2WCMA

Structure of bmori gobp2 (general odorant binding protein 2) with (10e)-hexadecen-12-yn-1-ol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 53
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wcmA00
3BFHA 3R1PA 3FE8A 3L47A 4INWA 4JD9A 3CABA 3QMEA 3R72A 3D76A 3DZTA 2GTEA 3B86A 3D78A 3CZ2A 3D77A 3FE6A 1XFRA 3CYZA 1ORGA 5DICA 3B6XA 1OOIX 1OOGA 3S0FA 3S0EA 2PQLA 2ERBA 1OW4A 3DYEA 1LS8A 2WCMA 3NHTA 1OOHA 2WC5A 3D73A 3RZSA 2QDIA 4INXA 1GM0A 3B7AA 4F7FA 3S0GA 1T14A 3BFBA 3BJHA 3PJIA 1DQEA 2WC6A 3N7HA 2WCHA 4OZDA 3D74A 3DY9A 2WCLA 3VB1A 3B87A 3NGVA 3CZ0A 2L2CA 1TWOA 3NHIA 3S0AA 2QEBA 2FJYA 3R1VA 1C3ZA 3Q8IA 2QEVA 3L4AA 3DXLA 1TUJA 3S0BA 1OOFA 3S0DA 3V2LA 3OGNA 5EL2A 3L4LA 2JPOA 2P70A 2P71A 2QEOA 3R1OA 1P28A 3CDNA 4FQTA 2KPHA 3K1EA 2WCJA 2H8VA 1QWVA 3BFAA 3CZ1A 3D75A 1C3YA 2QEHA 3FE9A 3B88A 2WCKA 4PT1A
chains in the Genus database with same CATH superfamily
3TDZA 1Q80A 3DVJA 4JPZB 1QXPA 3R1PA 1PVBA 2AMIA 2BNXA 3LLEA 2F3YA 1L7ZA 3O2PA 1S26D 2MLFC 1B7TZ 2BCBA 1KK7Y 1G4YR 2LCPA 2G9BA 3D76A 3PM2A 2LHLA 3KO0A 2LVJA 4L9MA 1YRTB 2LUXA 3B86A 4N1FA 5AANA 4PE0A 4YRUA 3OB2B 2BE4A 4MLWA 3CYZA 2JZIA 2LC5A 5DICA 4CLNA 5JOLA 3B6XA 1ZACA 2CT9A 4ICBA 4MRXA 4OCIA 1UP5A 1SK6D 3MSEB 2ZFDA 3S0EA 1N65A 1J7OA 1L2OB 1SCMB 1OW4A 4FQOA 2EC6C 1NPQA 1UHIA 3SG5A 1AUIB 3OX6A 5FI6A 3SG4A 3EK7A 3PALA 5HKZA 1IJ5A 4OKHA 5HLOA 2M3WA 5DKNA 2VRGA 4OR9B 2BBMA 1B7TY 1EG3A 2F2PA 3IVTA 1KCYA 2E30A 3UNWA 2PYQA 4HRGA 3BQ3A 1GM0A 2NCOA 3AAKA 1OMRA 3EG5B 3S0GA 1K8UA 2HETA 2JU0A 2KBMA 3SIBA 1NX2A 3JVTC 1DF0B 1Y1UA 1F55A 4C0KA 2KI4C 1MQ1A 1OMVA 4OZDA 2MBXA 1QV1A 1RECA 2KAXA 2WNDA 1YX7A 2WCLA 2K7DA 1M45A 2AUCA 1S6JA 3M0WA 1BOCA 4MSPA 1B8LA 2NZ0A 1J1DA 2F33A 2HF5A 2K7BA 1H4BA 2F3ZA 1OQPA 5FI7A 5AERA 3NHIA 2LLUA 1CM1A 1GJYA 4CFQA 1TNQA 1YVLA 3TUYC 1B47A 2CXJA 3K21A 2FJYA 1LKJA 2H61A 3NSIA 3Q8IA 1Z4HA 1IQ5A 1DF0A 4M2PA 1LXFC 4U8DA 3SS4A 1TUZA 1V1GA 2M7NA 1QIWA 1YVHA 5GQQC 3TS5B 2TN4A 1TRFA 2L4IA 2LUCA 4IL1A 1ZOTB 1TIZA 4YGAA 2Q4UA 1K90D 3CGAA 3KF9A 5J3XA 5KTYA 2COLB 1YR5A 3CZTX 2KQYA 1NCYA 2BCAA 1KFXS 1OOFA 4PE7A 1D1OA 1DELA 3BOWB 3S0DA 1NCXA 1SNLA 3V2LA 3O6BA 1J7RA 5EL2A 3L4LA 3LCPC 5F6TA 3BUWB 4PHJA 1DC1A 1KFUL 1S6IA 1IRJA 1SR6C 5DKQA 4DIRA 1XVJA 2MRDA 2KLEA 4GGFA 2JQ6A 2L51A 2Q91A 2CNPA 5CPVA 4GBAA 1DVIA 1J7QA 3PN7C 4BY4A 2BKIB 3EK4A 1YX8A 2LV7A 1QVIY 4A4CA 1UHHA 4DUQA 1V1FA 3VRQA 3D0YB 1B8RA 1A4PA 1GQMA 1XK4A 3BOWA 3HX4A 4AOMA 3BYAA 3D75A 4YI8A 1NP8A 4CPVA 4JWQA 1F70A 2GGMA 1IH0A 1R6PA 2JRFA 1G8IA 4P2YB 2Y1NA 3FE9A 3SS3A 1CLMA 1EJ3A 1AVSA 3BFHA 1CTRA 4INWA 3CR4X 1QX5B 1CFDA 1CB1A 2ZN8A 3CABA 1NYAA 1BMOA 4BY5A 3EVRA 1SL7A 2FOTA 4WQ2A 2R2IA 1K9KA 3DZTA 2F8PA 4HSZA 5CSJA 4N5XA 1QTXA 1FI6A 3LK1A 3CZ2A 2KYFA 1FI5A 3FE6A 3UO9A 1LVCD 1TN4A 4C0JA 2ZNEA 1NIWA 5HKYA 1U5IB 2WC8A 1AK8A 3VGOA 1JFKA 1OOIX 1C7VA 2K61A 1WY9A 1BLQA 1OOGA 5HKWA 2P6BB 1UHKA 2PQLA 4OV2A 1AP4A 3I5IB 2LP2A 1LS8A 1AHRA 2E6WA 1CNPA 1OOHA 3PATA 3VROA 1R2UA 1CM4A 3D73A 2KFHA 2I94A 4GNKB 1F4OA 2JOJA 5KU1A 1KQVA 2IS9A 1TNWA 3O4XA 4I5JA 1MUXA 2LVKA 1DTLA 1WRKA 1T14A 1U5IA 1IJ6A 2CBLA 1JSAA 1HQVA 2OS8B 1NCZA 2HPSA 1OE9B 1WRLA 4XJKB 1B8CA 1A29A 2WC6A 1SPYA 1S36A 3CS1A 1NWDA 2L0PA 2O5GA 3D74A 3GK2A 1MWNA 3N7HA 3I5HB 5ER5A 4DCKA 3SG7A 3VB1A 1IGVA 1RJVA 4MZJA 1XFZO 5CSIA 1DJYA 3TZ1A 3ICBA 1DJGA 2CCMA 3NGVA 2EHBA 1L2OC 4MZKA 5K89A 1DJXA 2KOTA 1QJTA 1TNXA 5D7FA 1AJ4A 4N1GA 4R1EA 3QRXA 3CTNA 3O78A 2V53A 2M9GA 4YGEB 1KWOC 2KI6D 1HT9A 1PK0D 1CDLA 3SG6A 1OOJA 4XJKA 3F45A 2MA2A 2L4HA 1RFJA 1XFWO 3BUXB 3TDIA 2PALA 1TUJA 1CDPA 2K7OA 3OHMB 1K95A 2M49B 1DJIA 5B8IB 1M63B 1RK9A 3OGNA 3TDUA 5TNCA 4MZLA 2LM5A 2QACA 2KGBC 2L98A 2LLSA 1DJWA 4D1EA 1MXEA 3O4YA 2BAPA 4PALA 4I5KA 1KQMC 2A4JA 4QJ5B 2JT3A 3KPXA 3R1OA 1P28A 4M2QA 4FQTA 4GUKA 4MN0A 4ZCVA 1IG5A 2KI4B 4UPGA 2HQWA 3K1EA 1S3PA 1QVIZ 2JPTA 1QX7A 2WCJA 2LMVA 3VRRA 1BR4B 1QWVA 2LAPA 4GPLB 1JF2A 2LMTA 4JKTA 1PVAA 4ETOA 4XYNA 2KAVA 1YRUB 2NXQA 1WDCC 2FCEA 1UHJA 2I2RE 2LVIA 3FWBA 3BUNB 4YI9A 1MF8B 1KFUS 2HQ8A 2WCEA 3B88A 4PT1A 1PSRA 4CFRA 3NSLA 1LA3A 2KFGA 1WLMA 2KNEA 1OZOA 3FE8A 3I5FC 4NQGA 4YBHB 2LMUA 2K7CA 4PDZA 2BL0C 3DF0B 1PSBA 4I5LB 2SASA 4JD9A 2JULA 3WHTB 3QMEA 1YTZC 2LP3A 2EGDA 2JTTA 3H4SE 1ODBA 1SCVA 2KLDA 1QATA 4PE4A 1E8AA 2GTEA 1NX1A 2NLNA 2I18A 1N2DA 3WHUB 4QJ4B 1XFYO 3D77A 1JWDA 1JC2A 3BXKA 2YGUA 3GK1A 1RTP1 2NCPA 1CKKA 1KSOA 1BF5A 4GFTA 2BE6A 2OTGC 1M46A 2WCFA 1K9PA 1MXLC 2K2AA 1UURA 2ERBA 2WOSA 3EKJA 2SCPA 1QLSA 3DF0A 4MVFA 3NHTA 3EVUA 1CMGA 2Y5IA 1EH2A 1K93D 1XA5A 1F4QA 4I5NB 3PN7B 2QDIA 1JF0A 1ZFSA 2FCDA 1K9UA 2DOQA 3JTDB 1CFPA 2JTZA 2JC2A 3B7AA 3RM1A 4IJ7A 3E3RA 1BR1B 2ZN9A 1BG1A 1KK8B 1QS7A 1CLLA 5IBWA 1DQEA 3AKBA 1J55A 2LE9B 3DVMA 4PHMA 1EXRA 1TCOB 2JT0A 2QPTA 1PALA 3DY9A 1RROA 1G33A 2H2KA 3SG3A 2WORA 2BCXA 4WRIA 3A8RA 1J7PA 3CR5X 1WRZA 1C7WA 5KSZA 2ZNDA 1NUBA 1CFCA 1K94A 3S0AA 1W7JB 2K2FA 4HRHA 3FIAA 3DVEA 3IQOA 2JNFA 3I5GB 3KHEA 2QEVA 2I7AA 1UHNA 1MR8A 2ZRTA 2MLEC 1SRAA 4DS7A 2LVVA 2ZKMX 3EK8A 1IQ3A 3DXLA 1YUTA 1FF1A 1SW8A 1F54A 1H8BA 3FS7A 2WCBA 2OS8C 5CSNA 1PRWA 2M1KB 3S0BA 1BU3A 3LL8B 1QLKA 4YGCB 3BUMB 1DMOA 4DRWA 1OMDA 3BUOB 3FWCA 3I5HC 5I94A 3OP0A 2ZRSA 4TNCA 4NDDA 1TCFA 1XFUO 2JPOA 1UWOA 3IF7A 1RWYA 5D69A 3SS5A 1SCMC 2P71A 3WXAA 3ZWHA 4YGBB 4P5OE 1LA0A 4M2OA 4YGDB 1XFXO 2QEOA 4ORAB 1NX3A 4JQ0D 1QASA 5HL1A 2BKHB 4WQ3A 1JBAA 5PALA 3DD4A 2KPHA 3SG2A 2KGRA 2FJUB 1W7IB 2JXLA 3LK0A 1DGVA 1B4CA 2BBNA 1A03A 1QX2A 5FYXA 2G2BA 2H61C 2H8VA 2Y4QA 1IIOA 1XFVO 1FPWA 1S1EA 4AQIA 2EC6B 5I8NA 1C3YA 2KQ6A 2KHNA 2RGIA 2LNKA 1CMFA 1GGZA 2AAOA 3CR2A 4CIDA 2KFFA 3L47A 5DKRA 1KWOB 1B9AA 1F8HA 2LANA 1Z2CB 3CWGA 3R72A 2JNXA 2JT8A 2D8NA 4NDBA 2ISDA 4GAOA 1KSMA 3JVTB 3D78A 3AAJA 1FW4A 2KBIA 4GGFC 4AQJA 1XFRA 2L50A 3D10A 1ORGA 2JXCA 4PHNA 3ZNIA 3PSRA 1CDMA 2LLTA 3TS5C 1LINA 3S0FA 2M97A 1N0YA 1K96A 3CLNA 4GGNA 2PSRA 1A75B 4A4BA 1SY9A 3DYEA 3EKHA 4NDCA 4PCWA 2PMYA 2WCMA 3OX5A 1M31A 1XK4C 3OB1B 2WC5A 1EG4A 1KQMB 3TUYB 3RZSA 1AJ5A 2M0RA 1ZMZA 2M8UA 4MEWA 2B1UA 3PLFB 3C1VA 3KEVA 1SBJA 3NSKA 4INXA 3GOFA 3OBVA 1Y1XA 5HLVA 3GK4X 1DEKA 1Y6WA 4F7FA 1YURA 2PVBA 1DGUA 3NSOA 3PFVA 3BFBA 1C07A 1DJHA 3BJHA 3PJIA 1NSHA 3AKAA 1SSEB 1CFFA 4E68A 1TOPA 1WDCB 4PE1A 4QJ3B 5AXIA 4F0ZB 1MHOA 1M39A 2WCHA 5CSFA 2PASA 1SMGA 2OPOA 1A75A 2BECA 4KYNA 1K2HA 1CLBA 1QIVA 3I5FB 1JFJA 3B87A 1CDNA 2M29A 5AEQA 5I2LA 3DVKA 1ZUZA 2BL0B 1SR6B 1KFXL 1FBVA 1YUUA 3CZ0A 5HYDA 2LHIA 2MHHA 5I2OA 2L2CA 4ORCB 1SKTA 1IKUA 2GGZA 1TWOA 1Y1AA 5JJGA 1S5GZ 1A2XA 2L5YA 1XYDA 2QEBA 3EVVA 1SL8A 2KSPA 3NXAA 3R1VA 4ORBB 1C3ZA 5FI2A 3JTDC 2KI6C 3SJSA 3L4AA 1WLZA 2L2EA 1KK8C 3RLZA 1GGWA 5BPJA 2OTGB 2M1UA 1SYMA 1J1EA 1YUSA 2PRUA 2Y1MA 4C0LA 1B1GA 1X02A 2M7LA 1ALVA 1Y0VH 3SIAA 1BJFA 5ER4X 3VRNA 1DJZA 1PULA 1OZSA 4MRYA 5I2QA 4USLA 2F2OA 2JWWA 2P70A 1NX0A 3I5IC 1W9ZA 2KAYA 2L5XB 1S5GY 4MBEA 4OVNF 3A4UB 1OSAA 1EL4A 1UUSA 1F71A 5G08A 2KYCA 2MAZA 3IQQA 1KK7Z 4Q04A 4ZCUA 1TNPA 1S6CA 2K8MB 3VRPA 3D0YA 3CDNA 1JUOA 3I5GC 4PHKA 1XO5A 1DT7B 4HREE 2KDHA 1TTXA 2CTNA 1VRKA 2O60A 3PM8A 2GV5A 5AFPA 1BT6A 2MJWB 1QV0A 4FTGA 1ALWA 3WNXB 3HCMA 1SL9A 3BFAA 1IWQA 2K0JA 3CZ1A 1BODA 5D3OA 2QEHA 2K60A 2WCKA
chains in the Genus database with same CATH topology
3BFHA 3R1PA 3FE8A 3L47A 4INWA 4JD9A 3CABA 3QMEA 3R72A 3D76A 3DZTA 2GTEA 3B86A 3D78A 3CZ2A 3D77A 3FE6A 1XFRA 3CYZA 1ORGA 5DICA 3B6XA 1OOIX 1OOGA 3S0FA 3S0EA 2PQLA 2ERBA 1OW4A 3DYEA 1LS8A 2WCMA 3NHTA 1OOHA 2WC5A 3D73A 3RZSA 2QDIA 4INXA 1GM0A 3B7AA 4F7FA 3S0GA 1T14A 3BFBA 3BJHA 3PJIA 1DQEA 2WC6A 3N7HA 2WCHA 4OZDA 3D74A 3DY9A 2WCLA 3VB1A 3B87A 3NGVA 3CZ0A 2L2CA 1TWOA 3NHIA 3S0AA 2QEBA 2FJYA 3R1VA 1C3ZA 3Q8IA 2QEVA 3L4AA 3DXLA 1TUJA 3S0BA 1OOFA 3S0DA 3V2LA 3OGNA 5EL2A 3L4LA 2JPOA 2P70A 2P71A 2QEOA 3R1OA 1P28A 3CDNA 4FQTA 2KPHA 3K1EA 2WCJA 2H8VA 1QWVA 3BFAA 3CZ1A 3D75A 1C3YA 2QEHA 3FE9A 3B88A 2WCKA 4PT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFH A;  3R1P A;  3FE8 A;  3L47 A;  4INW A;  4JD9 A;  3CAB A;  3QME A;  3R72 A;  3D76 A;  3DZT A;  2GTE A;  3B86 A;  3D78 A;  3CZ2 A;  3D77 A;  3FE6 A;  1XFR A;  3CYZ A;  1ORG A;  5DIC A;  3B6X A;  1OOI X;  1OOG A;  3S0F A;  3S0E A;  2PQL A;  2ERB A;  1OW4 A;  3DYE A;  1LS8 A;  2WCM A;  3NHT A;  1OOH A;  2WC5 A;  3D73 A;  3RZS A;  2QDI A;  4INX A;  1GM0 A;  3B7A A;  4F7F A;  3S0G A;  1T14 A;  3BFB A;  3BJH A;  3PJI A;  1DQE A;  2WC6 A;  3N7H A;  2WCH A;  4OZD A;  3D74 A;  3DY9 A;  2WCL A;  3VB1 A;  3B87 A;  3NGV A;  3CZ0 A;  2L2C A;  1TWO A;  3NHI A;  3S0A A;  2QEB A;  2FJY A;  3R1V A;  1C3Z A;  3Q8I A;  2QEV A;  3L4A A;  3DXL A;  1TUJ A;  3S0B A;  1OOF A;  3S0D A;  3V2L A;  3OGN A;  5EL2 A;  3L4L A;  2JPO A;  2P70 A;  2P71 A;  2QEO A;  3R1O A;  1P28 A;  3CDN A;  4FQT A;  2KPH A;  3K1E A;  2WCJ A;  2H8V A;  1QWV A;  3BFA A;  3CZ1 A;  3D75 A;  1C3Y A;  2QEH A;  3FE9 A;  3B88 A;  2WCK A;  4PT1 A; 
#chains in the Genus database with same CATH topology
 3TDZ A;  1Q80 A;  3DVJ A;  4JPZ B;  1QXP A;  3R1P A;  1PVB A;  2AMI A;  2BNX A;  3LLE A;  2F3Y A;  1L7Z A;  3O2P A;  1S26 D;  2MLF C;  1B7T Z;  2BCB A;  1KK7 Y;  1G4Y R;  2LCP A;  2G9B A;  3D76 A;  3PM2 A;  2LHL A;  3KO0 A;  2LVJ A;  4L9M A;  1YRT B;  2LUX A;  3B86 A;  4N1F A;  5AAN A;  4PE0 A;  4YRU A;  3OB2 B;  2BE4 A;  4MLW A;  3CYZ A;  2JZI A;  2LC5 A;  5DIC A;  4CLN A;  5JOL A;  3B6X A;  1ZAC A;  2CT9 A;  4ICB A;  4MRX A;  4OCI A;  1UP5 A;  1SK6 D;  3MSE B;  2ZFD A;  3S0E A;  1N65 A;  1J7O A;  1L2O B;  1SCM B;  1OW4 A;  4FQO A;  2EC6 C;  1NPQ A;  1UHI A;  3SG5 A;  1AUI B;  3OX6 A;  5FI6 A;  3SG4 A;  3EK7 A;  3PAL A;  5HKZ A;  1IJ5 A;  4OKH A;  5HLO A;  2M3W A;  5DKN A;  2VRG A;  4OR9 B;  2BBM A;  1B7T Y;  1EG3 A;  2F2P A;  3IVT A;  1KCY A;  2E30 A;  3UNW A;  2PYQ A;  4HRG A;  3BQ3 A;  1GM0 A;  2NCO A;  3AAK A;  1OMR A;  3EG5 B;  3S0G A;  1K8U A;  2HET A;  2JU0 A;  2KBM A;  3SIB A;  1NX2 A;  3JVT C;  1DF0 B;  1Y1U A;  1F55 A;  4C0K A;  2KI4 C;  1MQ1 A;  1OMV A;  4OZD A;  2MBX A;  1QV1 A;  1REC A;  2KAX A;  2WND A;  1YX7 A;  2WCL A;  2K7D A;  1M45 A;  2AUC A;  1S6J A;  3M0W A;  1BOC A;  4MSP A;  1B8L A;  2NZ0 A;  1J1D A;  2F33 A;  2HF5 A;  2K7B A;  1H4B A;  2F3Z A;  1OQP A;  5FI7 A;  5AER A;  3NHI A;  2LLU A;  1CM1 A;  1GJY A;  4CFQ A;  1TNQ A;  1YVL A;  3TUY C;  1B47 A;  2CXJ A;  3K21 A;  2FJY A;  1LKJ A;  2H61 A;  3NSI A;  3Q8I A;  1Z4H A;  1IQ5 A;  1DF0 A;  4M2P A;  1LXF C;  4U8D A;  3SS4 A;  1TUZ A;  1V1G A;  2M7N A;  1QIW A;  1YVH A;  5GQQ C;  3TS5 B;  2TN4 A;  1TRF A;  2L4I A;  2LUC A;  4IL1 A;  1ZOT B;  1TIZ A;  4YGA A;  2Q4U A;  1K90 D;  3CGA A;  3KF9 A;  5J3X A;  5KTY A;  2COL B;  1YR5 A;  3CZT X;  2KQY A;  1NCY A;  2BCA A;  1KFX S;  1OOF A;  4PE7 A;  1D1O A;  1DEL A;  3BOW B;  3S0D A;  1NCX A;  1SNL A;  3V2L A;  3O6B A;  1J7R A;  5EL2 A;  3L4L A;  3LCP C;  5F6T A;  3BUW B;  4PHJ A;  1DC1 A;  1KFU L;  1S6I A;  1IRJ A;  1SR6 C;  5DKQ A;  4DIR A;  1XVJ A;  2MRD A;  2KLE A;  4GGF A;  2JQ6 A;  2L51 A;  2Q91 A;  2CNP A;  5CPV A;  4GBA A;  1DVI A;  1J7Q A;  3PN7 C;  4BY4 A;  2BKI B;  3EK4 A;  1YX8 A;  2LV7 A;  1QVI Y;  4A4C A;  1UHH A;  4DUQ A;  1V1F A;  3VRQ A;  3D0Y B;  1B8R A;  1A4P A;  1GQM A;  1XK4 A;  3BOW A;  3HX4 A;  4AOM A;  3BYA A;  3D75 A;  4YI8 A;  1NP8 A;  4CPV A;  4JWQ A;  1F70 A;  2GGM A;  1IH0 A;  1R6P A;  2JRF A;  1G8I A;  4P2Y B;  2Y1N A;  3FE9 A;  3SS3 A;  1CLM A;  1EJ3 A;  1AVS A;  3BFH A;  1CTR A;  4INW A;  3CR4 X;  1QX5 B;  1CFD A;  1CB1 A;  2ZN8 A;  3CAB A;  1NYA A;  1BMO A;  4BY5 A;  3EVR A;  1SL7 A;  2FOT A;  4WQ2 A;  2R2I A;  1K9K A;  3DZT A;  2F8P A;  4HSZ A;  5CSJ A;  4N5X A;  1QTX A;  1FI6 A;  3LK1 A;  3CZ2 A;  2KYF A;  1FI5 A;  3FE6 A;  3UO9 A;  1LVC D;  1TN4 A;  4C0J A;  2ZNE A;  1NIW A;  5HKY A;  1U5I B;  2WC8 A;  1AK8 A;  3VGO A;  1JFK A;  1OOI X;  1C7V A;  2K61 A;  1WY9 A;  1BLQ A;  1OOG A;  5HKW A;  2P6B B;  1UHK A;  2PQL A;  4OV2 A;  1AP4 A;  3I5I B;  2LP2 A;  1LS8 A;  1AHR A;  2E6W A;  1CNP A;  1OOH A;  3PAT A;  3VRO A;  1R2U A;  1CM4 A;  3D73 A;  2KFH A;  2I94 A;  4GNK B;  1F4O A;  2JOJ A;  5KU1 A;  1KQV A;  2IS9 A;  1TNW A;  3O4X A;  4I5J A;  1MUX A;  2LVK A;  1DTL A;  1WRK A;  1T14 A;  1U5I A;  1IJ6 A;  2CBL A;  1JSA A;  1HQV A;  2OS8 B;  1NCZ A;  2HPS A;  1OE9 B;  1WRL A;  4XJK B;  1B8C A;  1A29 A;  2WC6 A;  1SPY A;  1S36 A;  3CS1 A;  1NWD A;  2L0P A;  2O5G A;  3D74 A;  3GK2 A;  1MWN A;  3N7H A;  3I5H B;  5ER5 A;  4DCK A;  3SG7 A;  3VB1 A;  1IGV A;  1RJV A;  4MZJ A;  1XFZ O;  5CSI A;  1DJY A;  3TZ1 A;  3ICB A;  1DJG A;  2CCM A;  3NGV A;  2EHB A;  1L2O C;  4MZK A;  5K89 A;  1DJX A;  2KOT A;  1QJT A;  1TNX A;  5D7F A;  1AJ4 A;  4N1G A;  4R1E A;  3QRX A;  3CTN A;  3O78 A;  2V53 A;  2M9G A;  4YGE B;  1KWO C;  2KI6 D;  1HT9 A;  1PK0 D;  1CDL A;  3SG6 A;  1OOJ A;  4XJK A;  3F45 A;  2MA2 A;  2L4H A;  1RFJ A;  1XFW O;  3BUX B;  3TDI A;  2PAL A;  1TUJ A;  1CDP A;  2K7O A;  3OHM B;  1K95 A;  2M49 B;  1DJI A;  5B8I B;  1M63 B;  1RK9 A;  3OGN A;  3TDU A;  5TNC A;  4MZL A;  2LM5 A;  2QAC A;  2KGB C;  2L98 A;  2LLS A;  1DJW A;  4D1E A;  1MXE A;  3O4Y A;  2BAP A;  4PAL A;  4I5K A;  1KQM C;  2A4J A;  4QJ5 B;  2JT3 A;  3KPX A;  3R1O A;  1P28 A;  4M2Q A;  4FQT A;  4GUK A;  4MN0 A;  4ZCV A;  1IG5 A;  2KI4 B;  4UPG A;  2HQW A;  3K1E A;  1S3P A;  1QVI Z;  2JPT A;  1QX7 A;  2WCJ A;  2LMV A;  3VRR A;  1BR4 B;  1QWV A;  2LAP A;  4GPL B;  1JF2 A;  2LMT A;  4JKT A;  1PVA A;  4ETO A;  4XYN A;  2KAV A;  1YRU B;  2NXQ A;  1WDC C;  2FCE A;  1UHJ A;  2I2R E;  2LVI A;  3FWB A;  3BUN B;  4YI9 A;  1MF8 B;  1KFU S;  2HQ8 A;  2WCE A;  3B88 A;  4PT1 A;  1PSR A;  4CFR A;  3NSL A;  1LA3 A;  2KFG A;  1WLM A;  2KNE A;  1OZO A;  3FE8 A;  3I5F C;  4NQG A;  4YBH B;  2LMU A;  2K7C A;  4PDZ A;  2BL0 C;  3DF0 B;  1PSB A;  4I5L B;  2SAS A;  4JD9 A;  2JUL A;  3WHT B;  3QME A;  1YTZ C;  2LP3 A;  2EGD A;  2JTT A;  3H4S E;  1ODB A;  1SCV A;  2KLD A;  1QAT A;  4PE4 A;  1E8A A;  2GTE A;  1NX1 A;  2NLN A;  2I18 A;  1N2D A;  3WHU B;  4QJ4 B;  1XFY O;  3D77 A;  1JWD A;  1JC2 A;  3BXK A;  2YGU A;  3GK1 A;  1RTP 1;  2NCP A;  1CKK A;  1KSO A;  1BF5 A;  4GFT A;  2BE6 A;  2OTG C;  1M46 A;  2WCF A;  1K9P A;  1MXL C;  2K2A A;  1UUR A;  2ERB A;  2WOS A;  3EKJ A;  2SCP A;  1QLS A;  3DF0 A;  4MVF A;  3NHT A;  3EVU A;  1CMG A;  2Y5I A;  1EH2 A;  1K93 D;  1XA5 A;  1F4Q A;  4I5N B;  3PN7 B;  2QDI A;  1JF0 A;  1ZFS A;  2FCD A;  1K9U A;  2DOQ A;  3JTD B;  1CFP A;  2JTZ A;  2JC2 A;  3B7A A;  3RM1 A;  4IJ7 A;  3E3R A;  1BR1 B;  2ZN9 A;  1BG1 A;  1KK8 B;  1QS7 A;  1CLL A;  5IBW A;  1DQE A;  3AKB A;  1J55 A;  2LE9 B;  3DVM A;  4PHM A;  1EXR A;  1TCO B;  2JT0 A;  2QPT A;  1PAL A;  3DY9 A;  1RRO A;  1G33 A;  2H2K A;  3SG3 A;  2WOR A;  2BCX A;  4WRI A;  3A8R A;  1J7P A;  3CR5 X;  1WRZ A;  1C7W A;  5KSZ A;  2ZND A;  1NUB A;  1CFC A;  1K94 A;  3S0A A;  1W7J B;  2K2F A;  4HRH A;  3FIA A;  3DVE A;  3IQO A;  2JNF A;  3I5G B;  3KHE A;  2QEV A;  2I7A A;  1UHN A;  1MR8 A;  2ZRT A;  2MLE C;  1SRA A;  4DS7 A;  2LVV A;  2ZKM X;  3EK8 A;  1IQ3 A;  3DXL A;  1YUT A;  1FF1 A;  1SW8 A;  1F54 A;  1H8B A;  3FS7 A;  2WCB A;  2OS8 C;  5CSN A;  1PRW A;  2M1K B;  3S0B A;  1BU3 A;  3LL8 B;  1QLK A;  4YGC B;  3BUM B;  1DMO A;  4DRW A;  1OMD A;  3BUO B;  3FWC A;  3I5H C;  5I94 A;  3OP0 A;  2ZRS A;  4TNC A;  4NDD A;  1TCF A;  1XFU O;  2JPO A;  1UWO A;  3IF7 A;  1RWY A;  5D69 A;  3SS5 A;  1SCM C;  2P71 A;  3WXA A;  3ZWH A;  4YGB B;  4P5O E;  1LA0 A;  4M2O A;  4YGD B;  1XFX O;  2QEO A;  4ORA B;  1NX3 A;  4JQ0 D;  1QAS A;  5HL1 A;  2BKH B;  4WQ3 A;  1JBA A;  5PAL A;  3DD4 A;  2KPH A;  3SG2 A;  2KGR A;  2FJU B;  1W7I B;  2JXL A;  3LK0 A;  1DGV A;  1B4C A;  2BBN A;  1A03 A;  1QX2 A;  5FYX A;  2G2B A;  2H61 C;  2H8V A;  2Y4Q A;  1IIO A;  1XFV O;  1FPW A;  1S1E A;  4AQI A;  2EC6 B;  5I8N A;  1C3Y A;  2KQ6 A;  2KHN A;  2RGI A;  2LNK A;  1CMF A;  1GGZ A;  2AAO A;  3CR2 A;  4CID A;  2KFF A;  3L47 A;  5DKR A;  1KWO B;  1B9A A;  1F8H A;  2LAN A;  1Z2C B;  3CWG A;  3R72 A;  2JNX A;  2JT8 A;  2D8N A;  4NDB A;  2ISD A;  4GAO A;  1KSM A;  3JVT B;  3D78 A;  3AAJ A;  1FW4 A;  2KBI A;  4GGF C;  4AQJ A;  1XFR A;  2L50 A;  3D10 A;  1ORG A;  2JXC A;  4PHN A;  3ZNI A;  3PSR A;  1CDM A;  2LLT A;  3TS5 C;  1LIN A;  3S0F A;  2M97 A;  1N0Y A;  1K96 A;  3CLN A;  4GGN A;  2PSR A;  1A75 B;  4A4B A;  1SY9 A;  3DYE A;  3EKH A;  4NDC A;  4PCW A;  2PMY A;  2WCM A;  3OX5 A;  1M31 A;  1XK4 C;  3OB1 B;  2WC5 A;  1EG4 A;  1KQM B;  3TUY B;  3RZS A;  1AJ5 A;  2M0R A;  1ZMZ A;  2M8U A;  4MEW A;  2B1U A;  3PLF B;  3C1V A;  3KEV A;  1SBJ A;  3NSK A;  4INX A;  3GOF A;  3OBV A;  1Y1X A;  5HLV A;  3GK4 X;  1DEK A;  1Y6W A;  4F7F A;  1YUR A;  2PVB A;  1DGU A;  3NSO A;  3PFV A;  3BFB A;  1C07 A;  1DJH A;  3BJH A;  3PJI A;  1NSH A;  3AKA A;  1SSE B;  1CFF A;  4E68 A;  1TOP A;  1WDC B;  4PE1 A;  4QJ3 B;  5AXI A;  4F0Z B;  1MHO A;  1M39 A;  2WCH A;  5CSF A;  2PAS A;  1SMG A;  2OPO A;  1A75 A;  2BEC A;  4KYN A;  1K2H A;  1CLB A;  1QIV A;  3I5F B;  1JFJ A;  3B87 A;  1CDN A;  2M29 A;  5AEQ A;  5I2L A;  3DVK A;  1ZUZ A;  2BL0 B;  1SR6 B;  1KFX L;  1FBV A;  1YUU A;  3CZ0 A;  5HYD A;  2LHI A;  2MHH A;  5I2O A;  2L2C A;  4ORC B;  1SKT A;  1IKU A;  2GGZ A;  1TWO A;  1Y1A A;  5JJG A;  1S5G Z;  1A2X A;  2L5Y A;  1XYD A;  2QEB A;  3EVV A;  1SL8 A;  2KSP A;  3NXA A;  3R1V A;  4ORB B;  1C3Z A;  5FI2 A;  3JTD C;  2KI6 C;  3SJS A;  3L4A A;  1WLZ A;  2L2E A;  1KK8 C;  3RLZ A;  1GGW A;  5BPJ A;  2OTG B;  2M1U A;  1SYM A;  1J1E A;  1YUS A;  2PRU A;  2Y1M A;  4C0L A;  1B1G A;  1X02 A;  2M7L A;  1ALV A;  1Y0V H;  3SIA A;  1BJF A;  5ER4 X;  3VRN A;  1DJZ A;  1PUL A;  1OZS A;  4MRY A;  5I2Q A;  4USL A;  2F2O A;  2JWW A;  2P70 A;  1NX0 A;  3I5I C;  1W9Z A;  2KAY A;  2L5X B;  1S5G Y;  4MBE A;  4OVN F;  3A4U B;  1OSA A;  1EL4 A;  1UUS A;  1F71 A;  5G08 A;  2KYC A;  2MAZ A;  3IQQ A;  1KK7 Z;  4Q04 A;  4ZCU A;  1TNP A;  1S6C A;  2K8M B;  3VRP A;  3D0Y A;  3CDN A;  1JUO A;  3I5G C;  4PHK A;  1XO5 A;  1DT7 B;  4HRE E;  2KDH A;  1TTX A;  2CTN A;  1VRK A;  2O60 A;  3PM8 A;  2GV5 A;  5AFP A;  1BT6 A;  2MJW B;  1QV0 A;  4FTG A;  1ALW A;  3WNX B;  3HCM A;  1SL9 A;  3BFA A;  1IWQ A;  2K0J A;  3CZ1 A;  1BOD A;  5D3O A;  2QEH A;  2K60 A;  2WCK A; 
#chains in the Genus database with same CATH homology
 3BFH A;  3R1P A;  3FE8 A;  3L47 A;  4INW A;  4JD9 A;  3CAB A;  3QME A;  3R72 A;  3D76 A;  3DZT A;  2GTE A;  3B86 A;  3D78 A;  3CZ2 A;  3D77 A;  3FE6 A;  1XFR A;  3CYZ A;  1ORG A;  5DIC A;  3B6X A;  1OOI X;  1OOG A;  3S0F A;  3S0E A;  2PQL A;  2ERB A;  1OW4 A;  3DYE A;  1LS8 A;  2WCM A;  3NHT A;  1OOH A;  2WC5 A;  3D73 A;  3RZS A;  2QDI A;  4INX A;  1GM0 A;  3B7A A;  4F7F A;  3S0G A;  1T14 A;  3BFB A;  3BJH A;  3PJI A;  1DQE A;  2WC6 A;  3N7H A;  2WCH A;  4OZD A;  3D74 A;  3DY9 A;  2WCL A;  3VB1 A;  3B87 A;  3NGV A;  3CZ0 A;  2L2C A;  1TWO A;  3NHI A;  3S0A A;  2QEB A;  2FJY A;  3R1V A;  1C3Z A;  3Q8I A;  2QEV A;  3L4A A;  3DXL A;  1TUJ A;  3S0B A;  1OOF A;  3S0D A;  3V2L A;  3OGN A;  5EL2 A;  3L4L A;  2JPO A;  2P70 A;  2P71 A;  2QEO A;  3R1O A;  1P28 A;  3CDN A;  4FQT A;  2KPH A;  3K1E A;  2WCJ A;  2H8V A;  1QWV A;  3BFA A;  3CZ1 A;  3D75 A;  1C3Y A;  2QEH A;  3FE9 A;  3B88 A;  2WCK A;  4PT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...