3SJSA

Crystal structure of ure3-binding protein from entamoeba histolytica, (d127a,n129a) mutant, native form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
212
Chain Sequence
NFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNARARSGTLEPHEILPALQQLGFYINQRTSLLLHRLFAMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
total genus 74
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sjsA01
3CGAA 3BUMB 4DIRA 1H8BA 1FF1A 2ZRSA 1QX7A 2L2EA 1D1OA 1TNWA 2M3WA 3TDUA 2KFFA 2F2PA 1BODA 2FCEA 1DGVA 1TIZA 1XK4A 1LA3A 3E3RA 4E68A 1KFUL 1WY9A 4PDZA 2E6WA 2LLUA 1NWDA 2ZN9A 5IBWA 1Y0VH 1QATA 1S6IA 4I5LB 1JUOA 1R2UA 1U5IB 4C0LA 1A75B 3NSLA 1JF0A 1SNLA 4XJKB 3D0YB 2ZRTA 4R1EA 4GUKA 1CLLA 1F71A 4JQ0D 2JXLA 2I18A 3KO0A 4OCIA 2F3ZA 3TDZA 2M49B 1QTXA 4GAOA 2KAYA 1F4OA 1KSOA 1MUXA 2K7BA 5F6TA 1J1DA 1SMGA 1DF0B 3SG4A 3SJSA 5TNCA 1CB1A 1YR5A 2ZN8A 1GJYA 1U5IA 1PVAA 2KYFA 1CDLA 1NPQA 1WLZA 5G08A 3D0YA 1SY9A 1W7JB 4WQ2A 1KWOC 5HKYA 1G33A 2LE9B 4HRHA 1EG4A 4GPLB 1TRFA 3AAJA 2KNEA 1AUIB 2BECA 2EC6C 1JC2A 3O6BA 1IJ6A 1ZACA 4PHJA 5JOLA 1S1EA 1BU3A 4MN0A 3SG7A 4MZLA 3CR4X 3I5FB 3CZTX 1DF0A 2LMUA 3AAKA 1M46A 3I5IB 3RLZA 1DJXA 3OX6A 3BOWB 3VGOA 1PALA 1FI6A 1GGWA 4ZCUA 3BUOB 1UHKA 3CR5X 3EVUA 1NX0A 1AK8A 2MA2A 1F8HA 3TUYC 1UHJA 5HKWA 1CM4A 1K9KA 4N1FA 2M7LA 5ER5A 2K2FA 2D8NA 1Y1UA 2RGIA 2HQ8A 3CS1A 3PLFB 3I5HB 4CFRA 1J7OA 2LLTA 3GK1A 1RK9A 2KQ6A 4GGNA 2ZNEA 1AP4A 1K94A 3AKAA 3HCMA 2Y1MA 2LMTA 1QVIY 2K61A 2KFGA 1V1FA 1QS7A 2BE4A 5D7FA 4DUQA 2OTGB 1B47A 1IG5A 1CM1A 1F4QA 1K9PA 3KPXA 1AJ4A 3BOWA 2K7DA 2LLSA 1BR1B 1QV0A 3FS7A 5DKQA 5AANA 5HYDA 2LMVA 1BMOA 3ICBA 1KQMC 4YGBB 2JT3A 4I5KA 3JTDC 1IH0A 1XFWO 4USLA 2K7OA 1ZFSA 2NXQA 4YGAA 1J7QA 1PVBA 4DRWA 4FQOA 3DD4A 2R2IA 1SL9A 5HKZA 2VRGA 3LK1A 2MBXA 4TNCA 1QV1A 1IGVA 1EH2A 2P6BB 1XK4C 2ZKMX 2BL0C 5CSFA 1ALWA 2JT8A 2LVKA 1B7TZ 3PFVA 4YBHB 1S6JA 2LP3A 3KF9A 4N1GA 1MF8B 1K93D 1BOCA 3HX4A 4N5XA 1HQVA 1UHIA 1YVHA 2LAPA 2OS8B 4M2QA 1SBJA 2HF5A 2WC8A 4L9MA 1CFFA 1NYAA 2JWWA 5AEQA 3WNXB 1A4PA 1QXPA 2Y5IA 2H2KA 3FIAA 1XYDA 4AOMA 1CDPA 4I5JA 2FCDA 1AVSA 1BR4B 2I7AA 3SG6A 5I2OA 1OMRA 1PK0D 2Y1NA 3K21A 1XVJA 1X02A 2JULA 3FWCA 2SCPA 5DKNA 1PSRA 1S5GZ 2K8MB 3OP0A 4QJ3B 3CWGA 1QIWA 4ORBB 1WRLA 1FI5A 1FPWA 2NCPA 4P2YB 3LLEA 4ZCVA 3BUWB 2JT0A 1CDMA 2G9BA 1MHOA 1CDNA 1SRAA 1UUSA 4PE1A 1SKTA 2KSPA 3DF0A 3QRXA 4QJ4B 5K89A 2BE6A 3BUNB 2KI6D 1Q80A 2IS9A 1XFYO 2PASA 5DKRA 3LK0A 2CBLA 2KDHA 1S6CA 1XO5A 1TCFA 1B8CA 4FTGA 1LVCD 2F3YA 1EJ3A 1E8AA 1SYMA 2L0PA 2WOSA 1DJGA 3EK4A 3TDIA 1KFXS 3OX5A 4DS7A 2JNXA 2LVVA 3NXAA 1XFXO 1K90D 4P5OE 5KTYA 1KK8B 1K2HA 1AJ5A 4MRYA 5HLOA 1C07A 1TN4A 1TNPA 4OR9B 1B4CA 1LA0A 1JBAA 1JF2A 1WLMA 1NCZA 2LP2A 2KGRA 3EKHA 1IWQA 2CTNA 3I5IC 2I2RE 3I5FC 3I5GB 1J55A 1M39A 3ZWHA 2Y4QA 2ZFDA 4GGFC 2QACA 1KK7Y 1EG3A 3TS5B 1A75A 1HT9A 2ZNDA 4NDCA 1RJVA 1N2DA 4XJKA 1N65A 3OB2B 2KYCA 1Y6WA 2BCAA 1L2OB 3PN7B 4ORAB 3PM8A 2KAVA 1NX3A 5FYXA 1MXEA 3M0WA 1DVIA 2LHIA 3I5HC 1WDCB 4YRUA 4WRIA 1MQ1A 3CTNA 3EKJA 3BQ3A 4YGDB 1R6PA 4CLNA 5I8NA 3PSRA 2O5GA 2OTGC 1CMFA 5CSIA 1IQ5A 4GBAA 3TZ1A 1K8UA 1KFXL 1TNXA 1XFZO 1MR8A 1YTZC 1S26D 2KBIA 1QASA 2HETA 2M9GA 3A4UB 3C1VA 1XFUO 3EK7A 3IQQA 1DT7B 2F2OA 2L98A 1H4BA 2BKHB 2JPTA 1S3PA 2L4HA 2PVBA 3BYAA 3JVTB 1JWDA 4CFQA 4PCWA 4D1EA 1SR6B 3WHUB 1B8LA 2MLEC 3VROA 1WRKA 2OPOA 1NIWA 4CIDA 1F55A 3NSIA 4MSPA 2LANA 5BPJA 1ZOTB 4MRXA 2M7NA 1DGUA 2GV5A 4PE0A 3O78A 4NDDA 3VRRA 2NCOA 1K96A 2MHHA 1IKUA 2OS8C 3RM1A 3DVEA 3PATA 1NSHA 3GK4X 4AQJA 2BCXA 1CFCA 1BT6A 2JC2A 5AERA 3VRQA 3H4SE 3SIAA 5CSJA 1L7ZA 4C0KA 2QPTA 1KQVA 2NZ0A 2O60A 1FW4A 4BY4A 4YI8A 1FBVA 3WHTB 1ALVA 3CLNA 4GFTA 1M45A 1IQ3A 1EXRA 1WRZA 2KHNA 1Y1XA 2LUCA 4ICBA 1K95A 4OVNF 2JTTA 4A4BA 1ZMZA 1OQPA 3GK2A 2L50A 2LVJA 1J7RA 3O2PA 3D10A 2KI4B 2ISDA 5I2LA 1DMOA 1C7WA 4U8DA 2I94A 1CLMA 1SL7A 1ODBA 1OMVA 4CPVA 1MWNA 3IQOA 1B7TY 1YVLA 1DJIA 2TN4A 2LUXA 1OMDA 3NSKA 1LXFC 1NUBA 1OE9B 1PSBA 2A4JA 2L4IA 1LKJA 1XFVO 2G2BA 2WCBA 4HSZA 1KCYA 4MEWA 2WCEA 2KOTA 1BLQA 1KK8C 2BBNA 4PE7A 2COLB 1J7PA 2JOJA 3SG3A 4WQ3A 2KAXA 4YGEB 1XA5A 3I5GC 5D69A 2CNPA 2JU0A 1SCMC 2BBMA 2F8PA 2AMIA 2AUCA 1UHNA 2JRFA 4MZKA 3LCPC 3TS5C 5HLVA 1DJHA 2E30A 2LCPA 1YRTB 2L5XB 4ETOA 3F45A 3PN7C 1L2OC 4UPGA 4PE4A 4HREE 2PSRA 1UWOA 1AHRA 1IJ5A 5GQQC 2L51A 1G4YR 1WDCC 2HPSA 1EL4A 2LNKA 1QJTA 1GQMA 4ORCB 1RROA 2PALA 4MVFA 1MXLC 1CNPA 2Q91A 1KK7Z 4MLWA 1SCMB 2Q4UA 3OHMB 4JWQA 1A2XA 1BJFA 1QLKA 3BXKA 3EVVA 3A8RA 4M2PA 1K9UA 2M29A 1SPYA 3IF7A 1SL8A 1QX2A 3JVTC 1CFDA 5KU1A 1RWYA 1SR6C 1NCXA 3AKBA 3WXAA 1YUUA 3LL8B 4OV2A 1NX1A 4DCKA 2MAZA 3KEVA 3SIBA 2LHLA 1B9AA 1QX5B 4OKHA 3SG2A 4YGCB 1DJYA 1SW8A 4PHKA 1B8RA 2PMYA 2LM5A 2LVIA 2PRUA 2M1KB 1YX8A 2EHBA 2LC5A 1F70A 2CT9A 1OZSA 4NQGA 2JTZA 3FWBA 4MBEA 3EVRA 4QJ5B 4NDBA 1N0YA 1QVIZ 1UP5A 3GOFA 2M0RA 2BKIB 3KHEA 4XYNA 3SG5A 2MJWB 3EK8A 1S36A 2WNDA 3DVJA 2GGMA 2KI6C 1YUTA 2CCMA 1BG1A 1GGZA 2KBMA 1KWOB 3BUXB 1DTLA 1TCOB 2B1UA 1C7VA 2M97A 1TOPA 1RFJA 2FJUB 1A03A 2EC6B 1YURA 1YX7A 2BCBA 2AAOA 3NSOA 2KI4C 2M1UA 4GNKB 1RECA 5ER4X 3VRPA 5J3XA 2WCFA 2GGZA 4YI9A 2CXJA 1F54A 4GGFA 5B8IB 4MZJA 1UHHA 1TTXA 4BY5A 2MLFC 1SK6D 2H61C 1LINA 3TUYB 1CKKA 1W7IB 5JJGA 4PHMA 2JXCA 1OZOA 1RTP1 3ZNIA 1IRJA 1PULA 4A4CA 1A29A 1G8IA 1OOJA 1VRKA 2HQWA 2KFHA 1JFJA 1KSMA 5KSZA 2DOQA 1M31A 3CR2A 4M2OA 1DJZA 1JFKA 4PALA 2NLNA 2FOTA 1DJWA 1UURA 4PHNA 1BF5A 4I5NB 5AFPA 3OB1B 1KFUS 1QIVA 4JPZB 5CSNA 5AXIA 3O4YA 5CPVA 1KQMB 2SASA 1NX2A 1NP8A 1J1EA 1V1GA 2JQ6A 1ZUZA 3JTDB 1SCVA 3MSEB 4C0JA 2WORA 4F0ZB 4IL1A 1CLBA 1CTRA 1PRWA 4Q04A 5PALA 4AQIA 2LV7A 2F33A 1TNQA 3DF0B 2JNFA 1Y1AA 4HRGA 2K2AA 1OSAA 2K7CA 2BL0B 3PALA 1QLSA 2V53A 3DVMA 1YUSA 1M63B 3DVKA 1NCYA 2KQYA 5I2QA 1YRUB 1JSAA 2K0JA 2M8UA 2MRDA 2JZIA 1CMGA 2KGBC 1CFPA 3VRNA 2H61A 2EGDA 1B1GA 1S5GY
chains in the Genus database with same CATH superfamily
3CGAA 3BUMB 4DIRA 1H8BA 1FF1A 2ZRSA 1QX7A 2L2EA 1D1OA 1TNWA 2M3WA 3TDUA 2KFFA 2F2PA 1BODA 2FCEA 1DGVA 1TIZA 5EL2A 3L4LA 3B86A 1XK4A 1LA3A 1Z2CB 3E3RA 4E68A 1KFUL 1WY9A 3D76A 4PDZA 2E6WA 2LLUA 1NWDA 2ZN9A 2L5YA 5IBWA 1Y0VH 1QATA 1S6IA 4I5LB 1JUOA 1R2UA 1U5IB 4C0LA 1A75B 3NSLA 1JF0A 1SNLA 4KYNA 3D0YB 4XJKB 2ZRTA 4R1EA 4GUKA 1CLLA 1F71A 4IJ7A 4JQ0D 2JXLA 2I18A 3KO0A 1QWVA 4OCIA 2F3ZA 3DY9A 3TDZA 2M49B 1QTXA 4GAOA 2KAYA 1F4OA 1KSOA 1MUXA 2K7BA 5F6TA 1J1DA 1SMGA 1DF0B 3SG4A 3SJSA 5TNCA 1CB1A 1YR5A 2ZN8A 1GJYA 1U5IA 1PVAA 2KYFA 1CDLA 1NPQA 1WLZA 5G08A 3D0YA 1SY9A 1W7JB 4WQ2A 1KWOC 5HKYA 1G33A 2LE9B 4HRHA 1EG4A 4GPLB 1TRFA 3AAJA 2KNEA 1AUIB 2BECA 2EC6C 3CABA 1JC2A 3O6BA 1IJ6A 1ZACA 4PHJA 5DICA 5JOLA 1S1EA 1BU3A 4MN0A 3SG7A 4MZLA 3CR4X 3I5FB 3CZTX 1DF0A 2LMUA 3AAKA 1M46A 3I5IB 4OZDA 3RLZA 1DJXA 3OX6A 3BOWB 3VGOA 1PALA 2WCMA 1FI6A 4ZCUA 1GGWA 3BUOB 1UHKA 3CR5X 3DYEA 3EVUA 1NX0A 1AK8A 1C3ZA 2MA2A 1F8HA 3TUYC 1UHJA 5HKWA 1CM4A 1K9KA 4N1FA 2M7LA 2ERBA 5ER5A 2K2FA 1TUZA 2D8NA 1Y1UA 2RGIA 2HQ8A 3CS1A 3PLFB 3I5HB 4CFRA 1J7OA 1DQEA 2LLTA 3GK1A 1RK9A 2KQ6A 4GGNA 2ZNEA 2KLEA 1AP4A 1K94A 3AKAA 3HCMA 2Y1MA 1W9ZA 1QVIY 2LMTA 2K61A 2KFGA 1V1FA 1QS7A 2BE4A 5D7FA 4DUQA 2OTGB 1B47A 1IG5A 1CM1A 1F4QA 1K9PA 3KPXA 1AJ4A 3BOWA 2K7DA 2LLSA 1BR1B 1QV0A 3FS7A 3R1PA 5DKQA 5AANA 2YGUA 2LMVA 1BMOA 3ICBA 1KQMC 3NGVA 3L47A 4YGBB 2JT3A 4I5KA 3JTDC 1IH0A 1XFWO 4USLA 2K7OA 1ZFSA 2NXQA 4YGAA 1J7QA 1PVBA 4DRWA 4FQOA 3DD4A 2R2IA 1SL9A 5HKZA 2VRGA 3LK1A 2MBXA 4TNCA 1QV1A 1IGVA 1EH2A 2P6BB 3D75A 1XK4C 2ZKMX 2BL0C 5CSFA 1ALWA 2JT8A 2LVKA 1B7TZ 3PFVA 4YBHB 1S6JA 2LP3A 3KF9A 3CZ2A 4N1GA 1MF8B 1K93D 1BOCA 3HX4A 4N5XA 1HQVA 2QDIA 1UHIA 1YVHA 2LAPA 2OS8B 4M2QA 1SBJA 2HF5A 2WC8A 4L9MA 1CFFA 1NYAA 2JWWA 3FE8A 5AEQA 3WNXB 1A4PA 1QXPA 2Y5IA 2H2KA 3FIAA 1XYDA 4AOMA 1CDPA 4I5JA 2FCDA 1AVSA 1BR4B 2I7AA 3SG6A 5I2OA 2PQLA 1OMRA 1PK0D 2Y1NA 3K21A 1XVJA 4FQTA 1X02A 2JULA 3B87A 2SCPA 3FWCA 1PSRA 1S5GZ 2K8MB 5DKNA 2KLDA 3OP0A 4JD9A 4QJ3B 3CWGA 1DC1A 1QIWA 4ORBB 1WRLA 1FI5A 1FPWA 2NCPA 4P2YB 3R1OA 3LLEA 5I94A 2JPOA 3BUWB 2JT0A 4ZCVA 1CDMA 2G9BA 1MHOA 1CDNA 3B88A 1SRAA 1UUSA 4PE1A 1SKTA 3IVTA 2KSPA 2QEVA 3DF0A 3QRXA 4QJ4B 5K89A 2BE6A 3BUNB 2KI6D 1Q80A 3FE6A 2IS9A 1XFYO 2PASA 5DKRA 3LK0A 2CBLA 2KDHA 1S6CA 1XO5A 1TCFA 1B8CA 4FTGA 1LVCD 2F3YA 1EJ3A 1E8AA 1SYMA 2L0PA 2WOSA 1DJGA 3EK4A 3TDIA 1KFXS 3OX5A 4DS7A 2WC6A 2JNXA 2LVVA 3NXAA 1XFXO 1K90D 4P5OE 5KTYA 1KK8B 1K2HA 1AJ5A 3Q8IA 4MRYA 2QEHA 5HLOA 1C07A 1TN4A 1TNPA 4OR9B 3VB1A 1LA0A 3S0GA 1JF2A 1WLMA 1NCZA 2LP2A 2KGRA 3EKHA 1IWQA 2CTNA 3I5IC 2I2RE 3I5FC 3I5GB 1J55A 1M39A 3ZWHA 2Y4QA 2ZFDA 4GGFC 2QACA 1KK7Y 1EG3A 3TS5B 1A75A 1HT9A 1OW4A 2ZNDA 1RJVA 1N2DA 4NDCA 1N65A 3OB2B 4XJKA 2KYCA 1Y6WA 2BCAA 1L2OB 3PN7B 4ORAB 3PM8A 2KAVA 1NX3A 5FYXA 1MXEA 3M0WA 1DVIA 2LHIA 3I5HC 1WDCB 4YRUA 4WRIA 1MQ1A 3CTNA 3EKJA 3CDNA 3O4XA 3BQ3A 4YGDB 1R6PA 5FI2A 4CLNA 3PSRA 5I8NA 2O5GA 2OTGC 1CMFA 5CSIA 1IQ5A 4GBAA 2WC5A 3TZ1A 1K8UA 1KFXL 1TNXA 1XFZO 4F7FA 1MR8A 1YTZC 1S26D 2KBIA 1QASA 2HETA 2M9GA 3A4UB 3C1VA 1XFUO 3EK7A 3IQQA 1DT7B 2F2OA 2L98A 1H4BA 2BKHB 2JPTA 1S3PA 2L4HA 2PVBA 3BYAA 3JVTB 1JWDA 4CFQA 4PCWA 4D1EA 1SR6B 1OOGA 2H8VA 1B8LA 3WHUB 2MLEC 3VROA 3K1EA 1WRKA 2OPOA 1NIWA 4CIDA 1F55A 3NSIA 4MSPA 2LANA 5BPJA 1ZOTB 4MRXA 2M7NA 1DGUA 2GV5A 4PE0A 3O78A 4NDDA 4PT1A 3VRRA 2NCOA 1K96A 2MHHA 1IKUA 2K60A 2OS8C 3EG5B 3RM1A 3DVEA 3PATA 1NSHA 3GK4X 3BFAA 4AQJA 2BCXA 1CFCA 1BT6A 2JC2A 2WCKA 5AERA 3VRQA 3H4SE 3SIAA 5CSJA 1L7ZA 1T14A 2WCLA 4C0KA 2QPTA 3SS5A 1KQVA 2NZ0A 2O60A 1FW4A 4BY4A 4YI8A 1FBVA 3WHTB 1ALVA 3CLNA 4GFTA 1M45A 1IQ3A 1EXRA 1WRZA 2KHNA 1Y1XA 2LUCA 4ICBA 1K95A 4OVNF 2JTTA 4A4BA 1ZMZA 1OQPA 3GK2A 2L50A 2LVJA 1J7RA 3O2PA 3D10A 3NHIA 2KI4B 2ISDA 5I2LA 1DMOA 2WCHA 1C7WA 3BFHA 1GM0A 2FJYA 2I94A 4U8DA 1CLMA 1SL7A 1Z4HA 1ODBA 2P70A 1OMVA 4CPVA 3D74A 1MWNA 2BAPA 2GTEA 1XFRA 5FI7A 3IQOA 1B7TY 1OOFA 1YVLA 1DJIA 2TN4A 2LUXA 1OMDA 3NSKA 1LXFC 3B7AA 1NUBA 1OE9B 1PSBA 2A4JA 2L2CA 2L4IA 3D78A 3S0BA 1LKJA 1ORGA 1SSEB 1XFVO 2G2BA 2WCBA 4HSZA 1KCYA 4MEWA 2WCEA 2KOTA 1BLQA 1KK8C 2BBNA 4PE7A 1IIOA 2COLB 1J7PA 2JOJA 3SG3A 4WQ3A 2KAXA 4YGEB 1XA5A 3I5GC 5D69A 5D3OA 2CNPA 2JU0A 1SCMC 2BBMA 2F8PA 2AMIA 2AUCA 1UHNA 2JRFA 3BFBA 3LCPC 4MZKA 5HLVA 3TS5C 3RZSA 1DJHA 2E30A 2LCPA 1YRTB 2L5XB 4ETOA 3F45A 3PN7C 1L2OC 4UPGA 4PE4A 4HREE 2PSRA 1UWOA 1AHRA 1IJ5A 5GQQC 2L51A 1G4YR 1WDCC 3CZ1A 2HPSA 3R1VA 1EL4A 2LNKA 1QJTA 1GQMA 4ORCB 3B6XA 1RROA 2PALA 2WCJA 4MVFA 1MXLC 3R72A 2Q91A 1CNPA 1KK7Z 4MLWA 1SCMB 1LS8A 3SS4A 2Q4UA 5FI6A 3OHMB 4JWQA 1A2XA 2PYQA 1BJFA 1QLKA 3BXKA 3EVVA 3A8RA 4M2PA 1K9UA 2M29A 1SPYA 3IF7A 1SL8A 1QX2A 3JVTC 1CFDA 5KU1A 1RWYA 1SR6C 1NCXA 3AKBA 3WXAA 1YUUA 3LL8B 4OV2A 1NX1A 4DCKA 2MAZA 3KEVA 3OBVA 2LHLA 3SIBA 1B9AA 3FE9A 1QX5B 3QMEA 4OKHA 3SG2A 4YGCB 1DJYA 3N7HA 1SW8A 4PHKA 1B8RA 2PMYA 2LM5A 2LVIA 2PRUA 1DEKA 2M1KB 1YX8A 3L4AA 2EHBA 2LC5A 3D77A 1F70A 2CT9A 1OZSA 4NQGA 3S0AA 2JTZA 3FWBA 1B4CA 4MBEA 3EVRA 3DZTA 4INWA 4QJ5B 4NDBA 1OOHA 1N0YA 1QVIZ 1UP5A 3GOFA 2M0RA 2BKIB 1TWOA 3KHEA 4XYNA 3SG5A 2MJWB 3EK8A 1JBAA 1S36A 2WNDA 3DVJA 2GGMA 2KI6C 1YUTA 1C3YA 3V2LA 2CCMA 1BG1A 1GGZA 2KBMA 1KWOB 3BUXB 1DTLA 1TCOB 3OGNA 2B1UA 1C7VA 2M97A 1TOPA 1RFJA 2FJUB 2KPHA 1A03A 2EC6B 1YURA 1YX7A 2BCBA 2AAOA 3NSOA 2KI4C 2M1UA 4GNKB 1RECA 5ER4X 3VRPA 5J3XA 2WCFA 2QEBA 2GGZA 4YI9A 2CXJA 1F54A 3BJHA 4GGFA 1OOIX 5B8IB 4MZJA 3DXLA 1UHHA 1TTXA 1P28A 4BY5A 2MLFC 1SK6D 2H61C 1LINA 3S0DA 3TUYB 1W7IB 3CYZA 1CKKA 5JJGA 4PHMA 5HL1A 2JXCA 1OZOA 1RTP1 3S0EA 3ZNIA 1IRJA 1PULA 3D73A 4A4CA 3SS3A 1A29A 1G8IA 1OOJA 1VRKA 2HQWA 2KFHA 1JFJA 1KSMA 5KSZA 2DOQA 1M31A 3CR2A 3NHTA 4M2OA 1DJZA 1JFKA 4PALA 2NLNA 2FOTA 1DJWA 1UURA 4PHNA 1BF5A 4I5NB 5AFPA 3OB1B 1KFUS 1QIVA 4JPZB 5CSNA 5AXIA 3O4YA 5CPVA 3PJIA 1KQMB 2SASA 1NX2A 1NP8A 1J1EA 1V1GA 2JQ6A 1ZUZA 5HYDA 3JTDB 1SCVA 3MSEB 4C0JA 2WORA 4F0ZB 4IL1A 1CLBA 2QEOA 1CTRA 1PRWA 3UNWA 4Q04A 5PALA 4AQIA 3PM2A 2LV7A 3CZ0A 2P71A 2F33A 1DELA 1TNQA 3DF0B 3S0FA 2JNFA 1Y1AA 4HRGA 2K2AA 1OSAA 2BNXA 2BL0B 2K7CA 3PALA 1QLSA 2V53A 3DVMA 1YUSA 1M63B 4INXA 1TUJA 3DVKA 1NCYA 2KQYA 5I2QA 1YRUB 1JSAA 3UO9A 2K0JA 2M8UA 2MRDA 4JKTA 2JZIA 1CMGA 2KGBC 1CFPA 3VRNA 2H61A 2EGDA 1B1GA 1S5GY
chains in the Genus database with same CATH topology
3CGAA 3BUMB 4DIRA 1H8BA 1FF1A 2ZRSA 1QX7A 2L2EA 1D1OA 1TNWA 2M3WA 3TDUA 2KFFA 2F2PA 1BODA 2FCEA 1DGVA 1TIZA 1XK4A 1LA3A 3E3RA 4E68A 1KFUL 1WY9A 4PDZA 2E6WA 2LLUA 1NWDA 2ZN9A 5IBWA 1Y0VH 1QATA 1S6IA 4I5LB 1JUOA 1R2UA 1U5IB 4C0LA 1A75B 3NSLA 1JF0A 1SNLA 4XJKB 3D0YB 2ZRTA 4R1EA 4GUKA 1CLLA 1F71A 4JQ0D 2JXLA 2I18A 3KO0A 4OCIA 2F3ZA 3TDZA 2M49B 1QTXA 4GAOA 2KAYA 1F4OA 1KSOA 1MUXA 2K7BA 5F6TA 1J1DA 1SMGA 1DF0B 3SG4A 3SJSA 5TNCA 1CB1A 1YR5A 2ZN8A 1GJYA 1U5IA 1PVAA 2KYFA 1CDLA 1NPQA 1WLZA 5G08A 3D0YA 1SY9A 1W7JB 4WQ2A 1KWOC 5HKYA 1G33A 2LE9B 4HRHA 1EG4A 4GPLB 1TRFA 3AAJA 2KNEA 1AUIB 2BECA 2EC6C 1JC2A 3O6BA 1IJ6A 1ZACA 4PHJA 5JOLA 1S1EA 1BU3A 4MN0A 3SG7A 4MZLA 3CR4X 3I5FB 3CZTX 1DF0A 2LMUA 3AAKA 1M46A 3I5IB 3RLZA 1DJXA 3OX6A 3BOWB 3VGOA 1PALA 1FI6A 1GGWA 4ZCUA 3BUOB 1UHKA 3CR5X 3EVUA 1NX0A 1AK8A 2MA2A 1F8HA 3TUYC 1UHJA 5HKWA 1CM4A 1K9KA 4N1FA 2M7LA 5ER5A 2K2FA 2D8NA 1Y1UA 2RGIA 2HQ8A 3CS1A 3PLFB 3I5HB 4CFRA 1J7OA 2LLTA 3GK1A 1RK9A 2KQ6A 4GGNA 2ZNEA 1AP4A 1K94A 3AKAA 3HCMA 2Y1MA 2LMTA 1QVIY 2K61A 2KFGA 1V1FA 1QS7A 2BE4A 5D7FA 4DUQA 2OTGB 1B47A 1IG5A 1CM1A 1F4QA 1K9PA 3KPXA 1AJ4A 3BOWA 2K7DA 2LLSA 1BR1B 1QV0A 3FS7A 5DKQA 5AANA 5HYDA 2LMVA 1BMOA 3ICBA 1KQMC 4YGBB 2JT3A 4I5KA 3JTDC 1IH0A 1XFWO 4USLA 2K7OA 1ZFSA 2NXQA 4YGAA 1J7QA 1PVBA 4DRWA 4FQOA 3DD4A 2R2IA 1SL9A 5HKZA 2VRGA 3LK1A 2MBXA 4TNCA 1QV1A 1IGVA 1EH2A 2P6BB 1XK4C 2ZKMX 2BL0C 5CSFA 1ALWA 2JT8A 2LVKA 1B7TZ 3PFVA 4YBHB 1S6JA 2LP3A 3KF9A 4N1GA 1MF8B 1K93D 1BOCA 3HX4A 4N5XA 1HQVA 1UHIA 1YVHA 2LAPA 2OS8B 4M2QA 1SBJA 2HF5A 2WC8A 4L9MA 1CFFA 1NYAA 2JWWA 5AEQA 3WNXB 1A4PA 1QXPA 2Y5IA 2H2KA 3FIAA 1XYDA 4AOMA 1CDPA 4I5JA 2FCDA 1AVSA 1BR4B 2I7AA 3SG6A 5I2OA 1OMRA 1PK0D 2Y1NA 3K21A 1XVJA 1X02A 2JULA 3FWCA 2SCPA 5DKNA 1PSRA 1S5GZ 2K8MB 3OP0A 4QJ3B 3CWGA 1QIWA 4ORBB 1WRLA 1FI5A 1FPWA 2NCPA 4P2YB 3LLEA 4ZCVA 3BUWB 2JT0A 1CDMA 2G9BA 1MHOA 1CDNA 1SRAA 1UUSA 4PE1A 1SKTA 2KSPA 3DF0A 3QRXA 4QJ4B 5K89A 2BE6A 3BUNB 2KI6D 1Q80A 2IS9A 1XFYO 2PASA 5DKRA 3LK0A 2CBLA 2KDHA 1S6CA 1XO5A 1TCFA 1B8CA 4FTGA 1LVCD 2F3YA 1EJ3A 1E8AA 1SYMA 2L0PA 2WOSA 1DJGA 3EK4A 3TDIA 1KFXS 3OX5A 4DS7A 2JNXA 2LVVA 3NXAA 1XFXO 1K90D 4P5OE 5KTYA 1KK8B 1K2HA 1AJ5A 4MRYA 5HLOA 1C07A 1TN4A 1TNPA 4OR9B 1B4CA 1LA0A 1JBAA 1JF2A 1WLMA 1NCZA 2LP2A 2KGRA 3EKHA 1IWQA 2CTNA 3I5IC 2I2RE 3I5FC 3I5GB 1J55A 1M39A 3ZWHA 2Y4QA 2ZFDA 4GGFC 2QACA 1KK7Y 1EG3A 3TS5B 1A75A 1HT9A 2ZNDA 4NDCA 1RJVA 1N2DA 4XJKA 1N65A 3OB2B 2KYCA 1Y6WA 2BCAA 1L2OB 3PN7B 4ORAB 3PM8A 2KAVA 1NX3A 5FYXA 1MXEA 3M0WA 1DVIA 2LHIA 3I5HC 1WDCB 4YRUA 4WRIA 1MQ1A 3CTNA 3EKJA 3BQ3A 4YGDB 1R6PA 4CLNA 5I8NA 3PSRA 2O5GA 2OTGC 1CMFA 5CSIA 1IQ5A 4GBAA 3TZ1A 1K8UA 1KFXL 1TNXA 1XFZO 1MR8A 1YTZC 1S26D 2KBIA 1QASA 2HETA 2M9GA 3A4UB 3C1VA 1XFUO 3EK7A 3IQQA 1DT7B 2F2OA 2L98A 1H4BA 2BKHB 2JPTA 1S3PA 2L4HA 2PVBA 3BYAA 3JVTB 1JWDA 4CFQA 4PCWA 4D1EA 1SR6B 3WHUB 1B8LA 2MLEC 3VROA 1WRKA 2OPOA 1NIWA 4CIDA 1F55A 3NSIA 4MSPA 2LANA 5BPJA 1ZOTB 4MRXA 2M7NA 1DGUA 2GV5A 4PE0A 3O78A 4NDDA 3VRRA 2NCOA 1K96A 2MHHA 1IKUA 2OS8C 3RM1A 3DVEA 3PATA 1NSHA 3GK4X 4AQJA 2BCXA 1CFCA 1BT6A 2JC2A 5AERA 3VRQA 3H4SE 3SIAA 5CSJA 1L7ZA 4C0KA 2QPTA 1KQVA 2NZ0A 2O60A 1FW4A 4BY4A 4YI8A 1FBVA 3WHTB 1ALVA 3CLNA 4GFTA 1M45A 1IQ3A 1EXRA 1WRZA 2KHNA 1Y1XA 2LUCA 4ICBA 1K95A 4OVNF 2JTTA 4A4BA 1ZMZA 1OQPA 3GK2A 2L50A 2LVJA 1J7RA 3O2PA 3D10A 2KI4B 2ISDA 5I2LA 1DMOA 1C7WA 4U8DA 2I94A 1CLMA 1SL7A 1ODBA 1OMVA 4CPVA 1MWNA 3IQOA 1B7TY 1YVLA 1DJIA 2TN4A 2LUXA 1OMDA 3NSKA 1LXFC 1NUBA 1OE9B 1PSBA 2A4JA 2L4IA 1LKJA 1XFVO 2G2BA 2WCBA 4HSZA 1KCYA 4MEWA 2WCEA 2KOTA 1BLQA 1KK8C 2BBNA 4PE7A 2COLB 1J7PA 2JOJA 3SG3A 4WQ3A 2KAXA 4YGEB 1XA5A 3I5GC 5D69A 2CNPA 2JU0A 1SCMC 2BBMA 2F8PA 2AMIA 2AUCA 1UHNA 2JRFA 4MZKA 3LCPC 3TS5C 5HLVA 1DJHA 2E30A 2LCPA 1YRTB 2L5XB 4ETOA 3F45A 3PN7C 1L2OC 4UPGA 4PE4A 4HREE 2PSRA 1UWOA 1AHRA 1IJ5A 5GQQC 2L51A 1G4YR 1WDCC 2HPSA 1EL4A 2LNKA 1QJTA 1GQMA 4ORCB 1RROA 2PALA 4MVFA 1MXLC 1CNPA 2Q91A 1KK7Z 4MLWA 1SCMB 2Q4UA 3OHMB 4JWQA 1A2XA 1BJFA 1QLKA 3BXKA 3EVVA 3A8RA 4M2PA 1K9UA 2M29A 1SPYA 3IF7A 1SL8A 1QX2A 3JVTC 1CFDA 5KU1A 1RWYA 1SR6C 1NCXA 3AKBA 3WXAA 1YUUA 3LL8B 4OV2A 1NX1A 4DCKA 2MAZA 3KEVA 3SIBA 2LHLA 1B9AA 1QX5B 4OKHA 3SG2A 4YGCB 1DJYA 1SW8A 4PHKA 1B8RA 2PMYA 2LM5A 2LVIA 2PRUA 2M1KB 1YX8A 2EHBA 2LC5A 1F70A 2CT9A 1OZSA 4NQGA 2JTZA 3FWBA 4MBEA 3EVRA 4QJ5B 4NDBA 1N0YA 1QVIZ 1UP5A 3GOFA 2M0RA 2BKIB 3KHEA 4XYNA 3SG5A 2MJWB 3EK8A 1S36A 2WNDA 3DVJA 2GGMA 2KI6C 1YUTA 2CCMA 1BG1A 1GGZA 2KBMA 1KWOB 3BUXB 1DTLA 1TCOB 2B1UA 1C7VA 2M97A 1TOPA 1RFJA 2FJUB 1A03A 2EC6B 1YURA 1YX7A 2BCBA 2AAOA 3NSOA 2KI4C 2M1UA 4GNKB 1RECA 5ER4X 3VRPA 5J3XA 2WCFA 2GGZA 4YI9A 2CXJA 1F54A 4GGFA 5B8IB 4MZJA 1UHHA 1TTXA 4BY5A 2MLFC 1SK6D 2H61C 1LINA 3TUYB 1CKKA 1W7IB 5JJGA 4PHMA 2JXCA 1OZOA 1RTP1 3ZNIA 1IRJA 1PULA 4A4CA 1A29A 1G8IA 1OOJA 1VRKA 2HQWA 2KFHA 1JFJA 1KSMA 5KSZA 2DOQA 1M31A 3CR2A 4M2OA 1DJZA 1JFKA 4PALA 2NLNA 2FOTA 1DJWA 1UURA 4PHNA 1BF5A 4I5NB 5AFPA 3OB1B 1KFUS 1QIVA 4JPZB 5CSNA 5AXIA 3O4YA 5CPVA 1KQMB 2SASA 1NX2A 1NP8A 1J1EA 1V1GA 2JQ6A 1ZUZA 3JTDB 1SCVA 3MSEB 4C0JA 2WORA 4F0ZB 4IL1A 1CLBA 1CTRA 1PRWA 4Q04A 5PALA 4AQIA 2LV7A 2F33A 1TNQA 3DF0B 2JNFA 1Y1AA 4HRGA 2K2AA 1OSAA 2K7CA 2BL0B 3PALA 1QLSA 2V53A 3DVMA 1YUSA 1M63B 3DVKA 1NCYA 2KQYA 5I2QA 1YRUB 1JSAA 2K0JA 2M8UA 2MRDA 2JZIA 1CMGA 2KGBC 1CFPA 3VRNA 2H61A 2EGDA 1B1GA 1S5GY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGA A;  3BUM B;  4DIR A;  1H8B A;  1FF1 A;  2ZRS A;  1QX7 A;  2L2E A;  1D1O A;  1TNW A;  2M3W A;  3TDU A;  2KFF A;  2F2P A;  1BOD A;  2FCE A;  1DGV A;  1TIZ A;  1XK4 A;  1LA3 A;  3E3R A;  4E68 A;  1KFU L;  1WY9 A;  4PDZ A;  2E6W A;  2LLU A;  1NWD A;  2ZN9 A;  5IBW A;  1Y0V H;  1QAT A;  1S6I A;  4I5L B;  1JUO A;  1R2U A;  1U5I B;  4C0L A;  1A75 B;  3NSL A;  1JF0 A;  1SNL A;  4XJK B;  3D0Y B;  2ZRT A;  4R1E A;  4GUK A;  1CLL A;  1F71 A;  4JQ0 D;  2JXL A;  2I18 A;  3KO0 A;  4OCI A;  2F3Z A;  3TDZ A;  2M49 B;  1QTX A;  4GAO A;  2KAY A;  1F4O A;  1KSO A;  1MUX A;  2K7B A;  5F6T A;  1J1D A;  1SMG A;  1DF0 B;  3SG4 A;  3SJS A;  5TNC A;  1CB1 A;  1YR5 A;  2ZN8 A;  1GJY A;  1U5I A;  1PVA A;  2KYF A;  1CDL A;  1NPQ A;  1WLZ A;  5G08 A;  3D0Y A;  1SY9 A;  1W7J B;  4WQ2 A;  1KWO C;  5HKY A;  1G33 A;  2LE9 B;  4HRH A;  1EG4 A;  4GPL B;  1TRF A;  3AAJ A;  2KNE A;  1AUI B;  2BEC A;  2EC6 C;  1JC2 A;  3O6B A;  1IJ6 A;  1ZAC A;  4PHJ A;  5JOL A;  1S1E A;  1BU3 A;  4MN0 A;  3SG7 A;  4MZL A;  3CR4 X;  3I5F B;  3CZT X;  1DF0 A;  2LMU A;  3AAK A;  1M46 A;  3I5I B;  3RLZ A;  1DJX A;  3OX6 A;  3BOW B;  3VGO A;  1PAL A;  1FI6 A;  1GGW A;  4ZCU A;  3BUO B;  1UHK A;  3CR5 X;  3EVU A;  1NX0 A;  1AK8 A;  2MA2 A;  1F8H A;  3TUY C;  1UHJ A;  5HKW A;  1CM4 A;  1K9K A;  4N1F A;  2M7L A;  5ER5 A;  2K2F A;  2D8N A;  1Y1U A;  2RGI A;  2HQ8 A;  3CS1 A;  3PLF B;  3I5H B;  4CFR A;  1J7O A;  2LLT A;  3GK1 A;  1RK9 A;  2KQ6 A;  4GGN A;  2ZNE A;  1AP4 A;  1K94 A;  3AKA A;  3HCM A;  2Y1M A;  2LMT A;  1QVI Y;  2K61 A;  2KFG A;  1V1F A;  1QS7 A;  2BE4 A;  5D7F A;  4DUQ A;  2OTG B;  1B47 A;  1IG5 A;  1CM1 A;  1F4Q A;  1K9P A;  3KPX A;  1AJ4 A;  3BOW A;  2K7D A;  2LLS A;  1BR1 B;  1QV0 A;  3FS7 A;  5DKQ A;  5AAN A;  5HYD A;  2LMV A;  1BMO A;  3ICB A;  1KQM C;  4YGB B;  2JT3 A;  4I5K A;  3JTD C;  1IH0 A;  1XFW O;  4USL A;  2K7O A;  1ZFS A;  2NXQ A;  4YGA A;  1J7Q A;  1PVB A;  4DRW A;  4FQO A;  3DD4 A;  2R2I A;  1SL9 A;  5HKZ A;  2VRG A;  3LK1 A;  2MBX A;  4TNC A;  1QV1 A;  1IGV A;  1EH2 A;  2P6B B;  1XK4 C;  2ZKM X;  2BL0 C;  5CSF A;  1ALW A;  2JT8 A;  2LVK A;  1B7T Z;  3PFV A;  4YBH B;  1S6J A;  2LP3 A;  3KF9 A;  4N1G A;  1MF8 B;  1K93 D;  1BOC A;  3HX4 A;  4N5X A;  1HQV A;  1UHI A;  1YVH A;  2LAP A;  2OS8 B;  4M2Q A;  1SBJ A;  2HF5 A;  2WC8 A;  4L9M A;  1CFF A;  1NYA A;  2JWW A;  5AEQ A;  3WNX B;  1A4P A;  1QXP A;  2Y5I A;  2H2K A;  3FIA A;  1XYD A;  4AOM A;  1CDP A;  4I5J A;  2FCD A;  1AVS A;  1BR4 B;  2I7A A;  3SG6 A;  5I2O A;  1OMR A;  1PK0 D;  2Y1N A;  3K21 A;  1XVJ A;  1X02 A;  2JUL A;  3FWC A;  2SCP A;  5DKN A;  1PSR A;  1S5G Z;  2K8M B;  3OP0 A;  4QJ3 B;  3CWG A;  1QIW A;  4ORB B;  1WRL A;  1FI5 A;  1FPW A;  2NCP A;  4P2Y B;  3LLE A;  4ZCV A;  3BUW B;  2JT0 A;  1CDM A;  2G9B A;  1MHO A;  1CDN A;  1SRA A;  1UUS A;  4PE1 A;  1SKT A;  2KSP A;  3DF0 A;  3QRX A;  4QJ4 B;  5K89 A;  2BE6 A;  3BUN B;  2KI6 D;  1Q80 A;  2IS9 A;  1XFY O;  2PAS A;  5DKR A;  3LK0 A;  2CBL A;  2KDH A;  1S6C A;  1XO5 A;  1TCF A;  1B8C A;  4FTG A;  1LVC D;  2F3Y A;  1EJ3 A;  1E8A A;  1SYM A;  2L0P A;  2WOS A;  1DJG A;  3EK4 A;  3TDI A;  1KFX S;  3OX5 A;  4DS7 A;  2JNX A;  2LVV A;  3NXA A;  1XFX O;  1K90 D;  4P5O E;  5KTY A;  1KK8 B;  1K2H A;  1AJ5 A;  4MRY A;  5HLO A;  1C07 A;  1TN4 A;  1TNP A;  4OR9 B;  1B4C A;  1LA0 A;  1JBA A;  1JF2 A;  1WLM A;  1NCZ A;  2LP2 A;  2KGR A;  3EKH A;  1IWQ A;  2CTN A;  3I5I C;  2I2R E;  3I5F C;  3I5G B;  1J55 A;  1M39 A;  3ZWH A;  2Y4Q A;  2ZFD A;  4GGF C;  2QAC A;  1KK7 Y;  1EG3 A;  3TS5 B;  1A75 A;  1HT9 A;  2ZND A;  4NDC A;  1RJV A;  1N2D A;  4XJK A;  1N65 A;  3OB2 B;  2KYC A;  1Y6W A;  2BCA A;  1L2O B;  3PN7 B;  4ORA B;  3PM8 A;  2KAV A;  1NX3 A;  5FYX A;  1MXE A;  3M0W A;  1DVI A;  2LHI A;  3I5H C;  1WDC B;  4YRU A;  4WRI A;  1MQ1 A;  3CTN A;  3EKJ A;  3BQ3 A;  4YGD B;  1R6P A;  4CLN A;  5I8N A;  3PSR A;  2O5G A;  2OTG C;  1CMF A;  5CSI A;  1IQ5 A;  4GBA A;  3TZ1 A;  1K8U A;  1KFX L;  1TNX A;  1XFZ O;  1MR8 A;  1YTZ C;  1S26 D;  2KBI A;  1QAS A;  2HET A;  2M9G A;  3A4U B;  3C1V A;  1XFU O;  3EK7 A;  3IQQ A;  1DT7 B;  2F2O A;  2L98 A;  1H4B A;  2BKH B;  2JPT A;  1S3P A;  2L4H A;  2PVB A;  3BYA A;  3JVT B;  1JWD A;  4CFQ A;  4PCW A;  4D1E A;  1SR6 B;  3WHU B;  1B8L A;  2MLE C;  3VRO A;  1WRK A;  2OPO A;  1NIW A;  4CID A;  1F55 A;  3NSI A;  4MSP A;  2LAN A;  5BPJ A;  1ZOT B;  4MRX A;  2M7N A;  1DGU A;  2GV5 A;  4PE0 A;  3O78 A;  4NDD A;  3VRR A;  2NCO A;  1K96 A;  2MHH A;  1IKU A;  2OS8 C;  3RM1 A;  3DVE A;  3PAT A;  1NSH A;  3GK4 X;  4AQJ A;  2BCX A;  1CFC A;  1BT6 A;  2JC2 A;  5AER A;  3VRQ A;  3H4S E;  3SIA A;  5CSJ A;  1L7Z A;  4C0K A;  2QPT A;  1KQV A;  2NZ0 A;  2O60 A;  1FW4 A;  4BY4 A;  4YI8 A;  1FBV A;  3WHT B;  1ALV A;  3CLN A;  4GFT A;  1M45 A;  1IQ3 A;  1EXR A;  1WRZ A;  2KHN A;  1Y1X A;  2LUC A;  4ICB A;  1K95 A;  4OVN F;  2JTT A;  4A4B A;  1ZMZ A;  1OQP A;  3GK2 A;  2L50 A;  2LVJ A;  1J7R A;  3O2P A;  3D10 A;  2KI4 B;  2ISD A;  5I2L A;  1DMO A;  1C7W A;  4U8D A;  2I94 A;  1CLM A;  1SL7 A;  1ODB A;  1OMV A;  4CPV A;  1MWN A;  3IQO A;  1B7T Y;  1YVL A;  1DJI A;  2TN4 A;  2LUX A;  1OMD A;  3NSK A;  1LXF C;  1NUB A;  1OE9 B;  1PSB A;  2A4J A;  2L4I A;  1LKJ A;  1XFV O;  2G2B A;  2WCB A;  4HSZ A;  1KCY A;  4MEW A;  2WCE A;  2KOT A;  1BLQ A;  1KK8 C;  2BBN A;  4PE7 A;  2COL B;  1J7P A;  2JOJ A;  3SG3 A;  4WQ3 A;  2KAX A;  4YGE B;  1XA5 A;  3I5G C;  5D69 A;  2CNP A;  2JU0 A;  1SCM C;  2BBM A;  2F8P A;  2AMI A;  2AUC A;  1UHN A;  2JRF A;  4MZK A;  3LCP C;  3TS5 C;  5HLV A;  1DJH A;  2E30 A;  2LCP A;  1YRT B;  2L5X B;  4ETO A;  3F45 A;  3PN7 C;  1L2O C;  4UPG A;  4PE4 A;  4HRE E;  2PSR A;  1UWO A;  1AHR A;  1IJ5 A;  5GQQ C;  2L51 A;  1G4Y R;  1WDC C;  2HPS A;  1EL4 A;  2LNK A;  1QJT A;  1GQM A;  4ORC B;  1RRO A;  2PAL A;  4MVF A;  1MXL C;  1CNP A;  2Q91 A;  1KK7 Z;  4MLW A;  1SCM B;  2Q4U A;  3OHM B;  4JWQ A;  1A2X A;  1BJF A;  1QLK A;  3BXK A;  3EVV A;  3A8R A;  4M2P A;  1K9U A;  2M29 A;  1SPY A;  3IF7 A;  1SL8 A;  1QX2 A;  3JVT C;  1CFD A;  5KU1 A;  1RWY A;  1SR6 C;  1NCX A;  3AKB A;  3WXA A;  1YUU A;  3LL8 B;  4OV2 A;  1NX1 A;  4DCK A;  2MAZ A;  3KEV A;  3SIB A;  2LHL A;  1B9A A;  1QX5 B;  4OKH A;  3SG2 A;  4YGC B;  1DJY A;  1SW8 A;  4PHK A;  1B8R A;  2PMY A;  2LM5 A;  2LVI A;  2PRU A;  2M1K B;  1YX8 A;  2EHB A;  2LC5 A;  1F70 A;  2CT9 A;  1OZS A;  4NQG A;  2JTZ A;  3FWB A;  4MBE A;  3EVR A;  4QJ5 B;  4NDB A;  1N0Y A;  1QVI Z;  1UP5 A;  3GOF A;  2M0R A;  2BKI B;  3KHE A;  4XYN A;  3SG5 A;  2MJW B;  3EK8 A;  1S36 A;  2WND A;  3DVJ A;  2GGM A;  2KI6 C;  1YUT A;  2CCM A;  1BG1 A;  1GGZ A;  2KBM A;  1KWO B;  3BUX B;  1DTL A;  1TCO B;  2B1U A;  1C7V A;  2M97 A;  1TOP A;  1RFJ A;  2FJU B;  1A03 A;  2EC6 B;  1YUR A;  1YX7 A;  2BCB A;  2AAO A;  3NSO A;  2KI4 C;  2M1U A;  4GNK B;  1REC A;  5ER4 X;  3VRP A;  5J3X A;  2WCF A;  2GGZ A;  4YI9 A;  2CXJ A;  1F54 A;  4GGF A;  5B8I B;  4MZJ A;  1UHH A;  1TTX A;  4BY5 A;  2MLF C;  1SK6 D;  2H61 C;  1LIN A;  3TUY B;  1CKK A;  1W7I B;  5JJG A;  4PHM A;  2JXC A;  1OZO A;  1RTP 1;  3ZNI A;  1IRJ A;  1PUL A;  4A4C A;  1A29 A;  1G8I A;  1OOJ A;  1VRK A;  2HQW A;  2KFH A;  1JFJ A;  1KSM A;  5KSZ A;  2DOQ A;  1M31 A;  3CR2 A;  4M2O A;  1DJZ A;  1JFK A;  4PAL A;  2NLN A;  2FOT A;  1DJW A;  1UUR A;  4PHN A;  1BF5 A;  4I5N B;  5AFP A;  3OB1 B;  1KFU S;  1QIV A;  4JPZ B;  5CSN A;  5AXI A;  3O4Y A;  5CPV A;  1KQM B;  2SAS A;  1NX2 A;  1NP8 A;  1J1E A;  1V1G A;  2JQ6 A;  1ZUZ A;  3JTD B;  1SCV A;  3MSE B;  4C0J A;  2WOR A;  4F0Z B;  4IL1 A;  1CLB A;  1CTR A;  1PRW A;  4Q04 A;  5PAL A;  4AQI A;  2LV7 A;  2F33 A;  1TNQ A;  3DF0 B;  2JNF A;  1Y1A A;  4HRG A;  2K2A A;  1OSA A;  2K7C A;  2BL0 B;  3PAL A;  1QLS A;  2V53 A;  3DVM A;  1YUS A;  1M63 B;  3DVK A;  1NCY A;  2KQY A;  5I2Q A;  1YRU B;  1JSA A;  2K0J A;  2M8U A;  2MRD A;  2JZI A;  1CMG A;  2KGB C;  1CFP A;  3VRN A;  2H61 A;  2EGD A;  1B1G A;  1S5G Y; 
#chains in the Genus database with same CATH topology
 3CGA A;  3BUM B;  4DIR A;  1H8B A;  1FF1 A;  2ZRS A;  1QX7 A;  2L2E A;  1D1O A;  1TNW A;  2M3W A;  3TDU A;  2KFF A;  2F2P A;  1BOD A;  2FCE A;  1DGV A;  1TIZ A;  5EL2 A;  3L4L A;  3B86 A;  1XK4 A;  1LA3 A;  1Z2C B;  3E3R A;  4E68 A;  1KFU L;  1WY9 A;  3D76 A;  4PDZ A;  2E6W A;  2LLU A;  1NWD A;  2ZN9 A;  2L5Y A;  5IBW A;  1Y0V H;  1QAT A;  1S6I A;  4I5L B;  1JUO A;  1R2U A;  1U5I B;  4C0L A;  1A75 B;  3NSL A;  1JF0 A;  1SNL A;  4KYN A;  3D0Y B;  4XJK B;  2ZRT A;  4R1E A;  4GUK A;  1CLL A;  1F71 A;  4IJ7 A;  4JQ0 D;  2JXL A;  2I18 A;  3KO0 A;  1QWV A;  4OCI A;  2F3Z A;  3DY9 A;  3TDZ A;  2M49 B;  1QTX A;  4GAO A;  2KAY A;  1F4O A;  1KSO A;  1MUX A;  2K7B A;  5F6T A;  1J1D A;  1SMG A;  1DF0 B;  3SG4 A;  3SJS A;  5TNC A;  1CB1 A;  1YR5 A;  2ZN8 A;  1GJY A;  1U5I A;  1PVA A;  2KYF A;  1CDL A;  1NPQ A;  1WLZ A;  5G08 A;  3D0Y A;  1SY9 A;  1W7J B;  4WQ2 A;  1KWO C;  5HKY A;  1G33 A;  2LE9 B;  4HRH A;  1EG4 A;  4GPL B;  1TRF A;  3AAJ A;  2KNE A;  1AUI B;  2BEC A;  2EC6 C;  3CAB A;  1JC2 A;  3O6B A;  1IJ6 A;  1ZAC A;  4PHJ A;  5DIC A;  5JOL A;  1S1E A;  1BU3 A;  4MN0 A;  3SG7 A;  4MZL A;  3CR4 X;  3I5F B;  3CZT X;  1DF0 A;  2LMU A;  3AAK A;  1M46 A;  3I5I B;  4OZD A;  3RLZ A;  1DJX A;  3OX6 A;  3BOW B;  3VGO A;  1PAL A;  2WCM A;  1FI6 A;  4ZCU A;  1GGW A;  3BUO B;  1UHK A;  3CR5 X;  3DYE A;  3EVU A;  1NX0 A;  1AK8 A;  1C3Z A;  2MA2 A;  1F8H A;  3TUY C;  1UHJ A;  5HKW A;  1CM4 A;  1K9K A;  4N1F A;  2M7L A;  2ERB A;  5ER5 A;  2K2F A;  1TUZ A;  2D8N A;  1Y1U A;  2RGI A;  2HQ8 A;  3CS1 A;  3PLF B;  3I5H B;  4CFR A;  1J7O A;  1DQE A;  2LLT A;  3GK1 A;  1RK9 A;  2KQ6 A;  4GGN A;  2ZNE A;  2KLE A;  1AP4 A;  1K94 A;  3AKA A;  3HCM A;  2Y1M A;  1W9Z A;  1QVI Y;  2LMT A;  2K61 A;  2KFG A;  1V1F A;  1QS7 A;  2BE4 A;  5D7F A;  4DUQ A;  2OTG B;  1B47 A;  1IG5 A;  1CM1 A;  1F4Q A;  1K9P A;  3KPX A;  1AJ4 A;  3BOW A;  2K7D A;  2LLS A;  1BR1 B;  1QV0 A;  3FS7 A;  3R1P A;  5DKQ A;  5AAN A;  2YGU A;  2LMV A;  1BMO A;  3ICB A;  1KQM C;  3NGV A;  3L47 A;  4YGB B;  2JT3 A;  4I5K A;  3JTD C;  1IH0 A;  1XFW O;  4USL A;  2K7O A;  1ZFS A;  2NXQ A;  4YGA A;  1J7Q A;  1PVB A;  4DRW A;  4FQO A;  3DD4 A;  2R2I A;  1SL9 A;  5HKZ A;  2VRG A;  3LK1 A;  2MBX A;  4TNC A;  1QV1 A;  1IGV A;  1EH2 A;  2P6B B;  3D75 A;  1XK4 C;  2ZKM X;  2BL0 C;  5CSF A;  1ALW A;  2JT8 A;  2LVK A;  1B7T Z;  3PFV A;  4YBH B;  1S6J A;  2LP3 A;  3KF9 A;  3CZ2 A;  4N1G A;  1MF8 B;  1K93 D;  1BOC A;  3HX4 A;  4N5X A;  1HQV A;  2QDI A;  1UHI A;  1YVH A;  2LAP A;  2OS8 B;  4M2Q A;  1SBJ A;  2HF5 A;  2WC8 A;  4L9M A;  1CFF A;  1NYA A;  2JWW A;  3FE8 A;  5AEQ A;  3WNX B;  1A4P A;  1QXP A;  2Y5I A;  2H2K A;  3FIA A;  1XYD A;  4AOM A;  1CDP A;  4I5J A;  2FCD A;  1AVS A;  1BR4 B;  2I7A A;  3SG6 A;  5I2O A;  2PQL A;  1OMR A;  1PK0 D;  2Y1N A;  3K21 A;  1XVJ A;  4FQT A;  1X02 A;  2JUL A;  3B87 A;  2SCP A;  3FWC A;  1PSR A;  1S5G Z;  2K8M B;  5DKN A;  2KLD A;  3OP0 A;  4JD9 A;  4QJ3 B;  3CWG A;  1DC1 A;  1QIW A;  4ORB B;  1WRL A;  1FI5 A;  1FPW A;  2NCP A;  4P2Y B;  3R1O A;  3LLE A;  5I94 A;  2JPO A;  3BUW B;  2JT0 A;  4ZCV A;  1CDM A;  2G9B A;  1MHO A;  1CDN A;  3B88 A;  1SRA A;  1UUS A;  4PE1 A;  1SKT A;  3IVT A;  2KSP A;  2QEV A;  3DF0 A;  3QRX A;  4QJ4 B;  5K89 A;  2BE6 A;  3BUN B;  2KI6 D;  1Q80 A;  3FE6 A;  2IS9 A;  1XFY O;  2PAS A;  5DKR A;  3LK0 A;  2CBL A;  2KDH A;  1S6C A;  1XO5 A;  1TCF A;  1B8C A;  4FTG A;  1LVC D;  2F3Y A;  1EJ3 A;  1E8A A;  1SYM A;  2L0P A;  2WOS A;  1DJG A;  3EK4 A;  3TDI A;  1KFX S;  3OX5 A;  4DS7 A;  2WC6 A;  2JNX A;  2LVV A;  3NXA A;  1XFX O;  1K90 D;  4P5O E;  5KTY A;  1KK8 B;  1K2H A;  1AJ5 A;  3Q8I A;  4MRY A;  2QEH A;  5HLO A;  1C07 A;  1TN4 A;  1TNP A;  4OR9 B;  3VB1 A;  1LA0 A;  3S0G A;  1JF2 A;  1WLM A;  1NCZ A;  2LP2 A;  2KGR A;  3EKH A;  1IWQ A;  2CTN A;  3I5I C;  2I2R E;  3I5F C;  3I5G B;  1J55 A;  1M39 A;  3ZWH A;  2Y4Q A;  2ZFD A;  4GGF C;  2QAC A;  1KK7 Y;  1EG3 A;  3TS5 B;  1A75 A;  1HT9 A;  1OW4 A;  2ZND A;  1RJV A;  1N2D A;  4NDC A;  1N65 A;  3OB2 B;  4XJK A;  2KYC A;  1Y6W A;  2BCA A;  1L2O B;  3PN7 B;  4ORA B;  3PM8 A;  2KAV A;  1NX3 A;  5FYX A;  1MXE A;  3M0W A;  1DVI A;  2LHI A;  3I5H C;  1WDC B;  4YRU A;  4WRI A;  1MQ1 A;  3CTN A;  3EKJ A;  3CDN A;  3O4X A;  3BQ3 A;  4YGD B;  1R6P A;  5FI2 A;  4CLN A;  3PSR A;  5I8N A;  2O5G A;  2OTG C;  1CMF A;  5CSI A;  1IQ5 A;  4GBA A;  2WC5 A;  3TZ1 A;  1K8U A;  1KFX L;  1TNX A;  1XFZ O;  4F7F A;  1MR8 A;  1YTZ C;  1S26 D;  2KBI A;  1QAS A;  2HET A;  2M9G A;  3A4U B;  3C1V A;  1XFU O;  3EK7 A;  3IQQ A;  1DT7 B;  2F2O A;  2L98 A;  1H4B A;  2BKH B;  2JPT A;  1S3P A;  2L4H A;  2PVB A;  3BYA A;  3JVT B;  1JWD A;  4CFQ A;  4PCW A;  4D1E A;  1SR6 B;  1OOG A;  2H8V A;  1B8L A;  3WHU B;  2MLE C;  3VRO A;  3K1E A;  1WRK A;  2OPO A;  1NIW A;  4CID A;  1F55 A;  3NSI A;  4MSP A;  2LAN A;  5BPJ A;  1ZOT B;  4MRX A;  2M7N A;  1DGU A;  2GV5 A;  4PE0 A;  3O78 A;  4NDD A;  4PT1 A;  3VRR A;  2NCO A;  1K96 A;  2MHH A;  1IKU A;  2K60 A;  2OS8 C;  3EG5 B;  3RM1 A;  3DVE A;  3PAT A;  1NSH A;  3GK4 X;  3BFA A;  4AQJ A;  2BCX A;  1CFC A;  1BT6 A;  2JC2 A;  2WCK A;  5AER A;  3VRQ A;  3H4S E;  3SIA A;  5CSJ A;  1L7Z A;  1T14 A;  2WCL A;  4C0K A;  2QPT A;  3SS5 A;  1KQV A;  2NZ0 A;  2O60 A;  1FW4 A;  4BY4 A;  4YI8 A;  1FBV A;  3WHT B;  1ALV A;  3CLN A;  4GFT A;  1M45 A;  1IQ3 A;  1EXR A;  1WRZ A;  2KHN A;  1Y1X A;  2LUC A;  4ICB A;  1K95 A;  4OVN F;  2JTT A;  4A4B A;  1ZMZ A;  1OQP A;  3GK2 A;  2L50 A;  2LVJ A;  1J7R A;  3O2P A;  3D10 A;  3NHI A;  2KI4 B;  2ISD A;  5I2L A;  1DMO A;  2WCH A;  1C7W A;  3BFH A;  1GM0 A;  2FJY A;  2I94 A;  4U8D A;  1CLM A;  1SL7 A;  1Z4H A;  1ODB A;  2P70 A;  1OMV A;  4CPV A;  3D74 A;  1MWN A;  2BAP A;  2GTE A;  1XFR A;  5FI7 A;  3IQO A;  1B7T Y;  1OOF A;  1YVL A;  1DJI A;  2TN4 A;  2LUX A;  1OMD A;  3NSK A;  1LXF C;  3B7A A;  1NUB A;  1OE9 B;  1PSB A;  2A4J A;  2L2C A;  2L4I A;  3D78 A;  3S0B A;  1LKJ A;  1ORG A;  1SSE B;  1XFV O;  2G2B A;  2WCB A;  4HSZ A;  1KCY A;  4MEW A;  2WCE A;  2KOT A;  1BLQ A;  1KK8 C;  2BBN A;  4PE7 A;  1IIO A;  2COL B;  1J7P A;  2JOJ A;  3SG3 A;  4WQ3 A;  2KAX A;  4YGE B;  1XA5 A;  3I5G C;  5D69 A;  5D3O A;  2CNP A;  2JU0 A;  1SCM C;  2BBM A;  2F8P A;  2AMI A;  2AUC A;  1UHN A;  2JRF A;  3BFB A;  3LCP C;  4MZK A;  5HLV A;  3TS5 C;  3RZS A;  1DJH A;  2E30 A;  2LCP A;  1YRT B;  2L5X B;  4ETO A;  3F45 A;  3PN7 C;  1L2O C;  4UPG A;  4PE4 A;  4HRE E;  2PSR A;  1UWO A;  1AHR A;  1IJ5 A;  5GQQ C;  2L51 A;  1G4Y R;  1WDC C;  3CZ1 A;  2HPS A;  3R1V A;  1EL4 A;  2LNK A;  1QJT A;  1GQM A;  4ORC B;  3B6X A;  1RRO A;  2PAL A;  2WCJ A;  4MVF A;  1MXL C;  3R72 A;  2Q91 A;  1CNP A;  1KK7 Z;  4MLW A;  1SCM B;  1LS8 A;  3SS4 A;  2Q4U A;  5FI6 A;  3OHM B;  4JWQ A;  1A2X A;  2PYQ A;  1BJF A;  1QLK A;  3BXK A;  3EVV A;  3A8R A;  4M2P A;  1K9U A;  2M29 A;  1SPY A;  3IF7 A;  1SL8 A;  1QX2 A;  3JVT C;  1CFD A;  5KU1 A;  1RWY A;  1SR6 C;  1NCX A;  3AKB A;  3WXA A;  1YUU A;  3LL8 B;  4OV2 A;  1NX1 A;  4DCK A;  2MAZ A;  3KEV A;  3OBV A;  2LHL A;  3SIB A;  1B9A A;  3FE9 A;  1QX5 B;  3QME A;  4OKH A;  3SG2 A;  4YGC B;  1DJY A;  3N7H A;  1SW8 A;  4PHK A;  1B8R A;  2PMY A;  2LM5 A;  2LVI A;  2PRU A;  1DEK A;  2M1K B;  1YX8 A;  3L4A A;  2EHB A;  2LC5 A;  3D77 A;  1F70 A;  2CT9 A;  1OZS A;  4NQG A;  3S0A A;  2JTZ A;  3FWB A;  1B4C A;  4MBE A;  3EVR A;  3DZT A;  4INW A;  4QJ5 B;  4NDB A;  1OOH A;  1N0Y A;  1QVI Z;  1UP5 A;  3GOF A;  2M0R A;  2BKI B;  1TWO A;  3KHE A;  4XYN A;  3SG5 A;  2MJW B;  3EK8 A;  1JBA A;  1S36 A;  2WND A;  3DVJ A;  2GGM A;  2KI6 C;  1YUT A;  1C3Y A;  3V2L A;  2CCM A;  1BG1 A;  1GGZ A;  2KBM A;  1KWO B;  3BUX B;  1DTL A;  1TCO B;  3OGN A;  2B1U A;  1C7V A;  2M97 A;  1TOP A;  1RFJ A;  2FJU B;  2KPH A;  1A03 A;  2EC6 B;  1YUR A;  1YX7 A;  2BCB A;  2AAO A;  3NSO A;  2KI4 C;  2M1U A;  4GNK B;  1REC A;  5ER4 X;  3VRP A;  5J3X A;  2WCF A;  2QEB A;  2GGZ A;  4YI9 A;  2CXJ A;  1F54 A;  3BJH A;  4GGF A;  1OOI X;  5B8I B;  4MZJ A;  3DXL A;  1UHH A;  1TTX A;  1P28 A;  4BY5 A;  2MLF C;  1SK6 D;  2H61 C;  1LIN A;  3S0D A;  3TUY B;  1W7I B;  3CYZ A;  1CKK A;  5JJG A;  4PHM A;  5HL1 A;  2JXC A;  1OZO A;  1RTP 1;  3S0E A;  3ZNI A;  1IRJ A;  1PUL A;  3D73 A;  4A4C A;  3SS3 A;  1A29 A;  1G8I A;  1OOJ A;  1VRK A;  2HQW A;  2KFH A;  1JFJ A;  1KSM A;  5KSZ A;  2DOQ A;  1M31 A;  3CR2 A;  3NHT A;  4M2O A;  1DJZ A;  1JFK A;  4PAL A;  2NLN A;  2FOT A;  1DJW A;  1UUR A;  4PHN A;  1BF5 A;  4I5N B;  5AFP A;  3OB1 B;  1KFU S;  1QIV A;  4JPZ B;  5CSN A;  5AXI A;  3O4Y A;  5CPV A;  3PJI A;  1KQM B;  2SAS A;  1NX2 A;  1NP8 A;  1J1E A;  1V1G A;  2JQ6 A;  1ZUZ A;  5HYD A;  3JTD B;  1SCV A;  3MSE B;  4C0J A;  2WOR A;  4F0Z B;  4IL1 A;  1CLB A;  2QEO A;  1CTR A;  1PRW A;  3UNW A;  4Q04 A;  5PAL A;  4AQI A;  3PM2 A;  2LV7 A;  3CZ0 A;  2P71 A;  2F33 A;  1DEL A;  1TNQ A;  3DF0 B;  3S0F A;  2JNF A;  1Y1A A;  4HRG A;  2K2A A;  1OSA A;  2BNX A;  2BL0 B;  2K7C A;  3PAL A;  1QLS A;  2V53 A;  3DVM A;  1YUS A;  1M63 B;  4INX A;  1TUJ A;  3DVK A;  1NCY A;  2KQY A;  5I2Q A;  1YRU B;  1JSA A;  3UO9 A;  2K0J A;  2M8U A;  2MRD A;  4JKT A;  2JZI A;  1CMG A;  2KGB C;  1CFP A;  3VRN A;  2H61 A;  2EGD A;  1B1G A;  1S5G Y; 
#chains in the Genus database with same CATH homology
 3CGA A;  3BUM B;  4DIR A;  1H8B A;  1FF1 A;  2ZRS A;  1QX7 A;  2L2E A;  1D1O A;  1TNW A;  2M3W A;  3TDU A;  2KFF A;  2F2P A;  1BOD A;  2FCE A;  1DGV A;  1TIZ A;  1XK4 A;  1LA3 A;  3E3R A;  4E68 A;  1KFU L;  1WY9 A;  4PDZ A;  2E6W A;  2LLU A;  1NWD A;  2ZN9 A;  5IBW A;  1Y0V H;  1QAT A;  1S6I A;  4I5L B;  1JUO A;  1R2U A;  1U5I B;  4C0L A;  1A75 B;  3NSL A;  1JF0 A;  1SNL A;  4XJK B;  3D0Y B;  2ZRT A;  4R1E A;  4GUK A;  1CLL A;  1F71 A;  4JQ0 D;  2JXL A;  2I18 A;  3KO0 A;  4OCI A;  2F3Z A;  3TDZ A;  2M49 B;  1QTX A;  4GAO A;  2KAY A;  1F4O A;  1KSO A;  1MUX A;  2K7B A;  5F6T A;  1J1D A;  1SMG A;  1DF0 B;  3SG4 A;  3SJS A;  5TNC A;  1CB1 A;  1YR5 A;  2ZN8 A;  1GJY A;  1U5I A;  1PVA A;  2KYF A;  1CDL A;  1NPQ A;  1WLZ A;  5G08 A;  3D0Y A;  1SY9 A;  1W7J B;  4WQ2 A;  1KWO C;  5HKY A;  1G33 A;  2LE9 B;  4HRH A;  1EG4 A;  4GPL B;  1TRF A;  3AAJ A;  2KNE A;  1AUI B;  2BEC A;  2EC6 C;  1JC2 A;  3O6B A;  1IJ6 A;  1ZAC A;  4PHJ A;  5JOL A;  1S1E A;  1BU3 A;  4MN0 A;  3SG7 A;  4MZL A;  3CR4 X;  3I5F B;  3CZT X;  1DF0 A;  2LMU A;  3AAK A;  1M46 A;  3I5I B;  3RLZ A;  1DJX A;  3OX6 A;  3BOW B;  3VGO A;  1PAL A;  1FI6 A;  1GGW A;  4ZCU A;  3BUO B;  1UHK A;  3CR5 X;  3EVU A;  1NX0 A;  1AK8 A;  2MA2 A;  1F8H A;  3TUY C;  1UHJ A;  5HKW A;  1CM4 A;  1K9K A;  4N1F A;  2M7L A;  5ER5 A;  2K2F A;  2D8N A;  1Y1U A;  2RGI A;  2HQ8 A;  3CS1 A;  3PLF B;  3I5H B;  4CFR A;  1J7O A;  2LLT A;  3GK1 A;  1RK9 A;  2KQ6 A;  4GGN A;  2ZNE A;  1AP4 A;  1K94 A;  3AKA A;  3HCM A;  2Y1M A;  2LMT A;  1QVI Y;  2K61 A;  2KFG A;  1V1F A;  1QS7 A;  2BE4 A;  5D7F A;  4DUQ A;  2OTG B;  1B47 A;  1IG5 A;  1CM1 A;  1F4Q A;  1K9P A;  3KPX A;  1AJ4 A;  3BOW A;  2K7D A;  2LLS A;  1BR1 B;  1QV0 A;  3FS7 A;  5DKQ A;  5AAN A;  5HYD A;  2LMV A;  1BMO A;  3ICB A;  1KQM C;  4YGB B;  2JT3 A;  4I5K A;  3JTD C;  1IH0 A;  1XFW O;  4USL A;  2K7O A;  1ZFS A;  2NXQ A;  4YGA A;  1J7Q A;  1PVB A;  4DRW A;  4FQO A;  3DD4 A;  2R2I A;  1SL9 A;  5HKZ A;  2VRG A;  3LK1 A;  2MBX A;  4TNC A;  1QV1 A;  1IGV A;  1EH2 A;  2P6B B;  1XK4 C;  2ZKM X;  2BL0 C;  5CSF A;  1ALW A;  2JT8 A;  2LVK A;  1B7T Z;  3PFV A;  4YBH B;  1S6J A;  2LP3 A;  3KF9 A;  4N1G A;  1MF8 B;  1K93 D;  1BOC A;  3HX4 A;  4N5X A;  1HQV A;  1UHI A;  1YVH A;  2LAP A;  2OS8 B;  4M2Q A;  1SBJ A;  2HF5 A;  2WC8 A;  4L9M A;  1CFF A;  1NYA A;  2JWW A;  5AEQ A;  3WNX B;  1A4P A;  1QXP A;  2Y5I A;  2H2K A;  3FIA A;  1XYD A;  4AOM A;  1CDP A;  4I5J A;  2FCD A;  1AVS A;  1BR4 B;  2I7A A;  3SG6 A;  5I2O A;  1OMR A;  1PK0 D;  2Y1N A;  3K21 A;  1XVJ A;  1X02 A;  2JUL A;  3FWC A;  2SCP A;  5DKN A;  1PSR A;  1S5G Z;  2K8M B;  3OP0 A;  4QJ3 B;  3CWG A;  1QIW A;  4ORB B;  1WRL A;  1FI5 A;  1FPW A;  2NCP A;  4P2Y B;  3LLE A;  4ZCV A;  3BUW B;  2JT0 A;  1CDM A;  2G9B A;  1MHO A;  1CDN A;  1SRA A;  1UUS A;  4PE1 A;  1SKT A;  2KSP A;  3DF0 A;  3QRX A;  4QJ4 B;  5K89 A;  2BE6 A;  3BUN B;  2KI6 D;  1Q80 A;  2IS9 A;  1XFY O;  2PAS A;  5DKR A;  3LK0 A;  2CBL A;  2KDH A;  1S6C A;  1XO5 A;  1TCF A;  1B8C A;  4FTG A;  1LVC D;  2F3Y A;  1EJ3 A;  1E8A A;  1SYM A;  2L0P A;  2WOS A;  1DJG A;  3EK4 A;  3TDI A;  1KFX S;  3OX5 A;  4DS7 A;  2JNX A;  2LVV A;  3NXA A;  1XFX O;  1K90 D;  4P5O E;  5KTY A;  1KK8 B;  1K2H A;  1AJ5 A;  4MRY A;  5HLO A;  1C07 A;  1TN4 A;  1TNP A;  4OR9 B;  1B4C A;  1LA0 A;  1JBA A;  1JF2 A;  1WLM A;  1NCZ A;  2LP2 A;  2KGR A;  3EKH A;  1IWQ A;  2CTN A;  3I5I C;  2I2R E;  3I5F C;  3I5G B;  1J55 A;  1M39 A;  3ZWH A;  2Y4Q A;  2ZFD A;  4GGF C;  2QAC A;  1KK7 Y;  1EG3 A;  3TS5 B;  1A75 A;  1HT9 A;  2ZND A;  4NDC A;  1RJV A;  1N2D A;  4XJK A;  1N65 A;  3OB2 B;  2KYC A;  1Y6W A;  2BCA A;  1L2O B;  3PN7 B;  4ORA B;  3PM8 A;  2KAV A;  1NX3 A;  5FYX A;  1MXE A;  3M0W A;  1DVI A;  2LHI A;  3I5H C;  1WDC B;  4YRU A;  4WRI A;  1MQ1 A;  3CTN A;  3EKJ A;  3BQ3 A;  4YGD B;  1R6P A;  4CLN A;  5I8N A;  3PSR A;  2O5G A;  2OTG C;  1CMF A;  5CSI A;  1IQ5 A;  4GBA A;  3TZ1 A;  1K8U A;  1KFX L;  1TNX A;  1XFZ O;  1MR8 A;  1YTZ C;  1S26 D;  2KBI A;  1QAS A;  2HET A;  2M9G A;  3A4U B;  3C1V A;  1XFU O;  3EK7 A;  3IQQ A;  1DT7 B;  2F2O A;  2L98 A;  1H4B A;  2BKH B;  2JPT A;  1S3P A;  2L4H A;  2PVB A;  3BYA A;  3JVT B;  1JWD A;  4CFQ A;  4PCW A;  4D1E A;  1SR6 B;  3WHU B;  1B8L A;  2MLE C;  3VRO A;  1WRK A;  2OPO A;  1NIW A;  4CID A;  1F55 A;  3NSI A;  4MSP A;  2LAN A;  5BPJ A;  1ZOT B;  4MRX A;  2M7N A;  1DGU A;  2GV5 A;  4PE0 A;  3O78 A;  4NDD A;  3VRR A;  2NCO A;  1K96 A;  2MHH A;  1IKU A;  2OS8 C;  3RM1 A;  3DVE A;  3PAT A;  1NSH A;  3GK4 X;  4AQJ A;  2BCX A;  1CFC A;  1BT6 A;  2JC2 A;  5AER A;  3VRQ A;  3H4S E;  3SIA A;  5CSJ A;  1L7Z A;  4C0K A;  2QPT A;  1KQV A;  2NZ0 A;  2O60 A;  1FW4 A;  4BY4 A;  4YI8 A;  1FBV A;  3WHT B;  1ALV A;  3CLN A;  4GFT A;  1M45 A;  1IQ3 A;  1EXR A;  1WRZ A;  2KHN A;  1Y1X A;  2LUC A;  4ICB A;  1K95 A;  4OVN F;  2JTT A;  4A4B A;  1ZMZ A;  1OQP A;  3GK2 A;  2L50 A;  2LVJ A;  1J7R A;  3O2P A;  3D10 A;  2KI4 B;  2ISD A;  5I2L A;  1DMO A;  1C7W A;  4U8D A;  2I94 A;  1CLM A;  1SL7 A;  1ODB A;  1OMV A;  4CPV A;  1MWN A;  3IQO A;  1B7T Y;  1YVL A;  1DJI A;  2TN4 A;  2LUX A;  1OMD A;  3NSK A;  1LXF C;  1NUB A;  1OE9 B;  1PSB A;  2A4J A;  2L4I A;  1LKJ A;  1XFV O;  2G2B A;  2WCB A;  4HSZ A;  1KCY A;  4MEW A;  2WCE A;  2KOT A;  1BLQ A;  1KK8 C;  2BBN A;  4PE7 A;  2COL B;  1J7P A;  2JOJ A;  3SG3 A;  4WQ3 A;  2KAX A;  4YGE B;  1XA5 A;  3I5G C;  5D69 A;  2CNP A;  2JU0 A;  1SCM C;  2BBM A;  2F8P A;  2AMI A;  2AUC A;  1UHN A;  2JRF A;  4MZK A;  3LCP C;  3TS5 C;  5HLV A;  1DJH A;  2E30 A;  2LCP A;  1YRT B;  2L5X B;  4ETO A;  3F45 A;  3PN7 C;  1L2O C;  4UPG A;  4PE4 A;  4HRE E;  2PSR A;  1UWO A;  1AHR A;  1IJ5 A;  5GQQ C;  2L51 A;  1G4Y R;  1WDC C;  2HPS A;  1EL4 A;  2LNK A;  1QJT A;  1GQM A;  4ORC B;  1RRO A;  2PAL A;  4MVF A;  1MXL C;  1CNP A;  2Q91 A;  1KK7 Z;  4MLW A;  1SCM B;  2Q4U A;  3OHM B;  4JWQ A;  1A2X A;  1BJF A;  1QLK A;  3BXK A;  3EVV A;  3A8R A;  4M2P A;  1K9U A;  2M29 A;  1SPY A;  3IF7 A;  1SL8 A;  1QX2 A;  3JVT C;  1CFD A;  5KU1 A;  1RWY A;  1SR6 C;  1NCX A;  3AKB A;  3WXA A;  1YUU A;  3LL8 B;  4OV2 A;  1NX1 A;  4DCK A;  2MAZ A;  3KEV A;  3SIB A;  2LHL A;  1B9A A;  1QX5 B;  4OKH A;  3SG2 A;  4YGC B;  1DJY A;  1SW8 A;  4PHK A;  1B8R A;  2PMY A;  2LM5 A;  2LVI A;  2PRU A;  2M1K B;  1YX8 A;  2EHB A;  2LC5 A;  1F70 A;  2CT9 A;  1OZS A;  4NQG A;  2JTZ A;  3FWB A;  4MBE A;  3EVR A;  4QJ5 B;  4NDB A;  1N0Y A;  1QVI Z;  1UP5 A;  3GOF A;  2M0R A;  2BKI B;  3KHE A;  4XYN A;  3SG5 A;  2MJW B;  3EK8 A;  1S36 A;  2WND A;  3DVJ A;  2GGM A;  2KI6 C;  1YUT A;  2CCM A;  1BG1 A;  1GGZ A;  2KBM A;  1KWO B;  3BUX B;  1DTL A;  1TCO B;  2B1U A;  1C7V A;  2M97 A;  1TOP A;  1RFJ A;  2FJU B;  1A03 A;  2EC6 B;  1YUR A;  1YX7 A;  2BCB A;  2AAO A;  3NSO A;  2KI4 C;  2M1U A;  4GNK B;  1REC A;  5ER4 X;  3VRP A;  5J3X A;  2WCF A;  2GGZ A;  4YI9 A;  2CXJ A;  1F54 A;  4GGF A;  5B8I B;  4MZJ A;  1UHH A;  1TTX A;  4BY5 A;  2MLF C;  1SK6 D;  2H61 C;  1LIN A;  3TUY B;  1CKK A;  1W7I B;  5JJG A;  4PHM A;  2JXC A;  1OZO A;  1RTP 1;  3ZNI A;  1IRJ A;  1PUL A;  4A4C A;  1A29 A;  1G8I A;  1OOJ A;  1VRK A;  2HQW A;  2KFH A;  1JFJ A;  1KSM A;  5KSZ A;  2DOQ A;  1M31 A;  3CR2 A;  4M2O A;  1DJZ A;  1JFK A;  4PAL A;  2NLN A;  2FOT A;  1DJW A;  1UUR A;  4PHN A;  1BF5 A;  4I5N B;  5AFP A;  3OB1 B;  1KFU S;  1QIV A;  4JPZ B;  5CSN A;  5AXI A;  3O4Y A;  5CPV A;  1KQM B;  2SAS A;  1NX2 A;  1NP8 A;  1J1E A;  1V1G A;  2JQ6 A;  1ZUZ A;  3JTD B;  1SCV A;  3MSE B;  4C0J A;  2WOR A;  4F0Z B;  4IL1 A;  1CLB A;  1CTR A;  1PRW A;  4Q04 A;  5PAL A;  4AQI A;  2LV7 A;  2F33 A;  1TNQ A;  3DF0 B;  2JNF A;  1Y1A A;  4HRG A;  2K2A A;  1OSA A;  2K7C A;  2BL0 B;  3PAL A;  1QLS A;  2V53 A;  3DVM A;  1YUS A;  1M63 B;  3DVK A;  1NCY A;  2KQY A;  5I2Q A;  1YRU B;  1JSA A;  2K0J A;  2M8U A;  2MRD A;  2JZI A;  1CMG A;  2KGB C;  1CFP A;  3VRN A;  2H61 A;  2EGD A;  1B1G A;  1S5G Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...