2WCMA

Structure of bmori gobp2 (general odorant binding protein 2) with (10e)-hexadecen-12-yn-1-ol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 53
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wcmA00
2QEOA 2P71A 3BFBA 1ORGA 3CYZA 2WCKA 1T14A 4F7FA 3CZ0A 3R1OA 2QEBA 2PQLA 3D75A 5EL2A 1GM0A 4INXA 3S0AA 3L47A 1OW4A 3OGNA 3CZ2A 3S0DA 1TWOA 2WCJA 3QMEA 3D73A 2WC6A 2ERBA 3S0EA 3DXLA 3K1EA 3CABA 3DYEA 3B7AA 2QDIA 1DQEA 3L4LA 3B86A 2GTEA 4OZDA 1OOHA 3R72A 2WC5A 3DZTA 3FE6A 3S0FA 1XFRA 1OOFA 3R1PA 3RZSA 3D74A 2QEVA 3CZ1A 1QWVA 3FE9A 1TUJA 3B88A 3NHTA 2JPOA 2WCLA 3N7HA 1OOIX 3DY9A 3D78A 1OOGA 2L2CA 3BFAA 2QEHA 2P70A 3L4AA 3B87A 3S0BA 1LS8A 3BJHA 3B6XA 2H8VA 2WCMA 1C3YA 2WCHA 4PT1A 3FE8A 2KPHA 4JD9A 4FQTA 3NHIA 3CDNA 3Q8IA 3D76A 1C3ZA 1P28A 3PJIA 2FJYA 3VB1A 3NGVA 3BFHA 3S0GA 3V2LA 4INWA 5DICA 3R1VA 3D77A
chains in the Genus database with same CATH superfamily
1XYDA 1RECA 4UPGA 1A75A 2K7CA 1DJXA 3EG5B 2JXCA 2L0PA 1B9AA 1W7IB 1TCOB 4ORBB 1YR5A 1S1EA 3MSEB 2M29A 1CMGA 1SPYA 2WCKA 1S3PA 1WRKA 2LM5A 4JKTA 4PHMA 3R1OA 2BCBA 2PQLA 1QX5B 2M0RA 1QIVA 4TNCA 1RK9A 3HCMA 3CTNA 1SCVA 2KOTA 1XVJA 2I7AA 3K21A 3L47A 4NDDA 3SG7A 1NX3A 1IIOA 1F4QA 2KQYA 1TWOA 2WCJA 2ISDA 4PHJA 3SG5A 2KAXA 3D73A 1R6PA 2ERBA 2LVJA 3S0EA 1K9UA 1CDNA 3K1EA 1AUIB 3CABA 3DYEA 1KWOB 2I18A 1YURA 4MN0A 2MBXA 5HL1A 4N1FA 1BMOA 1NCXA 3SIBA 2GTEA 3OHMB 5K89A 1KWOC 1TTXA 1U5IA 1JF0A 2KFHA 2WOSA 1F8HA 1YUTA 2HQWA 5G08A 3A4UB 4GUKA 1SR6B 1N0YA 3I5FB 1BU3A 2KLEA 1CLMA 4MVFA 1MHOA 3TDUA 1SMGA 1SR6C 3D0YB 3I5FC 3M0WA 2L4HA 4YGAA 1TN4A 1HT9A 2WC5A 3FE6A 2VRGA 2Y1MA 4MSPA 1CNPA 1N2DA 1GGZA 4GGFA 1NX0A 1QV0A 1NWDA 2O5GA 1LVCD 1DC1A 3QRXA 1G4YR 3WNXB 1S5GY 1XFZO 3FE9A 1NP8A 1BF5A 1ALWA 1TUJA 1CB1A 2PRUA 2BBNA 2PYQA 2WCEA 4L9MA 5IBWA 2JPOA 1DVIA 1MUXA 1SYMA 2KYFA 3PM2A 4NDCA 1H4BA 1QASA 2LVKA 4MLWA 1F70A 4U8DA 3SIAA 2WCFA 1B8CA 2LUCA 3DY9A 1DTLA 1KK7Y 1OOGA 2QACA 4PCWA 3KEVA 1Y1UA 1CKKA 1VRKA 5FI6A 3PATA 2K2FA 1IQ5A 5HLOA 1IRJA 4WRIA 3SS3A 1XK4C 1K95A 5AFPA 2L5XB 3SG4A 5AERA 2BCAA 3SG3A 3ZWHA 1SL7A 2MRDA 2GGMA 3OX6A 4MZJA 1YX8A 4GGNA 2BKHB 2ZN9A 2V53A 3SS5A 1J7QA 1LINA 1SKTA 2NZ0A 2BBMA 3EVUA 3CR2A 4ICBA 3VRPA 3LCPC 1G8IA 1KSMA 2G9BA 2M7NA 3CR4X 4C0JA 1C7WA 1TNXA 1W7JB 2KPHA 2KHNA 5DKRA 5AXIA 1M46A 3CDNA 2ZNDA 3PFVA 3Q8IA 1A29A 2R2IA 1B7TZ 2BAPA 1OMVA 2KI4B 1RFJA 2LVIA 3PALA 2OTGB 2B1UA 1P28A 2BKIB 2FCDA 2KI4C 3PJIA 4BY4A 2OTGC 2NCOA 1YRTB 2NXQA 3O78A 3VRQA 4DUQA 1NX1A 3NGVA 3BFHA 3SS4A 1BG1A 4M2OA 1MQ1A 3V2LA 1XFXO 1QLKA 1QVIY 2JRFA 5DICA 2M3WA 2K8MB 1C07A 2LCPA 3AAKA 4MZLA 2Q91A 1MWNA 1K9KA 1ZUZA 3DVEA 4IL1A 1DF0B 3FIAA 3JTDB 1NYAA 1CLBA 2M7LA 3CYZA 1TIZA 4CPVA 4NQGA 4AQIA 2JZIA 1M45A 3JTDC 1T14A 3EK4A 3WHTB 3CZ0A 4GAOA 5EL2A 2KI6C 1GM0A 2KI6D 2ZKMX 1JC2A 1F4OA 1OMRA 2H61A 2L51A 1TNQA 1ALVA 4YRUA 2F2OA 2Y5IA 4ETOA 2WORA 3DVKA 3OGNA 2BL0C 1AK8A 2JXLA 1K2HA 1C7VA 3BUWB 4YGBB 3VGOA 1K93D 2LLUA 1LA3A 2CXJA 1QJTA 2WC6A 3VROA 2MLFC 2NCPA 5JJGA 2K7OA 1EG4A 3KHEA 2AAOA 3AAJA 1PSRA 4MZKA 1BT6A 2LUXA 1DQEA 3CS1A 1TRFA 1MXLC 1PVAA 3UNWA 1KFXS 5DKQA 1LKJA 4DRWA 1PK0D 3KPXA 4CIDA 2KSPA 2JC2A 1Y6WA 1FBVA 1OOHA 1PRWA 1XFVO 3BUMB 1WLZA 3O4XA 4ZCVA 2JWWA 1TCFA 1MXEA 5I2LA 1A75B 3IVTA 1OQPA 2LLTA 2E6WA 4CLNA 1LXFC 1UHKA 1XFRA 2LP3A 3EVVA 3GK2A 2FJUB 3OB1B 4AOMA 1DJYA 1CDLA 3SG2A 2QEVA 4M2PA 1RTP1 2M49B 2PALA 3O4YA 4CFQA 1J7PA 1YUUA 2K7DA 2GGZA 2F2PA 1S36A 2K7BA 1JUOA 3FWBA 2CTNA 2L50A 3EKJA 4WQ3A 4QJ5B 1ZMZA 5KU1A 3BXKA 2LVVA 3BOWA 3LK0A 2HF5A 4MRXA 3F45A 2LANA 1FW4A 5CSNA 5DKNA 1B1GA 4NDBA 1KFUS 1AJ5A 5PALA 5ER4X 2WCLA 2BCXA 3N7HA 3OB2B 2A4JA 2KQ6A 3D78A 2CCMA 1B47A 1Y1AA 1CFCA 1NSHA 3A8RA 1CMFA 1JF2A 2LAPA 4ORCB 4XYNA 1MF8B 3VRRA 1UHNA 3I5IB 4PE0A 2BECA 2JPTA 2K60A 2P70A 1DMOA 3L4AA 2AMIA 4HRGA 2M1UA 3I5IC 3S0BA 1ZFSA 2KGRA 3GK1A 1FPWA 5FI2A 4ZCUA 1UUSA 2Q4UA 3BJHA 5I2OA 2BNXA 3LL8B 3B6XA 4E68A 3OP0A 1U5IB 2JT3A 1IH0A 2BE4A 2SASA 1EL4A 2H8VA 1XFYO 2LLSA 2WCHA 4PT1A 1DT7B 2G2BA 1ODBA 1Z2CB 1WY9A 2OPOA 4JD9A 3TDZA 3IF7A 1TNWA 5B8IB 1DGUA 1TOPA 2F33A 2JOJA 5CSFA 1UHHA 3RLZA 2LHIA 4BY5A 1L2OC 1SSEB 3EVRA 2KBIA 3CZTX 2HPSA 4JWQA 4FTGA 2LNKA 1PALA 2YGUA 5F6TA 4GGFC 2PVBA 4PHKA 2I94A 2JNXA 3BUNB 1JSAA 1EG3A 2F8PA 4I5NB 1DJZA 1S26D 4A4BA 4D1EA 3R1VA 5CPVA 4YI9A 1OSAA 5CSJA 3FWCA 5HKZA 1FF1A 1XFUO 4PHNA 4XJKA 2QEOA 2P71A 1WDCB 2ZNEA 2WC8A 3PN7C 1J7OA 4YGCB 1WDCC 4DCKA 1K94A 4HREE 1B8RA 1HQVA 1QLSA 1QXPA 1K9PA 1WRLA 2LE9B 2M1KB 4YGEB 1SNLA 4GFTA 5I2QA 1PULA 3S0AA 4Q04A 1V1FA 2OS8B 1NX2A 2HQ8A 1F54A 3DVJA 1OW4A 2O60A 3CZ2A 2OS8C 2COLB 1CFPA 2FOTA 4FQOA 1LA0A 3WXAA 3GOFA 3QMEA 4USLA 1KQVA 3CWGA 1BOCA 1J1DA 1PVBA 1AJ4A 4GPLB 3TDIA 3NXAA 3VRNA 1S6IA 4OCIA 1SL8A 2KLDA 1WRZA 4R1EA 4C0LA 3PSRA 1H8BA 4OR9B 1B4CA 1CDPA 2WNDA 2JNFA 4HRHA 2KDHA 2KYCA 1EXRA 3KO0A 1GJYA 2K61A 4IJ7A 1W9ZA 1DEKA 2BL0B 2ZN8A 3DF0A 3BUOB 1DJIA 3C1VA 3FS7A 4P2YB 3S0FA 2AUCA 2K0JA 2GV5A 3R1PA 1CFFA 3AKAA 2KFGA 3TUYB 1K8UA 2LV7A 1CLLA 1NCYA 1NUBA 2LHLA 3TUYC 5HKYA 4DS7A 1J7RA 1J55A 2MHHA 1K90D 2H2KA 3NHTA 3CLNA 1IQ3A 5JOLA 2QPTA 2H61C 2CT9A 1G33A 2PMYA 1NIWA 3LK1A 4JQ0D 1KFUL 1E8AA 2LMUA 1KCYA 3BFAA 1DJGA 1B7TY 2QEHA 4KYNA 3E3RA 2KNEA 1QX7A 1CFDA 3B87A 1Z4HA 2EC6B 1SRAA 2JQ6A 2KAYA 1GQMA 2Y4QA 5AEQA 1Y0VH 2EC6C 2I2RE 5I8NA 1SCMB 1RROA 4YBHB 3NSOA 3CGAA 3KF9A 1C3YA 1GGWA 1KK7Z 4PALA 1V1GA 1DJWA 1SCMC 4PDZA 3O2PA 2JT8A 2CBLA 2MLEC 2D8NA 4FQTA 2HETA 4N5XA 5D7FA 3TS5B 4OV2A 1J1EA 3TS5C 3D76A 4A4CA 2PASA 2CNPA 1SL9A 2LP2A 5FI7A 4DIRA 5D69A 3VB1A 5BPJA 1QS7A 1OOJA 2L5YA 2M9GA 4MEWA 4P5OE 3BYAA 1KK8B 5J3XA 1M63B 3S0GA 1A03A 2L98A 1YX7A 2MAZA 3I5GB 1UP5A 1QV1A 1KK8C 3BOWB 2SCPA 1BLQA 3D0YA 3D77A 2DOQA 2IS9A 3I5GC 1Y1XA 1CTRA 3JVTB 1A4PA 2JTZA 3IQQA 1BR4B 1RWYA 2LMTA 4ORAB 3BFBA 3JVTC 1ORGA 2BE6A 2P6BB 2MJWB 4F7FA 1L2OB 2M97A 2QEBA 3D75A 2KAVA 2L4IA 1R2UA 3WHUB 1DJHA 1QVIZ 1ZOTB 3I5HB 1YUSA 2RGIA 3NSIA 4INXA 5ER5A 1QATA 1UHIA 1AHRA 1OZSA 3I5HC 4JPZB 1YTZC 4QJ4B 1YVHA 4I5JA 5KTYA 2ZRSA 3EK8A 1K96A 3S0DA 1FI6A 5TNCA 3PM8A 1XK4A 3EKHA 4GBAA 4I5LB 3BQ3A 1M31A 3DXLA 3O6BA 4MRYA 1M39A 1JWDA 4OKHA 3ICBA 1IJ6A 1BJFA 1SK6D 2KFFA 2QDIA 3B7AA 3BUXB 3PN7B 3L4LA 3B86A 1N65A 2WCBA 4CFRA 4OZDA 4QJ3B 1DELA 1KQMB 1D1OA 4YI8A 1IG5A 1CM1A 1BR1B 1KQMC 4PE7A 2MA2A 1RJVA 1S6JA 1SBJA 3ZNIA 4C0KA 4YGDB 2ZFDA 3DZTA 3NSLA 1CM4A 3OX5A 4GNKB 4XJKB 1OOFA 1B8LA 4PE4A 3RZSA 1BODA 5KSZA 3D74A 3OBVA 3CZ1A 5HYDA 1QWVA 1F55A 1NCZA 1QTXA 5GQQC 1JFKA 1PSBA 1QIWA 3B88A 2ZRTA 1EH2A 3GK4X 3HX4A 2M8UA 2FCEA 1JBAA 2F3YA 1KSOA 1IKUA 1DGVA 1OZOA 1ZACA 1OOIX 3DVMA 4WQ2A 4PE1A 1EJ3A 1DF0A 1SY9A 2EGDA 2KBMA 4I5KA 5CSIA 5D3OA 3NSKA 5AANA 2K2AA 2JTTA 4M2QA 1A2XA 2L2CA 1IGVA 1KFXL 1TUZA 1QX2A 2TN4A 5HLVA 2JU0A 1CDMA 2E30A 1FI5A 4MBEA 4AQJA 3SG6A 1Q80A 1LS8A 5I94A 1MR8A 5FYXA 1XFWO 4N1GA 2L2EA 1IWQA 2F3ZA 1SW8A 1IJ5A 1TNPA 1NPQA 3D10A 1UHJA 2WCMA 1UWOA 1AP4A 1L7ZA 1YVLA 1OE9B 2LC5A 3FE8A 3PLFB 3LLEA 3SJSA 3NHIA 4F0ZB 1UURA 2JT0A 1JFJA 1F71A 3DF0B 3AKBA 1X02A 2EHBA 3CR5X 2JULA 3H4SE 3IQOA 1C3ZA 1XA5A 2FJYA 3DD4A 1S6CA 1WLMA 2PSRA 5HKWA 3RM1A 4OVNF 1S5GZ 2NLNA 1YRUB 1OMDA 2Y1NA 3EK7A 2KGBC 3TZ1A 4HSZA 1XO5A 4INWA 3UO9A 1AVSA 3R72A 2LMVA
chains in the Genus database with same CATH topology
2QEOA 2P71A 3BFBA 1ORGA 3CYZA 2WCKA 1T14A 4F7FA 3CZ0A 3R1OA 2QEBA 2PQLA 3D75A 5EL2A 1GM0A 4INXA 3S0AA 3L47A 1OW4A 3OGNA 3CZ2A 3S0DA 1TWOA 2WCJA 3QMEA 3D73A 2WC6A 2ERBA 3S0EA 3DXLA 3K1EA 3CABA 3DYEA 3B7AA 2QDIA 1DQEA 3L4LA 3B86A 2GTEA 4OZDA 1OOHA 3R72A 2WC5A 3DZTA 3FE6A 3S0FA 1XFRA 1OOFA 3R1PA 3RZSA 3D74A 2QEVA 3CZ1A 1QWVA 3FE9A 1TUJA 3B88A 3NHTA 2JPOA 2WCLA 3N7HA 1OOIX 3DY9A 3D78A 1OOGA 2L2CA 3BFAA 2QEHA 2P70A 3L4AA 3B87A 3S0BA 1LS8A 3BJHA 3B6XA 2H8VA 2WCMA 1C3YA 2WCHA 4PT1A 3FE8A 2KPHA 4JD9A 4FQTA 3NHIA 3CDNA 3Q8IA 3D76A 1C3ZA 1P28A 3PJIA 2FJYA 3VB1A 3NGVA 3BFHA 3S0GA 3V2LA 4INWA 5DICA 3R1VA 3D77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEO A;  2P71 A;  3BFB A;  1ORG A;  3CYZ A;  2WCK A;  1T14 A;  4F7F A;  3CZ0 A;  3R1O A;  2QEB A;  2PQL A;  3D75 A;  5EL2 A;  1GM0 A;  4INX A;  3S0A A;  3L47 A;  1OW4 A;  3OGN A;  3CZ2 A;  3S0D A;  1TWO A;  2WCJ A;  3QME A;  3D73 A;  2WC6 A;  2ERB A;  3S0E A;  3DXL A;  3K1E A;  3CAB A;  3DYE A;  3B7A A;  2QDI A;  1DQE A;  3L4L A;  3B86 A;  2GTE A;  4OZD A;  1OOH A;  3R72 A;  2WC5 A;  3DZT A;  3FE6 A;  3S0F A;  1XFR A;  1OOF A;  3R1P A;  3RZS A;  3D74 A;  2QEV A;  3CZ1 A;  1QWV A;  3FE9 A;  1TUJ A;  3B88 A;  3NHT A;  2JPO A;  2WCL A;  3N7H A;  1OOI X;  3DY9 A;  3D78 A;  1OOG A;  2L2C A;  3BFA A;  2QEH A;  2P70 A;  3L4A A;  3B87 A;  3S0B A;  1LS8 A;  3BJH A;  3B6X A;  2H8V A;  2WCM A;  1C3Y A;  2WCH A;  4PT1 A;  3FE8 A;  2KPH A;  4JD9 A;  4FQT A;  3NHI A;  3CDN A;  3Q8I A;  3D76 A;  1C3Z A;  1P28 A;  3PJI A;  2FJY A;  3VB1 A;  3NGV A;  3BFH A;  3S0G A;  3V2L A;  4INW A;  5DIC A;  3R1V A;  3D77 A; 
#chains in the Genus database with same CATH topology
 1XYD A;  1REC A;  4UPG A;  1A75 A;  2K7C A;  1DJX A;  3EG5 B;  2JXC A;  2L0P A;  1B9A A;  1W7I B;  1TCO B;  4ORB B;  1YR5 A;  1S1E A;  3MSE B;  2M29 A;  1CMG A;  1SPY A;  2WCK A;  1S3P A;  1WRK A;  2LM5 A;  4JKT A;  4PHM A;  3R1O A;  2BCB A;  2PQL A;  1QX5 B;  2M0R A;  1QIV A;  4TNC A;  1RK9 A;  3HCM A;  3CTN A;  1SCV A;  2KOT A;  1XVJ A;  2I7A A;  3K21 A;  3L47 A;  4NDD A;  3SG7 A;  1NX3 A;  1IIO A;  1F4Q A;  2KQY A;  1TWO A;  2WCJ A;  2ISD A;  4PHJ A;  3SG5 A;  2KAX A;  3D73 A;  1R6P A;  2ERB A;  2LVJ A;  3S0E A;  1K9U A;  1CDN A;  3K1E A;  1AUI B;  3CAB A;  3DYE A;  1KWO B;  2I18 A;  1YUR A;  4MN0 A;  2MBX A;  5HL1 A;  4N1F A;  1BMO A;  1NCX A;  3SIB A;  2GTE A;  3OHM B;  5K89 A;  1KWO C;  1TTX A;  1U5I A;  1JF0 A;  2KFH A;  2WOS A;  1F8H A;  1YUT A;  2HQW A;  5G08 A;  3A4U B;  4GUK A;  1SR6 B;  1N0Y A;  3I5F B;  1BU3 A;  2KLE A;  1CLM A;  4MVF A;  1MHO A;  3TDU A;  1SMG A;  1SR6 C;  3D0Y B;  3I5F C;  3M0W A;  2L4H A;  4YGA A;  1TN4 A;  1HT9 A;  2WC5 A;  3FE6 A;  2VRG A;  2Y1M A;  4MSP A;  1CNP A;  1N2D A;  1GGZ A;  4GGF A;  1NX0 A;  1QV0 A;  1NWD A;  2O5G A;  1LVC D;  1DC1 A;  3QRX A;  1G4Y R;  3WNX B;  1S5G Y;  1XFZ O;  3FE9 A;  1NP8 A;  1BF5 A;  1ALW A;  1TUJ A;  1CB1 A;  2PRU A;  2BBN A;  2PYQ A;  2WCE A;  4L9M A;  5IBW A;  2JPO A;  1DVI A;  1MUX A;  1SYM A;  2KYF A;  3PM2 A;  4NDC A;  1H4B A;  1QAS A;  2LVK A;  4MLW A;  1F70 A;  4U8D A;  3SIA A;  2WCF A;  1B8C A;  2LUC A;  3DY9 A;  1DTL A;  1KK7 Y;  1OOG A;  2QAC A;  4PCW A;  3KEV A;  1Y1U A;  1CKK A;  1VRK A;  5FI6 A;  3PAT A;  2K2F A;  1IQ5 A;  5HLO A;  1IRJ A;  4WRI A;  3SS3 A;  1XK4 C;  1K95 A;  5AFP A;  2L5X B;  3SG4 A;  5AER A;  2BCA A;  3SG3 A;  3ZWH A;  1SL7 A;  2MRD A;  2GGM A;  3OX6 A;  4MZJ A;  1YX8 A;  4GGN A;  2BKH B;  2ZN9 A;  2V53 A;  3SS5 A;  1J7Q A;  1LIN A;  1SKT A;  2NZ0 A;  2BBM A;  3EVU A;  3CR2 A;  4ICB A;  3VRP A;  3LCP C;  1G8I A;  1KSM A;  2G9B A;  2M7N A;  3CR4 X;  4C0J A;  1C7W A;  1TNX A;  1W7J B;  2KPH A;  2KHN A;  5DKR A;  5AXI A;  1M46 A;  3CDN A;  2ZND A;  3PFV A;  3Q8I A;  1A29 A;  2R2I A;  1B7T Z;  2BAP A;  1OMV A;  2KI4 B;  1RFJ A;  2LVI A;  3PAL A;  2OTG B;  2B1U A;  1P28 A;  2BKI B;  2FCD A;  2KI4 C;  3PJI A;  4BY4 A;  2OTG C;  2NCO A;  1YRT B;  2NXQ A;  3O78 A;  3VRQ A;  4DUQ A;  1NX1 A;  3NGV A;  3BFH A;  3SS4 A;  1BG1 A;  4M2O A;  1MQ1 A;  3V2L A;  1XFX O;  1QLK A;  1QVI Y;  2JRF A;  5DIC A;  2M3W A;  2K8M B;  1C07 A;  2LCP A;  3AAK A;  4MZL A;  2Q91 A;  1MWN A;  1K9K A;  1ZUZ A;  3DVE A;  4IL1 A;  1DF0 B;  3FIA A;  3JTD B;  1NYA A;  1CLB A;  2M7L A;  3CYZ A;  1TIZ A;  4CPV A;  4NQG A;  4AQI A;  2JZI A;  1M45 A;  3JTD C;  1T14 A;  3EK4 A;  3WHT B;  3CZ0 A;  4GAO A;  5EL2 A;  2KI6 C;  1GM0 A;  2KI6 D;  2ZKM X;  1JC2 A;  1F4O A;  1OMR A;  2H61 A;  2L51 A;  1TNQ A;  1ALV A;  4YRU A;  2F2O A;  2Y5I A;  4ETO A;  2WOR A;  3DVK A;  3OGN A;  2BL0 C;  1AK8 A;  2JXL A;  1K2H A;  1C7V A;  3BUW B;  4YGB B;  3VGO A;  1K93 D;  2LLU A;  1LA3 A;  2CXJ A;  1QJT A;  2WC6 A;  3VRO A;  2MLF C;  2NCP A;  5JJG A;  2K7O A;  1EG4 A;  3KHE A;  2AAO A;  3AAJ A;  1PSR A;  4MZK A;  1BT6 A;  2LUX A;  1DQE A;  3CS1 A;  1TRF A;  1MXL C;  1PVA A;  3UNW A;  1KFX S;  5DKQ A;  1LKJ A;  4DRW A;  1PK0 D;  3KPX A;  4CID A;  2KSP A;  2JC2 A;  1Y6W A;  1FBV A;  1OOH A;  1PRW A;  1XFV O;  3BUM B;  1WLZ A;  3O4X A;  4ZCV A;  2JWW A;  1TCF A;  1MXE A;  5I2L A;  1A75 B;  3IVT A;  1OQP A;  2LLT A;  2E6W A;  4CLN A;  1LXF C;  1UHK A;  1XFR A;  2LP3 A;  3EVV A;  3GK2 A;  2FJU B;  3OB1 B;  4AOM A;  1DJY A;  1CDL A;  3SG2 A;  2QEV A;  4M2P A;  1RTP 1;  2M49 B;  2PAL A;  3O4Y A;  4CFQ A;  1J7P A;  1YUU A;  2K7D A;  2GGZ A;  2F2P A;  1S36 A;  2K7B A;  1JUO A;  3FWB A;  2CTN A;  2L50 A;  3EKJ A;  4WQ3 A;  4QJ5 B;  1ZMZ A;  5KU1 A;  3BXK A;  2LVV A;  3BOW A;  3LK0 A;  2HF5 A;  4MRX A;  3F45 A;  2LAN A;  1FW4 A;  5CSN A;  5DKN A;  1B1G A;  4NDB A;  1KFU S;  1AJ5 A;  5PAL A;  5ER4 X;  2WCL A;  2BCX A;  3N7H A;  3OB2 B;  2A4J A;  2KQ6 A;  3D78 A;  2CCM A;  1B47 A;  1Y1A A;  1CFC A;  1NSH A;  3A8R A;  1CMF A;  1JF2 A;  2LAP A;  4ORC B;  4XYN A;  1MF8 B;  3VRR A;  1UHN A;  3I5I B;  4PE0 A;  2BEC A;  2JPT A;  2K60 A;  2P70 A;  1DMO A;  3L4A A;  2AMI A;  4HRG A;  2M1U A;  3I5I C;  3S0B A;  1ZFS A;  2KGR A;  3GK1 A;  1FPW A;  5FI2 A;  4ZCU A;  1UUS A;  2Q4U A;  3BJH A;  5I2O A;  2BNX A;  3LL8 B;  3B6X A;  4E68 A;  3OP0 A;  1U5I B;  2JT3 A;  1IH0 A;  2BE4 A;  2SAS A;  1EL4 A;  2H8V A;  1XFY O;  2LLS A;  2WCH A;  4PT1 A;  1DT7 B;  2G2B A;  1ODB A;  1Z2C B;  1WY9 A;  2OPO A;  4JD9 A;  3TDZ A;  3IF7 A;  1TNW A;  5B8I B;  1DGU A;  1TOP A;  2F33 A;  2JOJ A;  5CSF A;  1UHH A;  3RLZ A;  2LHI A;  4BY5 A;  1L2O C;  1SSE B;  3EVR A;  2KBI A;  3CZT X;  2HPS A;  4JWQ A;  4FTG A;  2LNK A;  1PAL A;  2YGU A;  5F6T A;  4GGF C;  2PVB A;  4PHK A;  2I94 A;  2JNX A;  3BUN B;  1JSA A;  1EG3 A;  2F8P A;  4I5N B;  1DJZ A;  1S26 D;  4A4B A;  4D1E A;  3R1V A;  5CPV A;  4YI9 A;  1OSA A;  5CSJ A;  3FWC A;  5HKZ A;  1FF1 A;  1XFU O;  4PHN A;  4XJK A;  2QEO A;  2P71 A;  1WDC B;  2ZNE A;  2WC8 A;  3PN7 C;  1J7O A;  4YGC B;  1WDC C;  4DCK A;  1K94 A;  4HRE E;  1B8R A;  1HQV A;  1QLS A;  1QXP A;  1K9P A;  1WRL A;  2LE9 B;  2M1K B;  4YGE B;  1SNL A;  4GFT A;  5I2Q A;  1PUL A;  3S0A A;  4Q04 A;  1V1F A;  2OS8 B;  1NX2 A;  2HQ8 A;  1F54 A;  3DVJ A;  1OW4 A;  2O60 A;  3CZ2 A;  2OS8 C;  2COL B;  1CFP A;  2FOT A;  4FQO A;  1LA0 A;  3WXA A;  3GOF A;  3QME A;  4USL A;  1KQV A;  3CWG A;  1BOC A;  1J1D A;  1PVB A;  1AJ4 A;  4GPL B;  3TDI A;  3NXA A;  3VRN A;  1S6I A;  4OCI A;  1SL8 A;  2KLD A;  1WRZ A;  4R1E A;  4C0L A;  3PSR A;  1H8B A;  4OR9 B;  1B4C A;  1CDP A;  2WND A;  2JNF A;  4HRH A;  2KDH A;  2KYC A;  1EXR A;  3KO0 A;  1GJY A;  2K61 A;  4IJ7 A;  1W9Z A;  1DEK A;  2BL0 B;  2ZN8 A;  3DF0 A;  3BUO B;  1DJI A;  3C1V A;  3FS7 A;  4P2Y B;  3S0F A;  2AUC A;  2K0J A;  2GV5 A;  3R1P A;  1CFF A;  3AKA A;  2KFG A;  3TUY B;  1K8U A;  2LV7 A;  1CLL A;  1NCY A;  1NUB A;  2LHL A;  3TUY C;  5HKY A;  4DS7 A;  1J7R A;  1J55 A;  2MHH A;  1K90 D;  2H2K A;  3NHT A;  3CLN A;  1IQ3 A;  5JOL A;  2QPT A;  2H61 C;  2CT9 A;  1G33 A;  2PMY A;  1NIW A;  3LK1 A;  4JQ0 D;  1KFU L;  1E8A A;  2LMU A;  1KCY A;  3BFA A;  1DJG A;  1B7T Y;  2QEH A;  4KYN A;  3E3R A;  2KNE A;  1QX7 A;  1CFD A;  3B87 A;  1Z4H A;  2EC6 B;  1SRA A;  2JQ6 A;  2KAY A;  1GQM A;  2Y4Q A;  5AEQ A;  1Y0V H;  2EC6 C;  2I2R E;  5I8N A;  1SCM B;  1RRO A;  4YBH B;  3NSO A;  3CGA A;  3KF9 A;  1C3Y A;  1GGW A;  1KK7 Z;  4PAL A;  1V1G A;  1DJW A;  1SCM C;  4PDZ A;  3O2P A;  2JT8 A;  2CBL A;  2MLE C;  2D8N A;  4FQT A;  2HET A;  4N5X A;  5D7F A;  3TS5 B;  4OV2 A;  1J1E A;  3TS5 C;  3D76 A;  4A4C A;  2PAS A;  2CNP A;  1SL9 A;  2LP2 A;  5FI7 A;  4DIR A;  5D69 A;  3VB1 A;  5BPJ A;  1QS7 A;  1OOJ A;  2L5Y A;  2M9G A;  4MEW A;  4P5O E;  3BYA A;  1KK8 B;  5J3X A;  1M63 B;  3S0G A;  1A03 A;  2L98 A;  1YX7 A;  2MAZ A;  3I5G B;  1UP5 A;  1QV1 A;  1KK8 C;  3BOW B;  2SCP A;  1BLQ A;  3D0Y A;  3D77 A;  2DOQ A;  2IS9 A;  3I5G C;  1Y1X A;  1CTR A;  3JVT B;  1A4P A;  2JTZ A;  3IQQ A;  1BR4 B;  1RWY A;  2LMT A;  4ORA B;  3BFB A;  3JVT C;  1ORG A;  2BE6 A;  2P6B B;  2MJW B;  4F7F A;  1L2O B;  2M97 A;  2QEB A;  3D75 A;  2KAV A;  2L4I A;  1R2U A;  3WHU B;  1DJH A;  1QVI Z;  1ZOT B;  3I5H B;  1YUS A;  2RGI A;  3NSI A;  4INX A;  5ER5 A;  1QAT A;  1UHI A;  1AHR A;  1OZS A;  3I5H C;  4JPZ B;  1YTZ C;  4QJ4 B;  1YVH A;  4I5J A;  5KTY A;  2ZRS A;  3EK8 A;  1K96 A;  3S0D A;  1FI6 A;  5TNC A;  3PM8 A;  1XK4 A;  3EKH A;  4GBA A;  4I5L B;  3BQ3 A;  1M31 A;  3DXL A;  3O6B A;  4MRY A;  1M39 A;  1JWD A;  4OKH A;  3ICB A;  1IJ6 A;  1BJF A;  1SK6 D;  2KFF A;  2QDI A;  3B7A A;  3BUX B;  3PN7 B;  3L4L A;  3B86 A;  1N65 A;  2WCB A;  4CFR A;  4OZD A;  4QJ3 B;  1DEL A;  1KQM B;  1D1O A;  4YI8 A;  1IG5 A;  1CM1 A;  1BR1 B;  1KQM C;  4PE7 A;  2MA2 A;  1RJV A;  1S6J A;  1SBJ A;  3ZNI A;  4C0K A;  4YGD B;  2ZFD A;  3DZT A;  3NSL A;  1CM4 A;  3OX5 A;  4GNK B;  4XJK B;  1OOF A;  1B8L A;  4PE4 A;  3RZS A;  1BOD A;  5KSZ A;  3D74 A;  3OBV A;  3CZ1 A;  5HYD A;  1QWV A;  1F55 A;  1NCZ A;  1QTX A;  5GQQ C;  1JFK A;  1PSB A;  1QIW A;  3B88 A;  2ZRT A;  1EH2 A;  3GK4 X;  3HX4 A;  2M8U A;  2FCE A;  1JBA A;  2F3Y A;  1KSO A;  1IKU A;  1DGV A;  1OZO A;  1ZAC A;  1OOI X;  3DVM A;  4WQ2 A;  4PE1 A;  1EJ3 A;  1DF0 A;  1SY9 A;  2EGD A;  2KBM A;  4I5K A;  5CSI A;  5D3O A;  3NSK A;  5AAN A;  2K2A A;  2JTT A;  4M2Q A;  1A2X A;  2L2C A;  1IGV A;  1KFX L;  1TUZ A;  1QX2 A;  2TN4 A;  5HLV A;  2JU0 A;  1CDM A;  2E30 A;  1FI5 A;  4MBE A;  4AQJ A;  3SG6 A;  1Q80 A;  1LS8 A;  5I94 A;  1MR8 A;  5FYX A;  1XFW O;  4N1G A;  2L2E A;  1IWQ A;  2F3Z A;  1SW8 A;  1IJ5 A;  1TNP A;  1NPQ A;  3D10 A;  1UHJ A;  2WCM A;  1UWO A;  1AP4 A;  1L7Z A;  1YVL A;  1OE9 B;  2LC5 A;  3FE8 A;  3PLF B;  3LLE A;  3SJS A;  3NHI A;  4F0Z B;  1UUR A;  2JT0 A;  1JFJ A;  1F71 A;  3DF0 B;  3AKB A;  1X02 A;  2EHB A;  3CR5 X;  2JUL A;  3H4S E;  3IQO A;  1C3Z A;  1XA5 A;  2FJY A;  3DD4 A;  1S6C A;  1WLM A;  2PSR A;  5HKW A;  3RM1 A;  4OVN F;  1S5G Z;  2NLN A;  1YRU B;  1OMD A;  2Y1N A;  3EK7 A;  2KGB C;  3TZ1 A;  4HSZ A;  1XO5 A;  4INW A;  3UO9 A;  1AVS A;  3R72 A;  2LMV A; 
#chains in the Genus database with same CATH homology
 2QEO A;  2P71 A;  3BFB A;  1ORG A;  3CYZ A;  2WCK A;  1T14 A;  4F7F A;  3CZ0 A;  3R1O A;  2QEB A;  2PQL A;  3D75 A;  5EL2 A;  1GM0 A;  4INX A;  3S0A A;  3L47 A;  1OW4 A;  3OGN A;  3CZ2 A;  3S0D A;  1TWO A;  2WCJ A;  3QME A;  3D73 A;  2WC6 A;  2ERB A;  3S0E A;  3DXL A;  3K1E A;  3CAB A;  3DYE A;  3B7A A;  2QDI A;  1DQE A;  3L4L A;  3B86 A;  2GTE A;  4OZD A;  1OOH A;  3R72 A;  2WC5 A;  3DZT A;  3FE6 A;  3S0F A;  1XFR A;  1OOF A;  3R1P A;  3RZS A;  3D74 A;  2QEV A;  3CZ1 A;  1QWV A;  3FE9 A;  1TUJ A;  3B88 A;  3NHT A;  2JPO A;  2WCL A;  3N7H A;  1OOI X;  3DY9 A;  3D78 A;  1OOG A;  2L2C A;  3BFA A;  2QEH A;  2P70 A;  3L4A A;  3B87 A;  3S0B A;  1LS8 A;  3BJH A;  3B6X A;  2H8V A;  2WCM A;  1C3Y A;  2WCH A;  4PT1 A;  3FE8 A;  2KPH A;  4JD9 A;  4FQT A;  3NHI A;  3CDN A;  3Q8I A;  3D76 A;  1C3Z A;  1P28 A;  3PJI A;  2FJY A;  3VB1 A;  3NGV A;  3BFH A;  3S0G A;  3V2L A;  4INW A;  5DIC A;  3R1V A;  3D77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...