2WCMA

Structure of bmori gobp2 (general odorant binding protein 2) with (10e)-hexadecen-12-yn-1-ol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
total genus 53
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wcmA00
3DZTA 2WCMA 3B6XA 3NHIA 3D74A 2WCJA 1GM0A 3R1OA 5DICA 3S0BA 1C3YA 3RZSA 2GTEA 3B88A 3DY9A 4INXA 4PT1A 3L4AA 4F7FA 3BJHA 2P70A 3B86A 1C3ZA 2WCKA 1T14A 3L47A 3NHTA 3NGVA 4OZDA 2JPOA 3N7HA 3R1PA 3FE9A 1OOIX 1TUJA 3OGNA 3CYZA 3BFAA 3D75A 1TWOA 3FE8A 3CDNA 2L2CA 3VB1A 3QMEA 3FE6A 2H8VA 3D73A 3S0FA 1OOHA 1LS8A 3Q8IA 3CZ2A 3DXLA 3V2LA 2QDIA 3L4LA 4FQTA 2WCLA 3CZ0A 3PJIA 2ERBA 3B87A 3DYEA 2QEBA 3R72A 2WC6A 2QEVA 3S0DA 1XFRA 2WC5A 2KPHA 3S0GA 3K1EA 2QEOA 3BFHA 1OW4A 3CABA 2FJYA 1OOGA 2QEHA 2WCHA 3D78A 3S0AA 1P28A 3B7AA 3D77A 1ORGA 3D76A 3BFBA 4INWA 4JD9A 1OOFA 1QWVA 2PQLA 5EL2A 3S0EA 1DQEA 3R1VA 3CZ1A 2P71A
chains in the Genus database with same CATH superfamily
2LE9B 3BOWA 1EL4A 1IJ6A 2WCMA 1B1GA 1L2OB 3B6XA 1BR1B 1B8RA 4MBEA 1GM0A 1JUOA 4PHKA 4AQJA 3R1OA 3I5HB 4DIRA 3S0BA 1UHHA 2K7CA 1B8CA 1QX5B 1SRAA 2KI4C 1S36A 1U5IA 3RZSA 1DGUA 1B7TZ 2GTEA 1S26D 4YI9A 2JU0A 3B88A 5D69A 1XK4A 4INXA 2EC6C 3PSRA 2K7OA 3O6BA 1NIWA 4NDBA 4YRUA 3GK4X 2BE4A 3PM2A 3BJHA 1JF0A 2E6WA 2IS9A 3DF0A 1TCOB 4YGDB 2MLFC 2I7AA 1WRKA 1TNXA 1CLMA 2M49B 2KI6C 3DVEA 3PFVA 1KFXS 1T14A 2F8PA 3DD4A 4GPLB 2LC5A 3NHTA 1IRJA 3NGVA 4MZLA 3QRXA 1D1OA 1CMFA 2JNFA 3R1PA 1QX2A 4XJKB 4MVFA 1ZOTB 2QPTA 1A75B 2F2OA 2BNXA 2KBMA 4OCIA 1DMOA 4NQGA 1SSEB 1J7RA 1QXPA 2LLUA 3CGAA 1A2XA 2KGRA 3M0WA 4MZJA 3FE8A 2L2CA 5JJGA 1CDPA 1DEKA 1N2DA 2JT0A 4YGAA 4DS7A 4M2PA 1DJIA 2AMIA 1UHJA 5PALA 4ORAB 3I5IC 2PRUA 3Q8IA 2K60A 2RGIA 2K61A 2OTGC 1K8UA 1ZMZA 3V2LA 1Z4HA 1DGVA 2L5YA 1J1EA 2KQYA 1TIZA 3L4LA 2LCPA 2MA2A 1DJGA 2PASA 2Y1NA 2G2BA 3CZ0A 3PJIA 5AEQA 1BF5A 3BQ3A 2CCMA 3RM1A 4YBHB 2JRFA 3NSOA 4FTGA 3TDIA 2LVKA 2QEBA 3R72A 2GV5A 2ZN8A 3PM8A 4C0JA 3I5IB 2WORA 5IBWA 1YUUA 1XYDA 2QEVA 3CWGA 1QJTA 1TCFA 1YX8A 2OTGB 3EK7A 3IQOA 3OX5A 1M39A 1NCYA 3I5FC 1MXEA 3JVTB 2SCPA 2HETA 5AANA 1IG5A 3DVMA 3K1EA 1OZOA 1PULA 1R2UA 1YURA 3VRQA 5CPVA 4C0LA 4HREE 1YUTA 2MJWB 3LCPC 1S6CA 1RJVA 1OOGA 1BMOA 2QEHA 2LNKA 2KLDA 1B9AA 1DF0A 1MF8B 2GGZA 2Y1MA 3RLZA 1P28A 2L4IA 1S5GZ 3B7AA 5HYDA 1H8BA 1ZFSA 1KK7Z 2MRDA 4PHMA 2LUXA 5DKRA 3SG3A 5I8NA 1BG1A 1YRUB 2LV7A 4AQIA 3C1VA 4PDZA 4C0KA 2Y5IA 4OKHA 1CNPA 2L4HA 2R2IA 3NSKA 4INWA 1OOFA 1QWVA 1S1EA 1KSOA 4M2QA 5HLOA 2KFHA 5AFPA 2PVBA 1CFFA 3S0EA 1L7ZA 1OMDA 2M9GA 1DQEA 3SG6A 4D1EA 1NX1A 2K0JA 3O4XA 2F33A 5I94A 4QJ3B 2V53A 4BY4A 3CZ1A 1V1FA 4CLNA 5BPJA 1CDNA 5ER4X 5HLVA 1YTZC 4AOMA 4I5JA 4N1GA 4I5NB 2BECA 2K2AA 1F4QA 2P71A 1HQVA 4MEWA 5B8IB 3D74A 1HT9A 4TNCA 3SG2A 3WXAA 1EG3A 2O60A 2WOSA 1CFDA 3GK2A 1BJFA 1SCVA 3AAKA 4GGNA 4YGBB 1F55A 4L9MA 3OB2B 2CXJA 1TNWA 1MR8A 1N65A 2K7DA 1ZACA 3KF9A 1IWQA 2L0PA 1K9KA 4A4CA 2ZRTA 1GGZA 2WCBA 1C07A 1ALVA 2EGDA 1XVJA 1Z2CB 4HRGA 2M0RA 1NCXA 1OQPA 2Q4UA 2JT3A 4Q04A 3B86A 1M45A 3SS4A 2WCKA 1LINA 1LVCD 4KYNA 3TZ1A 5I2QA 4MN0A 4FQOA 1OMRA 1FI6A 3TDZA 3EK8A 1J7QA 1JWDA 4N1FA 1SCMC 1BT6A 1SNLA 4OZDA 1QX7A 2JQ6A 1NX3A 5TNCA 1UP5A 2TN4A 1ALWA 4PCWA 2BKHB 1Y1AA 1EJ3A 3CYZA 2KBIA 1J55A 1QVIY 1QIVA 1WDCC 2HQ8A 1DJXA 1TWOA 1XK4C 1K93D 5D3OA 2ZNEA 3VB1A 1SCMB 1M63B 1PVBA 4YGCB 3H4SE 2LHLA 5K89A 2H8VA 4WRIA 1YR5A 4A4BA 1JSAA 1OOHA 1LS8A 1XFYO 1DELA 1E8AA 2B1UA 2F3ZA 3ICBA 3HCMA 4XYNA 1CLBA 2KI4B 1U5IB 2KFFA 1KWOC 5D7FA 1WDCB 3IF7A 1MUXA 3CR5X 4MZKA 4I5KA 1YVHA 2EC6B 2LMVA 1RFJA 2KI6D 2FCDA 1S6JA 1SPYA 2KHNA 1KSMA 3DF0B 1V1GA 4CFRA 1G33A 3EKHA 4OR9B 2KFGA 4XJKA 3SG4A 1JFJA 1R6PA 3OB1B 1FBVA 4GAOA 2WCEA 1WY9A 1Y1XA 3D0YA 1JFKA 1YX7A 3SS5A 2WC8A 4PALA 2LVJA 2QEOA 3BFHA 2KDHA 2ZNDA 2L2EA 2HQWA 5JOLA 2FJYA 4CFQA 1XA5A 3S0AA 3D77A 2NCPA 3KHEA 1QASA 4GBAA 2OPOA 1EG4A 1MHOA 1CM1A 2JULA 3BUMB 3D76A 4NDCA 1TOPA 1AJ5A 2ZKMX 1SL9A 2PQLA 2M97A 4GNKB 1W9ZA 2BBNA 4E68A 2L98A 1F4OA 2M3WA 1WRZA 2BBMA 4YI8A 1XFWO 3VRPA 3SG5A 1RROA 1CTRA 1F54A 3BXKA 1OE9B 1S6IA 4ETOA 1BU3A 4JQ0D 1YVLA 3I5GC 1AK8A 3EVUA 1KFUL 1RTP1 2KSPA 3NHIA 5CSJA 1NPQA 1DC1A 1SL8A 2JPTA 2PMYA 2KNEA 1LXFC 2LMUA 4CIDA 1PSRA 3PLFB 3I5FB 5I2OA 1NSHA 1NWDA 1IQ3A 1KCYA 3OX6A 3O4YA 2Q91A 5KTYA 3I5GB 4ORCB 3DY9A 2OS8C 3LK0A 3F45A 2D8NA 2JNXA 3CTNA 5HL1A 3L4AA 1DF0B 4F7FA 1GJYA 1TTXA 2P70A 1SR6C 1TRFA 1UWOA 3IVTA 1SL7A 1OMVA 3VRNA 2K2FA 1QLKA 1QVIZ 2JXLA 4QJ4B 1XFXO 3L47A 2KOTA 1IJ5A 1XFUO 1QV0A 3EKJA 4PE1A 1LA3A 2JPOA 1AVSA 2BCBA 2LLSA 3N7HA 1G8IA 2CTNA 3FE9A 1DT7B 4GUKA 1DJWA 1Q80A 1FPWA 3NSLA 3PN7C 2DOQA 1GQMA 1NUBA 1B4CA 2L50A 3OGNA 1BOCA 2NZ0A 3SIBA 1MWNA 2JOJA 3JTDC 3BFAA 3D75A 4QJ5B 1M31A 2BL0C 1EXRA 1QIWA 1K9PA 3QMEA 3LK1A 4GFTA 3EK4A 3FE6A 1J7PA 1CM4A 1DVIA 2LP2A 2PYQA 4JKTA 3VROA 3D73A 3S0FA 1LKJA 1CB1A 1CLLA 1KQMC 2JZIA 1B8LA 4JPZB 4R1EA 5CSIA 3SS3A 3VRRA 2SASA 2I94A 3DXLA 1K90D 1K9UA 1CDLA 2BCAA 2NCOA 5DKQA 3WHTB 2F2PA 2WCFA 1UHIA 4DUQA 2BL0B 2WCLA 2ZFDA 2ERBA 2VRGA 1YUSA 3O2PA 3OBVA 3NXAA 1VRKA 4ICBA 2KYFA 1F71A 1XFVO 1BR4B 1OOJA 2YGUA 2M7LA 1KQMB 3I5HC 2KQ6A 1J7OA 2LM5A 2MHHA 4PHNA 4HSZA 2F3YA 1QV1A 1XFRA 3BOWB 1G4YR 4PE4A 1OSAA 5HKZA 1ODBA 1Y1UA 3SG7A 1F70A 4GGFA 2COLB 2LMTA 4BY5A 2FOTA 2I2RE 1MXLC 1OW4A 3D10A 3WNXB 1QS7A 3CABA 1CDMA 4DRWA 1NX0A 2I18A 2WCHA 3K21A 2KAXA 1A03A 1SMGA 2FCEA 1FW4A 1GGWA 1UHKA 3EVVA 2MAZA 3KO0A 5AERA 2HF5A 4IL1A 1WLMA 2CT9A 1JF2A 4JD9A 2H61C 2NLNA 2H61A 3FWBA 5EL2A 5FI2A 2QACA 1AUIB 1KFXL 2K8MB 1JC2A 3ZWHA 2K7BA 4HRHA 4USLA 1B47A 1JBAA 3CR2A 3R1VA 1A75A 2JTTA 1QATA 2A4JA 2WNDA 3DVJA 1A29A 1KWOB 2LVIA 2KLEA 1UHNA 3GOFA 4M2OA 3TS5C 1W7IB 3BUOB 3DZTA 2LP3A 1IKUA 1K94A 1SW8A 1C7WA 2MBXA 4ORBB 3WHUB 4I5LB 2LUCA 3TUYC 2JT8A 4MLWA 2WCJA 4PHJA 1ZUZA 5AXIA 2P6BB 5DICA 1DTLA 1NCZA 1C3YA 2Y4QA 1K2HA 3D0YB 1TN4A 1PRWA 1SY9A 4DCKA 1UURA 4MSPA 2AAOA 4U8DA 4MRYA 3TDUA 3TS5B 3O78A 1CKKA 5FI6A 5FYXA 3LLEA 1XFZO 4CPVA 1QTXA 3PALA 3IQQA 3GK1A 4PT1A 3TUYB 1NYAA 2M1UA 1TUZA 2NXQA 5GQQC 4ZCVA 1C3ZA 2BE6A 2H2KA 1RWYA 4JWQA 3FWCA 2BAPA 3E3RA 2EHBA 2LAPA 2O5GA 1BODA 1M46A 2KYCA 2M1KB 2KAYA 1UUSA 3JVTC 1OZSA 1WLZA 1WRLA 1KK8C 2JXCA 2ZRSA 2AUCA 1B7TY 3PATA 4ZCUA 1IH0A 3NSIA 4MRXA 1PK0D 4N5XA 1PALA 1OOIX 2HPSA 2JWWA 2M8UA 1H4BA 1LA0A 2G9BA 2CBLA 1TUJA 2PALA 1MQ1A 3AKBA 3EG5B 1CFPA 2KAVA 1KFUS 3LL8B 1W7JB 3CLNA 2ISDA 4PE0A 2LVVA 1IGVA 3CZTX 2L51A 2M29A 2FJUB 2ZN9A 2M7NA 5I2LA 1IIOA 3CDNA 3CS1A 5DKNA 2MLEC 1KK8B 1X02A 1SYMA 4P2YB 4WQ2A 1J1DA 3UNWA 5G08A 1RECA 3KEVA 5J3XA 2GGMA 1IQ5A 1K96A 2LHIA 3OP0A 3AKAA 3CZ2A 3DVKA 1PSBA 1N0YA 2KGBC 2QDIA 1FF1A 3FS7A 5KSZA 3ZNIA 3KPXA 4FQTA 1BLQA 1SK6D 1FI5A 1RK9A 1NX2A 1SKTA 2OS8B 3B87A 2PSRA 3BYAA 3DYEA 4OVNF 3OHMB 1A4PA 3BUNB 5HKYA 1C7VA 2LLTA 5FI7A 1S3PA 1EH2A 1SBJA 1SR6B 2WC6A 3UO9A 1TNPA 4P5OE 1TNQA 1YRTB 3BUXB 3MSEB 1DJHA 4UPGA 1PVAA 1Y0VH 3AAJA 3S0DA 1QLSA 2JC2A 3EVRA 2WC5A 3VGOA 2E30A 4F0ZB 2KPHA 5KU1A 3HX4A 3S0GA 1F8HA 3A4UB 1KQVA 1AJ4A 3A8RA 2LANA 3PN7B 3BUWB 2CNPA 1K95A 3D78A 4OV2A 1AHRA 4PE7A 1Y6WA 2JTZA 1XO5A 1ORGA 1DJYA 3JTDB 1AP4A 2BKIB 5F6TA 3BFBA 4WQ3A 5CSFA 5CSNA 4YGEB 3SIAA 1L2OC 5HKWA 5ER5A 1NP8A 4IJ7A 1CMGA 4NDDA 2BCXA 1CFCA 3FIAA 3CR4X 1DJZA 1S5GY 3SJSA 2L5XB 1KK7Y 4GGFC
chains in the Genus database with same CATH topology
3DZTA 2WCMA 3B6XA 3NHIA 3D74A 2WCJA 1GM0A 3R1OA 5DICA 3S0BA 1C3YA 3RZSA 2GTEA 3B88A 3DY9A 4INXA 4PT1A 3L4AA 4F7FA 3BJHA 2P70A 3B86A 1C3ZA 2WCKA 1T14A 3L47A 3NHTA 3NGVA 4OZDA 2JPOA 3N7HA 3R1PA 3FE9A 1OOIX 1TUJA 3OGNA 3CYZA 3BFAA 3D75A 1TWOA 3FE8A 3CDNA 2L2CA 3VB1A 3QMEA 3FE6A 2H8VA 3D73A 3S0FA 1OOHA 1LS8A 3Q8IA 3CZ2A 3DXLA 3V2LA 2QDIA 3L4LA 4FQTA 2WCLA 3CZ0A 3PJIA 2ERBA 3B87A 3DYEA 2QEBA 3R72A 2WC6A 2QEVA 3S0DA 1XFRA 2WC5A 2KPHA 3S0GA 3K1EA 2QEOA 3BFHA 1OW4A 3CABA 2FJYA 1OOGA 2QEHA 2WCHA 3D78A 3S0AA 1P28A 3B7AA 3D77A 1ORGA 3D76A 3BFBA 4INWA 4JD9A 1OOFA 1QWVA 2PQLA 5EL2A 3S0EA 1DQEA 3R1VA 3CZ1A 2P71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZT A;  2WCM A;  3B6X A;  3NHI A;  3D74 A;  2WCJ A;  1GM0 A;  3R1O A;  5DIC A;  3S0B A;  1C3Y A;  3RZS A;  2GTE A;  3B88 A;  3DY9 A;  4INX A;  4PT1 A;  3L4A A;  4F7F A;  3BJH A;  2P70 A;  3B86 A;  1C3Z A;  2WCK A;  1T14 A;  3L47 A;  3NHT A;  3NGV A;  4OZD A;  2JPO A;  3N7H A;  3R1P A;  3FE9 A;  1OOI X;  1TUJ A;  3OGN A;  3CYZ A;  3BFA A;  3D75 A;  1TWO A;  3FE8 A;  3CDN A;  2L2C A;  3VB1 A;  3QME A;  3FE6 A;  2H8V A;  3D73 A;  3S0F A;  1OOH A;  1LS8 A;  3Q8I A;  3CZ2 A;  3DXL A;  3V2L A;  2QDI A;  3L4L A;  4FQT A;  2WCL A;  3CZ0 A;  3PJI A;  2ERB A;  3B87 A;  3DYE A;  2QEB A;  3R72 A;  2WC6 A;  2QEV A;  3S0D A;  1XFR A;  2WC5 A;  2KPH A;  3S0G A;  3K1E A;  2QEO A;  3BFH A;  1OW4 A;  3CAB A;  2FJY A;  1OOG A;  2QEH A;  2WCH A;  3D78 A;  3S0A A;  1P28 A;  3B7A A;  3D77 A;  1ORG A;  3D76 A;  3BFB A;  4INW A;  4JD9 A;  1OOF A;  1QWV A;  2PQL A;  5EL2 A;  3S0E A;  1DQE A;  3R1V A;  3CZ1 A;  2P71 A; 
#chains in the Genus database with same CATH topology
 2LE9 B;  3BOW A;  1EL4 A;  1IJ6 A;  2WCM A;  1B1G A;  1L2O B;  3B6X A;  1BR1 B;  1B8R A;  4MBE A;  1GM0 A;  1JUO A;  4PHK A;  4AQJ A;  3R1O A;  3I5H B;  4DIR A;  3S0B A;  1UHH A;  2K7C A;  1B8C A;  1QX5 B;  1SRA A;  2KI4 C;  1S36 A;  1U5I A;  3RZS A;  1DGU A;  1B7T Z;  2GTE A;  1S26 D;  4YI9 A;  2JU0 A;  3B88 A;  5D69 A;  1XK4 A;  4INX A;  2EC6 C;  3PSR A;  2K7O A;  3O6B A;  1NIW A;  4NDB A;  4YRU A;  3GK4 X;  2BE4 A;  3PM2 A;  3BJH A;  1JF0 A;  2E6W A;  2IS9 A;  3DF0 A;  1TCO B;  4YGD B;  2MLF C;  2I7A A;  1WRK A;  1TNX A;  1CLM A;  2M49 B;  2KI6 C;  3DVE A;  3PFV A;  1KFX S;  1T14 A;  2F8P A;  3DD4 A;  4GPL B;  2LC5 A;  3NHT A;  1IRJ A;  3NGV A;  4MZL A;  3QRX A;  1D1O A;  1CMF A;  2JNF A;  3R1P A;  1QX2 A;  4XJK B;  4MVF A;  1ZOT B;  2QPT A;  1A75 B;  2F2O A;  2BNX A;  2KBM A;  4OCI A;  1DMO A;  4NQG A;  1SSE B;  1J7R A;  1QXP A;  2LLU A;  3CGA A;  1A2X A;  2KGR A;  3M0W A;  4MZJ A;  3FE8 A;  2L2C A;  5JJG A;  1CDP A;  1DEK A;  1N2D A;  2JT0 A;  4YGA A;  4DS7 A;  4M2P A;  1DJI A;  2AMI A;  1UHJ A;  5PAL A;  4ORA B;  3I5I C;  2PRU A;  3Q8I A;  2K60 A;  2RGI A;  2K61 A;  2OTG C;  1K8U A;  1ZMZ A;  3V2L A;  1Z4H A;  1DGV A;  2L5Y A;  1J1E A;  2KQY A;  1TIZ A;  3L4L A;  2LCP A;  2MA2 A;  1DJG A;  2PAS A;  2Y1N A;  2G2B A;  3CZ0 A;  3PJI A;  5AEQ A;  1BF5 A;  3BQ3 A;  2CCM A;  3RM1 A;  4YBH B;  2JRF A;  3NSO A;  4FTG A;  3TDI A;  2LVK A;  2QEB A;  3R72 A;  2GV5 A;  2ZN8 A;  3PM8 A;  4C0J A;  3I5I B;  2WOR A;  5IBW A;  1YUU A;  1XYD A;  2QEV A;  3CWG A;  1QJT A;  1TCF A;  1YX8 A;  2OTG B;  3EK7 A;  3IQO A;  3OX5 A;  1M39 A;  1NCY A;  3I5F C;  1MXE A;  3JVT B;  2SCP A;  2HET A;  5AAN A;  1IG5 A;  3DVM A;  3K1E A;  1OZO A;  1PUL A;  1R2U A;  1YUR A;  3VRQ A;  5CPV A;  4C0L A;  4HRE E;  1YUT A;  2MJW B;  3LCP C;  1S6C A;  1RJV A;  1OOG A;  1BMO A;  2QEH A;  2LNK A;  2KLD A;  1B9A A;  1DF0 A;  1MF8 B;  2GGZ A;  2Y1M A;  3RLZ A;  1P28 A;  2L4I A;  1S5G Z;  3B7A A;  5HYD A;  1H8B A;  1ZFS A;  1KK7 Z;  2MRD A;  4PHM A;  2LUX A;  5DKR A;  3SG3 A;  5I8N A;  1BG1 A;  1YRU B;  2LV7 A;  4AQI A;  3C1V A;  4PDZ A;  4C0K A;  2Y5I A;  4OKH A;  1CNP A;  2L4H A;  2R2I A;  3NSK A;  4INW A;  1OOF A;  1QWV A;  1S1E A;  1KSO A;  4M2Q A;  5HLO A;  2KFH A;  5AFP A;  2PVB A;  1CFF A;  3S0E A;  1L7Z A;  1OMD A;  2M9G A;  1DQE A;  3SG6 A;  4D1E A;  1NX1 A;  2K0J A;  3O4X A;  2F33 A;  5I94 A;  4QJ3 B;  2V53 A;  4BY4 A;  3CZ1 A;  1V1F A;  4CLN A;  5BPJ A;  1CDN A;  5ER4 X;  5HLV A;  1YTZ C;  4AOM A;  4I5J A;  4N1G A;  4I5N B;  2BEC A;  2K2A A;  1F4Q A;  2P71 A;  1HQV A;  4MEW A;  5B8I B;  3D74 A;  1HT9 A;  4TNC A;  3SG2 A;  3WXA A;  1EG3 A;  2O60 A;  2WOS A;  1CFD A;  3GK2 A;  1BJF A;  1SCV A;  3AAK A;  4GGN A;  4YGB B;  1F55 A;  4L9M A;  3OB2 B;  2CXJ A;  1TNW A;  1MR8 A;  1N65 A;  2K7D A;  1ZAC A;  3KF9 A;  1IWQ A;  2L0P A;  1K9K A;  4A4C A;  2ZRT A;  1GGZ A;  2WCB A;  1C07 A;  1ALV A;  2EGD A;  1XVJ A;  1Z2C B;  4HRG A;  2M0R A;  1NCX A;  1OQP A;  2Q4U A;  2JT3 A;  4Q04 A;  3B86 A;  1M45 A;  3SS4 A;  2WCK A;  1LIN A;  1LVC D;  4KYN A;  3TZ1 A;  5I2Q A;  4MN0 A;  4FQO A;  1OMR A;  1FI6 A;  3TDZ A;  3EK8 A;  1J7Q A;  1JWD A;  4N1F A;  1SCM C;  1BT6 A;  1SNL A;  4OZD A;  1QX7 A;  2JQ6 A;  1NX3 A;  5TNC A;  1UP5 A;  2TN4 A;  1ALW A;  4PCW A;  2BKH B;  1Y1A A;  1EJ3 A;  3CYZ A;  2KBI A;  1J55 A;  1QVI Y;  1QIV A;  1WDC C;  2HQ8 A;  1DJX A;  1TWO A;  1XK4 C;  1K93 D;  5D3O A;  2ZNE A;  3VB1 A;  1SCM B;  1M63 B;  1PVB A;  4YGC B;  3H4S E;  2LHL A;  5K89 A;  2H8V A;  4WRI A;  1YR5 A;  4A4B A;  1JSA A;  1OOH A;  1LS8 A;  1XFY O;  1DEL A;  1E8A A;  2B1U A;  2F3Z A;  3ICB A;  3HCM A;  4XYN A;  1CLB A;  2KI4 B;  1U5I B;  2KFF A;  1KWO C;  5D7F A;  1WDC B;  3IF7 A;  1MUX A;  3CR5 X;  4MZK A;  4I5K A;  1YVH A;  2EC6 B;  2LMV A;  1RFJ A;  2KI6 D;  2FCD A;  1S6J A;  1SPY A;  2KHN A;  1KSM A;  3DF0 B;  1V1G A;  4CFR A;  1G33 A;  3EKH A;  4OR9 B;  2KFG A;  4XJK A;  3SG4 A;  1JFJ A;  1R6P A;  3OB1 B;  1FBV A;  4GAO A;  2WCE A;  1WY9 A;  1Y1X A;  3D0Y A;  1JFK A;  1YX7 A;  3SS5 A;  2WC8 A;  4PAL A;  2LVJ A;  2QEO A;  3BFH A;  2KDH A;  2ZND A;  2L2E A;  2HQW A;  5JOL A;  2FJY A;  4CFQ A;  1XA5 A;  3S0A A;  3D77 A;  2NCP A;  3KHE A;  1QAS A;  4GBA A;  2OPO A;  1EG4 A;  1MHO A;  1CM1 A;  2JUL A;  3BUM B;  3D76 A;  4NDC A;  1TOP A;  1AJ5 A;  2ZKM X;  1SL9 A;  2PQL A;  2M97 A;  4GNK B;  1W9Z A;  2BBN A;  4E68 A;  2L98 A;  1F4O A;  2M3W A;  1WRZ A;  2BBM A;  4YI8 A;  1XFW O;  3VRP A;  3SG5 A;  1RRO A;  1CTR A;  1F54 A;  3BXK A;  1OE9 B;  1S6I A;  4ETO A;  1BU3 A;  4JQ0 D;  1YVL A;  3I5G C;  1AK8 A;  3EVU A;  1KFU L;  1RTP 1;  2KSP A;  3NHI A;  5CSJ A;  1NPQ A;  1DC1 A;  1SL8 A;  2JPT A;  2PMY A;  2KNE A;  1LXF C;  2LMU A;  4CID A;  1PSR A;  3PLF B;  3I5F B;  5I2O A;  1NSH A;  1NWD A;  1IQ3 A;  1KCY A;  3OX6 A;  3O4Y A;  2Q91 A;  5KTY A;  3I5G B;  4ORC B;  3DY9 A;  2OS8 C;  3LK0 A;  3F45 A;  2D8N A;  2JNX A;  3CTN A;  5HL1 A;  3L4A A;  1DF0 B;  4F7F A;  1GJY A;  1TTX A;  2P70 A;  1SR6 C;  1TRF A;  1UWO A;  3IVT A;  1SL7 A;  1OMV A;  3VRN A;  2K2F A;  1QLK A;  1QVI Z;  2JXL A;  4QJ4 B;  1XFX O;  3L47 A;  2KOT A;  1IJ5 A;  1XFU O;  1QV0 A;  3EKJ A;  4PE1 A;  1LA3 A;  2JPO A;  1AVS A;  2BCB A;  2LLS A;  3N7H A;  1G8I A;  2CTN A;  3FE9 A;  1DT7 B;  4GUK A;  1DJW A;  1Q80 A;  1FPW A;  3NSL A;  3PN7 C;  2DOQ A;  1GQM A;  1NUB A;  1B4C A;  2L50 A;  3OGN A;  1BOC A;  2NZ0 A;  3SIB A;  1MWN A;  2JOJ A;  3JTD C;  3BFA A;  3D75 A;  4QJ5 B;  1M31 A;  2BL0 C;  1EXR A;  1QIW A;  1K9P A;  3QME A;  3LK1 A;  4GFT A;  3EK4 A;  3FE6 A;  1J7P A;  1CM4 A;  1DVI A;  2LP2 A;  2PYQ A;  4JKT A;  3VRO A;  3D73 A;  3S0F A;  1LKJ A;  1CB1 A;  1CLL A;  1KQM C;  2JZI A;  1B8L A;  4JPZ B;  4R1E A;  5CSI A;  3SS3 A;  3VRR A;  2SAS A;  2I94 A;  3DXL A;  1K90 D;  1K9U A;  1CDL A;  2BCA A;  2NCO A;  5DKQ A;  3WHT B;  2F2P A;  2WCF A;  1UHI A;  4DUQ A;  2BL0 B;  2WCL A;  2ZFD A;  2ERB A;  2VRG A;  1YUS A;  3O2P A;  3OBV A;  3NXA A;  1VRK A;  4ICB A;  2KYF A;  1F71 A;  1XFV O;  1BR4 B;  1OOJ A;  2YGU A;  2M7L A;  1KQM B;  3I5H C;  2KQ6 A;  1J7O A;  2LM5 A;  2MHH A;  4PHN A;  4HSZ A;  2F3Y A;  1QV1 A;  1XFR A;  3BOW B;  1G4Y R;  4PE4 A;  1OSA A;  5HKZ A;  1ODB A;  1Y1U A;  3SG7 A;  1F70 A;  4GGF A;  2COL B;  2LMT A;  4BY5 A;  2FOT A;  2I2R E;  1MXL C;  1OW4 A;  3D10 A;  3WNX B;  1QS7 A;  3CAB A;  1CDM A;  4DRW A;  1NX0 A;  2I18 A;  2WCH A;  3K21 A;  2KAX A;  1A03 A;  1SMG A;  2FCE A;  1FW4 A;  1GGW A;  1UHK A;  3EVV A;  2MAZ A;  3KO0 A;  5AER A;  2HF5 A;  4IL1 A;  1WLM A;  2CT9 A;  1JF2 A;  4JD9 A;  2H61 C;  2NLN A;  2H61 A;  3FWB A;  5EL2 A;  5FI2 A;  2QAC A;  1AUI B;  1KFX L;  2K8M B;  1JC2 A;  3ZWH A;  2K7B A;  4HRH A;  4USL A;  1B47 A;  1JBA A;  3CR2 A;  3R1V A;  1A75 A;  2JTT A;  1QAT A;  2A4J A;  2WND A;  3DVJ A;  1A29 A;  1KWO B;  2LVI A;  2KLE A;  1UHN A;  3GOF A;  4M2O A;  3TS5 C;  1W7I B;  3BUO B;  3DZT A;  2LP3 A;  1IKU A;  1K94 A;  1SW8 A;  1C7W A;  2MBX A;  4ORB B;  3WHU B;  4I5L B;  2LUC A;  3TUY C;  2JT8 A;  4MLW A;  2WCJ A;  4PHJ A;  1ZUZ A;  5AXI A;  2P6B B;  5DIC A;  1DTL A;  1NCZ A;  1C3Y A;  2Y4Q A;  1K2H A;  3D0Y B;  1TN4 A;  1PRW A;  1SY9 A;  4DCK A;  1UUR A;  4MSP A;  2AAO A;  4U8D A;  4MRY A;  3TDU A;  3TS5 B;  3O78 A;  1CKK A;  5FI6 A;  5FYX A;  3LLE A;  1XFZ O;  4CPV A;  1QTX A;  3PAL A;  3IQQ A;  3GK1 A;  4PT1 A;  3TUY B;  1NYA A;  2M1U A;  1TUZ A;  2NXQ A;  5GQQ C;  4ZCV A;  1C3Z A;  2BE6 A;  2H2K A;  1RWY A;  4JWQ A;  3FWC A;  2BAP A;  3E3R A;  2EHB A;  2LAP A;  2O5G A;  1BOD A;  1M46 A;  2KYC A;  2M1K B;  2KAY A;  1UUS A;  3JVT C;  1OZS A;  1WLZ A;  1WRL A;  1KK8 C;  2JXC A;  2ZRS A;  2AUC A;  1B7T Y;  3PAT A;  4ZCU A;  1IH0 A;  3NSI A;  4MRX A;  1PK0 D;  4N5X A;  1PAL A;  1OOI X;  2HPS A;  2JWW A;  2M8U A;  1H4B A;  1LA0 A;  2G9B A;  2CBL A;  1TUJ A;  2PAL A;  1MQ1 A;  3AKB A;  3EG5 B;  1CFP A;  2KAV A;  1KFU S;  3LL8 B;  1W7J B;  3CLN A;  2ISD A;  4PE0 A;  2LVV A;  1IGV A;  3CZT X;  2L51 A;  2M29 A;  2FJU B;  2ZN9 A;  2M7N A;  5I2L A;  1IIO A;  3CDN A;  3CS1 A;  5DKN A;  2MLE C;  1KK8 B;  1X02 A;  1SYM A;  4P2Y B;  4WQ2 A;  1J1D A;  3UNW A;  5G08 A;  1REC A;  3KEV A;  5J3X A;  2GGM A;  1IQ5 A;  1K96 A;  2LHI A;  3OP0 A;  3AKA A;  3CZ2 A;  3DVK A;  1PSB A;  1N0Y A;  2KGB C;  2QDI A;  1FF1 A;  3FS7 A;  5KSZ A;  3ZNI A;  3KPX A;  4FQT A;  1BLQ A;  1SK6 D;  1FI5 A;  1RK9 A;  1NX2 A;  1SKT A;  2OS8 B;  3B87 A;  2PSR A;  3BYA A;  3DYE A;  4OVN F;  3OHM B;  1A4P A;  3BUN B;  5HKY A;  1C7V A;  2LLT A;  5FI7 A;  1S3P A;  1EH2 A;  1SBJ A;  1SR6 B;  2WC6 A;  3UO9 A;  1TNP A;  4P5O E;  1TNQ A;  1YRT B;  3BUX B;  3MSE B;  1DJH A;  4UPG A;  1PVA A;  1Y0V H;  3AAJ A;  3S0D A;  1QLS A;  2JC2 A;  3EVR A;  2WC5 A;  3VGO A;  2E30 A;  4F0Z B;  2KPH A;  5KU1 A;  3HX4 A;  3S0G A;  1F8H A;  3A4U B;  1KQV A;  1AJ4 A;  3A8R A;  2LAN A;  3PN7 B;  3BUW B;  2CNP A;  1K95 A;  3D78 A;  4OV2 A;  1AHR A;  4PE7 A;  1Y6W A;  2JTZ A;  1XO5 A;  1ORG A;  1DJY A;  3JTD B;  1AP4 A;  2BKI B;  5F6T A;  3BFB A;  4WQ3 A;  5CSF A;  5CSN A;  4YGE B;  3SIA A;  1L2O C;  5HKW A;  5ER5 A;  1NP8 A;  4IJ7 A;  1CMG A;  4NDD A;  2BCX A;  1CFC A;  3FIA A;  3CR4 X;  1DJZ A;  1S5G Y;  3SJS A;  2L5X B;  1KK7 Y;  4GGF C; 
#chains in the Genus database with same CATH homology
 3DZT A;  2WCM A;  3B6X A;  3NHI A;  3D74 A;  2WCJ A;  1GM0 A;  3R1O A;  5DIC A;  3S0B A;  1C3Y A;  3RZS A;  2GTE A;  3B88 A;  3DY9 A;  4INX A;  4PT1 A;  3L4A A;  4F7F A;  3BJH A;  2P70 A;  3B86 A;  1C3Z A;  2WCK A;  1T14 A;  3L47 A;  3NHT A;  3NGV A;  4OZD A;  2JPO A;  3N7H A;  3R1P A;  3FE9 A;  1OOI X;  1TUJ A;  3OGN A;  3CYZ A;  3BFA A;  3D75 A;  1TWO A;  3FE8 A;  3CDN A;  2L2C A;  3VB1 A;  3QME A;  3FE6 A;  2H8V A;  3D73 A;  3S0F A;  1OOH A;  1LS8 A;  3Q8I A;  3CZ2 A;  3DXL A;  3V2L A;  2QDI A;  3L4L A;  4FQT A;  2WCL A;  3CZ0 A;  3PJI A;  2ERB A;  3B87 A;  3DYE A;  2QEB A;  3R72 A;  2WC6 A;  2QEV A;  3S0D A;  1XFR A;  2WC5 A;  2KPH A;  3S0G A;  3K1E A;  2QEO A;  3BFH A;  1OW4 A;  3CAB A;  2FJY A;  1OOG A;  2QEH A;  2WCH A;  3D78 A;  3S0A A;  1P28 A;  3B7A A;  3D77 A;  1ORG A;  3D76 A;  3BFB A;  4INW A;  4JD9 A;  1OOF A;  1QWV A;  2PQL A;  5EL2 A;  3S0E A;  1DQE A;  3R1V A;  3CZ1 A;  2P71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...