3SJSA

Crystal structure of ure3-binding protein from entamoeba histolytica, (d127a,n129a) mutant, native form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
212
Chain Sequence
NFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNARARSGTLEPHEILPALQQLGFYINQRTSLLLHRLFAMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
total genus 74
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sjsA01
3D0YB 2K7CA 1OQPA 1QX2A 3IQQA 2FCDA 1KQMC 2K2AA 2KQYA 3OX6A 1IQ5A 2KBIA 4JQ0D 4USLA 3SG7A 4CLNA 3I5FB 2PRUA 1TCOB 2WCBA 4QJ4B 2JTTA 1AJ4A 2LLSA 3D10A 4NDDA 5HLVA 3JVTC 1AVSA 4HSZA 1W7IB 1S5GZ 2WC8A 2Q4UA 2DOQA 3SG4A 3GOFA 2WNDA 1KK8B 2BBNA 1XFWO 2E30A 1QS7A 1K95A 4N1FA 2FJUB 2KSPA 1TN4A 2KI6C 1A4PA 1Y6WA 4OVNF 2LVJA 1EH2A 4PHJA 2L2EA 2PASA 2WOSA 1KWOC 4D1EA 1V1FA 5ER5A 4GPLB 1RROA 1OMRA 2H2KA 3FS7A 3ZNIA 1BJFA 1X02A 3O6BA 3I5HB 1WRKA 1SW8A 2KGRA 1B7TZ 2CTNA 2NCPA 2JXCA 3BUXB 2EC6C 1LA3A 4MSPA 5D69A 2COLB 1QX7A 4MZKA 3WNXB 3VGOA 1K9KA 1IWQA 1DTLA 1SKTA 2JT8A 1UHHA 1W7JB 2JT0A 1NYAA 1XFVO 1WRLA 3E3RA 2F33A 3F45A 1C07A 2KAVA 1HT9A 1V1GA 3LL8B 2OTGB 2JNFA 1JWDA 3NXAA 4YGAA 1CFPA 1YUTA 4ETOA 3LK0A 1MR8A 1A75B 1PVAA 1F55A 1BT6A 1OE9B 4WQ2A 1RWYA 1TNQA 2ISDA 1MXLC 4DS7A 2CBLA 2HF5A 1DGUA 1PVBA 1Y1UA 3KO0A 3PSRA 1HQVA 1ZMZA 1LINA 3FWBA 1KCYA 2ZNEA 1OMDA 1SL9A 2PSRA 3CR4X 1B8CA 3CTNA 1DF0B 5DKRA 2H61A 3CLNA 4UPGA 2GV5A 5IBWA 1R6PA 3OX5A 3I5FC 1ZOTB 2JU0A 2Y1MA 1UP5A 1XO5A 4TNCA 2KAYA 4E68A 2KI4B 3EK8A 3DVMA 2LE9B 1FBVA 1A03A 1AHRA 4ICBA 1F71A 1K96A 3MSEB 2KQ6A 2P6BB 4GAOA 3EVVA 1KK8C 2I7AA 1OZOA 2F3ZA 4MRXA 4YGEB 2O5GA 1NUBA 3AKBA 1KFXS 3KEVA 1A75A 4ORCB 4DIRA 1QXPA 2LC5A 2VRGA 1YVHA 1SYMA 1BU3A 4GFTA 1S6CA 2KFGA 3TDIA 1FI6A 2AMIA 2I94A 3O2PA 4MVFA 5I2OA 1CM1A 1L7ZA 1IQ3A 1S5GY 2F2PA 2ZKMX 3EK7A 4PHKA 2LLTA 3I5HC 1YURA 1DF0A 1UHKA 3DD4A 1ODBA 1SK6D 2ZRTA 4HRHA 3ZWHA 2I2RE 2LHIA 1JF2A 3CS1A 3BUMB 1TRFA 4R1EA 3PM8A 2LMTA 1ALVA 1LA0A 2LANA 4I5KA 3DVJA 1XVJA 1QV1A 5I2QA 1WLMA 2LP2A 2ZFDA 2LAPA 1UWOA 2JQ6A 2PVBA 1QVIZ 2OTGC 3AKAA 3SJSA 2M97A 1B7TY 1AUIB 1TNWA 3K21A 4MN0A 2KI6D 1JFJA 1EXRA 2BCXA 3WXAA 1ZUZA 1TCFA 2TN4A 1QTXA 2M7NA 4YGDB 3SIBA 1YVLA 1F70A 2ZN9A 1BR4B 1Y0VH 1UHNA 1A2XA 4AQIA 3BXKA 2JULA 1UHJA 4L9MA 2CT9A 4MBEA 1TOPA 2LM5A 1XK4A 4I5LB 3SG5A 1DJXA 2G9BA 4OKHA 2M7LA 1M39A 1NCYA 2Y4QA 1BR1B 4ORBB 2MBXA 2OPOA 1EJ3A 2AUCA 3EKHA 4XJKB 1LXFC 4ORAB 2EGDA 2KI4C 2V53A 1IGVA 2QACA 1J55A 1SL8A 4F0ZB 4PHNA 1Y1AA 2BL0B 2KAXA 4NQGA 1MWNA 2JWWA 5CSIA 3D0YA 3BUNB 2M3WA 5AEQA 1N65A 4I5JA 4NDBA 1SMGA 2F3YA 3KF9A 1DGVA 1QLSA 2L5XB 3GK4X 3NSKA 1B4CA 4M2QA 3GK1A 2KFFA 3RM1A 1TNXA 2D8NA 1CLMA 5KSZA 1CMGA 4PE0A 2CCMA 5I2LA 3A8RA 1AP4A 1KFUL 2CXJA 4AQJA 3PN7B 4YI9A 1KSMA 4YI8A 1S6JA 1S1EA 1N0YA 1PULA 5BPJA 1CDLA 4M2PA 1XK4C 2M1UA 2KYFA 2JRFA 1PSRA 1DJGA 2Y1NA 3AAJA 3JTDB 1XFYO 2LV7A 1OZSA 1DJIA 2AAOA 1FW4A 3O4YA 3SG2A 2L4IA 3OB2B 1DMOA 1MF8B 2Y5IA 1IG5A 2K0JA 4CFQA 3CR5X 2IS9A 4PALA 1E8AA 1C7VA 1QIVA 4MLWA 2M1KB 3VROA 2BE6A 1LKJA 3ICBA 4QJ3B 4WQ3A 1FPWA 1H4BA 1SRAA 1OOJA 4PDZA 1JF0A 1YRTB 2JOJA 1YUSA 2JXLA 1M46A 2B1UA 3HCMA 5ER4X 2NLNA 4HRGA 1JUOA 2LUCA 3I5IB 1QIWA 3I5GB 1S6IA 1SL7A 2F8PA 5HYDA 2OS8B 3EVUA 3KHEA 5AFPA 4BY4A 1YR5A 4YRUA 1SCMB 1TIZA 1WDCB 2E6WA 2LVVA 1F54A 1CNPA 1G8IA 2KNEA 5CSFA 1A29A 4YBHB 3GK2A 1GJYA 1K8UA 1SPYA 1G4YR 2HPSA 2NXQA 3OHMB 5KU1A 1CKKA 1C7WA 1QVIY 4DUQA 1B8RA 1RK9A 2SASA 4P5OE 3TS5B 1NSHA 2M29A 4FQOA 5B8IB 4CPVA 1MHOA 4C0KA 1F8HA 2LLUA 2MLFC 3BQ3A 2M49B 4ZCUA 1PALA 1OMVA 4GGNA 1M45A 3FWCA 3PALA 1F4OA 2MRDA 4MZLA 5DKQA 1AJ5A 4OV2A 1IKUA 2BL0C 1K9PA 5AXIA 4PHMA 1XFZO 4C0LA 1ZFSA 2SCPA 1L2OB 4A4CA 2JTZA 4QJ5B 4JPZB 4GUKA 5PALA 3CGAA 1PRWA 1QLKA 1YTZC 3BOWB 1IJ5A 3EK4A 1AK8A 2MLEC 2RGIA 4NDCA 1CFCA 1J7QA 2K7DA 2HETA 3PN7C 5AANA 3O78A 2G2BA 3TUYB 1N2DA 3EKJA 3CR2A 3C1VA 1NIWA 1RJVA 1K93D 3VRNA 2K8MB 2FCEA 4CIDA 1SR6B 1K2HA 1NPQA 1MUXA 5F6TA 5JJGA 1DJZA 1S36A 2JZIA 1TTXA 1UURA 2LMVA 3JTDC 4M2OA 2PMYA 1CMFA 2NCOA 4MZJA 5DKNA 5G08A 2K61A 1J7PA 4YGBB 4C0JA 1F4QA 4GBAA 2L4HA 4Q04A 4OR9B 3IF7A 1UUSA 1NCXA 5FYXA 4DRWA 3CWGA 1QJTA 4GGFC 1J7OA 1J1EA 1S26D 2MJWB 4WRIA 4PE1A 2LMUA 3VRRA 2LP3A 1EG3A 2M0RA 2L50A 1SCVA 3I5IC 1YX8A 3BOWA 3I5GC 2LUXA 4CFRA 4N1GA 1DT7B 1GGZA 2OS8C 3DVEA 2KFHA 3PFVA 1SCMC 1FF1A 2LVIA 1WDCC 2MAZA 2WORA 2ZRSA 5HKZA 2KYCA 1BLQA 1CTRA 5JOLA 2MHHA 3H4SE 1CFDA 1CB1A 1KK7Z 2WCFA 2WCEA 3TS5C 2I18A 3OB1B 3PLFB 1OSAA 2BBMA 1UHIA 1SY9A 1VRKA 2ZN8A 2BCAA 1NX3A 5I8NA 3BUWB 2CNPA 3HX4A 2QPTA 1GQMA 2NZ0A 5D7FA 3SG6A 1YX7A 3OP0A 2JNXA 1CM4A 3WHTB 4P2YB 1BMOA 3LCPC 1GGWA 3QRXA 5TNCA 1L2OC 2L51A 4XJKA 5HKYA 1RECA 4N5XA 3WHUB 2EHBA 5J3XA 3DVKA 1S3PA 2K7OA 2LNKA 3FIAA 2JPTA 1D1OA 1KFUS 2BCBA 3TDUA 1YUUA 3LK1A 1XA5A 4OCIA 1H8BA 5CPVA 4MRYA 1IRJA 1KQMB 1G33A 3NSOA 5CSNA 1EG4A 1FI5A 4JWQA 2HQWA 1BOCA 2KOTA 1IJ6A 1NX1A 3TUYC 3RLZA 2BKHB 3SIAA 4AOMA 1MXEA 4BY5A 2GGMA 1U5IB 1BODA 3DF0B 1SR6C 2M8UA 1Y1XA 3JVTB 1CDNA 2R2IA 2L98A 3NSIA 4XYNA 1CFFA 1NCZA 2F2OA 1J7RA 1ZACA 2K2FA 1BG1A 1XFUO 4MEWA 1Q80A 2JC2A 1WLZA 3LLEA 4PE7A 1JFKA 1QASA 3EVRA 1WY9A 1NX2A 2FOTA 2L0PA 2Q91A 4U8DA 3VRPA 1CLLA 2ZNDA 1SBJA 1DJYA 1CDPA 1QV0A 1K94A 1KFXL 3NSLA 1XFXO 1IH0A 1RTP1 2GGZA 5HLOA 1KWOB 1B9AA 3KPXA 3SG3A 4ZCVA 3TDZA 5K89A 1RFJA 5KTYA 2K7BA 2PALA 1ALWA 3IQOA 1PK0D 4YGCB 1PSBA 2LHLA 1BF5A 1TNPA 5CSJA 4I5NB 1JC2A 1QATA 3AAKA 3CZTX 2EC6B 2JT3A 4GGFA 1WRZA 5GQQC 5HKWA 1K9UA 2LCPA 1CDMA 1DJWA 1J1DA 4GNKB 3M0WA 2KGBC 1JSAA 1U5IA 1R2UA 4FTGA 4HREE 1NWDA 3DF0A 4PCWA 4A4BA 1B1GA 1NP8A 2HQ8A 1DJHA 3TZ1A 1LVCD 2BKIB 2LVKA 2BECA 1JBAA 1XYDA 2O60A 3PATA 1YRUB 1B47A 4PE4A 3BUOB 2H61C 1DVIA 2M9GA 2MA2A 4IL1A 1CLBA 1KSOA 1M63B 4DCKA 2A4JA 5AERA 2BE4A 1B8LA 3BYAA 1NX0A 1KQVA 1KK7Y 1MQ1A 1M31A 2KHNA 1K90D 2KBMA 3A4UB 1EL4A 1QX5B 3VRQA 1SNLA 2KDHA
chains in the Genus database with same CATH superfamily
3D0YB 2K7CA 1OQPA 1QX2A 3IQQA 2FCDA 1KQMC 2K2AA 2KQYA 3DY9A 1IQ5A 2KBIA 3OX6A 4USLA 3SG7A 1FI5A 4CLNA 3I5FB 2PRUA 1TCOB 2WCBA 3B7AA 3UO9A 3L4AA 2JTTA 1AJ4A 4QJ4B 2LLSA 3D10A 4NDDA 5HLVA 1Z2CB 2PYQA 3JVTC 1AVSA 4HSZA 1W7IB 1S5GZ 2WC8A 2Q4UA 2DOQA 3SG4A 3GOFA 3SS3A 2WCJA 1C3YA 2WNDA 3RZSA 1KK8B 2BBNA 1XFWO 1DEKA 2E30A 1QS7A 4IJ7A 1K95A 4N1FA 2FJUB 2KSPA 1TN4A 2KI6C 3BFHA 1A4PA 1Y6WA 4OVNF 2LVJA 1EH2A 1W9ZA 4PHJA 2L2EA 2PASA 3CDNA 1DC1A 2WOSA 1KWOC 4D1EA 1V1FA 3N7HA 5ER5A 1TUZA 4GPLB 1RROA 1OMRA 2H2KA 3FS7A 3ZNIA 1BJFA 1X02A 3O6BA 3I5HB 1WRKA 1SW8A 2KGRA 1B7TZ 2WCMA 2CTNA 2NCPA 2JXCA 3BUXB 2EC6C 1LA3A 4MSPA 5D69A 2COLB 1QX7A 4MZKA 3WNXB 3VGOA 1K9KA 1IWQA 1DTLA 1SKTA 1SSEB 2JT8A 1UHHA 1W7JB 3D78A 2JT0A 1NYAA 1XFVO 1WRLA 3E3RA 2F33A 3F45A 2QEOA 1C07A 2KAVA 1HT9A 1V1GA 3LL8B 2OTGB 2JNFA 1JWDA 3NXAA 4YGAA 1CFPA 1YUTA 4ETOA 3LK0A 1MR8A 1A75B 1PVAA 1F55A 1BT6A 1OE9B 3NGVA 4WQ2A 1RWYA 2QEVA 1TNQA 2ISDA 1MXLC 4DS7A 2CBLA 2HF5A 1DGUA 1PVBA 1Y1UA 3KO0A 3PSRA 1HQVA 1ZMZA 1LINA 3FWBA 1KCYA 2ZNEA 1OMDA 1SL9A 2PSRA 3CR4X 3FE8A 1B8CA 3CTNA 3CZ1A 3CZ0A 1DF0B 5DKRA 2H61A 3CLNA 4UPGA 2GV5A 5IBWA 1R6PA 3OX5A 3I5FC 1ZOTB 2JU0A 2Y1MA 1UP5A 1XO5A 4TNCA 2KAYA 4E68A 2KI4B 3EK8A 3B86A 3DVMA 2LE9B 1FBVA 1A03A 1AHRA 4ICBA 1F71A 1K96A 3MSEB 2KQ6A 2P6BB 4GAOA 3EVVA 1KK8C 2I7AA 1OZOA 2F3ZA 4MRXA 4YGEB 2O5GA 1ORGA 1NUBA 1T14A 3AKBA 1KFXS 2YGUA 3KEVA 1A75A 4ORCB 4DIRA 1QXPA 2LC5A 3B88A 2VRGA 1YVHA 1SYMA 3UNWA 1BU3A 2KPHA 4GFTA 2QEBA 1S6CA 2KFGA 3O4XA 3S0BA 3TDIA 2WC6A 1FI6A 2AMIA 2I94A 3O2PA 4MVFA 5I2OA 1CM1A 1L7ZA 3B6XA 1IQ3A 3D77A 1S5GY 2F2PA 2ZKMX 3EK7A 4PHKA 2LLTA 3I5HC 1QWVA 1YURA 1DF0A 1UHKA 3DD4A 1ODBA 1SK6D 2ZRTA 4HRHA 3DYEA 3ZWHA 2I2RE 2LHIA 1OOHA 1JF2A 1TWOA 3CS1A 3BUMB 1TRFA 4R1EA 3PM8A 2LMTA 1ALVA 1DELA 3SS5A 1LA0A 2LANA 4I5KA 3DVJA 1XVJA 1QV1A 5I2QA 1WLMA 2LP2A 2ZFDA 2LAPA 1UWOA 2JQ6A 2PVBA 1QVIZ 2OTGC 3AKAA 2K60A 3SJSA 2M97A 3VB1A 1B7TY 1AUIB 1TNWA 3K21A 4MN0A 2KI6D 1JFJA 1EXRA 2BCXA 3WXAA 1ZUZA 1TCFA 2TN4A 1QTXA 2M7NA 4YGDB 3SIBA 1YVLA 1F70A 2ZN9A 1BR4B 1Y0VH 1UHNA 1A2XA 4AQIA 3BXKA 2JULA 1UHJA 4L9MA 2CT9A 4F7FA 4MBEA 1TOPA 2LM5A 3CZ2A 1XK4A 4I5LB 3SG5A 1DJXA 1OW4A 2G9BA 4INXA 4OKHA 1M39A 2M7LA 1LS8A 1NCYA 2Y4QA 1BR1B 4JKTA 4ORBB 2MBXA 2OPOA 1EJ3A 2AUCA 3EKHA 4XJKB 1LXFC 4ORAB 2EGDA 2KI4C 2V53A 1IGVA 2QACA 1J55A 1SL8A 4F0ZB 4PHNA 1Y1AA 2BL0B 2KAXA 4NQGA 1MWNA 2JWWA 3QMEA 5CSIA 3D0YA 3BUNB 2M3WA 5AEQA 1N65A 4I5JA 4NDBA 1SMGA 2F3YA 3KF9A 1DGVA 1QLSA 2L5XB 3GK4X 3NSKA 1B4CA 4M2QA 3GK1A 2KFFA 3RM1A 1TNXA 2D8NA 1CLMA 5KSZA 1CMGA 4PE0A 2CCMA 5I2LA 3A8RA 1AP4A 3V2LA 1KFUL 2CXJA 4AQJA 3PN7B 4YI9A 1KSMA 4JD9A 4YI8A 1S6JA 1TUJA 1S1EA 1N0YA 1PULA 5BPJA 2FJYA 1CDLA 4M2PA 1XK4C 2M1UA 2KYFA 2JRFA 1PSRA 1DJGA 2Y1NA 3AAJA 3JTDB 1XFYO 2LV7A 1OZSA 1DJIA 2AAOA 1FW4A 3O4YA 3SG2A 1Z4HA 2L4IA 3OB2B 1DMOA 1MF8B 2Y5IA 1IG5A 2K0JA 3DXLA 4CFQA 3CR5X 2IS9A 4PALA 1E8AA 1C7VA 1QIVA 3FE9A 3S0EA 2QDIA 4PT1A 4MLWA 2M1KB 3VROA 2BE6A 1LKJA 3ICBA 4QJ3B 4WQ3A 1FPWA 1H4BA 1SRAA 1OOJA 4PDZA 1JF0A 1YRTB 2JOJA 1YUSA 2JXLA 1M46A 2B1UA 3HCMA 3NHIA 2NLNA 5ER4X 4HRGA 1JUOA 2LUCA 3I5IB 1QIWA 3I5GB 3K1EA 1S6IA 1SL7A 2F8PA 5HYDA 2OS8B 3EVUA 3KHEA 3SS4A 5AFPA 4BY4A 1YR5A 3D74A 4YRUA 1SCMB 3IVTA 1TIZA 1WDCB 2E6WA 4FQTA 2LVVA 1F54A 1CNPA 1G8IA 2KNEA 5CSFA 1A29A 4YBHB 3GK2A 1GJYA 3R1OA 1K8UA 1SPYA 1OOIX 1G4YR 2HPSA 2NXQA 3OHMB 5KU1A 1CKKA 1C7WA 1QVIY 4DUQA 1B8RA 1RK9A 2SASA 4P5OE 3TS5B 1NSHA 2M29A 2QEHA 3B87A 4FQOA 4CPVA 5B8IB 5EL2A 1MHOA 4C0KA 1OOGA 1F8HA 2LLUA 2MLFC 3BQ3A 2M49B 4ZCUA 1PALA 1OMVA 3S0GA 4GGNA 1M45A 3FWCA 3PALA 1F4OA 2MRDA 4MZLA 5DKQA 1AJ5A 3DZTA 4OV2A 1IKUA 2BL0C 3D76A 1K9PA 5AXIA 4PHMA 1XFZO 4C0LA 1ZFSA 2SCPA 1L2OB 4A4CA 4JQ0D 2JTZA 4QJ5B 3CABA 4JPZB 2KLEA 4GUKA 5PALA 3CGAA 1PRWA 1QLKA 1YTZC 3BOWB 1IJ5A 3EK4A 2JPOA 1AK8A 2MLEC 2RGIA 4NDCA 1OOFA 1CFCA 1J7QA 2K7DA 2HETA 3PN7C 5AANA 3O78A 2G2BA 2PQLA 3TUYB 1N2DA 2WCKA 3CR2A 3EKJA 3C1VA 1NIWA 1RJVA 1K93D 3VRNA 2K8MB 2FCEA 4CIDA 1SR6B 1K2HA 1NPQA 1MUXA 5F6TA 5JJGA 1DJZA 1S36A 2BNXA 2JZIA 1TTXA 1UURA 2LMVA 3JTDC 4M2OA 2PMYA 1CMFA 2NCOA 4MZJA 5DKNA 5G08A 2K61A 1J7PA 4YGBB 4C0JA 1F4QA 4GBAA 2L4HA 4Q04A 4OR9B 3IF7A 1UUSA 1NCXA 5FYXA 4DRWA 3CWGA 1QJTA 4GGFC 4KYNA 1J7OA 1J1EA 1S26D 2MJWB 4WRIA 3S0AA 4PE1A 2LMUA 3VRRA 1DQEA 2LP3A 1EG3A 2M0RA 2L50A 2P70A 3PJIA 3PM2A 5DICA 1SCVA 3L4LA 3I5IC 1C3ZA 1YX8A 3BOWA 3I5GC 2LUXA 4CFRA 4N1GA 1DT7B 1GGZA 2OS8C 3DVEA 2KFHA 3PFVA 1SCMC 1FF1A 2LVIA 1WDCC 2MAZA 2WORA 2ZRSA 5HKZA 2KYCA 1BLQA 1CTRA 5JOLA 2MHHA 3H4SE 1CFDA 1CB1A 1KK7Z 2BAPA 2WCFA 2WCEA 3TS5C 2I18A 1P28A 3OB1B 3PLFB 1OSAA 2BBMA 1UHIA 1SY9A 1VRKA 2ZN8A 2L2CA 3R1VA 2BCAA 1NX3A 5I8NA 3BUWB 2CNPA 3HX4A 1IIOA 2QPTA 1GQMA 2NZ0A 5D7FA 3SG6A 1YX7A 1XFRA 3OP0A 1GM0A 2JNXA 1CM4A 3WHTB 4P2YB 1BMOA 3LCPC 1GGWA 3QRXA 5TNCA 1L2OC 4INWA 2L51A 4XJKA 5HKYA 3L47A 1RECA 4N5XA 3WHUB 2EHBA 5J3XA 3DVKA 1S3PA 2K7OA 2LNKA 2WCHA 3FIAA 2JPTA 1D1OA 1KFUS 2BCBA 3BFAA 1YUUA 3LK1A 3TDUA 1XA5A 4OCIA 1H8BA 2WCLA 5CPVA 4MRYA 1IRJA 1KQMB 1G33A 3NSOA 5CSNA 3OBVA 1EG4A 3EG5B 5FI2A 3BJHA 3S0FA 4JWQA 2HQWA 1BOCA 2KOTA 5FI6A 1IJ6A 1NX1A 3TUYC 3RLZA 2BKHB 3SIAA 4AOMA 1MXEA 4BY5A 2GGMA 1U5IB 1BODA 3DF0B 1SR6C 2M8UA 1Y1XA 3JVTB 1CDNA 2R2IA 2L98A 5FI7A 3NSIA 4XYNA 1CFFA 1NCZA 2F2OA 1J7RA 1ZACA 2K2FA 1BG1A 1XFUO 4MEWA 1Q80A 2JC2A 1WLZA 3LLEA 2WC5A 1JFKA 4PE7A 1QASA 3EVRA 1WY9A 2ERBA 4OZDA 3CYZA 1NX2A 2FOTA 2L0PA 2Q91A 4U8DA 3VRPA 1CLLA 2ZNDA 1SBJA 1DJYA 1CDPA 1QV0A 3D75A 1K94A 1KFXL 3NSLA 1XFXO 1IH0A 1RTP1 2GGZA 5HLOA 1KWOB 1B9AA 3KPXA 3Q8IA 4ZCVA 3SG3A 3TDZA 1RFJA 5K89A 5KTYA 2K7BA 2PALA 1ALWA 3IQOA 1PK0D 3R72A 4YGCB 1PSBA 2LHLA 1BF5A 3FE6A 1TNPA 5CSJA 3D73A 4I5NB 1JC2A 1QATA 3AAKA 3CZTX 2EC6B 2JT3A 4GGFA 1WRZA 5GQQC 5HKWA 1K9UA 2LCPA 1CDMA 1DJWA 1J1DA 4GNKB 3M0WA 2KGBC 2KLDA 1JSAA 1U5IA 1R2UA 4FTGA 4HREE 1NWDA 3DF0A 4PCWA 4A4BA 1B1GA 1NP8A 2GTEA 2HQ8A 2L5YA 3OGNA 1DJHA 3TZ1A 3NHTA 1LVCD 2BKIB 2H8VA 2LVKA 2BECA 1JBAA 1XYDA 2O60A 3PATA 1YRUB 2P71A 1B47A 4PE4A 5HL1A 3BUOB 2H61C 1DVIA 2M9GA 2MA2A 4IL1A 1CLBA 1KSOA 1M63B 4DCKA 2A4JA 3BFBA 5AERA 3R1PA 2BE4A 1B8LA 3BYAA 1NX0A 1KQVA 1KK7Y 1MQ1A 1M31A 2KHNA 1K90D 2KBMA 3A4UB 1EL4A 1QX5B 3VRQA 1SNLA 3S0DA 5I94A 2KDHA 5D3OA
chains in the Genus database with same CATH topology
3D0YB 2K7CA 1OQPA 1QX2A 3IQQA 2FCDA 1KQMC 2K2AA 2KQYA 3OX6A 1IQ5A 2KBIA 4JQ0D 4USLA 3SG7A 4CLNA 3I5FB 2PRUA 1TCOB 2WCBA 4QJ4B 2JTTA 1AJ4A 2LLSA 3D10A 4NDDA 5HLVA 3JVTC 1AVSA 4HSZA 1W7IB 1S5GZ 2WC8A 2Q4UA 2DOQA 3SG4A 3GOFA 2WNDA 1KK8B 2BBNA 1XFWO 2E30A 1QS7A 1K95A 4N1FA 2FJUB 2KSPA 1TN4A 2KI6C 1A4PA 1Y6WA 4OVNF 2LVJA 1EH2A 4PHJA 2L2EA 2PASA 2WOSA 1KWOC 4D1EA 1V1FA 5ER5A 4GPLB 1RROA 1OMRA 2H2KA 3FS7A 3ZNIA 1BJFA 1X02A 3O6BA 3I5HB 1WRKA 1SW8A 2KGRA 1B7TZ 2CTNA 2NCPA 2JXCA 3BUXB 2EC6C 1LA3A 4MSPA 5D69A 2COLB 1QX7A 4MZKA 3WNXB 3VGOA 1K9KA 1IWQA 1DTLA 1SKTA 2JT8A 1UHHA 1W7JB 2JT0A 1NYAA 1XFVO 1WRLA 3E3RA 2F33A 3F45A 1C07A 2KAVA 1HT9A 1V1GA 3LL8B 2OTGB 2JNFA 1JWDA 3NXAA 4YGAA 1CFPA 1YUTA 4ETOA 3LK0A 1MR8A 1A75B 1PVAA 1F55A 1BT6A 1OE9B 4WQ2A 1RWYA 1TNQA 2ISDA 1MXLC 4DS7A 2CBLA 2HF5A 1DGUA 1PVBA 1Y1UA 3KO0A 3PSRA 1HQVA 1ZMZA 1LINA 3FWBA 1KCYA 2ZNEA 1OMDA 1SL9A 2PSRA 3CR4X 1B8CA 3CTNA 1DF0B 5DKRA 2H61A 3CLNA 4UPGA 2GV5A 5IBWA 1R6PA 3OX5A 3I5FC 1ZOTB 2JU0A 2Y1MA 1UP5A 1XO5A 4TNCA 2KAYA 4E68A 2KI4B 3EK8A 3DVMA 2LE9B 1FBVA 1A03A 1AHRA 4ICBA 1F71A 1K96A 3MSEB 2KQ6A 2P6BB 4GAOA 3EVVA 1KK8C 2I7AA 1OZOA 2F3ZA 4MRXA 4YGEB 2O5GA 1NUBA 3AKBA 1KFXS 3KEVA 1A75A 4ORCB 4DIRA 1QXPA 2LC5A 2VRGA 1YVHA 1SYMA 1BU3A 4GFTA 1S6CA 2KFGA 3TDIA 1FI6A 2AMIA 2I94A 3O2PA 4MVFA 5I2OA 1CM1A 1L7ZA 1IQ3A 1S5GY 2F2PA 2ZKMX 3EK7A 4PHKA 2LLTA 3I5HC 1YURA 1DF0A 1UHKA 3DD4A 1ODBA 1SK6D 2ZRTA 4HRHA 3ZWHA 2I2RE 2LHIA 1JF2A 3CS1A 3BUMB 1TRFA 4R1EA 3PM8A 2LMTA 1ALVA 1LA0A 2LANA 4I5KA 3DVJA 1XVJA 1QV1A 5I2QA 1WLMA 2LP2A 2ZFDA 2LAPA 1UWOA 2JQ6A 2PVBA 1QVIZ 2OTGC 3AKAA 3SJSA 2M97A 1B7TY 1AUIB 1TNWA 3K21A 4MN0A 2KI6D 1JFJA 1EXRA 2BCXA 3WXAA 1ZUZA 1TCFA 2TN4A 1QTXA 2M7NA 4YGDB 3SIBA 1YVLA 1F70A 2ZN9A 1BR4B 1Y0VH 1UHNA 1A2XA 4AQIA 3BXKA 2JULA 1UHJA 4L9MA 2CT9A 4MBEA 1TOPA 2LM5A 1XK4A 4I5LB 3SG5A 1DJXA 2G9BA 4OKHA 2M7LA 1M39A 1NCYA 2Y4QA 1BR1B 4ORBB 2MBXA 2OPOA 1EJ3A 2AUCA 3EKHA 4XJKB 1LXFC 4ORAB 2EGDA 2KI4C 2V53A 1IGVA 2QACA 1J55A 1SL8A 4F0ZB 4PHNA 1Y1AA 2BL0B 2KAXA 4NQGA 1MWNA 2JWWA 5CSIA 3D0YA 3BUNB 2M3WA 5AEQA 1N65A 4I5JA 4NDBA 1SMGA 2F3YA 3KF9A 1DGVA 1QLSA 2L5XB 3GK4X 3NSKA 1B4CA 4M2QA 3GK1A 2KFFA 3RM1A 1TNXA 2D8NA 1CLMA 5KSZA 1CMGA 4PE0A 2CCMA 5I2LA 3A8RA 1AP4A 1KFUL 2CXJA 4AQJA 3PN7B 4YI9A 1KSMA 4YI8A 1S6JA 1S1EA 1N0YA 1PULA 5BPJA 1CDLA 4M2PA 1XK4C 2M1UA 2KYFA 2JRFA 1PSRA 1DJGA 2Y1NA 3AAJA 3JTDB 1XFYO 2LV7A 1OZSA 1DJIA 2AAOA 1FW4A 3O4YA 3SG2A 2L4IA 3OB2B 1DMOA 1MF8B 2Y5IA 1IG5A 2K0JA 4CFQA 3CR5X 2IS9A 4PALA 1E8AA 1C7VA 1QIVA 4MLWA 2M1KB 3VROA 2BE6A 1LKJA 3ICBA 4QJ3B 4WQ3A 1FPWA 1H4BA 1SRAA 1OOJA 4PDZA 1JF0A 1YRTB 2JOJA 1YUSA 2JXLA 1M46A 2B1UA 3HCMA 5ER4X 2NLNA 4HRGA 1JUOA 2LUCA 3I5IB 1QIWA 3I5GB 1S6IA 1SL7A 2F8PA 5HYDA 2OS8B 3EVUA 3KHEA 5AFPA 4BY4A 1YR5A 4YRUA 1SCMB 1TIZA 1WDCB 2E6WA 2LVVA 1F54A 1CNPA 1G8IA 2KNEA 5CSFA 1A29A 4YBHB 3GK2A 1GJYA 1K8UA 1SPYA 1G4YR 2HPSA 2NXQA 3OHMB 5KU1A 1CKKA 1C7WA 1QVIY 4DUQA 1B8RA 1RK9A 2SASA 4P5OE 3TS5B 1NSHA 2M29A 4FQOA 5B8IB 4CPVA 1MHOA 4C0KA 1F8HA 2LLUA 2MLFC 3BQ3A 2M49B 4ZCUA 1PALA 1OMVA 4GGNA 1M45A 3FWCA 3PALA 1F4OA 2MRDA 4MZLA 5DKQA 1AJ5A 4OV2A 1IKUA 2BL0C 1K9PA 5AXIA 4PHMA 1XFZO 4C0LA 1ZFSA 2SCPA 1L2OB 4A4CA 2JTZA 4QJ5B 4JPZB 4GUKA 5PALA 3CGAA 1PRWA 1QLKA 1YTZC 3BOWB 1IJ5A 3EK4A 1AK8A 2MLEC 2RGIA 4NDCA 1CFCA 1J7QA 2K7DA 2HETA 3PN7C 5AANA 3O78A 2G2BA 3TUYB 1N2DA 3EKJA 3CR2A 3C1VA 1NIWA 1RJVA 1K93D 3VRNA 2K8MB 2FCEA 4CIDA 1SR6B 1K2HA 1NPQA 1MUXA 5F6TA 5JJGA 1DJZA 1S36A 2JZIA 1TTXA 1UURA 2LMVA 3JTDC 4M2OA 2PMYA 1CMFA 2NCOA 4MZJA 5DKNA 5G08A 2K61A 1J7PA 4YGBB 4C0JA 1F4QA 4GBAA 2L4HA 4Q04A 4OR9B 3IF7A 1UUSA 1NCXA 5FYXA 4DRWA 3CWGA 1QJTA 4GGFC 1J7OA 1J1EA 1S26D 2MJWB 4WRIA 4PE1A 2LMUA 3VRRA 2LP3A 1EG3A 2M0RA 2L50A 1SCVA 3I5IC 1YX8A 3BOWA 3I5GC 2LUXA 4CFRA 4N1GA 1DT7B 1GGZA 2OS8C 3DVEA 2KFHA 3PFVA 1SCMC 1FF1A 2LVIA 1WDCC 2MAZA 2WORA 2ZRSA 5HKZA 2KYCA 1BLQA 1CTRA 5JOLA 2MHHA 3H4SE 1CFDA 1CB1A 1KK7Z 2WCFA 2WCEA 3TS5C 2I18A 3OB1B 3PLFB 1OSAA 2BBMA 1UHIA 1SY9A 1VRKA 2ZN8A 2BCAA 1NX3A 5I8NA 3BUWB 2CNPA 3HX4A 2QPTA 1GQMA 2NZ0A 5D7FA 3SG6A 1YX7A 3OP0A 2JNXA 1CM4A 3WHTB 4P2YB 1BMOA 3LCPC 1GGWA 3QRXA 5TNCA 1L2OC 2L51A 4XJKA 5HKYA 1RECA 4N5XA 3WHUB 2EHBA 5J3XA 3DVKA 1S3PA 2K7OA 2LNKA 3FIAA 2JPTA 1D1OA 1KFUS 2BCBA 3TDUA 1YUUA 3LK1A 1XA5A 4OCIA 1H8BA 5CPVA 4MRYA 1IRJA 1KQMB 1G33A 3NSOA 5CSNA 1EG4A 1FI5A 4JWQA 2HQWA 1BOCA 2KOTA 1IJ6A 1NX1A 3TUYC 3RLZA 2BKHB 3SIAA 4AOMA 1MXEA 4BY5A 2GGMA 1U5IB 1BODA 3DF0B 1SR6C 2M8UA 1Y1XA 3JVTB 1CDNA 2R2IA 2L98A 3NSIA 4XYNA 1CFFA 1NCZA 2F2OA 1J7RA 1ZACA 2K2FA 1BG1A 1XFUO 4MEWA 1Q80A 2JC2A 1WLZA 3LLEA 4PE7A 1JFKA 1QASA 3EVRA 1WY9A 1NX2A 2FOTA 2L0PA 2Q91A 4U8DA 3VRPA 1CLLA 2ZNDA 1SBJA 1DJYA 1CDPA 1QV0A 1K94A 1KFXL 3NSLA 1XFXO 1IH0A 1RTP1 2GGZA 5HLOA 1KWOB 1B9AA 3KPXA 3SG3A 4ZCVA 3TDZA 5K89A 1RFJA 5KTYA 2K7BA 2PALA 1ALWA 3IQOA 1PK0D 4YGCB 1PSBA 2LHLA 1BF5A 1TNPA 5CSJA 4I5NB 1JC2A 1QATA 3AAKA 3CZTX 2EC6B 2JT3A 4GGFA 1WRZA 5GQQC 5HKWA 1K9UA 2LCPA 1CDMA 1DJWA 1J1DA 4GNKB 3M0WA 2KGBC 1JSAA 1U5IA 1R2UA 4FTGA 4HREE 1NWDA 3DF0A 4PCWA 4A4BA 1B1GA 1NP8A 2HQ8A 1DJHA 3TZ1A 1LVCD 2BKIB 2LVKA 2BECA 1JBAA 1XYDA 2O60A 3PATA 1YRUB 1B47A 4PE4A 3BUOB 2H61C 1DVIA 2M9GA 2MA2A 4IL1A 1CLBA 1KSOA 1M63B 4DCKA 2A4JA 5AERA 2BE4A 1B8LA 3BYAA 1NX0A 1KQVA 1KK7Y 1MQ1A 1M31A 2KHNA 1K90D 2KBMA 3A4UB 1EL4A 1QX5B 3VRQA 1SNLA 2KDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Y B;  2K7C A;  1OQP A;  1QX2 A;  3IQQ A;  2FCD A;  1KQM C;  2K2A A;  2KQY A;  3OX6 A;  1IQ5 A;  2KBI A;  4JQ0 D;  4USL A;  3SG7 A;  4CLN A;  3I5F B;  2PRU A;  1TCO B;  2WCB A;  4QJ4 B;  2JTT A;  1AJ4 A;  2LLS A;  3D10 A;  4NDD A;  5HLV A;  3JVT C;  1AVS A;  4HSZ A;  1W7I B;  1S5G Z;  2WC8 A;  2Q4U A;  2DOQ A;  3SG4 A;  3GOF A;  2WND A;  1KK8 B;  2BBN A;  1XFW O;  2E30 A;  1QS7 A;  1K95 A;  4N1F A;  2FJU B;  2KSP A;  1TN4 A;  2KI6 C;  1A4P A;  1Y6W A;  4OVN F;  2LVJ A;  1EH2 A;  4PHJ A;  2L2E A;  2PAS A;  2WOS A;  1KWO C;  4D1E A;  1V1F A;  5ER5 A;  4GPL B;  1RRO A;  1OMR A;  2H2K A;  3FS7 A;  3ZNI A;  1BJF A;  1X02 A;  3O6B A;  3I5H B;  1WRK A;  1SW8 A;  2KGR A;  1B7T Z;  2CTN A;  2NCP A;  2JXC A;  3BUX B;  2EC6 C;  1LA3 A;  4MSP A;  5D69 A;  2COL B;  1QX7 A;  4MZK A;  3WNX B;  3VGO A;  1K9K A;  1IWQ A;  1DTL A;  1SKT A;  2JT8 A;  1UHH A;  1W7J B;  2JT0 A;  1NYA A;  1XFV O;  1WRL A;  3E3R A;  2F33 A;  3F45 A;  1C07 A;  2KAV A;  1HT9 A;  1V1G A;  3LL8 B;  2OTG B;  2JNF A;  1JWD A;  3NXA A;  4YGA A;  1CFP A;  1YUT A;  4ETO A;  3LK0 A;  1MR8 A;  1A75 B;  1PVA A;  1F55 A;  1BT6 A;  1OE9 B;  4WQ2 A;  1RWY A;  1TNQ A;  2ISD A;  1MXL C;  4DS7 A;  2CBL A;  2HF5 A;  1DGU A;  1PVB A;  1Y1U A;  3KO0 A;  3PSR A;  1HQV A;  1ZMZ A;  1LIN A;  3FWB A;  1KCY A;  2ZNE A;  1OMD A;  1SL9 A;  2PSR A;  3CR4 X;  1B8C A;  3CTN A;  1DF0 B;  5DKR A;  2H61 A;  3CLN A;  4UPG A;  2GV5 A;  5IBW A;  1R6P A;  3OX5 A;  3I5F C;  1ZOT B;  2JU0 A;  2Y1M A;  1UP5 A;  1XO5 A;  4TNC A;  2KAY A;  4E68 A;  2KI4 B;  3EK8 A;  3DVM A;  2LE9 B;  1FBV A;  1A03 A;  1AHR A;  4ICB A;  1F71 A;  1K96 A;  3MSE B;  2KQ6 A;  2P6B B;  4GAO A;  3EVV A;  1KK8 C;  2I7A A;  1OZO A;  2F3Z A;  4MRX A;  4YGE B;  2O5G A;  1NUB A;  3AKB A;  1KFX S;  3KEV A;  1A75 A;  4ORC B;  4DIR A;  1QXP A;  2LC5 A;  2VRG A;  1YVH A;  1SYM A;  1BU3 A;  4GFT A;  1S6C A;  2KFG A;  3TDI A;  1FI6 A;  2AMI A;  2I94 A;  3O2P A;  4MVF A;  5I2O A;  1CM1 A;  1L7Z A;  1IQ3 A;  1S5G Y;  2F2P A;  2ZKM X;  3EK7 A;  4PHK A;  2LLT A;  3I5H C;  1YUR A;  1DF0 A;  1UHK A;  3DD4 A;  1ODB A;  1SK6 D;  2ZRT A;  4HRH A;  3ZWH A;  2I2R E;  2LHI A;  1JF2 A;  3CS1 A;  3BUM B;  1TRF A;  4R1E A;  3PM8 A;  2LMT A;  1ALV A;  1LA0 A;  2LAN A;  4I5K A;  3DVJ A;  1XVJ A;  1QV1 A;  5I2Q A;  1WLM A;  2LP2 A;  2ZFD A;  2LAP A;  1UWO A;  2JQ6 A;  2PVB A;  1QVI Z;  2OTG C;  3AKA A;  3SJS A;  2M97 A;  1B7T Y;  1AUI B;  1TNW A;  3K21 A;  4MN0 A;  2KI6 D;  1JFJ A;  1EXR A;  2BCX A;  3WXA A;  1ZUZ A;  1TCF A;  2TN4 A;  1QTX A;  2M7N A;  4YGD B;  3SIB A;  1YVL A;  1F70 A;  2ZN9 A;  1BR4 B;  1Y0V H;  1UHN A;  1A2X A;  4AQI A;  3BXK A;  2JUL A;  1UHJ A;  4L9M A;  2CT9 A;  4MBE A;  1TOP A;  2LM5 A;  1XK4 A;  4I5L B;  3SG5 A;  1DJX A;  2G9B A;  4OKH A;  2M7L A;  1M39 A;  1NCY A;  2Y4Q A;  1BR1 B;  4ORB B;  2MBX A;  2OPO A;  1EJ3 A;  2AUC A;  3EKH A;  4XJK B;  1LXF C;  4ORA B;  2EGD A;  2KI4 C;  2V53 A;  1IGV A;  2QAC A;  1J55 A;  1SL8 A;  4F0Z B;  4PHN A;  1Y1A A;  2BL0 B;  2KAX A;  4NQG A;  1MWN A;  2JWW A;  5CSI A;  3D0Y A;  3BUN B;  2M3W A;  5AEQ A;  1N65 A;  4I5J A;  4NDB A;  1SMG A;  2F3Y A;  3KF9 A;  1DGV A;  1QLS A;  2L5X B;  3GK4 X;  3NSK A;  1B4C A;  4M2Q A;  3GK1 A;  2KFF A;  3RM1 A;  1TNX A;  2D8N A;  1CLM A;  5KSZ A;  1CMG A;  4PE0 A;  2CCM A;  5I2L A;  3A8R A;  1AP4 A;  1KFU L;  2CXJ A;  4AQJ A;  3PN7 B;  4YI9 A;  1KSM A;  4YI8 A;  1S6J A;  1S1E A;  1N0Y A;  1PUL A;  5BPJ A;  1CDL A;  4M2P A;  1XK4 C;  2M1U A;  2KYF A;  2JRF A;  1PSR A;  1DJG A;  2Y1N A;  3AAJ A;  3JTD B;  1XFY O;  2LV7 A;  1OZS A;  1DJI A;  2AAO A;  1FW4 A;  3O4Y A;  3SG2 A;  2L4I A;  3OB2 B;  1DMO A;  1MF8 B;  2Y5I A;  1IG5 A;  2K0J A;  4CFQ A;  3CR5 X;  2IS9 A;  4PAL A;  1E8A A;  1C7V A;  1QIV A;  4MLW A;  2M1K B;  3VRO A;  2BE6 A;  1LKJ A;  3ICB A;  4QJ3 B;  4WQ3 A;  1FPW A;  1H4B A;  1SRA A;  1OOJ A;  4PDZ A;  1JF0 A;  1YRT B;  2JOJ A;  1YUS A;  2JXL A;  1M46 A;  2B1U A;  3HCM A;  5ER4 X;  2NLN A;  4HRG A;  1JUO A;  2LUC A;  3I5I B;  1QIW A;  3I5G B;  1S6I A;  1SL7 A;  2F8P A;  5HYD A;  2OS8 B;  3EVU A;  3KHE A;  5AFP A;  4BY4 A;  1YR5 A;  4YRU A;  1SCM B;  1TIZ A;  1WDC B;  2E6W A;  2LVV A;  1F54 A;  1CNP A;  1G8I A;  2KNE A;  5CSF A;  1A29 A;  4YBH B;  3GK2 A;  1GJY A;  1K8U A;  1SPY A;  1G4Y R;  2HPS A;  2NXQ A;  3OHM B;  5KU1 A;  1CKK A;  1C7W A;  1QVI Y;  4DUQ A;  1B8R A;  1RK9 A;  2SAS A;  4P5O E;  3TS5 B;  1NSH A;  2M29 A;  4FQO A;  5B8I B;  4CPV A;  1MHO A;  4C0K A;  1F8H A;  2LLU A;  2MLF C;  3BQ3 A;  2M49 B;  4ZCU A;  1PAL A;  1OMV A;  4GGN A;  1M45 A;  3FWC A;  3PAL A;  1F4O A;  2MRD A;  4MZL A;  5DKQ A;  1AJ5 A;  4OV2 A;  1IKU A;  2BL0 C;  1K9P A;  5AXI A;  4PHM A;  1XFZ O;  4C0L A;  1ZFS A;  2SCP A;  1L2O B;  4A4C A;  2JTZ A;  4QJ5 B;  4JPZ B;  4GUK A;  5PAL A;  3CGA A;  1PRW A;  1QLK A;  1YTZ C;  3BOW B;  1IJ5 A;  3EK4 A;  1AK8 A;  2MLE C;  2RGI A;  4NDC A;  1CFC A;  1J7Q A;  2K7D A;  2HET A;  3PN7 C;  5AAN A;  3O78 A;  2G2B A;  3TUY B;  1N2D A;  3EKJ A;  3CR2 A;  3C1V A;  1NIW A;  1RJV A;  1K93 D;  3VRN A;  2K8M B;  2FCE A;  4CID A;  1SR6 B;  1K2H A;  1NPQ A;  1MUX A;  5F6T A;  5JJG A;  1DJZ A;  1S36 A;  2JZI A;  1TTX A;  1UUR A;  2LMV A;  3JTD C;  4M2O A;  2PMY A;  1CMF A;  2NCO A;  4MZJ A;  5DKN A;  5G08 A;  2K61 A;  1J7P A;  4YGB B;  4C0J A;  1F4Q A;  4GBA A;  2L4H A;  4Q04 A;  4OR9 B;  3IF7 A;  1UUS A;  1NCX A;  5FYX A;  4DRW A;  3CWG A;  1QJT A;  4GGF C;  1J7O A;  1J1E A;  1S26 D;  2MJW B;  4WRI A;  4PE1 A;  2LMU A;  3VRR A;  2LP3 A;  1EG3 A;  2M0R A;  2L50 A;  1SCV A;  3I5I C;  1YX8 A;  3BOW A;  3I5G C;  2LUX A;  4CFR A;  4N1G A;  1DT7 B;  1GGZ A;  2OS8 C;  3DVE A;  2KFH A;  3PFV A;  1SCM C;  1FF1 A;  2LVI A;  1WDC C;  2MAZ A;  2WOR A;  2ZRS A;  5HKZ A;  2KYC A;  1BLQ A;  1CTR A;  5JOL A;  2MHH A;  3H4S E;  1CFD A;  1CB1 A;  1KK7 Z;  2WCF A;  2WCE A;  3TS5 C;  2I18 A;  3OB1 B;  3PLF B;  1OSA A;  2BBM A;  1UHI A;  1SY9 A;  1VRK A;  2ZN8 A;  2BCA A;  1NX3 A;  5I8N A;  3BUW B;  2CNP A;  3HX4 A;  2QPT A;  1GQM A;  2NZ0 A;  5D7F A;  3SG6 A;  1YX7 A;  3OP0 A;  2JNX A;  1CM4 A;  3WHT B;  4P2Y B;  1BMO A;  3LCP C;  1GGW A;  3QRX A;  5TNC A;  1L2O C;  2L51 A;  4XJK A;  5HKY A;  1REC A;  4N5X A;  3WHU B;  2EHB A;  5J3X A;  3DVK A;  1S3P A;  2K7O A;  2LNK A;  3FIA A;  2JPT A;  1D1O A;  1KFU S;  2BCB A;  3TDU A;  1YUU A;  3LK1 A;  1XA5 A;  4OCI A;  1H8B A;  5CPV A;  4MRY A;  1IRJ A;  1KQM B;  1G33 A;  3NSO A;  5CSN A;  1EG4 A;  1FI5 A;  4JWQ A;  2HQW A;  1BOC A;  2KOT A;  1IJ6 A;  1NX1 A;  3TUY C;  3RLZ A;  2BKH B;  3SIA A;  4AOM A;  1MXE A;  4BY5 A;  2GGM A;  1U5I B;  1BOD A;  3DF0 B;  1SR6 C;  2M8U A;  1Y1X A;  3JVT B;  1CDN A;  2R2I A;  2L98 A;  3NSI A;  4XYN A;  1CFF A;  1NCZ A;  2F2O A;  1J7R A;  1ZAC A;  2K2F A;  1BG1 A;  1XFU O;  4MEW A;  1Q80 A;  2JC2 A;  1WLZ A;  3LLE A;  4PE7 A;  1JFK A;  1QAS A;  3EVR A;  1WY9 A;  1NX2 A;  2FOT A;  2L0P A;  2Q91 A;  4U8D A;  3VRP A;  1CLL A;  2ZND A;  1SBJ A;  1DJY A;  1CDP A;  1QV0 A;  1K94 A;  1KFX L;  3NSL A;  1XFX O;  1IH0 A;  1RTP 1;  2GGZ A;  5HLO A;  1KWO B;  1B9A A;  3KPX A;  3SG3 A;  4ZCV A;  3TDZ A;  5K89 A;  1RFJ A;  5KTY A;  2K7B A;  2PAL A;  1ALW A;  3IQO A;  1PK0 D;  4YGC B;  1PSB A;  2LHL A;  1BF5 A;  1TNP A;  5CSJ A;  4I5N B;  1JC2 A;  1QAT A;  3AAK A;  3CZT X;  2EC6 B;  2JT3 A;  4GGF A;  1WRZ A;  5GQQ C;  5HKW A;  1K9U A;  2LCP A;  1CDM A;  1DJW A;  1J1D A;  4GNK B;  3M0W A;  2KGB C;  1JSA A;  1U5I A;  1R2U A;  4FTG A;  4HRE E;  1NWD A;  3DF0 A;  4PCW A;  4A4B A;  1B1G A;  1NP8 A;  2HQ8 A;  1DJH A;  3TZ1 A;  1LVC D;  2BKI B;  2LVK A;  2BEC A;  1JBA A;  1XYD A;  2O60 A;  3PAT A;  1YRU B;  1B47 A;  4PE4 A;  3BUO B;  2H61 C;  1DVI A;  2M9G A;  2MA2 A;  4IL1 A;  1CLB A;  1KSO A;  1M63 B;  4DCK A;  2A4J A;  5AER A;  2BE4 A;  1B8L A;  3BYA A;  1NX0 A;  1KQV A;  1KK7 Y;  1MQ1 A;  1M31 A;  2KHN A;  1K90 D;  2KBM A;  3A4U B;  1EL4 A;  1QX5 B;  3VRQ A;  1SNL A;  2KDH A; 
#chains in the Genus database with same CATH topology
 3D0Y B;  2K7C A;  1OQP A;  1QX2 A;  3IQQ A;  2FCD A;  1KQM C;  2K2A A;  2KQY A;  3DY9 A;  1IQ5 A;  2KBI A;  3OX6 A;  4USL A;  3SG7 A;  1FI5 A;  4CLN A;  3I5F B;  2PRU A;  1TCO B;  2WCB A;  3B7A A;  3UO9 A;  3L4A A;  2JTT A;  1AJ4 A;  4QJ4 B;  2LLS A;  3D10 A;  4NDD A;  5HLV A;  1Z2C B;  2PYQ A;  3JVT C;  1AVS A;  4HSZ A;  1W7I B;  1S5G Z;  2WC8 A;  2Q4U A;  2DOQ A;  3SG4 A;  3GOF A;  3SS3 A;  2WCJ A;  1C3Y A;  2WND A;  3RZS A;  1KK8 B;  2BBN A;  1XFW O;  1DEK A;  2E30 A;  1QS7 A;  4IJ7 A;  1K95 A;  4N1F A;  2FJU B;  2KSP A;  1TN4 A;  2KI6 C;  3BFH A;  1A4P A;  1Y6W A;  4OVN F;  2LVJ A;  1EH2 A;  1W9Z A;  4PHJ A;  2L2E A;  2PAS A;  3CDN A;  1DC1 A;  2WOS A;  1KWO C;  4D1E A;  1V1F A;  3N7H A;  5ER5 A;  1TUZ A;  4GPL B;  1RRO A;  1OMR A;  2H2K A;  3FS7 A;  3ZNI A;  1BJF A;  1X02 A;  3O6B A;  3I5H B;  1WRK A;  1SW8 A;  2KGR A;  1B7T Z;  2WCM A;  2CTN A;  2NCP A;  2JXC A;  3BUX B;  2EC6 C;  1LA3 A;  4MSP A;  5D69 A;  2COL B;  1QX7 A;  4MZK A;  3WNX B;  3VGO A;  1K9K A;  1IWQ A;  1DTL A;  1SKT A;  1SSE B;  2JT8 A;  1UHH A;  1W7J B;  3D78 A;  2JT0 A;  1NYA A;  1XFV O;  1WRL A;  3E3R A;  2F33 A;  3F45 A;  2QEO A;  1C07 A;  2KAV A;  1HT9 A;  1V1G A;  3LL8 B;  2OTG B;  2JNF A;  1JWD A;  3NXA A;  4YGA A;  1CFP A;  1YUT A;  4ETO A;  3LK0 A;  1MR8 A;  1A75 B;  1PVA A;  1F55 A;  1BT6 A;  1OE9 B;  3NGV A;  4WQ2 A;  1RWY A;  2QEV A;  1TNQ A;  2ISD A;  1MXL C;  4DS7 A;  2CBL A;  2HF5 A;  1DGU A;  1PVB A;  1Y1U A;  3KO0 A;  3PSR A;  1HQV A;  1ZMZ A;  1LIN A;  3FWB A;  1KCY A;  2ZNE A;  1OMD A;  1SL9 A;  2PSR A;  3CR4 X;  3FE8 A;  1B8C A;  3CTN A;  3CZ1 A;  3CZ0 A;  1DF0 B;  5DKR A;  2H61 A;  3CLN A;  4UPG A;  2GV5 A;  5IBW A;  1R6P A;  3OX5 A;  3I5F C;  1ZOT B;  2JU0 A;  2Y1M A;  1UP5 A;  1XO5 A;  4TNC A;  2KAY A;  4E68 A;  2KI4 B;  3EK8 A;  3B86 A;  3DVM A;  2LE9 B;  1FBV A;  1A03 A;  1AHR A;  4ICB A;  1F71 A;  1K96 A;  3MSE B;  2KQ6 A;  2P6B B;  4GAO A;  3EVV A;  1KK8 C;  2I7A A;  1OZO A;  2F3Z A;  4MRX A;  4YGE B;  2O5G A;  1ORG A;  1NUB A;  1T14 A;  3AKB A;  1KFX S;  2YGU A;  3KEV A;  1A75 A;  4ORC B;  4DIR A;  1QXP A;  2LC5 A;  3B88 A;  2VRG A;  1YVH A;  1SYM A;  3UNW A;  1BU3 A;  2KPH A;  4GFT A;  2QEB A;  1S6C A;  2KFG A;  3O4X A;  3S0B A;  3TDI A;  2WC6 A;  1FI6 A;  2AMI A;  2I94 A;  3O2P A;  4MVF A;  5I2O A;  1CM1 A;  1L7Z A;  3B6X A;  1IQ3 A;  3D77 A;  1S5G Y;  2F2P A;  2ZKM X;  3EK7 A;  4PHK A;  2LLT A;  3I5H C;  1QWV A;  1YUR A;  1DF0 A;  1UHK A;  3DD4 A;  1ODB A;  1SK6 D;  2ZRT A;  4HRH A;  3DYE A;  3ZWH A;  2I2R E;  2LHI A;  1OOH A;  1JF2 A;  1TWO A;  3CS1 A;  3BUM B;  1TRF A;  4R1E A;  3PM8 A;  2LMT A;  1ALV A;  1DEL A;  3SS5 A;  1LA0 A;  2LAN A;  4I5K A;  3DVJ A;  1XVJ A;  1QV1 A;  5I2Q A;  1WLM A;  2LP2 A;  2ZFD A;  2LAP A;  1UWO A;  2JQ6 A;  2PVB A;  1QVI Z;  2OTG C;  3AKA A;  2K60 A;  3SJS A;  2M97 A;  3VB1 A;  1B7T Y;  1AUI B;  1TNW A;  3K21 A;  4MN0 A;  2KI6 D;  1JFJ A;  1EXR A;  2BCX A;  3WXA A;  1ZUZ A;  1TCF A;  2TN4 A;  1QTX A;  2M7N A;  4YGD B;  3SIB A;  1YVL A;  1F70 A;  2ZN9 A;  1BR4 B;  1Y0V H;  1UHN A;  1A2X A;  4AQI A;  3BXK A;  2JUL A;  1UHJ A;  4L9M A;  2CT9 A;  4F7F A;  4MBE A;  1TOP A;  2LM5 A;  3CZ2 A;  1XK4 A;  4I5L B;  3SG5 A;  1DJX A;  1OW4 A;  2G9B A;  4INX A;  4OKH A;  1M39 A;  2M7L A;  1LS8 A;  1NCY A;  2Y4Q A;  1BR1 B;  4JKT A;  4ORB B;  2MBX A;  2OPO A;  1EJ3 A;  2AUC A;  3EKH A;  4XJK B;  1LXF C;  4ORA B;  2EGD A;  2KI4 C;  2V53 A;  1IGV A;  2QAC A;  1J55 A;  1SL8 A;  4F0Z B;  4PHN A;  1Y1A A;  2BL0 B;  2KAX A;  4NQG A;  1MWN A;  2JWW A;  3QME A;  5CSI A;  3D0Y A;  3BUN B;  2M3W A;  5AEQ A;  1N65 A;  4I5J A;  4NDB A;  1SMG A;  2F3Y A;  3KF9 A;  1DGV A;  1QLS A;  2L5X B;  3GK4 X;  3NSK A;  1B4C A;  4M2Q A;  3GK1 A;  2KFF A;  3RM1 A;  1TNX A;  2D8N A;  1CLM A;  5KSZ A;  1CMG A;  4PE0 A;  2CCM A;  5I2L A;  3A8R A;  1AP4 A;  3V2L A;  1KFU L;  2CXJ A;  4AQJ A;  3PN7 B;  4YI9 A;  1KSM A;  4JD9 A;  4YI8 A;  1S6J A;  1TUJ A;  1S1E A;  1N0Y A;  1PUL A;  5BPJ A;  2FJY A;  1CDL A;  4M2P A;  1XK4 C;  2M1U A;  2KYF A;  2JRF A;  1PSR A;  1DJG A;  2Y1N A;  3AAJ A;  3JTD B;  1XFY O;  2LV7 A;  1OZS A;  1DJI A;  2AAO A;  1FW4 A;  3O4Y A;  3SG2 A;  1Z4H A;  2L4I A;  3OB2 B;  1DMO A;  1MF8 B;  2Y5I A;  1IG5 A;  2K0J A;  3DXL A;  4CFQ A;  3CR5 X;  2IS9 A;  4PAL A;  1E8A A;  1C7V A;  1QIV A;  3FE9 A;  3S0E A;  2QDI A;  4PT1 A;  4MLW A;  2M1K B;  3VRO A;  2BE6 A;  1LKJ A;  3ICB A;  4QJ3 B;  4WQ3 A;  1FPW A;  1H4B A;  1SRA A;  1OOJ A;  4PDZ A;  1JF0 A;  1YRT B;  2JOJ A;  1YUS A;  2JXL A;  1M46 A;  2B1U A;  3HCM A;  3NHI A;  2NLN A;  5ER4 X;  4HRG A;  1JUO A;  2LUC A;  3I5I B;  1QIW A;  3I5G B;  3K1E A;  1S6I A;  1SL7 A;  2F8P A;  5HYD A;  2OS8 B;  3EVU A;  3KHE A;  3SS4 A;  5AFP A;  4BY4 A;  1YR5 A;  3D74 A;  4YRU A;  1SCM B;  3IVT A;  1TIZ A;  1WDC B;  2E6W A;  4FQT A;  2LVV A;  1F54 A;  1CNP A;  1G8I A;  2KNE A;  5CSF A;  1A29 A;  4YBH B;  3GK2 A;  1GJY A;  3R1O A;  1K8U A;  1SPY A;  1OOI X;  1G4Y R;  2HPS A;  2NXQ A;  3OHM B;  5KU1 A;  1CKK A;  1C7W A;  1QVI Y;  4DUQ A;  1B8R A;  1RK9 A;  2SAS A;  4P5O E;  3TS5 B;  1NSH A;  2M29 A;  2QEH A;  3B87 A;  4FQO A;  4CPV A;  5B8I B;  5EL2 A;  1MHO A;  4C0K A;  1OOG A;  1F8H A;  2LLU A;  2MLF C;  3BQ3 A;  2M49 B;  4ZCU A;  1PAL A;  1OMV A;  3S0G A;  4GGN A;  1M45 A;  3FWC A;  3PAL A;  1F4O A;  2MRD A;  4MZL A;  5DKQ A;  1AJ5 A;  3DZT A;  4OV2 A;  1IKU A;  2BL0 C;  3D76 A;  1K9P A;  5AXI A;  4PHM A;  1XFZ O;  4C0L A;  1ZFS A;  2SCP A;  1L2O B;  4A4C A;  4JQ0 D;  2JTZ A;  4QJ5 B;  3CAB A;  4JPZ B;  2KLE A;  4GUK A;  5PAL A;  3CGA A;  1PRW A;  1QLK A;  1YTZ C;  3BOW B;  1IJ5 A;  3EK4 A;  2JPO A;  1AK8 A;  2MLE C;  2RGI A;  4NDC A;  1OOF A;  1CFC A;  1J7Q A;  2K7D A;  2HET A;  3PN7 C;  5AAN A;  3O78 A;  2G2B A;  2PQL A;  3TUY B;  1N2D A;  2WCK A;  3CR2 A;  3EKJ A;  3C1V A;  1NIW A;  1RJV A;  1K93 D;  3VRN A;  2K8M B;  2FCE A;  4CID A;  1SR6 B;  1K2H A;  1NPQ A;  1MUX A;  5F6T A;  5JJG A;  1DJZ A;  1S36 A;  2BNX A;  2JZI A;  1TTX A;  1UUR A;  2LMV A;  3JTD C;  4M2O A;  2PMY A;  1CMF A;  2NCO A;  4MZJ A;  5DKN A;  5G08 A;  2K61 A;  1J7P A;  4YGB B;  4C0J A;  1F4Q A;  4GBA A;  2L4H A;  4Q04 A;  4OR9 B;  3IF7 A;  1UUS A;  1NCX A;  5FYX A;  4DRW A;  3CWG A;  1QJT A;  4GGF C;  4KYN A;  1J7O A;  1J1E A;  1S26 D;  2MJW B;  4WRI A;  3S0A A;  4PE1 A;  2LMU A;  3VRR A;  1DQE A;  2LP3 A;  1EG3 A;  2M0R A;  2L50 A;  2P70 A;  3PJI A;  3PM2 A;  5DIC A;  1SCV A;  3L4L A;  3I5I C;  1C3Z A;  1YX8 A;  3BOW A;  3I5G C;  2LUX A;  4CFR A;  4N1G A;  1DT7 B;  1GGZ A;  2OS8 C;  3DVE A;  2KFH A;  3PFV A;  1SCM C;  1FF1 A;  2LVI A;  1WDC C;  2MAZ A;  2WOR A;  2ZRS A;  5HKZ A;  2KYC A;  1BLQ A;  1CTR A;  5JOL A;  2MHH A;  3H4S E;  1CFD A;  1CB1 A;  1KK7 Z;  2BAP A;  2WCF A;  2WCE A;  3TS5 C;  2I18 A;  1P28 A;  3OB1 B;  3PLF B;  1OSA A;  2BBM A;  1UHI A;  1SY9 A;  1VRK A;  2ZN8 A;  2L2C A;  3R1V A;  2BCA A;  1NX3 A;  5I8N A;  3BUW B;  2CNP A;  3HX4 A;  1IIO A;  2QPT A;  1GQM A;  2NZ0 A;  5D7F A;  3SG6 A;  1YX7 A;  1XFR A;  3OP0 A;  1GM0 A;  2JNX A;  1CM4 A;  3WHT B;  4P2Y B;  1BMO A;  3LCP C;  1GGW A;  3QRX A;  5TNC A;  1L2O C;  4INW A;  2L51 A;  4XJK A;  5HKY A;  3L47 A;  1REC A;  4N5X A;  3WHU B;  2EHB A;  5J3X A;  3DVK A;  1S3P A;  2K7O A;  2LNK A;  2WCH A;  3FIA A;  2JPT A;  1D1O A;  1KFU S;  2BCB A;  3BFA A;  1YUU A;  3LK1 A;  3TDU A;  1XA5 A;  4OCI A;  1H8B A;  2WCL A;  5CPV A;  4MRY A;  1IRJ A;  1KQM B;  1G33 A;  3NSO A;  5CSN A;  3OBV A;  1EG4 A;  3EG5 B;  5FI2 A;  3BJH A;  3S0F A;  4JWQ A;  2HQW A;  1BOC A;  2KOT A;  5FI6 A;  1IJ6 A;  1NX1 A;  3TUY C;  3RLZ A;  2BKH B;  3SIA A;  4AOM A;  1MXE A;  4BY5 A;  2GGM A;  1U5I B;  1BOD A;  3DF0 B;  1SR6 C;  2M8U A;  1Y1X A;  3JVT B;  1CDN A;  2R2I A;  2L98 A;  5FI7 A;  3NSI A;  4XYN A;  1CFF A;  1NCZ A;  2F2O A;  1J7R A;  1ZAC A;  2K2F A;  1BG1 A;  1XFU O;  4MEW A;  1Q80 A;  2JC2 A;  1WLZ A;  3LLE A;  2WC5 A;  1JFK A;  4PE7 A;  1QAS A;  3EVR A;  1WY9 A;  2ERB A;  4OZD A;  3CYZ A;  1NX2 A;  2FOT A;  2L0P A;  2Q91 A;  4U8D A;  3VRP A;  1CLL A;  2ZND A;  1SBJ A;  1DJY A;  1CDP A;  1QV0 A;  3D75 A;  1K94 A;  1KFX L;  3NSL A;  1XFX O;  1IH0 A;  1RTP 1;  2GGZ A;  5HLO A;  1KWO B;  1B9A A;  3KPX A;  3Q8I A;  4ZCV A;  3SG3 A;  3TDZ A;  1RFJ A;  5K89 A;  5KTY A;  2K7B A;  2PAL A;  1ALW A;  3IQO A;  1PK0 D;  3R72 A;  4YGC B;  1PSB A;  2LHL A;  1BF5 A;  3FE6 A;  1TNP A;  5CSJ A;  3D73 A;  4I5N B;  1JC2 A;  1QAT A;  3AAK A;  3CZT X;  2EC6 B;  2JT3 A;  4GGF A;  1WRZ A;  5GQQ C;  5HKW A;  1K9U A;  2LCP A;  1CDM A;  1DJW A;  1J1D A;  4GNK B;  3M0W A;  2KGB C;  2KLD A;  1JSA A;  1U5I A;  1R2U A;  4FTG A;  4HRE E;  1NWD A;  3DF0 A;  4PCW A;  4A4B A;  1B1G A;  1NP8 A;  2GTE A;  2HQ8 A;  2L5Y A;  3OGN A;  1DJH A;  3TZ1 A;  3NHT A;  1LVC D;  2BKI B;  2H8V A;  2LVK A;  2BEC A;  1JBA A;  1XYD A;  2O60 A;  3PAT A;  1YRU B;  2P71 A;  1B47 A;  4PE4 A;  5HL1 A;  3BUO B;  2H61 C;  1DVI A;  2M9G A;  2MA2 A;  4IL1 A;  1CLB A;  1KSO A;  1M63 B;  4DCK A;  2A4J A;  3BFB A;  5AER A;  3R1P A;  2BE4 A;  1B8L A;  3BYA A;  1NX0 A;  1KQV A;  1KK7 Y;  1MQ1 A;  1M31 A;  2KHN A;  1K90 D;  2KBM A;  3A4U B;  1EL4 A;  1QX5 B;  3VRQ A;  1SNL A;  3S0D A;  5I94 A;  2KDH A;  5D3O A; 
#chains in the Genus database with same CATH homology
 3D0Y B;  2K7C A;  1OQP A;  1QX2 A;  3IQQ A;  2FCD A;  1KQM C;  2K2A A;  2KQY A;  3OX6 A;  1IQ5 A;  2KBI A;  4JQ0 D;  4USL A;  3SG7 A;  4CLN A;  3I5F B;  2PRU A;  1TCO B;  2WCB A;  4QJ4 B;  2JTT A;  1AJ4 A;  2LLS A;  3D10 A;  4NDD A;  5HLV A;  3JVT C;  1AVS A;  4HSZ A;  1W7I B;  1S5G Z;  2WC8 A;  2Q4U A;  2DOQ A;  3SG4 A;  3GOF A;  2WND A;  1KK8 B;  2BBN A;  1XFW O;  2E30 A;  1QS7 A;  1K95 A;  4N1F A;  2FJU B;  2KSP A;  1TN4 A;  2KI6 C;  1A4P A;  1Y6W A;  4OVN F;  2LVJ A;  1EH2 A;  4PHJ A;  2L2E A;  2PAS A;  2WOS A;  1KWO C;  4D1E A;  1V1F A;  5ER5 A;  4GPL B;  1RRO A;  1OMR A;  2H2K A;  3FS7 A;  3ZNI A;  1BJF A;  1X02 A;  3O6B A;  3I5H B;  1WRK A;  1SW8 A;  2KGR A;  1B7T Z;  2CTN A;  2NCP A;  2JXC A;  3BUX B;  2EC6 C;  1LA3 A;  4MSP A;  5D69 A;  2COL B;  1QX7 A;  4MZK A;  3WNX B;  3VGO A;  1K9K A;  1IWQ A;  1DTL A;  1SKT A;  2JT8 A;  1UHH A;  1W7J B;  2JT0 A;  1NYA A;  1XFV O;  1WRL A;  3E3R A;  2F33 A;  3F45 A;  1C07 A;  2KAV A;  1HT9 A;  1V1G A;  3LL8 B;  2OTG B;  2JNF A;  1JWD A;  3NXA A;  4YGA A;  1CFP A;  1YUT A;  4ETO A;  3LK0 A;  1MR8 A;  1A75 B;  1PVA A;  1F55 A;  1BT6 A;  1OE9 B;  4WQ2 A;  1RWY A;  1TNQ A;  2ISD A;  1MXL C;  4DS7 A;  2CBL A;  2HF5 A;  1DGU A;  1PVB A;  1Y1U A;  3KO0 A;  3PSR A;  1HQV A;  1ZMZ A;  1LIN A;  3FWB A;  1KCY A;  2ZNE A;  1OMD A;  1SL9 A;  2PSR A;  3CR4 X;  1B8C A;  3CTN A;  1DF0 B;  5DKR A;  2H61 A;  3CLN A;  4UPG A;  2GV5 A;  5IBW A;  1R6P A;  3OX5 A;  3I5F C;  1ZOT B;  2JU0 A;  2Y1M A;  1UP5 A;  1XO5 A;  4TNC A;  2KAY A;  4E68 A;  2KI4 B;  3EK8 A;  3DVM A;  2LE9 B;  1FBV A;  1A03 A;  1AHR A;  4ICB A;  1F71 A;  1K96 A;  3MSE B;  2KQ6 A;  2P6B B;  4GAO A;  3EVV A;  1KK8 C;  2I7A A;  1OZO A;  2F3Z A;  4MRX A;  4YGE B;  2O5G A;  1NUB A;  3AKB A;  1KFX S;  3KEV A;  1A75 A;  4ORC B;  4DIR A;  1QXP A;  2LC5 A;  2VRG A;  1YVH A;  1SYM A;  1BU3 A;  4GFT A;  1S6C A;  2KFG A;  3TDI A;  1FI6 A;  2AMI A;  2I94 A;  3O2P A;  4MVF A;  5I2O A;  1CM1 A;  1L7Z A;  1IQ3 A;  1S5G Y;  2F2P A;  2ZKM X;  3EK7 A;  4PHK A;  2LLT A;  3I5H C;  1YUR A;  1DF0 A;  1UHK A;  3DD4 A;  1ODB A;  1SK6 D;  2ZRT A;  4HRH A;  3ZWH A;  2I2R E;  2LHI A;  1JF2 A;  3CS1 A;  3BUM B;  1TRF A;  4R1E A;  3PM8 A;  2LMT A;  1ALV A;  1LA0 A;  2LAN A;  4I5K A;  3DVJ A;  1XVJ A;  1QV1 A;  5I2Q A;  1WLM A;  2LP2 A;  2ZFD A;  2LAP A;  1UWO A;  2JQ6 A;  2PVB A;  1QVI Z;  2OTG C;  3AKA A;  3SJS A;  2M97 A;  1B7T Y;  1AUI B;  1TNW A;  3K21 A;  4MN0 A;  2KI6 D;  1JFJ A;  1EXR A;  2BCX A;  3WXA A;  1ZUZ A;  1TCF A;  2TN4 A;  1QTX A;  2M7N A;  4YGD B;  3SIB A;  1YVL A;  1F70 A;  2ZN9 A;  1BR4 B;  1Y0V H;  1UHN A;  1A2X A;  4AQI A;  3BXK A;  2JUL A;  1UHJ A;  4L9M A;  2CT9 A;  4MBE A;  1TOP A;  2LM5 A;  1XK4 A;  4I5L B;  3SG5 A;  1DJX A;  2G9B A;  4OKH A;  2M7L A;  1M39 A;  1NCY A;  2Y4Q A;  1BR1 B;  4ORB B;  2MBX A;  2OPO A;  1EJ3 A;  2AUC A;  3EKH A;  4XJK B;  1LXF C;  4ORA B;  2EGD A;  2KI4 C;  2V53 A;  1IGV A;  2QAC A;  1J55 A;  1SL8 A;  4F0Z B;  4PHN A;  1Y1A A;  2BL0 B;  2KAX A;  4NQG A;  1MWN A;  2JWW A;  5CSI A;  3D0Y A;  3BUN B;  2M3W A;  5AEQ A;  1N65 A;  4I5J A;  4NDB A;  1SMG A;  2F3Y A;  3KF9 A;  1DGV A;  1QLS A;  2L5X B;  3GK4 X;  3NSK A;  1B4C A;  4M2Q A;  3GK1 A;  2KFF A;  3RM1 A;  1TNX A;  2D8N A;  1CLM A;  5KSZ A;  1CMG A;  4PE0 A;  2CCM A;  5I2L A;  3A8R A;  1AP4 A;  1KFU L;  2CXJ A;  4AQJ A;  3PN7 B;  4YI9 A;  1KSM A;  4YI8 A;  1S6J A;  1S1E A;  1N0Y A;  1PUL A;  5BPJ A;  1CDL A;  4M2P A;  1XK4 C;  2M1U A;  2KYF A;  2JRF A;  1PSR A;  1DJG A;  2Y1N A;  3AAJ A;  3JTD B;  1XFY O;  2LV7 A;  1OZS A;  1DJI A;  2AAO A;  1FW4 A;  3O4Y A;  3SG2 A;  2L4I A;  3OB2 B;  1DMO A;  1MF8 B;  2Y5I A;  1IG5 A;  2K0J A;  4CFQ A;  3CR5 X;  2IS9 A;  4PAL A;  1E8A A;  1C7V A;  1QIV A;  4MLW A;  2M1K B;  3VRO A;  2BE6 A;  1LKJ A;  3ICB A;  4QJ3 B;  4WQ3 A;  1FPW A;  1H4B A;  1SRA A;  1OOJ A;  4PDZ A;  1JF0 A;  1YRT B;  2JOJ A;  1YUS A;  2JXL A;  1M46 A;  2B1U A;  3HCM A;  5ER4 X;  2NLN A;  4HRG A;  1JUO A;  2LUC A;  3I5I B;  1QIW A;  3I5G B;  1S6I A;  1SL7 A;  2F8P A;  5HYD A;  2OS8 B;  3EVU A;  3KHE A;  5AFP A;  4BY4 A;  1YR5 A;  4YRU A;  1SCM B;  1TIZ A;  1WDC B;  2E6W A;  2LVV A;  1F54 A;  1CNP A;  1G8I A;  2KNE A;  5CSF A;  1A29 A;  4YBH B;  3GK2 A;  1GJY A;  1K8U A;  1SPY A;  1G4Y R;  2HPS A;  2NXQ A;  3OHM B;  5KU1 A;  1CKK A;  1C7W A;  1QVI Y;  4DUQ A;  1B8R A;  1RK9 A;  2SAS A;  4P5O E;  3TS5 B;  1NSH A;  2M29 A;  4FQO A;  5B8I B;  4CPV A;  1MHO A;  4C0K A;  1F8H A;  2LLU A;  2MLF C;  3BQ3 A;  2M49 B;  4ZCU A;  1PAL A;  1OMV A;  4GGN A;  1M45 A;  3FWC A;  3PAL A;  1F4O A;  2MRD A;  4MZL A;  5DKQ A;  1AJ5 A;  4OV2 A;  1IKU A;  2BL0 C;  1K9P A;  5AXI A;  4PHM A;  1XFZ O;  4C0L A;  1ZFS A;  2SCP A;  1L2O B;  4A4C A;  2JTZ A;  4QJ5 B;  4JPZ B;  4GUK A;  5PAL A;  3CGA A;  1PRW A;  1QLK A;  1YTZ C;  3BOW B;  1IJ5 A;  3EK4 A;  1AK8 A;  2MLE C;  2RGI A;  4NDC A;  1CFC A;  1J7Q A;  2K7D A;  2HET A;  3PN7 C;  5AAN A;  3O78 A;  2G2B A;  3TUY B;  1N2D A;  3EKJ A;  3CR2 A;  3C1V A;  1NIW A;  1RJV A;  1K93 D;  3VRN A;  2K8M B;  2FCE A;  4CID A;  1SR6 B;  1K2H A;  1NPQ A;  1MUX A;  5F6T A;  5JJG A;  1DJZ A;  1S36 A;  2JZI A;  1TTX A;  1UUR A;  2LMV A;  3JTD C;  4M2O A;  2PMY A;  1CMF A;  2NCO A;  4MZJ A;  5DKN A;  5G08 A;  2K61 A;  1J7P A;  4YGB B;  4C0J A;  1F4Q A;  4GBA A;  2L4H A;  4Q04 A;  4OR9 B;  3IF7 A;  1UUS A;  1NCX A;  5FYX A;  4DRW A;  3CWG A;  1QJT A;  4GGF C;  1J7O A;  1J1E A;  1S26 D;  2MJW B;  4WRI A;  4PE1 A;  2LMU A;  3VRR A;  2LP3 A;  1EG3 A;  2M0R A;  2L50 A;  1SCV A;  3I5I C;  1YX8 A;  3BOW A;  3I5G C;  2LUX A;  4CFR A;  4N1G A;  1DT7 B;  1GGZ A;  2OS8 C;  3DVE A;  2KFH A;  3PFV A;  1SCM C;  1FF1 A;  2LVI A;  1WDC C;  2MAZ A;  2WOR A;  2ZRS A;  5HKZ A;  2KYC A;  1BLQ A;  1CTR A;  5JOL A;  2MHH A;  3H4S E;  1CFD A;  1CB1 A;  1KK7 Z;  2WCF A;  2WCE A;  3TS5 C;  2I18 A;  3OB1 B;  3PLF B;  1OSA A;  2BBM A;  1UHI A;  1SY9 A;  1VRK A;  2ZN8 A;  2BCA A;  1NX3 A;  5I8N A;  3BUW B;  2CNP A;  3HX4 A;  2QPT A;  1GQM A;  2NZ0 A;  5D7F A;  3SG6 A;  1YX7 A;  3OP0 A;  2JNX A;  1CM4 A;  3WHT B;  4P2Y B;  1BMO A;  3LCP C;  1GGW A;  3QRX A;  5TNC A;  1L2O C;  2L51 A;  4XJK A;  5HKY A;  1REC A;  4N5X A;  3WHU B;  2EHB A;  5J3X A;  3DVK A;  1S3P A;  2K7O A;  2LNK A;  3FIA A;  2JPT A;  1D1O A;  1KFU S;  2BCB A;  3TDU A;  1YUU A;  3LK1 A;  1XA5 A;  4OCI A;  1H8B A;  5CPV A;  4MRY A;  1IRJ A;  1KQM B;  1G33 A;  3NSO A;  5CSN A;  1EG4 A;  1FI5 A;  4JWQ A;  2HQW A;  1BOC A;  2KOT A;  1IJ6 A;  1NX1 A;  3TUY C;  3RLZ A;  2BKH B;  3SIA A;  4AOM A;  1MXE A;  4BY5 A;  2GGM A;  1U5I B;  1BOD A;  3DF0 B;  1SR6 C;  2M8U A;  1Y1X A;  3JVT B;  1CDN A;  2R2I A;  2L98 A;  3NSI A;  4XYN A;  1CFF A;  1NCZ A;  2F2O A;  1J7R A;  1ZAC A;  2K2F A;  1BG1 A;  1XFU O;  4MEW A;  1Q80 A;  2JC2 A;  1WLZ A;  3LLE A;  4PE7 A;  1JFK A;  1QAS A;  3EVR A;  1WY9 A;  1NX2 A;  2FOT A;  2L0P A;  2Q91 A;  4U8D A;  3VRP A;  1CLL A;  2ZND A;  1SBJ A;  1DJY A;  1CDP A;  1QV0 A;  1K94 A;  1KFX L;  3NSL A;  1XFX O;  1IH0 A;  1RTP 1;  2GGZ A;  5HLO A;  1KWO B;  1B9A A;  3KPX A;  3SG3 A;  4ZCV A;  3TDZ A;  5K89 A;  1RFJ A;  5KTY A;  2K7B A;  2PAL A;  1ALW A;  3IQO A;  1PK0 D;  4YGC B;  1PSB A;  2LHL A;  1BF5 A;  1TNP A;  5CSJ A;  4I5N B;  1JC2 A;  1QAT A;  3AAK A;  3CZT X;  2EC6 B;  2JT3 A;  4GGF A;  1WRZ A;  5GQQ C;  5HKW A;  1K9U A;  2LCP A;  1CDM A;  1DJW A;  1J1D A;  4GNK B;  3M0W A;  2KGB C;  1JSA A;  1U5I A;  1R2U A;  4FTG A;  4HRE E;  1NWD A;  3DF0 A;  4PCW A;  4A4B A;  1B1G A;  1NP8 A;  2HQ8 A;  1DJH A;  3TZ1 A;  1LVC D;  2BKI B;  2LVK A;  2BEC A;  1JBA A;  1XYD A;  2O60 A;  3PAT A;  1YRU B;  1B47 A;  4PE4 A;  3BUO B;  2H61 C;  1DVI A;  2M9G A;  2MA2 A;  4IL1 A;  1CLB A;  1KSO A;  1M63 B;  4DCK A;  2A4J A;  5AER A;  2BE4 A;  1B8L A;  3BYA A;  1NX0 A;  1KQV A;  1KK7 Y;  1MQ1 A;  1M31 A;  2KHN A;  1K90 D;  2KBM A;  3A4U B;  1EL4 A;  1QX5 B;  3VRQ A;  1SNL A;  2KDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...