2WCMA

Structure of bmori gobp2 (general odorant binding protein 2) with (10e)-hexadecen-12-yn-1-ol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
b'TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 53
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wcmA00
1T14A 3S0FA 2GTEA 1LS8A 1OOGA 3DY9A 2QEBA 2WC5A 3BJHA 3S0BA 3R1PA 2QEOA 3L4LA 2WCJA 3DZTA 3D74A 4JD9A 3RZSA 3D73A 3S0DA 3S0AA 3D76A 3NHTA 3S0EA 3L4AA 2H8VA 2QEHA 1OOIX 3CZ1A 3OGNA 3B87A 3D75A 3VB1A 1XFRA 2ERBA 3FE9A 3PJIA 1OOHA 3BFBA 3K1EA 2JPOA 3BFAA 3CZ2A 3R72A 4FQTA 2P70A 2QDIA 1TWOA 3DXLA 4F7FA 2KPHA 3CABA 1QWVA 3Q8IA 2WCMA 4PT1A 1OOFA 3BFHA 1DQEA 4INWA 3CZ0A 2WCLA 3FE8A 3B88A 1TUJA 2WCHA 3D77A 3NGVA 1OW4A 3B7AA 2QEVA 5EL2A 3S0GA 1ORGA 3B6XA 3QMEA 1C3YA 4OZDA 3CDNA 4INXA 3FE6A 3L47A 3R1OA 3B86A 3CYZA 5DICA 3V2LA 2L2CA 1C3ZA 1GM0A 2PQLA 1P28A 3DYEA 2WCKA 3D78A 2WC6A 2FJYA 3NHIA 2P71A 3N7HA 3R1VA
chains in the Genus database with same CATH superfamily
1F55A 2GGZA 3DF0A 1Q80A 2WOSA 1SR6B 2BCAA 3WXAA 2QEBA 1CFPA 4JWQA 1PALA 5CSFA 1PK0D 1KK8C 1KQMB 1NX1A 2NZ0A 3EVVA 1AP4A 1G8IA 1CDLA 1S1EA 5HKZA 4N5XA 3O6BA 2F3ZA 2LHLA 4N1FA 1CFDA 1QVIY 1XVJA 5PALA 1WDCB 3CZTX 3D73A 1IWQA 1B8LA 1IH0A 1CTRA 1SSEB 1TOPA 4CIDA 4JQ0D 2F2OA 3SG5A 1LKJA 3D76A 3TZ1A 4OVNF 5IBWA 3S0EA 3S0AA 1J7QA 1DMOA 1XK4C 4YGBB 2DOQA 4D1EA 4HRGA 2P6BB 2ISDA 1QS7A 2K7DA 1OOIX 3SS4A 3GK4X 3I5GC 2JNFA 1TNQA 3B87A 3OB2B 4MSPA 1KQMC 2ZN9A 3VB1A 1FI6A 1IRJA 1B9AA 1TCOB 1NCYA 1S6JA 3VROA 1QVIZ 2JXLA 4A4BA 2LVJA 2ERBA 2LE9B 3E3RA 1OMDA 2M1UA 1DVIA 3PFVA 2I18A 3EVUA 2BNXA 4I5NB 1OOHA 2EHBA 1QIWA 3PM8A 3TDZA 1BODA 1ALVA 4OV2A 1NPQA 2M7LA 1N0YA 2JPOA 2JULA 1DJWA 2HQ8A 2ZN8A 2L2EA 3BUWB 1EXRA 5CSJA 5HL1A 2LMVA 4FQTA 1TUZA 4C0KA 1CFCA 3VGOA 1WY9A 2M0RA 2QDIA 5GQQC 4GFTA 1QX5B 2KHNA 2LMTA 3DXLA 4F7FA 2BCBA 4L9MA 4ORBB 1SK6D 3D0YB 2FOTA 2JT3A 2MLEC 4XJKB 3OHMB 1AVSA 4M2QA 1E8AA 1SY9A 1B4CA 1RWYA 1Y1AA 1DQEA 1XFZO 3LL8B 1RJVA 4INWA 1K95A 3JVTB 1UURA 3SS3A 2KAVA 2EC6B 1F4OA 4YGCB 3C1VA 3SIAA 4FTGA 2WORA 4N1GA 3B7AA 5EL2A 5I2LA 1K94A 2K7CA 3BYAA 5I94A 1YRUB 3GK2A 2M7NA 1AJ4A 1F4QA 1ORGA 1QLSA 2VRGA 2Y1MA 4PHNA 1Z4HA 1MR8A 1NP8A 1W7IB 5HKYA 1C3YA 3PATA 1GGWA 1W9ZA 3OBVA 2MLFC 4OR9B 4OZDA 4QJ3B 4WQ3A 1BLQA 4CFQA 2K2FA 3HX4A 1J7RA 2R2IA 3FWCA 1YVHA 3L47A 4M2OA 2AUCA 1K8UA 5DICA 1CLMA 1KK7Y 2LANA 1C3ZA 2LP2A 2Q4UA 1ZOTB 4YI9A 5D7FA 1BF5A 1TIZA 1J7OA 2KI4C 1IIOA 1XFVO 1DC1A 1LINA 5AERA 2FJYA 1KSOA 1SL9A 2KGRA 1XYDA 4TNCA 1CNPA 4ZCVA 3BXKA 3R1VA 1YUTA 1TNPA 1Y1UA 1LS8A 2NLNA 2NXQA 1UWOA 2ZNEA 4GNKB 1F8HA 3FS7A 3WNXB 1TNXA 1V1GA 3BUXB 5HYDA 1NCXA 4XJKA 1KSMA 1KK7Z 2M29A 1VRKA 2EGDA 4DCKA 1DJYA 2G9BA 1M63B 2PALA 5F6TA 5G08A 1DT7B 2QEOA 3LCPC 1YRTB 2KYCA 2JT0A 2Y1NA 5FI6A 4QJ4B 1JWDA 1BJFA 4GGFC 2WNDA 3O2PA 3RZSA 2V53A 4I5KA 3S0DA 3PM2A 1ALWA 1BMOA 1NIWA 1OMRA 1SBJA 2K7BA 3NHTA 4KYNA 4BY4A 1G4YR 2L0PA 1JC2A 3TUYC 2TN4A 3I5IC 1GGZA 5DKNA 1EG4A 1QLKA 4MZKA 3BQ3A 1UP5A 1D1OA 4ORCB 1SCMC 2NCPA 2PMYA 2LMUA 1TRFA 2KOTA 2LVKA 4MZJA 5HLOA 5TNCA 1CLBA 3PN7B 5CSIA 1R2UA 1SRAA 2H61A 1FW4A 2KFHA 3AAJA 1AK8A 1BR4B 3GOFA 2KDHA 5K89A 1V1FA 4QJ5B 1F71A 2JZIA 1EH2A 3EK4A 2O5GA 4NDDA 1ZMZA 3LLEA 1QIVA 1K93D 5HKWA 3DD4A 1BT6A 3BFBA 4GGFA 1J55A 3UO9A 4BY5A 1Y1XA 1FF1A 3OX6A 1KWOB 4YGAA 2Y4QA 3I5HC 1N65A 3O4XA 1F54A 1MQ1A 3R72A 3UNWA 3EKJA 2A4JA 2KQYA 1OE9B 1SR6C 3I5FB 1TWOA 4PHJA 1FBVA 1SL8A 1ZUZA 1K9PA 3CABA 1QWVA 3CTNA 3IVTA 1CDPA 3Q8IA 1B1GA 2LHIA 2ZKMX 2OPOA 4AQJA 2KQ6A 4USLA 1RECA 1CFFA 1B8RA 2LM5A 1BOCA 3VRQA 3CZ0A 1S6IA 2L4IA 1K9KA 3H4SE 3TDIA 1WDCC 2FCDA 2JC2A 1KWOC 3NGVA 2LVIA 1GJYA 1QJTA 2JU0A 2OTGB 2HQWA 1B47A 3LK1A 4JPZB 4MRYA 5AFPA 2BL0B 1IJ5A 3CS1A 4MBEA 2WCEA 4PCWA 1QTXA 3B6XA 3OB1B 3CR4X 4Q04A 3IQOA 1NUBA 2PYQA 3O78A 2BAPA 4PE0A 1Z2CB 2WC8A 3CDNA 5DKRA 4C0JA 4INXA 1MUXA 1J1EA 2BBMA 3BUNB 4PE4A 2L50A 3FE6A 1M46A 2ZFDA 5AXIA 3R1OA 1LA3A 3B86A 1KQVA 1OOJA 1SL7A 2SASA 2CT9A 2PQLA 2IS9A 1MWNA 2OTGC 2WCKA 3DYEA 3D78A 2M3WA 3F45A 4OKHA 1TN4A 4AQIA 1JF2A 2BL0C 2F8PA 1DJZA 1CDMA 2CNPA 1DELA 4DRWA 2G2BA 2LUCA 2AMIA 2M9GA 5FI2A 3CGAA 1AHRA 2BKIB 4DIRA 3N7HA 2RGIA 4PE7A 1F70A 2BBNA 1ODBA 2JT8A 2LAPA 4ICBA 3RLZA 3EK8A 1B8CA 2LNKA 3BJHA 1S3PA 1LXFC 1PSRA 1RK9A 3KF9A 3R1PA 1PRWA 1CMGA 2KAYA 4IL1A 3JVTC 2WCJA 3D74A 1WLMA 1PVBA 2EC6C 2L5YA 4FQOA 1NSHA 3PLFB 1UUSA 2BE6A 1XFWO 2KI6D 1SYMA 3DVMA 3M0WA 1IJ6A 3EVRA 4HRHA 1DGVA 1OQPA 2B1UA 1TNWA 4P5OE 2H8VA 2QEHA 4YI8A 1DJXA 2YGUA 2Q91A 2WCBA 3OX5A 1LVCD 3CR5X 1K96A 1J7PA 5FI7A 3BUMB 3DVKA 4GBAA 2HETA 3D75A 2H61C 4I5JA 4NDBA 1H4BA 1K2HA 1DJGA 3ICBA 1DJIA 1BU3A 1HQVA 5D3OA 1N2DA 1CM4A 5B8IB 1BG1A 1CKKA 2M97A 1U5IB 2M49B 1GQMA 3EG5B 3FE9A 3ZNIA 2KLDA 2LLUA 3JTDB 1C07A 3SS5A 1QV0A 1JFKA 1S26D 1J1DA 4NQGA 1X02A 1G33A 5I2QA 1QATA 3K1EA 3GK1A 1CMFA 1QV1A 2M1KB 4MN0A 5I8NA 5HLVA 2KNEA 2PRUA 4YGEB 2ZRTA 2F3YA 2KFFA 4IJ7A 1OSAA 2ZRSA 5CPVA 2D8NA 2KLEA 2P70A 4F0ZB 4PE1A 2JTTA 2WCFA 1XFUO 2BKHB 2HF5A 3NSKA 4ETOA 4YRUA 1TCFA 2FJUB 2KSPA 2OS8B 4MEWA 3CLNA 4GAOA 1WRLA 1KK8B 1SMGA 2MHHA 4PT1A 3SJSA 1OOFA 3BFHA 3JTDC 1NWDA 4GGNA 2HPSA 3KHEA 3FE8A 1PSBA 1SNLA 1TTXA 1TUJA 1Y0VH 1XA5A 2E6WA 2WCHA 4ZCUA 3BOWB 1OMVA 4DS7A 3D77A 1QX2A 1A4PA 2QEVA 5FYXA 3IQQA 3S0GA 1UHJA 3EKHA 1QASA 2I94A 1NCZA 1RTP1 1ZACA 3SG3A 5CSNA 4MZLA 5KU1A 1JF0A 4PHKA 1S6CA 4YBHB 2LVVA 1XFXO 1CLLA 2OS8C 3I5GB 4C0LA 3NSOA 1NX0A 1YVLA 2SCPA 3PN7C 1WLZA 2F2PA 1PULA 3DVEA 1H8BA 4A4CA 4CLNA 4PHMA 3VRPA 5AANA 2K60A 3CYZA 1U5IA 2CBLA 2L2CA 2ZNDA 3SG4A 1P28A 4HSZA 2K7OA 1S36A 1HT9A 3KEVA 1YX7A 2LC5A 2WC6A 1PVAA 2F33A 2LLSA 1FI5A 3A8RA 3K21A 2K8MB 2BECA 1W7JB 2P71A 1MF8B 3NHIA 4WRIA 1JSAA 1WRKA 1CDNA 1KCYA 1T14A 3S0FA 1SW8A 1KFXL 2GTEA 2JRFA 2LCPA 1OOGA 1S5GY 1SPYA 3DY9A 3I5FC 2LV7A 3PALA 3AKAA 2WC5A 4PDZA 1A75B 3CR2A 1MXEA 3BUOB 1OZOA 1WRZA 2I7AA 2JQ6A 4MVFA 4NDCA 3S0BA 1IQ5A 2MA2A 3KPXA 2AAOA 4CFRA 3L4LA 3MSEB 4I5LB 1KFUL 3DZTA 1YURA 5KTYA 1YR5A 4ORAB 1FPWA 4JD9A 1IG5A 4R1EA 3ZWHA 1A03A 4HREE 3A4UB 3OP0A 1XFYO 3BOWA 1YUSA 2JNXA 3SG2A 3KO0A 1IGVA 1QX7A 2JPTA 3NSIA 1IKUA 1JBAA 1S5GZ 1DEKA 3L4AA 1SKTA 2PSRA 1XK4A 3WHTB 1JFJA 1EG3A 1EL4A 1EJ3A 4YGDB 1XO5A 1DF0B 3CZ1A 1A29A 3OGNA 4PALA 2LUXA 2CXJA 4AOMA 2L5XB 2MBXA 1XFRA 2CCMA 2QACA 3NXAA 3SG6A 3IF7A 5I2OA 1OZSA 2PVBA 3PSRA 3PJIA 2BCXA 1M31A 4P2YB 3NSLA 1DGUA 2K0JA 2KGBC 2KI4B 2GV5A 4MLWA 3WHUB 1C7VA 1MXLC 3RM1A 2JXCA 3D10A 1L2OB 4MRXA 3VRNA 2KBIA 1LA0A 1NYAA 3BFAA 3CWGA 1KFXS 4GPLB 3CZ2A 2NCOA 3LK0A 1UHNA 3DF0B 2H2KA 2K61A 5J3XA 3TS5B 3EK7A 4DUQA 4U8DA 1RFJA 1C7WA 1NX2A 2KPHA 1AUIB 2M8UA 1A75A 2WCMA 3O4YA 1KFUS 1K9UA 1Y6WA 1UHKA 1YUUA 1A2XA 2GGMA 3AKBA 2KYFA 2PASA 2K2AA 2Y5IA 2JWWA 2QPTA 2WCLA 5ER4X 1SCVA 1MHOA 2KI6C 3B88A 2L51A 5AEQA 2KBMA 4M2PA 1CB1A 4OCIA 4E68A 1L2OC 4GUKA 2LLTA 2MAZA 1QXPA 3FWBA 4UPGA 3AAKA 1B7TY 3QMEA 3TS5C 3TUYB 3I5IB 2KAXA 4JKTA 5JOLA 3TDUA 2BE4A 4XYNA 1DTLA 5D69A 1IQ3A 1DF0A 1SCMB 1DJHA 3QRXA 3SG7A 1BR1B 2MJWB 1JUOA 3D0YA 1NX3A 5BPJA 1UHIA 2L98A 4WQ2A 2KFGA 5DKQA 5ER5A 5JJGA 1YTZC 3V2LA 1AJ5A 1UHHA 2E30A 1M39A 3VRRA 1GM0A 1R6PA 3FIAA 2JTZA 1L7ZA 4CPVA 2JOJA 2I2RE 2L4HA 1ZFSA 1CM1A 1B7TZ 3DVJA 2CTNA 2LP3A 3SIBA 2O60A 1K90D 5KSZA 3I5HB 2COLB 3HCMA 1OW4A 1YX8A 1M45A 2MRDA 2FCEA 1RROA
chains in the Genus database with same CATH topology
1T14A 3S0FA 2GTEA 1LS8A 1OOGA 3DY9A 2QEBA 2WC5A 3BJHA 3S0BA 3R1PA 2QEOA 3L4LA 2WCJA 3DZTA 3D74A 4JD9A 3RZSA 3D73A 3S0DA 3S0AA 3D76A 3NHTA 3S0EA 3L4AA 2H8VA 2QEHA 1OOIX 3CZ1A 3OGNA 3B87A 3D75A 3VB1A 1XFRA 2ERBA 3FE9A 3PJIA 1OOHA 3BFBA 3K1EA 2JPOA 3BFAA 3CZ2A 3R72A 4FQTA 2P70A 2QDIA 1TWOA 3DXLA 4F7FA 2KPHA 3CABA 1QWVA 3Q8IA 2WCMA 4PT1A 1OOFA 3BFHA 1DQEA 4INWA 3CZ0A 2WCLA 3FE8A 3B88A 1TUJA 2WCHA 3D77A 3NGVA 1OW4A 3B7AA 2QEVA 5EL2A 3S0GA 1ORGA 3B6XA 3QMEA 1C3YA 4OZDA 3CDNA 4INXA 3FE6A 3L47A 3R1OA 3B86A 3CYZA 5DICA 3V2LA 2L2CA 1C3ZA 1GM0A 2PQLA 1P28A 3DYEA 2WCKA 3D78A 2WC6A 2FJYA 3NHIA 2P71A 3N7HA 3R1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T14 A;  3S0F A;  2GTE A;  1LS8 A;  1OOG A;  3DY9 A;  2QEB A;  2WC5 A;  3BJH A;  3S0B A;  3R1P A;  2QEO A;  3L4L A;  2WCJ A;  3DZT A;  3D74 A;  4JD9 A;  3RZS A;  3D73 A;  3S0D A;  3S0A A;  3D76 A;  3NHT A;  3S0E A;  3L4A A;  2H8V A;  2QEH A;  1OOI X;  3CZ1 A;  3OGN A;  3B87 A;  3D75 A;  3VB1 A;  1XFR A;  2ERB A;  3FE9 A;  3PJI A;  1OOH A;  3BFB A;  3K1E A;  2JPO A;  3BFA A;  3CZ2 A;  3R72 A;  4FQT A;  2P70 A;  2QDI A;  1TWO A;  3DXL A;  4F7F A;  2KPH A;  3CAB A;  1QWV A;  3Q8I A;  2WCM A;  4PT1 A;  1OOF A;  3BFH A;  1DQE A;  4INW A;  3CZ0 A;  2WCL A;  3FE8 A;  3B88 A;  1TUJ A;  2WCH A;  3D77 A;  3NGV A;  1OW4 A;  3B7A A;  2QEV A;  5EL2 A;  3S0G A;  1ORG A;  3B6X A;  3QME A;  1C3Y A;  4OZD A;  3CDN A;  4INX A;  3FE6 A;  3L47 A;  3R1O A;  3B86 A;  3CYZ A;  5DIC A;  3V2L A;  2L2C A;  1C3Z A;  1GM0 A;  2PQL A;  1P28 A;  3DYE A;  2WCK A;  3D78 A;  2WC6 A;  2FJY A;  3NHI A;  2P71 A;  3N7H A;  3R1V A; 
#chains in the Genus database with same CATH topology
 1F55 A;  2GGZ A;  3DF0 A;  1Q80 A;  2WOS A;  1SR6 B;  2BCA A;  3WXA A;  2QEB A;  1CFP A;  4JWQ A;  1PAL A;  5CSF A;  1PK0 D;  1KK8 C;  1KQM B;  1NX1 A;  2NZ0 A;  3EVV A;  1AP4 A;  1G8I A;  1CDL A;  1S1E A;  5HKZ A;  4N5X A;  3O6B A;  2F3Z A;  2LHL A;  4N1F A;  1CFD A;  1QVI Y;  1XVJ A;  5PAL A;  1WDC B;  3CZT X;  3D73 A;  1IWQ A;  1B8L A;  1IH0 A;  1CTR A;  1SSE B;  1TOP A;  4CID A;  4JQ0 D;  2F2O A;  3SG5 A;  1LKJ A;  3D76 A;  3TZ1 A;  4OVN F;  5IBW A;  3S0E A;  3S0A A;  1J7Q A;  1DMO A;  1XK4 C;  4YGB B;  2DOQ A;  4D1E A;  4HRG A;  2P6B B;  2ISD A;  1QS7 A;  2K7D A;  1OOI X;  3SS4 A;  3GK4 X;  3I5G C;  2JNF A;  1TNQ A;  3B87 A;  3OB2 B;  4MSP A;  1KQM C;  2ZN9 A;  3VB1 A;  1FI6 A;  1IRJ A;  1B9A A;  1TCO B;  1NCY A;  1S6J A;  3VRO A;  1QVI Z;  2JXL A;  4A4B A;  2LVJ A;  2ERB A;  2LE9 B;  3E3R A;  1OMD A;  2M1U A;  1DVI A;  3PFV A;  2I18 A;  3EVU A;  2BNX A;  4I5N B;  1OOH A;  2EHB A;  1QIW A;  3PM8 A;  3TDZ A;  1BOD A;  1ALV A;  4OV2 A;  1NPQ A;  2M7L A;  1N0Y A;  2JPO A;  2JUL A;  1DJW A;  2HQ8 A;  2ZN8 A;  2L2E A;  3BUW B;  1EXR A;  5CSJ A;  5HL1 A;  2LMV A;  4FQT A;  1TUZ A;  4C0K A;  1CFC A;  3VGO A;  1WY9 A;  2M0R A;  2QDI A;  5GQQ C;  4GFT A;  1QX5 B;  2KHN A;  2LMT A;  3DXL A;  4F7F A;  2BCB A;  4L9M A;  4ORB B;  1SK6 D;  3D0Y B;  2FOT A;  2JT3 A;  2MLE C;  4XJK B;  3OHM B;  1AVS A;  4M2Q A;  1E8A A;  1SY9 A;  1B4C A;  1RWY A;  1Y1A A;  1DQE A;  1XFZ O;  3LL8 B;  1RJV A;  4INW A;  1K95 A;  3JVT B;  1UUR A;  3SS3 A;  2KAV A;  2EC6 B;  1F4O A;  4YGC B;  3C1V A;  3SIA A;  4FTG A;  2WOR A;  4N1G A;  3B7A A;  5EL2 A;  5I2L A;  1K94 A;  2K7C A;  3BYA A;  5I94 A;  1YRU B;  3GK2 A;  2M7N A;  1AJ4 A;  1F4Q A;  1ORG A;  1QLS A;  2VRG A;  2Y1M A;  4PHN A;  1Z4H A;  1MR8 A;  1NP8 A;  1W7I B;  5HKY A;  1C3Y A;  3PAT A;  1GGW A;  1W9Z A;  3OBV A;  2MLF C;  4OR9 B;  4OZD A;  4QJ3 B;  4WQ3 A;  1BLQ A;  4CFQ A;  2K2F A;  3HX4 A;  1J7R A;  2R2I A;  3FWC A;  1YVH A;  3L47 A;  4M2O A;  2AUC A;  1K8U A;  5DIC A;  1CLM A;  1KK7 Y;  2LAN A;  1C3Z A;  2LP2 A;  2Q4U A;  1ZOT B;  4YI9 A;  5D7F A;  1BF5 A;  1TIZ A;  1J7O A;  2KI4 C;  1IIO A;  1XFV O;  1DC1 A;  1LIN A;  5AER A;  2FJY A;  1KSO A;  1SL9 A;  2KGR A;  1XYD A;  4TNC A;  1CNP A;  4ZCV A;  3BXK A;  3R1V A;  1YUT A;  1TNP A;  1Y1U A;  1LS8 A;  2NLN A;  2NXQ A;  1UWO A;  2ZNE A;  4GNK B;  1F8H A;  3FS7 A;  3WNX B;  1TNX A;  1V1G A;  3BUX B;  5HYD A;  1NCX A;  4XJK A;  1KSM A;  1KK7 Z;  2M29 A;  1VRK A;  2EGD A;  4DCK A;  1DJY A;  2G9B A;  1M63 B;  2PAL A;  5F6T A;  5G08 A;  1DT7 B;  2QEO A;  3LCP C;  1YRT B;  2KYC A;  2JT0 A;  2Y1N A;  5FI6 A;  4QJ4 B;  1JWD A;  1BJF A;  4GGF C;  2WND A;  3O2P A;  3RZS A;  2V53 A;  4I5K A;  3S0D A;  3PM2 A;  1ALW A;  1BMO A;  1NIW A;  1OMR A;  1SBJ A;  2K7B A;  3NHT A;  4KYN A;  4BY4 A;  1G4Y R;  2L0P A;  1JC2 A;  3TUY C;  2TN4 A;  3I5I C;  1GGZ A;  5DKN A;  1EG4 A;  1QLK A;  4MZK A;  3BQ3 A;  1UP5 A;  1D1O A;  4ORC B;  1SCM C;  2NCP A;  2PMY A;  2LMU A;  1TRF A;  2KOT A;  2LVK A;  4MZJ A;  5HLO A;  5TNC A;  1CLB A;  3PN7 B;  5CSI A;  1R2U A;  1SRA A;  2H61 A;  1FW4 A;  2KFH A;  3AAJ A;  1AK8 A;  1BR4 B;  3GOF A;  2KDH A;  5K89 A;  1V1F A;  4QJ5 B;  1F71 A;  2JZI A;  1EH2 A;  3EK4 A;  2O5G A;  4NDD A;  1ZMZ A;  3LLE A;  1QIV A;  1K93 D;  5HKW A;  3DD4 A;  1BT6 A;  3BFB A;  4GGF A;  1J55 A;  3UO9 A;  4BY5 A;  1Y1X A;  1FF1 A;  3OX6 A;  1KWO B;  4YGA A;  2Y4Q A;  3I5H C;  1N65 A;  3O4X A;  1F54 A;  1MQ1 A;  3R72 A;  3UNW A;  3EKJ A;  2A4J A;  2KQY A;  1OE9 B;  1SR6 C;  3I5F B;  1TWO A;  4PHJ A;  1FBV A;  1SL8 A;  1ZUZ A;  1K9P A;  3CAB A;  1QWV A;  3CTN A;  3IVT A;  1CDP A;  3Q8I A;  1B1G A;  2LHI A;  2ZKM X;  2OPO A;  4AQJ A;  2KQ6 A;  4USL A;  1REC A;  1CFF A;  1B8R A;  2LM5 A;  1BOC A;  3VRQ A;  3CZ0 A;  1S6I A;  2L4I A;  1K9K A;  3H4S E;  3TDI A;  1WDC C;  2FCD A;  2JC2 A;  1KWO C;  3NGV A;  2LVI A;  1GJY A;  1QJT A;  2JU0 A;  2OTG B;  2HQW A;  1B47 A;  3LK1 A;  4JPZ B;  4MRY A;  5AFP A;  2BL0 B;  1IJ5 A;  3CS1 A;  4MBE A;  2WCE A;  4PCW A;  1QTX A;  3B6X A;  3OB1 B;  3CR4 X;  4Q04 A;  3IQO A;  1NUB A;  2PYQ A;  3O78 A;  2BAP A;  4PE0 A;  1Z2C B;  2WC8 A;  3CDN A;  5DKR A;  4C0J A;  4INX A;  1MUX A;  1J1E A;  2BBM A;  3BUN B;  4PE4 A;  2L50 A;  3FE6 A;  1M46 A;  2ZFD A;  5AXI A;  3R1O A;  1LA3 A;  3B86 A;  1KQV A;  1OOJ A;  1SL7 A;  2SAS A;  2CT9 A;  2PQL A;  2IS9 A;  1MWN A;  2OTG C;  2WCK A;  3DYE A;  3D78 A;  2M3W A;  3F45 A;  4OKH A;  1TN4 A;  4AQI A;  1JF2 A;  2BL0 C;  2F8P A;  1DJZ A;  1CDM A;  2CNP A;  1DEL A;  4DRW A;  2G2B A;  2LUC A;  2AMI A;  2M9G A;  5FI2 A;  3CGA A;  1AHR A;  2BKI B;  4DIR A;  3N7H A;  2RGI A;  4PE7 A;  1F70 A;  2BBN A;  1ODB A;  2JT8 A;  2LAP A;  4ICB A;  3RLZ A;  3EK8 A;  1B8C A;  2LNK A;  3BJH A;  1S3P A;  1LXF C;  1PSR A;  1RK9 A;  3KF9 A;  3R1P A;  1PRW A;  1CMG A;  2KAY A;  4IL1 A;  3JVT C;  2WCJ A;  3D74 A;  1WLM A;  1PVB A;  2EC6 C;  2L5Y A;  4FQO A;  1NSH A;  3PLF B;  1UUS A;  2BE6 A;  1XFW O;  2KI6 D;  1SYM A;  3DVM A;  3M0W A;  1IJ6 A;  3EVR A;  4HRH A;  1DGV A;  1OQP A;  2B1U A;  1TNW A;  4P5O E;  2H8V A;  2QEH A;  4YI8 A;  1DJX A;  2YGU A;  2Q91 A;  2WCB A;  3OX5 A;  1LVC D;  3CR5 X;  1K96 A;  1J7P A;  5FI7 A;  3BUM B;  3DVK A;  4GBA A;  2HET A;  3D75 A;  2H61 C;  4I5J A;  4NDB A;  1H4B A;  1K2H A;  1DJG A;  3ICB A;  1DJI A;  1BU3 A;  1HQV A;  5D3O A;  1N2D A;  1CM4 A;  5B8I B;  1BG1 A;  1CKK A;  2M97 A;  1U5I B;  2M49 B;  1GQM A;  3EG5 B;  3FE9 A;  3ZNI A;  2KLD A;  2LLU A;  3JTD B;  1C07 A;  3SS5 A;  1QV0 A;  1JFK A;  1S26 D;  1J1D A;  4NQG A;  1X02 A;  1G33 A;  5I2Q A;  1QAT A;  3K1E A;  3GK1 A;  1CMF A;  1QV1 A;  2M1K B;  4MN0 A;  5I8N A;  5HLV A;  2KNE A;  2PRU A;  4YGE B;  2ZRT A;  2F3Y A;  2KFF A;  4IJ7 A;  1OSA A;  2ZRS A;  5CPV A;  2D8N A;  2KLE A;  2P70 A;  4F0Z B;  4PE1 A;  2JTT A;  2WCF A;  1XFU O;  2BKH B;  2HF5 A;  3NSK A;  4ETO A;  4YRU A;  1TCF A;  2FJU B;  2KSP A;  2OS8 B;  4MEW A;  3CLN A;  4GAO A;  1WRL A;  1KK8 B;  1SMG A;  2MHH A;  4PT1 A;  3SJS A;  1OOF A;  3BFH A;  3JTD C;  1NWD A;  4GGN A;  2HPS A;  3KHE A;  3FE8 A;  1PSB A;  1SNL A;  1TTX A;  1TUJ A;  1Y0V H;  1XA5 A;  2E6W A;  2WCH A;  4ZCU A;  3BOW B;  1OMV A;  4DS7 A;  3D77 A;  1QX2 A;  1A4P A;  2QEV A;  5FYX A;  3IQQ A;  3S0G A;  1UHJ A;  3EKH A;  1QAS A;  2I94 A;  1NCZ A;  1RTP 1;  1ZAC A;  3SG3 A;  5CSN A;  4MZL A;  5KU1 A;  1JF0 A;  4PHK A;  1S6C A;  4YBH B;  2LVV A;  1XFX O;  1CLL A;  2OS8 C;  3I5G B;  4C0L A;  3NSO A;  1NX0 A;  1YVL A;  2SCP A;  3PN7 C;  1WLZ A;  2F2P A;  1PUL A;  3DVE A;  1H8B A;  4A4C A;  4CLN A;  4PHM A;  3VRP A;  5AAN A;  2K60 A;  3CYZ A;  1U5I A;  2CBL A;  2L2C A;  2ZND A;  3SG4 A;  1P28 A;  4HSZ A;  2K7O A;  1S36 A;  1HT9 A;  3KEV A;  1YX7 A;  2LC5 A;  2WC6 A;  1PVA A;  2F33 A;  2LLS A;  1FI5 A;  3A8R A;  3K21 A;  2K8M B;  2BEC A;  1W7J B;  2P71 A;  1MF8 B;  3NHI A;  4WRI A;  1JSA A;  1WRK A;  1CDN A;  1KCY A;  1T14 A;  3S0F A;  1SW8 A;  1KFX L;  2GTE A;  2JRF A;  2LCP A;  1OOG A;  1S5G Y;  1SPY A;  3DY9 A;  3I5F C;  2LV7 A;  3PAL A;  3AKA A;  2WC5 A;  4PDZ A;  1A75 B;  3CR2 A;  1MXE A;  3BUO B;  1OZO A;  1WRZ A;  2I7A A;  2JQ6 A;  4MVF A;  4NDC A;  3S0B A;  1IQ5 A;  2MA2 A;  3KPX A;  2AAO A;  4CFR A;  3L4L A;  3MSE B;  4I5L B;  1KFU L;  3DZT A;  1YUR A;  5KTY A;  1YR5 A;  4ORA B;  1FPW A;  4JD9 A;  1IG5 A;  4R1E A;  3ZWH A;  1A03 A;  4HRE E;  3A4U B;  3OP0 A;  1XFY O;  3BOW A;  1YUS A;  2JNX A;  3SG2 A;  3KO0 A;  1IGV A;  1QX7 A;  2JPT A;  3NSI A;  1IKU A;  1JBA A;  1S5G Z;  1DEK A;  3L4A A;  1SKT A;  2PSR A;  1XK4 A;  3WHT B;  1JFJ A;  1EG3 A;  1EL4 A;  1EJ3 A;  4YGD B;  1XO5 A;  1DF0 B;  3CZ1 A;  1A29 A;  3OGN A;  4PAL A;  2LUX A;  2CXJ A;  4AOM A;  2L5X B;  2MBX A;  1XFR A;  2CCM A;  2QAC A;  3NXA A;  3SG6 A;  3IF7 A;  5I2O A;  1OZS A;  2PVB A;  3PSR A;  3PJI A;  2BCX A;  1M31 A;  4P2Y B;  3NSL A;  1DGU A;  2K0J A;  2KGB C;  2KI4 B;  2GV5 A;  4MLW A;  3WHU B;  1C7V A;  1MXL C;  3RM1 A;  2JXC A;  3D10 A;  1L2O B;  4MRX A;  3VRN A;  2KBI A;  1LA0 A;  1NYA A;  3BFA A;  3CWG A;  1KFX S;  4GPL B;  3CZ2 A;  2NCO A;  3LK0 A;  1UHN A;  3DF0 B;  2H2K A;  2K61 A;  5J3X A;  3TS5 B;  3EK7 A;  4DUQ A;  4U8D A;  1RFJ A;  1C7W A;  1NX2 A;  2KPH A;  1AUI B;  2M8U A;  1A75 A;  2WCM A;  3O4Y A;  1KFU S;  1K9U A;  1Y6W A;  1UHK A;  1YUU A;  1A2X A;  2GGM A;  3AKB A;  2KYF A;  2PAS A;  2K2A A;  2Y5I A;  2JWW A;  2QPT A;  2WCL A;  5ER4 X;  1SCV A;  1MHO A;  2KI6 C;  3B88 A;  2L51 A;  5AEQ A;  2KBM A;  4M2P A;  1CB1 A;  4OCI A;  4E68 A;  1L2O C;  4GUK A;  2LLT A;  2MAZ A;  1QXP A;  3FWB A;  4UPG A;  3AAK A;  1B7T Y;  3QME A;  3TS5 C;  3TUY B;  3I5I B;  2KAX A;  4JKT A;  5JOL A;  3TDU A;  2BE4 A;  4XYN A;  1DTL A;  5D69 A;  1IQ3 A;  1DF0 A;  1SCM B;  1DJH A;  3QRX A;  3SG7 A;  1BR1 B;  2MJW B;  1JUO A;  3D0Y A;  1NX3 A;  5BPJ A;  1UHI A;  2L98 A;  4WQ2 A;  2KFG A;  5DKQ A;  5ER5 A;  5JJG A;  1YTZ C;  3V2L A;  1AJ5 A;  1UHH A;  2E30 A;  1M39 A;  3VRR A;  1GM0 A;  1R6P A;  3FIA A;  2JTZ A;  1L7Z A;  4CPV A;  2JOJ A;  2I2R E;  2L4H A;  1ZFS A;  1CM1 A;  1B7T Z;  3DVJ A;  2CTN A;  2LP3 A;  3SIB A;  2O60 A;  1K90 D;  5KSZ A;  3I5H B;  2COL B;  3HCM A;  1OW4 A;  1YX8 A;  1M45 A;  2MRD A;  2FCE A;  1RRO A; 
#chains in the Genus database with same CATH homology
 1T14 A;  3S0F A;  2GTE A;  1LS8 A;  1OOG A;  3DY9 A;  2QEB A;  2WC5 A;  3BJH A;  3S0B A;  3R1P A;  2QEO A;  3L4L A;  2WCJ A;  3DZT A;  3D74 A;  4JD9 A;  3RZS A;  3D73 A;  3S0D A;  3S0A A;  3D76 A;  3NHT A;  3S0E A;  3L4A A;  2H8V A;  2QEH A;  1OOI X;  3CZ1 A;  3OGN A;  3B87 A;  3D75 A;  3VB1 A;  1XFR A;  2ERB A;  3FE9 A;  3PJI A;  1OOH A;  3BFB A;  3K1E A;  2JPO A;  3BFA A;  3CZ2 A;  3R72 A;  4FQT A;  2P70 A;  2QDI A;  1TWO A;  3DXL A;  4F7F A;  2KPH A;  3CAB A;  1QWV A;  3Q8I A;  2WCM A;  4PT1 A;  1OOF A;  3BFH A;  1DQE A;  4INW A;  3CZ0 A;  2WCL A;  3FE8 A;  3B88 A;  1TUJ A;  2WCH A;  3D77 A;  3NGV A;  1OW4 A;  3B7A A;  2QEV A;  5EL2 A;  3S0G A;  1ORG A;  3B6X A;  3QME A;  1C3Y A;  4OZD A;  3CDN A;  4INX A;  3FE6 A;  3L47 A;  3R1O A;  3B86 A;  3CYZ A;  5DIC A;  3V2L A;  2L2C A;  1C3Z A;  1GM0 A;  2PQL A;  1P28 A;  3DYE A;  2WCK A;  3D78 A;  2WC6 A;  2FJY A;  3NHI A;  2P71 A;  3N7H A;  3R1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...