A;  4MEW A;  2OTG B;  4OV2 A;  4A4B A;  1A4P A;  4ETO A;  3PAT A;  2WCB A;  3PAL A;  2K7D A;  1R2U A;  3I5H B;  1JSA A;  1PSB A;  3SG2 A;  1KFU L;  2JRF A;  1UHJ A;  2LP2 A;  2TN4 A;  3VRP A;  3I5H C;  4HRH A;  1YRU B;  2MLE C;  4R1E A;  1WLM A;  3EKJ A;  1LKJ A;  1G33 A;  1QIW A;  1YRT B;  1YVL A;  2BCB A;  2LLT A;  1FBV A;  2HF5 A;  3I5G B;  3PFV A;  1JBA A;  1JC2 A;  1NIW A;  3CR2 A;  4GFT A;  1M39 A;  3RLZ A;  1CMG A;  2LHI A;  2L0P A;  4I5L B;  1QS7 A;  2E30 A;  1B7T Z;  4HRE E;  1XFU O;  3NSI A;  2BKH B;  3ZNI A;  1K9P A;  2WC8 A;  1MHO A;  4YI8 A;  3LCP C;  1K95 A;  1QTX A;  3PN7 B;  2LC5 A;  4MZK A;  4I5K A;  2P6B B;  3O6B A;  2Y1N A;  1NP8 A;  3I5I C;  2H61 A;  4NDD A;  5J3X A;  4DS7 A;  1M45 A;  2MAZ A;  1TNX A;  4UPG A;  2F33 A;  3IQO A;  2AAO A;  4YRU A;  4OR9 B;  1OE9 B;  3SG7 A;  1SY9 A;  3D0Y B;  2PMY A;  4N1G A;  1F4Q A;  1BJF A;  1UHN A;  1SRA A;  4MN0 A;  1ZMZ A;  2M7N A;  1WRZ A;  3OB1 B;  4YGD B;  2LVI A;  2E6W A;  4Q04 A;  2MHH A;  2R2I A;  2CCM A;  3CWG A;  5D69 A;  4AQI A;  2L2E A;  1BOC A;  1XFY O;  1XFW O;  2VRG A;  4QJ4 B;  1AJ5 A;  1RWY A;  1F55 A;  1TTX A;  5HLO A;  4FTG A;  1S3P A;  2IS9 A;  2O60 A;  3TDI A;  3EK8 A;  1G4Y R;  1SCM B;  1L2O B;  3PSR A;  5ER5 A;  2KAY A;  2M29 A;  4M2P A;  1SCM C;  2JPT A;  1C7V A;  1L2O C;  1NX0 A;  4PAL A;  3GOF A;  4L9M A;  4NDC A;  2M9G A;  4DUQ A;  3SIB A;  3TS5 C;  1G8I A;  1OZO A;  3BOW A;  2JOJ A;  2KFH A;  3EVR A;  4HRG A;  1KK8 B;  1TRF A;  1ZFS A;  4ORA B;  3WXA A;  4CLN A;  2BBN A;  3LK0 A;  3KO0 A;  2KGB C;  4PDZ A;  2K2F A;  2MA2 A;  3EK4 A;  2BL0 B;  1RJV A;  1Y1U A;  3WHT B;  1RRO A;  1TCF A;  1NX2 A;  4JWQ A;  4NQG A;  1YUT A;  3DF0 B;  1J7O A;  1QVI Y;  2RGI A;  1J55 A;  2MJW B;  4DIR A;  4MZL A;  4IL1 A;  2JT3 A;  2EGD A;  1NWD A;  2I7A A;  3QRX A;  2LVK A;  4ORC B;  2LCP A;  3IQQ A;  3RM1 A;  1FPW A;  1ODB A;  1CFF A;  1NSH A;  2H61 C;  3DVK A;  1Y6W A;  1OMR A;  1B8R A;  5KU1 A;  3DD4 A;  1AJ4 A;  1QV1 A;  3I5F C;  1M31 A;  1IQ5 A;  1C7W A;  5DKN A;  1A29 A;  2LLU A;  2PAS A;  3JTD C;  2JU0 A;  3D10 A;  3DVJ A;  1QJT A;  5IBW A;  2PVB A;  2JC2 A;  1KWO C;  4OKH A;  1NX1 A;  2KOT A;  1QXP A;  4GNK B;  5I2O A;  4GBA A;  3WNX B;  4N5X A;  3SG5 A;  1K93 D;  4PE4 A;  2QPT A;  1JF2 A;  2NCO A;  4JQ0 D;  4N1F A;  1BR4 B;  5ER4 X;  4CID A;  1DJH A;  5KTY A;  1VRK A;  1LXF C;  1EL4 A;  1DMO A;  2AUC A;  1LA0 A;  4XJK A;  3TZ1 A;  1DJI A;  4XYN A;  1K90 D;  1B4C A;  1AK8 A;  3BUX B;  1J7P A;  1K9K A;  1YVH A;  3KEV A;  1MF8 B;  1PRW A;  1R6P A;  2KBM A;  2ZFD A;  1CLB A;  4TNC A;  2CBL A;  2LP3 A;  5CPV A;  1CDL A;  4I5N B;  1FI6 A;  3O4Y A;  5AFP A;  1DF0 B;  3CR4 X;  1AVS A;  2Q91 A;  2JUL A;  2JZI A;  4C0J A;  2K0J A;  1U5I A;  2KFG A;  4PHK A;  5CSF A;  4QJ3 B;  5HLV A;  2NCP A;  1CLL A;  1Y1A A; 
#chains in the Genus database with same CATH topology
 1QX2 A;  2LMU A;  4ZCV A;  4WRI A;  1F54 A;  4MZJ A;  4JPZ B;  1NCX A;  3NXA A;  3WHU B;  2ZRS A;  5GQQ C;  1BF5 A;  1F4O A;  1RTP 1;  1K9U A;  1JFK A;  1OOG A;  1PVA A;  1JF0 A;  3QME A;  1B8C A;  4DRW A;  2B1U A;  2L4I A;  1K8U A;  1TUZ A;  1S36 A;  1ZUZ A;  3I5I B;  2Q4U A;  1IGV A;  5DIC A;  1S6I A;  1XFX O;  1RK9 A;  1N0Y A;  1SCV A;  3FE6 A;  4NDB A;  1CB1 A;  2KLD A;  4YGA A;  1IKU A;  3JVT B;  1KQV A;  2OS8 B;  3ICB A;  1C07 A;  5I2L A;  1A75 B;  3JVT C;  2OS8 C;  3B6X A;  1EG4 A;  2JNX A;  2LUX A;  1J1D A;  4ORB B;  1F70 A;  2O5G A;  3B86 A;  1OOF A;  1DGU A;  3BXK A;  2I2R E;  3CS1 A;  4PE7 A;  3O78 A;  5F6T A;  2ISD A;  2Y5I A;  1WRK A;  1PSR A;  1B7T Y;  4U8D A;  4YGB B;  2WND A;  3VRR A;  2LLS A;  1NYA A;  2CT9 A;  3O2P A;  3GK1 A;  1KFX S;  2JNF A;  2PRU A;  2K2A A;  2K7B A;  2WOR A;  3FE8 A;  3SIA A;  2KPH A;  1DC1 A;  1WDC B;  1LS8 A;  3AKA A;  3BFB A;  4IJ7 A;  1KFU S;  5DKQ A;  4ICB A;  1Y1X A;  1SPY A;  4F7F A;  1WDC C;  2K8M B;  2KNE A;  3Q8I A;  3VRN A;  2KDH A;  1MQ1 A;  4A4C A;  1LA3 A;  1SYM A;  2WCE A;  1DGV A;  3OX5 A;  1PUL A;  1CM1 A;  1DT7 B;  3TS5 B;  2BCX A;  2WCF A;  3VGO A;  2KAV A;  4I5J A;  1IQ3 A;  3R1O A;  2BBM A;  2JTT A;  3D75 A;  4PHJ A;  5PAL A;  2AMI A;  2BKI B;  1TIZ A;  2I18 A;  2FCE A;  3LLE A;  5G08 A;  5HKW A;  3HX4 A;  1ZOT B;  3IF7 A;  1TNW A;  3MSE B;  2WCK A;  4P5O E;  3GK4 X;  3E3R A;  1QAT A;  1S5G Z;  1C3Y A;  1UP5 A;  3CTN A;  1DEL A;  1REC A;  1S26 D;  1SSE B;  3FWC A;  3R1P A;  1OOJ A;  1M63 B;  2QEB A;  5DKR A;  1NUB A;  4PHM A;  2M8U A;  1CDN A;  1T14 A;  1OW4 A;  5BPJ A;  4OVN F;  2BEC A;  3AKB A;  3SG6 A;  1CDP A;  3TDU A;  1FI5 A;  4AQJ A;  1QX7 A;  3SJS A;  2L98 A;  1CNP A;  2FCD A;  1DJY A;  3NSO A;  5CSN A;  2K61 A;  1IJ5 A;  2L50 A;  3L4L A;  1WY9 A;  1J7Q A;  1QAS A;  1QLK A;  3CGA A;  4GGN A;  4BY4 A;  1SKT A;  2JTZ A;  4YGC B;  2JXC A;  2LV7 A;  4OCI A;  2WCM A;  5HKY A;  1W7J B;  2M49 B;  1QV0 A;  3B88 A;  3I5F B;  1MWN A;  1YR5 A;  3LK1 A;  2G9B A;  2F2O A;  3DXL A;  3OB2 B;  3JTD B;  3H4S E;  1IWQ A;  4AOM A;  1N65 A;  4GGF A;  1KK7 Z;  1KWO B;  2BE6 A;  1S5G Y;  2F3Y A;  5JJG A;  1D1O A;  2P70 A;  2PQL A;  2A4J A;  1EXR A;  2K7O A;  1OZS A;  2ZN9 A;  3EVU A;  2HPS A;  4P2Y B;  1UHI A;  2COL B;  1CTR A;  2KSP A;  1WRL A;  1UHH A;  1LVC D;  5B8I B;  1IJ6 A;  1V1G A;  4MLW A;  2QAC A;  4C0K A;  3D73 A;  2HET A;  2HQW A;  1TOP A;  4GUK A;  3SS4 A;  1OMV A;  4YGE B;  1MXL C;  3ZWH A;  3BFH A;  3BOW B;  1OMD A;  2M1U A;  4CPV A;  1DJW A;  2L4H A;  3AAJ A;  1YTZ C;  5CSI A;  1KK7 Y;  2MBX A;  4YI9 A;  2KI4 C;  4PE1 A;  4PHN A;  1B47 A;  1BR1 B;  3NSL A;  1JFJ A;  1FW4 A;  2KYC A;  3D0Y A;  4MSP A;  3VRQ A;  1KQM B;  2EHB A;  3S0E A;  3L4A A;  2FOT A;  1TNQ A;  1DVI A;  1KQM C;  1KSO A;  1Y0V H;  2LMT A;  3KHE A;  2YGU A;  3CR5 X;  4PE0 A;  1KCY A;  1CFP A;  3CZ1 A;  1F8H A;  1SMG A;  1UUR A;  1B9A A;  2G2B A;  2CTN A;  3PM8 A;  4GAO A;  4ZCU A;  2ZND A;  4KYN A;  2JPO A;  1XYD A;  4YBH B;  2QDI A;  3AAK A;  1YUU A;  4WQ2 A;  3VRO A;  1XA5 A;  1YX7 A;  1XK4 A;  3B7A A;  1BOD A;  2KGR A;  2HQ8 A;  1KSM A;  1MR8 A;  1MXE A;  1SBJ A;  2OTG C;  2LE9 B;  1QWV A;  1KFX L;  5JOL A;  5HKZ A;  5I94 A;  3S0A A;  4MBE A;  2LHL A;  1K96 A;  1MUX A;  2NLN A;  5FI2 A;  1IH0 A;  3SG3 A;  1F71 A;  3DVM A;  5D7F A;  3CZT X;  1DQE A;  3OP0 A;  1OSA A;  1J7R A;  1H4B A;  2ZN8 A;  1YX8 A;  3FWB A;  1AP4 A;  4GGF C;  3C1V A;  5K89 A;  1CFC A;  1SL9 A;  1DJG A;  1TCO B;  2BE4 A;  3I5G C;  3V2L A;  5HL1 A;  5HYD A;  3RZS A;  2GTE A;  1B8L A;  1A03 A;  1YUR A;  2LVV A;  3BUM B;  4MRX A;  3NSK A;  1NCY A;  1TWO A;  2KQY A;  1EH2 A;  1GM0 A;  2M97 A;  1NCZ A;  3M0W A;  2Y1M A;  3DF0 A;  3S0B A;  2KHN A;  1K94 A;  1SR6 B;  2LVJ A;  3A4U B;  3CLN A;  5AER A;  1K2H A;  1PVB A;  3FE9 A;  1M46 A;  1AUI B;  2JQ6 A;  2LM5 A;  1SR6 C;  2NXQ A;  2ZNE A;  1S6C A;  5TNC A;  4MRY A;  1N2D A;  2SCP A;  4XJK B;  3PN7 C;  1TN4 A;  3PM2 A;  1Q80 A;  4WQ3 A;  3BUW B;  1CKK A;  3S0G A;  3EVV A;  4INW A;  2L51 A;  2K7C A;  1H8B A;  3BQ3 A;  1NX3 A;  1SL7 A;  3DVE A;  2F2P A;  1UUS A;  2F3Z A;  3EK7 A;  4CFQ A;  4FQO A;  4E68 A;  1BLQ A;  2D8N A;  3D76 A;  5I8N A;  1SL8 A;  4F0Z B;  1IRJ A;  1QIV A;  2DOQ A;  1BG1 A;  4QJ5 B;  1ALW A;  1W7I B;  4PCW A;  2KAX A;  1JWD A;  1QX5 B;  3EKH A;  2WCH A;  1U5I B;  4DCK A;  5FI6 A;  2KFF A;  3OX6 A;  1BU3 A;  1PK0 D;  1UWO A;  2MRD A;  3TUY B;  5I2Q A;  1QVI Z;  3PLF B;  1XK4 C;  2JT8 A;  2ZRT A;  1J1E A;  3TUY C;  2MLF C;  2EC6 B;  1DJZ A;  1E8A A;  1SW8 A;  3CDN A;  4CFR A;  1S6J A;  1CM4 A;  2EC6 C;  4GPL B;  1CLM A;  2V53 A;  2ZKM X;  3FS7 A;  4USL A;  4BY5 A;  2F8P A;  1TNP A;  1BMO A;  1BT6 A;  3IVT A;  1NPQ A;  1XFZ O;  2CXJ A;  1IG5 A;  5AXI A;  1P28 A;  1YUS A;  1EJ3 A;  1DTL A;  1SK6 D;  3K21 A;  1S1E A;  2KYF A;  2L5X B;  3FIA A;  5FYX A;  3SG4 A;  2JT0 A;  1ALV A;  1HQV A;  1XVJ A;  2JXL A;  2WC6 A;  1KK8 C;  1OQP A;  1PAL A;  2NZ0 A;  3NGV A;  3R72 A;  2M7L A;  1QLS A;  4D1E A;  2GGM A;  3BYA A;  3OGN A;  4HSZ A;  4MVF A;  1XFV O;  2KI6 D;  3R1V A;  1DF0 A;  2LUC A;  1CMF A;  2BL0 C;  3CZ0 A;  3D78 A;  2M0R A;  3NHT A;  1AHR A;  2LAP A;  2I94 A;  3K1E A;  1LIN A;  2FJY A;  5D3O A;  2KBI A;  5AEQ A;  3N7H A;  1WLZ A;  2L2C A;  3OHM B;  1L7Z A;  5AAN A;  4OZD A;  1RFJ A;  3TDZ A;  2KQ6 A;  3KF9 A;  3BUN B;  1GGW A;  1V1F A;  1XO5 A;  2LNK A;  1IIO A;  2JWW A;  1A2X A;  2LAN A;  2BCA A;  2WC5 A;  2GGZ A;  2H2K A;  3GK2 A;  1GGZ A;  2KI4 B;  2WOS A;  4M2Q A;  2SAS A;  1GJY A;  3BUO B;  2LMV A;  1CDM A;  2OPO A;  3F45 A;  4C0L A;  1A75 A;  5KSZ A;  1ORG A;  3HCM A;  2CNP A;  4M2O A;  2KI6 C;  3A8R A;  2GV5 A;  3VB1 A;  1B1G A;  1SNL A;  1DJX A;  1HT9 A;  1X02 A;  3KPX A;  1JUO A;  3OBV A;  1ZAC A;  1GQM A;  2PAL A;  1CFD A;  2M3W A;  5CSJ A;  1UHK A;  2PSR A;  3LL8 B;  2FJU B;  1FF1 A;  2Y4Q A;  2M1K B;  1EG3 A;  4MEW A;  4JD9 A;  2OTG B;  4OV2 A;  4A4B A;  1A4P A;  3PJI A;  4ETO A;  3BJH A;  1TUJ A;  4JKT A;  3UO9 A;  3PAT A;  2WCB A;  3PAL A;  2K7D A;  3NHI A;  1R2U A;  3I5H B;  1JSA A;  1PSB A;  3SG2 A;  1KFU L;  2JRF A;  1UHJ A;  2LP2 A;  2TN4 A;  3VRP A;  3I5H C;  4HRH A;  1YRU B;  2MLE C;  4R1E A;  2QEO A;  1WLM A;  3EKJ A;  1LKJ A;  1G33 A;  1QIW A;  1YRT B;  1YVL A;  2BCB A;  5FI7 A;  2LLT A;  1FBV A;  2HF5 A;  3I5G B;  3PFV A;  1JBA A;  1JC2 A;  1NIW A;  3CR2 A;  4GFT A;  1M39 A;  1OOH A;  3RLZ A;  1CMG A;  2LHI A;  2L0P A;  4I5L B;  1QS7 A;  2E30 A;  1B7T Z;  4HRE E;  3SS3 A;  1XFU O;  3NSI A;  2BKH B;  3ZNI A;  1K9P A;  2WC8 A;  1OOI X;  1MHO A;  4YI8 A;  3LCP C;  2WCL A;  1K95 A;  1QTX A;  3PN7 B;  2LC5 A;  4MZK A;  4I5K A;  2P6B B;  3O6B A;  2Y1N A;  1NP8 A;  3I5I C;  2H61 A;  4FQT A;  4NDD A;  5J3X A;  2BNX A;  1M45 A;  4DS7 A;  3SS5 A;  2MAZ A;  1TNX A;  4UPG A;  2F33 A;  3IQO A;  2AAO A;  3UNW A;  4YRU A;  4OR9 B;  1OE9 B;  3L47 A;  3SG7 A;  1SY9 A;  1Z2C B;  3D0Y B;  2PMY A;  4N1G A;  1F4Q A;  1BJF A;  1UHN A;  1SRA A;  3DYE A;  1ZMZ A;  4MN0 A;  2M7N A;  2H8V A;  1WRZ A;  2L5Y A;  1W9Z A;  2P71 A;  2LVI A;  3OB1 B;  2ERB A;  4YGD B;  2E6W A;  3BFA A;  4Q04 A;  2MHH A;  2R2I A;  2CCM A;  3CWG A;  5D69 A;  4AQI A;  2BAP A;  2L2E A;  1BOC A;  1XFY O;  1XFW O;  2VRG A;  4QJ4 B;  1AJ5 A;  1RWY A;  1F55 A;  1TTX A;  5HLO A;  4FTG A;  1S3P A;  2IS9 A;  2O60 A;  5EL2 A;  3TDI A;  1Z4H A;  3EK8 A;  1G4Y R;  1SCM B;  1L2O B;  3PSR A;  5ER5 A;  2KAY A;  3CYZ A;  2M29 A;  4M2P A;  1SCM C;  2JPT A;  1C7V A;  1L2O C;  1NX0 A;  4PAL A;  3GOF A;  4L9M A;  4NDC A;  2M9G A;  4DUQ A;  3SIB A;  3TS5 C;  1G8I A;  1OZO A;  3BOW A;  2JOJ A;  2KFH A;  3EVR A;  4HRG A;  1KK8 B;  2K60 A;  2QEV A;  1TRF A;  1ZFS A;  4ORA B;  3WXA A;  4PT1 A;  4CLN A;  2BBN A;  3LK0 A;  3KO0 A;  2KGB C;  4PDZ A;  2K2F A;  2MA2 A;  3B87 A;  3EG5 B;  3EK4 A;  2BL0 B;  1RJV A;  1Y1U A;  3WHT B;  1RRO A;  1TCF A;  1NX2 A;  4JWQ A;  4NQG A;  1YUT A;  3DF0 B;  1J7O A;  1QVI Y;  2RGI A;  1J55 A;  2MJW B;  4DIR A;  3S0F A;  3CZ2 A;  4MZL A;  4IL1 A;  2JT3 A;  1DEK A;  2EGD A;  1NWD A;  2I7A A;  3QRX A;  2LVK A;  4ORC B;  2LCP A;  3IQQ A;  3RM1 A;  1FPW A;  1ODB A;  1CFF A;  1NSH A;  3O4X A;  3DY9 A;  2H61 C;  3DVK A;  1Y6W A;  1OMR A;  1B8R A;  5KU1 A;  3DD4 A;  1AJ4 A;  1QV1 A;  3I5F C;  1M31 A;  1IQ5 A;  1C7W A;  5DKN A;  1A29 A;  2LLU A;  2PAS A;  3JTD C;  2JU0 A;  3D10 A;  3DVJ A;  1QJT A;  5IBW A;  2PYQ A;  2PVB A;  2JC2 A;  1KWO C;  3DZT A;  1XFR A;  3D77 A;  4OKH A;  2QEH A;  1NX1 A;  2KOT A;  1QXP A;  4GNK B;  5I2O A;  4GBA A;  3WNX B;  4N5X A;  3SG5 A;  1K93 D;  4PE4 A;  2QPT A;  1JF2 A;  2NCO A;  4JQ0 D;  4N1F A;  1BR4 B;  5ER4 X;  4CID A;  1DJH A;  5KTY A;  1VRK A;  1LXF C;  1EL4 A;  1DMO A;  2AUC A;  1LA0 A;  3CAB A;  4XJK A;  3TZ1 A;  1DJI A;  4XYN A;  1K90 D;  1B4C A;  1AK8 A;  3BUX B;  3D74 A;  1K9K A;  1J7P A;  1YVH A;  1C3Z A;  3KEV A;  1MF8 B;  3S0D A;  1PRW A;  1R6P A;  2KBM A;  2ZFD A;  1CLB A;  4TNC A;  2CBL A;  2LP3 A;  5CPV A;  1CDL A;  4I5N B;  1FI6 A;  2KLE A;  3O4Y A;  5AFP A;  1DF0 B;  3CR4 X;  1AVS A;  2Q91 A;  2JUL A;  2JZI A;  4C0J A;  2K0J A;  1U5I A;  2KFG A;  2WCJ A;  4INX A;  4PHK A;  4QJ3 B;  5CSF A;  5HLV A;  2NCP A;  1CLL A;  1Y1A A; 
#chains in the Genus database with same CATH homology
 1QX2 A;  2LMU A;  4ZCV A;  4WRI A;  1F54 A;  4MZJ A;  4JPZ B;  1NCX A;  3NXA A;  3WHU B;  2ZRS A;  5GQQ C;  1BF5 A;  1F4O A;  1RTP 1;  1K9U A;  1JFK A;  1PVA A;  1JF0 A;  4DRW A;  1B8C A;  2B1U A;  2L4I A;  1K8U A;  1ZUZ A;  1S36 A;  3I5I B;  2Q4U A;  1IGV A;  1S6I A;  1XFX O;  1RK9 A;  1N0Y A;  1SCV A;  1CB1 A;  4NDB A;  4YGA A;  1IKU A;  3JVT B;  1KQV A;  2OS8 B;  3ICB A;  1C07 A;  5I2L A;  1A75 B;  3JVT C;  2OS8 C;  1EG4 A;  2JNX A;  2LUX A;  1J1D A;  4ORB B;  1F70 A;  2O5G A;  1DGU A;  3BXK A;  2I2R E;  3CS1 A;  4PE7 A;  3O78 A;  5F6T A;  2ISD A;  2Y5I A;  1WRK A;  1PSR A;  1B7T Y;  4U8D A;  4YGB B;  2WND A;  3VRR A;  2LLS A;  1NYA A;  2CT9 A;  3O2P A;  3GK1 A;  1KFX S;  2JNF A;  2PRU A;  2K2A A;  2K7B A;  2WOR A;  3SIA A;  1WDC B;  3AKA A;  1KFU S;  5DKQ A;  4ICB A;  1Y1X A;  1SPY A;  1WDC C;  2K8M B;  2KNE A;  3VRN A;  2KDH A;  1MQ1 A;  4A4C A;  1LA3 A;  1SYM A;  2WCE A;  1DGV A;  3OX5 A;  1PUL A;  1CM1 A;  1DT7 B;  3TS5 B;  2BCX A;  2WCF A;  3VGO A;  2KAV A;  4I5J A;  1IQ3 A;  2BBM A;  2JTT A;  4PHJ A;  5PAL A;  2AMI A;  2BKI B;  1TIZ A;  2I18 A;  2FCE A;  3LLE A;  5G08 A;  5HKW A;  3HX4 A;  1ZOT B;  3IF7 A;  1TNW A;  3MSE B;  4P5O E;  3GK4 X;  3E3R A;  1QAT A;  1S5G Z;  1UP5 A;  3CTN A;  1REC A;  1S26 D;  3FWC A;  1OOJ A;  1M63 B;  5DKR A;  1NUB A;  4PHM A;  2M8U A;  1CDN A;  5BPJ A;  4OVN F;  2BEC A;  3AKB A;  3SG6 A;  1CDP A;  3TDU A;  1FI5 A;  4AQJ A;  1QX7 A;  3SJS A;  2L98 A;  1CNP A;  2FCD A;  1DJY A;  3NSO A;  5CSN A;  2K61 A;  1IJ5 A;  2L50 A;  1J7Q A;  1WY9 A;  1QAS A;  1QLK A;  3CGA A;  4GGN A;  4BY4 A;  1SKT A;  2JTZ A;  4YGC B;  2JXC A;  2LV7 A;  4OCI A;  5HKY A;  1W7J B;  2M49 B;  1QV0 A;  3I5F B;  1MWN A;  1YR5 A;  3LK1 A;  2G9B A;  2F2O A;  3OB2 B;  3JTD B;  3H4S E;  1IWQ A;  4AOM A;  1N65 A;  4GGF A;  1KK7 Z;  1KWO B;  2BE6 A;  1S5G Y;  2F3Y A;  5JJG A;  1D1O A;  2A4J A;  1EXR A;  2K7O A;  1OZS A;  2ZN9 A;  3EVU A;  2HPS A;  4P2Y B;  1UHI A;  2COL B;  1CTR A;  2KSP A;  1WRL A;  1UHH A;  1LVC D;  5B8I B;  1IJ6 A;  1V1G A;  4MLW A;  2QAC A;  4C0K A;  2HET A;  2HQW A;  1TOP A;  4GUK A;  1OMV A;  4YGE B;  1MXL C;  3ZWH A;  3BOW B;  1OMD A;  2M1U A;  4CPV A;  1DJW A;  2L4H A;  3AAJ A;  1YTZ C;  5CSI A;  1KK7 Y;  2MBX A;  4YI9 A;  2KI4 C;  4PE1 A;  4PHN A;  1B47 A;  1BR1 B;  3NSL A;  1JFJ A;  1FW4 A;  2KYC A;  3D0Y A;  4MSP A;  3VRQ A;  1KQM B;  2EHB A;  2FOT A;  1TNQ A;  1DVI A;  1KQM C;  1KSO A;  1Y0V H;  2LMT A;  3KHE A;  3CR5 X;  4PE0 A;  1KCY A;  1CFP A;  1F8H A;  1SMG A;  1UUR A;  1B9A A;  2G2B A;  2CTN A;  3PM8 A;  4GAO A;  4ZCU A;  2ZND A;  1XYD A;  4YBH B;  3AAK A;  4WQ2 A;  1YUU A;  3VRO A;  1XA5 A;  1YX7 A;  1XK4 A;  1BOD A;  2KGR A;  2HQ8 A;  1KSM A;  1MR8 A;  1MXE A;  1SBJ A;  2OTG C;  2LE9 B;  1KFX L;  5JOL A;  5HKZ A;  4MBE A;  2LHL A;  1K96 A;  1MUX A;  2NLN A;  1IH0 A;  3SG3 A;  1F71 A;  3DVM A;  5D7F A;  3CZT X;  3OP0 A;  1OSA A;  1J7R A;  1H4B A;  2ZN8 A;  1YX8 A;  3FWB A;  1AP4 A;  4GGF C;  3C1V A;  5K89 A;  1CFC A;  1SL9 A;  1DJG A;  1TCO B;  2BE4 A;  3I5G C;  5HYD A;  1B8L A;  1A03 A;  1YUR A;  2LVV A;  3BUM B;  4MRX A;  3NSK A;  1NCY A;  2KQY A;  1EH2 A;  2M97 A;  1NCZ A;  3M0W A;  2Y1M A;  3DF0 A;  2KHN A;  1K94 A;  1SR6 B;  2LVJ A;  3A4U B;  3CLN A;  5AER A;  1K2H A;  1PVB A;  1M46 A;  1AUI B;  2JQ6 A;  2LM5 A;  1SR6 C;  2NXQ A;  2ZNE A;  1S6C A;  5TNC A;  4MRY A;  1N2D A;  2SCP A;  4XJK B;  3PN7 C;  1TN4 A;  1Q80 A;  4WQ3 A;  3BUW B;  1CKK A;  3EVV A;  2L51 A;  2K7C A;  1H8B A;  3BQ3 A;  1NX3 A;  1SL7 A;  3DVE A;  2F2P A;  1UUS A;  2F3Z A;  3EK7 A;  4CFQ A;  4FQO A;  4E68 A;  1BLQ A;  2D8N A;  5I8N A;  1SL8 A;  4F0Z B;  1IRJ A;  1QIV A;  2DOQ A;  1BG1 A;  4QJ5 B;  1ALW A;  1W7I B;  4PCW A;  2KAX A;  1JWD A;  1QX5 B;  3EKH A;  1U5I B;  4DCK A;  2KFF A;  3OX6 A;  1BU3 A;  1PK0 D;  1UWO A;  2MRD A;  3TUY B;  5I2Q A;  1QVI Z;  3PLF B;  1XK4 C;  2JT8 A;  2ZRT A;  1J1E A;  3TUY C;  2MLF C;  2EC6 B;  1DJZ A;  1E8A A;  1SW8 A;  4CFR A;  1S6J A;  1CM4 A;  2EC6 C;  4GPL B;  1CLM A;  2V53 A;  2ZKM X;  3FS7 A;  4USL A;  4BY5 A;  2F8P A;  1TNP A;  1BMO A;  1BT6 A;  1NPQ A;  1XFZ O;  2CXJ A;  1IG5 A;  5AXI A;  1SK6 D;  1EJ3 A;  1YUS A;  1DTL A;  3K21 A;  1S1E A;  2KYF A;  2L5X B;  3FIA A;  5FYX A;  3SG4 A;  2JT0 A;  1ALV A;  1HQV A;  1XVJ A;  2JXL A;  1KK8 C;  1OQP A;  1PAL A;  2NZ0 A;  2M7L A;  4D1E A;  1QLS A;  2GGM A;  3BYA A;  4HSZ A;  4MVF A;  1XFV O;  2KI6 D;  1DF0 A;  2LUC A;  1CMF A;  2BL0 C;  2M0R A;  1AHR A;  2LAP A;  2I94 A;  1LIN A;  2KBI A;  5AEQ A;  1WLZ A;  3OHM B;  1L7Z A;  5AAN A;  1RFJ A;  3TDZ A;  2KQ6 A;  3KF9 A;  3BUN B;  1GGW A;  1V1F A;  1XO5 A;  2LNK A;  2JWW A;  1A2X A;  2LAN A;  2BCA A;  2GGZ A;  2H2K A;  3GK2 A;  1GGZ A;  2KI4 B;  2WOS A;  4M2Q A;  2SAS A;  1GJY A;  3BUO B;  2LMV A;  1CDM A;  2OPO A;  3F45 A;  4C0L A;  1A75 A;  5KSZ A;  3HCM A;  2CNP A;  4M2O A;  2KI6 C;  3A8R A;  2GV5 A;  1B1G A;  1SNL A;  1DJX A;  1HT9 A;  1X02 A;  3KPX A;  1JUO A;  1ZAC A;  1GQM A;  2PAL A;  1CFD A;  2M3W A;  5CSJ A;  1UHK A;  2PSR A;  3LL8 B;  2FJU B;  1FF1 A;  2Y4Q A;  2M1K B;  1EG3 A;  4MEW A;  2OTG B;  4OV2 A;  4A4B A;  1A4P A;  4ETO A;  3PAT A;  2WCB A;  3PAL A;  2K7D A;  1R2U A;  3I5H B;  1JSA A;  1PSB A;  3SG2 A;  1KFU L;  2JRF A;  1UHJ A;  2LP2 A;  2TN4 A;  3VRP A;  3I5H C;  4HRH A;  1YRU B;  2MLE C;  4R1E A;  1WLM A;  3EKJ A;  1LKJ A;  1G33 A;  1QIW A;  1YRT B;  1YVL A;  2BCB A;  2LLT A;  1FBV A;  2HF5 A;  3I5G B;  3PFV A;  1JBA A;  1JC2 A;  1NIW A;  3CR2 A;  4GFT A;  1M39 A;  3RLZ A;  1CMG A;  2LHI A;  2L0P A;  4I5L B;  1QS7 A;  2E30 A;  1B7T Z;  4HRE E;  1XFU O;  3NSI A;  2BKH B;  3ZNI A;  1K9P A;  2WC8 A;  1MHO A;  4YI8 A;  3LCP C;  1K95 A;  1QTX A;  3PN7 B;  2LC5 A;  4MZK A;  4I5K A;  2P6B B;  3O6B A;  2Y1N A;  1NP8 A;  3I5I C;  2H61 A;  4NDD A;  5J3X A;  4DS7 A;  1M45 A;  2MAZ A;  1TNX A;  4UPG A;  2F33 A;  3IQO A;  2AAO A;  4YRU A;  4OR9 B;  1OE9 B;  3SG7 A;  1SY9 A;  3D0Y B;  2PMY A;  4N1G A;  1F4Q A;  1BJF A;  1UHN A;  1SRA A;  4MN0 A;  1ZMZ A;  2M7N A;  1WRZ A;  3OB1 B;  4YGD B;  2LVI A;  2E6W A;  4Q04 A;  2MHH A;  2R2I A;  2CCM A;  3CWG A;  5D69 A;  4AQI A;  2L2E A;  1BOC A;  1XFY O;  1XFW O;  2VRG A;  4QJ4 B;  1AJ5 A;  1RWY A;  1F55 A;  1TTX A;  5HLO A;  4FTG A;  1S3P A;  2IS9 A;  2O60 A;  3TDI A;  3EK8 A;  1G4Y R;  1SCM B;  1L2O B;  3PSR A;  5ER5 A;  2KAY A;  2M29 A;  4M2P A;  1SCM C;  2JPT A;  1C7V A;  1L2O C;  1NX0 A;  4PAL A;  3GOF A;  4L9M A;  4NDC A;  2M9G A;  4DUQ A;  3SIB A;  3TS5 C;  1G8I A;  1OZO A;  3BOW A;  2JOJ A;  2KFH A;  3EVR A;  4HRG A;  1KK8 B;  1TRF A;  1ZFS A;  4ORA B;  3WXA A;  4CLN A;  2BBN A;  3LK0 A;  3KO0 A;  2KGB C;  4PDZ A;  2K2F A;  2MA2 A;  3EK4 A;  2BL0 B;  1RJV A;  1Y1U A;  3WHT B;  1RRO A;  1TCF A;  1NX2 A;  4JWQ A;  4NQG A;  1YUT A;  3DF0 B;  1J7O A;  1QVI Y;  2RGI A;  1J55 A;  2MJW B;  4DIR A;  4MZL A;  4IL1 A;  2JT3 A;  2EGD A;  1NWD A;  2I7A A;  3QRX A;  2LVK A;  4ORC B;  2LCP A;  3IQQ A;  3RM1 A;  1FPW A;  1ODB A;  1CFF A;  1NSH A;  2H61 C;  3DVK A;  1Y6W A;  1OMR A;  1B8R A;  5KU1 A;  3DD4 A;  1AJ4 A;  1QV1 A;  3I5F C;  1M31 A;  1IQ5 A;  1C7W A;  5DKN A;  1A29 A;  2LLU A;  2PAS A;  3JTD C;  2JU0 A;  3D10 A;  3DVJ A;  1QJT A;  5IBW A;  2PVB A;  2JC2 A;  1KWO C;  4OKH A;  1NX1 A;  2KOT A;  1QXP A;  4GNK B;  5I2O A;  4GBA A;  3WNX B;  4N5X A;  3SG5 A;  1K93 D;  4PE4 A;  2QPT A;  1JF2 A;  2NCO A;  4JQ0 D;  4N1F A;  1BR4 B;  5ER4 X;  4CID A;  1DJH A;  5KTY A;  1VRK A;  1LXF C;  1EL4 A;  1DMO A;  2AUC A;  1LA0 A;  4XJK A;  3TZ1 A;  1DJI A;  4XYN A;  1K90 D;  1B4C A;  1AK8 A;  3BUX B;  1J7P A;  1K9K A;  1YVH A;  3KEV A;  1MF8 B;  1PRW A;  1R6P A;  2KBM A;  2ZFD A;  1CLB A;  4TNC A;  2CBL A;  2LP3 A;  5CPV A;  1CDL A;  4I5N B;  1FI6 A;  3O4Y A;  5AFP A;  1DF0 B;  3CR4 X;  1AVS A;  2Q91 A;  2JUL A;  2JZI A;  4C0J A;  2K0J A;  1U5I A;  2KFG A;  4PHK A;  5CSF A;  4QJ3 B;  5HLV A;  2NCP A;  1CLL A;  1Y1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...