3WXAA

X-ray crystal structural analysis of the complex between alg-2 and sec31a peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
167
structure length
167
Chain Sequence
QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/transport protein
molecule keywords Programmed cell death protein 6
publication title Structural Analysis of the Complex between Penta-EF-Hand ALG-2 Protein and Sec31A Peptide Reveals a Novel Target Recognition Mechanism of ALG-2
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3wxaA00
2LHIA 2GGMA 2JT3A 2ZRSA 1SRAA 2RGIA 4PHNA 1SYMA 1OOJA 3PN7B 1NX3A 1K93D 2JC2A 1DVIA 4MVFA 4E68A 1CFDA 3DVJA 4YGCB 1S36A 2L51A 4F0ZB 4PE7A 2WORA 1K94A 3M0WA 1J7PA 2I94A 2KYCA 4USLA 1QS7A 1A75B 1KK8C 1BODA 1ZMZA 2M1KB 2LVJA 2Y1MA 1SL7A 4WQ2A 1BT6A 2M29A 3I5FC 3O4YA 2Q91A 3NSIA 5D69A 2HETA 1UP5A 2AUCA 3H4SE 5PALA 2JRFA 2KAXA 2HQ8A 4PHKA 3VRPA 1LXFC 2WNDA 2R2IA 2G2BA 1BG1A 1BMOA 4YGBB 1K9PA 1W7JB 1SCVA 1JC2A 1UHIA 2AAOA 1M39A 2K61A 1WRZA 1PSRA 1S6JA 2BL0B 2KFGA 2LUCA 3BUOB 1KQMC 1AJ4A 1XFVO 3I5HB 3PLFB 1Q80A 1SCMC 1AUIB 4MSPA 3OB1B 2ZN8A 4C0JA 4JPZB 1CFCA 4DRWA 2JULA 2NCPA 4BY5A 1CMFA 2LMTA 1KWOB 1PVAA 2KYFA 2L50A 3VRNA 4MBEA 1KK7Y 1TRFA 5KU1A 3JTDC 3CLNA 1K90D 1K9KA 2A4JA 2JTTA 1CM4A 2NXQA 3PALA 2FJUB 4ORBB 2LHLA 1AK8A 3O78A 1GJYA 1RK9A 2BBMA 3PN7C 3I5GB 3SG3A 1S26D 4PHMA 1MWNA 4WQ3A 3VROA 3EVUA 2KQ6A 1SMGA 1A03A 1OMDA 2LNKA 2Y1NA 1SY9A 1YR5A 2ZKMX 2OTGB 1BOCA 1YRTB 2I2RE 2COLB 2KNEA 4ORAB 4OV2A 2KGBC 2KQYA 1F8HA 1UHHA 1K9UA 1A2XA 1B8LA 2KAYA 1TNQA 1CDMA 2P6BB 4ZCUA 2MAZA 1DT7B 1IQ3A 1Y1XA 2KFFA 2LLSA 1DJYA 3PSRA 1S5GZ 1MF8B 3D0YA 4FTGA 1JFJA 5CSNA 1IKUA 1B4CA 4NDCA 2QPTA 2LP2A 1XO5A 1TOPA 4CFRA 1N65A 1PALA 4M2OA 1XFZO 1CDPA 1QX5B 3BQ3A 1KFUS 2BL0C 1JSAA 1TNXA 1CLLA 2HQWA 1FW4A 1L2OB 2LMUA 2HF5A 1RFJA 1G4YR 3CZTX 1CB1A 1C7WA 4Q04A 1LA0A 2CBLA 3ZWHA 2KAVA 1RWYA 1ZACA 1DMOA 2LCPA 4DCKA 4N1GA 2Q4UA 1R6PA 3FIAA 3JVTB 2F2OA 2JPTA 1KCYA 2PRUA 5I2OA 4ETOA 4DIRA 4I5NB 3RM1A 3NSKA 2KBIA 1KFXS 3I5GC 4PDZA 3CR5X 1TCOB 4GUKA 1FPWA 2BKHB 1MXEA 1ZFSA 4YI8A 1B9AA 3FWCA 5KSZA 2M9GA 2PSRA 1AP4A 1VRKA 2OTGC 1SW8A 2KBMA 2K7OA 3TDZA 2GV5A 2LVIA 4HREE 2DOQA 1MQ1A 2H2KA 4YGAA 1WRLA 3SG6A 2MA2A 1SPYA 1F4OA 4IL1A 4YI9A 4BY4A 1IH0A 4MZJA 1SK6D 1WRKA 3A8RA 5BPJA 1B47A 1RJVA 1BLQA 1QX7A 2M0RA 1NP8A 2V53A 1TN4A 3EKHA 1V1FA 4CFQA 3O2PA 1DJHA 1XFWO 4XJKB 4R1EA 3SG4A 4PCWA 2LANA 3ZNIA 1NX0A 1NCZA 1MUXA 1QATA 2JXLA 1IRJA 4GFTA 4YGDB 1L2OC 5CPVA 1EJ3A 1B7TY 2I7AA 1J7QA 5HKZA 1YX8A 1QX2A 3FS7A 2NZ0A 2JU0A 1JWDA 3D0YB 2CNPA 1J7RA 5HKWA 3EKJA 1Y1AA 1N2DA 1JFKA 1J7OA 1B8RA 1DJIA 4U8DA 1K8UA 1NWDA 2L0PA 3PM8A 4FQOA 2ZNDA 2D8NA 1ODBA 5JOLA 2MLFC 1FI5A 5AFPA 2JNXA 2K2AA 5K89A 1CDLA 1KFUL 4YBHB 5I2LA 2JT8A 2Y5IA 3GK1A 5HLVA 1YRUB 4NDBA 4MLWA 2LVVA 4GBAA 5FYXA 1SNLA 4AQJA 1GQMA 5F6TA 1U5IA 2M49B 1AVSA 5DKNA 1PULA 4L9MA 1K2HA 2ZRTA 4OCIA 1B8CA 1CKKA 5J3XA 1NX2A 5TNCA 3TS5B 1CFFA 3CTNA 3BXKA 3EK7A 2LC5A 2K8MB 3AKBA 2KI4B 4GGFC 1CLMA 1K96A 1KFXL 1IG5A 4M2PA 4DS7A 1TTXA 1UUSA 2WC8A 3DF0A 1XYDA 2I18A 1DJZA 1OE9B 2WCBA 3WHTB 1SR6B 5HYDA 1EH2A 1DJWA 1HQVA 1NCXA 3SG7A 3CR4X 3DVKA 3CS1A 1F54A 1FI6A 3HCMA 2BBNA 2PVBA 3AKAA 1EG3A 5AERA 1QVIZ 4ICBA 2BCXA 4I5JA 1JF2A 1B1GA 3ICBA 2SASA 1A4PA 2M7LA 4UPGA 1UHJA 2L98A 1QASA 1BR4B 4MRYA 3WHUB 4GNKB 2WCEA 4WRIA 2HPSA 3KHEA 3C1VA 1FBVA 1YURA 1QIWA 3NXAA 1S6CA 4AOMA 1X02A 5KTYA 1EG4A 3CWGA 5HLOA 4PHJA 1LVCD 3MSEB 4N1FA 1WY9A 3DVEA 2BCBA 2BE6A 1XFYO 2F8PA 2BCAA 3LLEA 4CPVA 4PE4A 3I5HC 1XK4A 4YGEB 1DJGA 2LAPA 3GK4X 3I5IB 1QXPA 1QV0A 2K7BA 1IQ5A 1KWOC 1L7ZA 1WDCB 1OQPA 3TS5C 3LK0A 1SL8A 2Y4QA 3NSLA 3KEVA 2ISDA 2WOSA 1W7IB 1UWOA 1CM1A 1BU3A 1AJ5A 1SR6C 1U5IB 4XYNA 3VRRA 1CFPA 3SIAA 3OX6A 2PMYA 3EVVA 2M3WA 1TIZA 4OKHA 1Y6WA 1BJFA 3TZ1A 5CSIA 2BKIB 1N0YA 1CNPA 3VRQA 1KK7Z 1PRWA 3VGOA 5G08A 4PE1A 4AQIA 3DF0B 3I5FB 1QTXA 1JF0A 3KPXA 1RTP1 1F71A 1OZSA 1F70A 2JTZA 3BYAA 5I2QA 1LKJA 3KF9A 4P5OE 3BOWA 3NSOA 3WXAA 1WLZA 1DGUA 1MR8A 5CSJA 1DF0A 1IJ5A 1RECA 2OPOA 1Y0VH 1AHRA 2M1UA 3BUWB 2WCFA 4MEWA 5CSFA 2K2FA 2ZNEA 1M63B 2TN4A 2CCMA 2IS9A 1SCMB 2H61A 1C07A 1IGVA 2JZIA 2OS8B 3LCPC 2KGRA 1ZOTB 2AMIA 2ZN9A 4NQGA 4PALA 4A4BA 2FCDA 3A4UB 1WLMA 2E30A 2F33A 2FOTA 1V1GA 2BE4A 3CR2A 1DGVA 1ALVA 5IBWA 2EHBA 2LLUA 3AAKA 5D7FA 1GGZA 3IQQA 1J1DA 3K21A 4GPLB 1S3PA 4C0KA 3JVTC 1DJXA 3QRXA 1BR1B 2LP3A 1XFXO 2LMVA 1CDNA 1TNWA 2L4HA 4MN0A 1M46A 2KFHA 1XA5A 1SBJA 3HX4A 3O6BA 1YX7A 1OMRA 1S5GY 3OX5A 5AANA 3SG5A 1NCYA 5I8NA 3TDIA 1OMVA 2MLEC 5ER5A 2LLTA 2BECA 4PE0A 2PASA 5JJGA 2MRDA 4GAOA 1TCFA 2KOTA 3SJSA 1EL4A 3OP0A 4TNCA 2O5GA 2L2EA 1YVLA 4I5KA 4CIDA 1YVHA 3TDUA 4OVNF 1H8BA 4A4CA 1SKTA 1S6IA 1XVJA 2PALA 2L5XB 1J55A 2B1UA 1NX1A 4P2YB 4QJ4B 2SCPA 1CMGA 2LE9B 4HRGA 1R2UA 4JQ0D 3CGAA 1NPQA 4MRXA 1M31A 1UURA 3PATA 3BUXB 1QV1A 2OS8C 3BUNB 4ZCVA 1BF5A 5DKRA 1MXLC 3TUYB 1QJTA 2G9BA 1F4QA 2KI6C 2LUXA 3RLZA 1TNPA 3BOWB 2K0JA 1H4BA 3DVMA 1C7VA 3WNXB 1OSAA 1DF0B 1NYAA 3F45A 1SL9A 1S1EA 1NUBA 2JT0A 5B8IB 2KDHA 4JWQA 2ZFDA 2EGDA 1XK4C 2KHNA 1K95A 1QLKA 3FWBA 1QIVA 4GGFA 4QJ5B 2F2PA 2O60A 1YUTA 1B7TZ 1PVBA 1KQVA 4HRHA 4ORCB 5GQQC 2LV7A 2K7DA 1MHOA 1RROA 3IQOA 1PK0D 4XJKA 1YUSA 2EC6B 1ZUZA 3LK1A 4MZLA 4NDDA 2JQ6A 2KI6D 2MJWB 4M2QA 1CTRA 1QLSA 1OZOA 2LVKA 1JBAA 4I5LB 1XFUO 2K7CA 1A75A 2NLNA 4N5XA 2KI4C 1ALWA 1D1OA 2CTNA 1GGWA 1CLBA 2MHHA 1NSHA 2JXCA 1IWQA 1NIWA 4QJ3B 4CLNA 3EK4A 1M45A 5ER4X 1KSOA 1EXRA 2JWWA 3GOFA 1FF1A 1G33A 1KSMA 1E8AA 2LM5A 1KK8B 2E6WA 2L4IA 1YTZC 3TUYC 2JOJA 1UHKA 3EVRA 2VRGA 2JNFA 4D1EA 4GGNA 3E3RA 4OR9B 2MBXA 2F3ZA 2QACA 3PFVA 3SIBA 3OB2B 3D10A 1YUUA 2H61C 1JUOA 2CXJA 5AXIA 3SG2A 3DD4A 3KO0A 1A29A 1Y1UA 1G8IA 1J1EA 1LINA 2M7NA 2M8UA 4YRUA 3BUMB 1KQMB 5DKQA 2GGZA 1DTLA 3OHMB 4MZKA 1LA3A 1IJ6A 2CT9A 1PSBA 5AEQA 2KSPA 3AAJA 2EC6C 3GK2A 2M97A 4DUQA 5HKYA 2FCEA 3I5IC 1F55A 1QVIY 2NCOA 1UHNA 3EK8A 3IF7A 1WDCC 4C0LA 2F3YA 3LL8B 3JTDB 1HT9A 4HSZA
chains in the Genus database with same CATH superfamily
2LHIA 2GGMA 3L47A 2JT3A 2ZRSA 1SRAA 2RGIA 4PHNA 1SYMA 1OOJA 3PN7B 1NX3A 1K93D 2JC2A 1DVIA 4MVFA 4E68A 1CFDA 3DVJA 4YGCB 1S36A 2L51A 4F0ZB 4PE7A 2WORA 1K94A 3M0WA 1J7PA 2WCMA 2I94A 2KYCA 4USLA 1QS7A 1A75B 1KK8C 1C3YA 1BODA 1ZMZA 2M1KB 2LVJA 2Y1MA 4PT1A 1SL7A 4WQ2A 2K60A 1BT6A 2M29A 3I5FC 3O4YA 2Q91A 3NSIA 5D69A 2HETA 1UP5A 2AUCA 3H4SE 5PALA 2JRFA 2KAXA 2HQ8A 4PHKA 3VRPA 1LXFC 2WNDA 3SS5A 2R2IA 2G2BA 1BG1A 1DQEA 3D76A 5EL2A 1BMOA 4YGBB 1K9PA 1W7JB 1SCVA 1T14A 3D75A 1UHIA 2AAOA 3OGNA 1JC2A 1C3ZA 1M39A 3B6XA 1DC1A 2K61A 1WRZA 1PSRA 1S6JA 2BL0B 2KFGA 2LUCA 3BUOB 1KQMC 1AJ4A 1XFVO 3I5HB 3PLFB 1Q80A 1SCMC 1AUIB 2WC5A 4MSPA 3OB1B 2ZN8A 4C0JA 4JPZB 1CFCA 4DRWA 2JULA 2NCPA 4BY5A 1CMFA 2LMTA 1KWOB 3D77A 5DICA 1PVAA 2KYFA 2L50A 3VRNA 4MBEA 1KK7Y 1TRFA 5KU1A 3JTDC 3CLNA 1K90D 1K9KA 2YGUA 2A4JA 2JTTA 1CM4A 2NXQA 1TUJA 3PALA 2FJUB 4ORBB 2LHLA 1AK8A 3O78A 1GJYA 1RK9A 2BBMA 3PN7C 3I5GB 3CZ0A 3SG3A 1S26D 4PHMA 1MWNA 4WQ3A 3VROA 3EVUA 2KQ6A 3V2LA 1SMGA 1A03A 1OMDA 2LNKA 2Y1NA 1SY9A 1YR5A 2QEHA 2ZKMX 2OTGB 1BOCA 1OOFA 1YRTB 2QEVA 2I2RE 2COLB 2KNEA 4ORAB 4OV2A 2KGBC 2KQYA 1F8HA 1UHHA 1K9UA 1A2XA 1B8LA 2KAYA 1TNQA 1CDMA 2P6BB 4ZCUA 2MAZA 1DT7B 1IQ3A 1Y1XA 2KFFA 2LLSA 1DJYA 3OBVA 1S5GZ 1MF8B 3BFHA 3D0YA 3PSRA 4FTGA 1JFJA 5CSNA 3UO9A 1IKUA 1B4CA 4NDCA 2QPTA 2LP2A 1XO5A 1TOPA 3DXLA 4CFRA 1N65A 1PALA 4M2OA 1XFZO 1CDPA 1QX5B 1OOGA 1KFUS 2BL0C 3BQ3A 1JSAA 3CDNA 1TNXA 1CLLA 2HQWA 1FW4A 1L2OB 2LMUA 2HF5A 2WCJA 1RFJA 1G4YR 2L2CA 3CZTX 1CB1A 1C7WA 4Q04A 1LA0A 2CBLA 3ZWHA 2KAVA 3S0GA 1RWYA 1ZACA 1DMOA 2LCPA 4DCKA 4N1GA 2P71A 2Q4UA 3NGVA 1R6PA 3FIAA 3JVTB 2F2OA 2JPTA 1KCYA 2PRUA 5I2OA 4ETOA 4DIRA 2PYQA 4I5NB 3RM1A 3NSKA 2KBIA 1KFXS 3S0DA 3FE8A 3I5GC 4PDZA 3CR5X 3FE6A 1TCOB 2H8VA 4GUKA 1FPWA 2BKHB 1MXEA 1ZFSA 4YI8A 1B9AA 3FWCA 5KSZA 2JPOA 2M9GA 2PSRA 2WCLA 5D3OA 1AP4A 1VRKA 2OTGC 4FQTA 1SW8A 2KBMA 2K7OA 3TDZA 2GV5A 2LVIA 4HREE 2DOQA 1MQ1A 2H2KA 4YGAA 1WRLA 3SG6A 2MA2A 1SPYA 1F4OA 4IL1A 4YI9A 4BY4A 1IH0A 4MZJA 1SK6D 1WRKA 3A8RA 5BPJA 1ORGA 1B47A 1RJVA 2BAPA 1BLQA 1QX7A 2M0RA 1NP8A 3S0AA 1SSEB 1TN4A 2V53A 1V1FA 3EKHA 3Q8IA 4CFQA 3O2PA 1DJHA 1XFWO 3DYEA 3FE9A 4XJKB 4F7FA 4R1EA 3SG4A 4PCWA 2LANA 3ZNIA 1NX0A 1NCZA 1MUXA 1QATA 2L5YA 2JXLA 1IRJA 4GFTA 4YGDB 1L2OC 5CPVA 3R72A 1EJ3A 1B7TY 2I7AA 1J7QA 5HKZA 1YX8A 1QX2A 3FS7A 2NZ0A 2JU0A 1JWDA 3D0YB 2CNPA 1J7RA 5HKWA 3EKJA 1Y1AA 1N2DA 1JFKA 1J7OA 1B8RA 1DJIA 3SS3A 4U8DA 1K8UA 1NWDA 2L0PA 3PM8A 4FQOA 2ZNDA 2D8NA 1ODBA 5JOLA 2MLFC 1FI5A 5AFPA 2JNXA 2K2AA 5K89A 1CDLA 1KFUL 4YBHB 5I2LA 2JT8A 2Y5IA 3GK1A 5HLVA 1YRUB 2P70A 4MLWA 4NDBA 2LVVA 1XFRA 4GBAA 5FYXA 1SNLA 4AQJA 3B87A 1GQMA 5F6TA 1U5IA 2M49B 1AVSA 3BJHA 5DKNA 1PULA 4L9MA 1K2HA 2ZRTA 4OCIA 1B8CA 1CKKA 5J3XA 1NX2A 3CABA 5TNCA 3TS5B 1CFFA 3CTNA 1P28A 3BXKA 3EK7A 2LC5A 2K8MB 3AKBA 2KI4B 4GGFC 1CLMA 1K96A 3L4LA 1KFXL 1IG5A 4M2PA 4DS7A 1TTXA 1UUSA 2WC8A 3DF0A 1XYDA 2I18A 1DJZA 1OE9B 2WCBA 3WHTB 1SR6B 5HYDA 1EH2A 1DJWA 1HQVA 1NCXA 3SG7A 3CR4X 3DVKA 4OZDA 3CS1A 1F54A 1FI6A 3HCMA 2BBNA 2PVBA 3AKAA 1EG3A 3R1VA 5AERA 1QVIZ 4ICBA 2KLEA 2BCXA 4I5JA 1JF2A 1B1GA 3ICBA 2SASA 1A4PA 1LS8A 2M7LA 1OW4A 4UPGA 5HL1A 1UHJA 2L98A 1QASA 1BR4B 4MRYA 3WHUB 4GNKB 2WCEA 4WRIA 2HPSA 3KHEA 1Z4HA 3C1VA 3L4AA 1FBVA 2ERBA 1YURA 1QIWA 3NXAA 1S6CA 4AOMA 1X02A 3EG5B 5KTYA 1EG4A 3CWGA 5HLOA 4PHJA 1LVCD 3K1EA 3MSEB 4N1FA 5I94A 1WY9A 3DVEA 2BCBA 2BE6A 1XFYO 2F8PA 2BCAA 3LLEA 4CPVA 4PE4A 3I5HC 1XK4A 4YGEB 1DJGA 2LAPA 3GK4X 3I5IB 1OOIX 1QXPA 1QV0A 2K7BA 1IQ5A 1IIOA 1KWOC 1L7ZA 1WDCB 1OQPA 3S0BA 3LK0A 3TS5C 1SL8A 2Y4QA 3NSLA 3D78A 3KEVA 2ISDA 2WOSA 1W7IB 1UWOA 1DEKA 4INWA 1CM1A 1BU3A 1AJ5A 1SR6C 1U5IB 4XYNA 3VRRA 1CFPA 3SIAA 3OX6A 2PMYA 3EVVA 2M3WA 1TIZA 4OKHA 1Y6WA 2BNXA 1BJFA 3TZ1A 5CSIA 2BKIB 1N0YA 1CNPA 3VRQA 3B86A 1KK7Z 1PRWA 3VGOA 5G08A 4PE1A 3S0FA 3SS4A 4AQIA 3DF0B 3I5FB 1QTXA 3B7AA 1JF0A 3KPXA 1RTP1 1F71A 1OZSA 3VB1A 1F70A 2QEOA 2JTZA 3BYAA 5I2QA 1LKJA 3KF9A 4P5OE 3D74A 3PJIA 3BOWA 3NSOA 3WXAA 1WLZA 1DGUA 1MR8A 5CSJA 1DF0A 1IJ5A 1RECA 2OPOA 1Y0VH 1AHRA 2M1UA 3BUWB 2WCFA 4MEWA 5CSFA 2K2FA 2ZNEA 1M63B 2TN4A 2CCMA 2IS9A 1SCMB 2H61A 1C07A 1IGVA 2JZIA 2OS8B 3LCPC 2KGRA 1ZOTB 2AMIA 2ZN9A 4NQGA 4PALA 4A4BA 2FCDA 3A4UB 1WLMA 3D73A 2E30A 2F33A 2FOTA 1V1GA 2BE4A 3CR2A 5FI7A 1DGVA 1ALVA 3CZ2A 5IBWA 2EHBA 2LLUA 3AAKA 5D7FA 3B88A 1GGZA 3IQQA 1J1DA 3K21A 4GPLB 1S3PA 2WCKA 3JVTC 1DJXA 3QRXA 4C0KA 1BR1B 2LP3A 1XFXO 1OOHA 2LMVA 1CDNA 1TNWA 2L4HA 2FJYA 4MN0A 3BFBA 1M46A 2KFHA 1XA5A 1SBJA 3HX4A 3O6BA 1YX7A 1OMRA 3BFAA 1S5GY 3OX5A 5AANA 3SG5A 1NCYA 5I8NA 3TDIA 1OMVA 2MLEC 5ER5A 2LLTA 2BECA 4PE0A 2PASA 5JJGA 2MRDA 4GAOA 1TCFA 3NHTA 2KOTA 3SJSA 1EL4A 3OP0A 4TNCA 2O5GA 2L2EA 3RZSA 1YVLA 3CYZA 4I5KA 4CIDA 1YVHA 2WC6A 4OVNF 3TDUA 2QDIA 4A4CA 1H8BA 1SKTA 1S6IA 1XVJA 2PALA 2L5XB 1J55A 2B1UA 2PQLA 1NX1A 4P2YB 4QJ4B 2SCPA 1CMGA 2LE9B 4HRGA 1R2UA 4JQ0D 3CGAA 3DY9A 1NPQA 4MRXA 1M31A 1UURA 3PATA 3BUXB 1QV1A 3CZ1A 2WCHA 2OS8C 3BUNB 4ZCVA 1BF5A 5DKRA 1MXLC 3TUYB 1QJTA 2G9BA 1Z2CB 1F4QA 2KI6C 5FI2A 2LUXA 3RLZA 1TNPA 1W9ZA 3BOWB 2K0JA 1H4BA 2QEBA 3DVMA 3O4XA 3WNXB 1C7VA 1OSAA 1DF0B 4IJ7A 1NYAA 3F45A 3QMEA 1SL9A 3R1OA 1S1EA 1NUBA 2JT0A 5B8IB 2KPHA 2KDHA 1DELA 2ZFDA 2EGDA 1XK4C 2KHNA 4JWQA 1K95A 1QLKA 3FWBA 1QIVA 4GGFA 4QJ5B 2F2PA 2GTEA 2O60A 1YUTA 1B7TZ 1PVBA 3NHIA 4KYNA 4HRHA 4ORCB 5GQQC 1KQVA 2LV7A 2K7DA 1MHOA 1RROA 3IQOA 1GM0A 1PK0D 4XJKA 1YUSA 2EC6B 1ZUZA 3LK1A 4MZLA 4NDDA 2JQ6A 1TWOA 2KI6D 2MJWB 4M2QA 1CTRA 1QLSA 1OZOA 2LVKA 3DZTA 1JBAA 4I5LB 1XFUO 4INXA 3IVTA 2K7CA 1A75A 2NLNA 4N5XA 2KI4C 1ALWA 3N7HA 1D1OA 2CTNA 1GGWA 1CLBA 2MHHA 1NSHA 2JXCA 1IWQA 1NIWA 4QJ3B 4CLNA 3EK4A 1M45A 5ER4X 1KSOA 1EXRA 2JWWA 3GOFA 1FF1A 1G33A 1KSMA 2KLDA 1E8AA 2LM5A 1KK8B 2E6WA 2L4IA 1YTZC 3TUYC 2JOJA 1UHKA 3EVRA 1QWVA 2VRGA 2JNFA 4D1EA 4GGNA 3E3RA 4OR9B 4JKTA 2F3ZA 2MBXA 2QACA 3PFVA 3SIBA 3OB2B 3D10A 1YUUA 5FI6A 3S0EA 2H61C 1JUOA 2CXJA 5AXIA 3SG2A 3DD4A 3KO0A 1A29A 1Y1UA 3R1PA 1G8IA 1J1EA 1LINA 2M7NA 2M8UA 4YRUA 3BUMB 1KQMB 5DKQA 2GGZA 1DTLA 3OHMB 4MZKA 4JD9A 1LA3A 1IJ6A 2CT9A 1PSBA 3UNWA 5AEQA 2KSPA 3AAJA 2EC6C 3GK2A 2M97A 4DUQA 5HKYA 2FCEA 3I5IC 1F55A 1QVIY 2NCOA 1TUZA 1UHNA 3EK8A 3IF7A 1WDCC 4C0LA 2F3YA 3LL8B 3PM2A 3JTDB 1HT9A 4HSZA
chains in the Genus database with same CATH topology
2LHIA 2GGMA 2JT3A 2ZRSA 1SRAA 2RGIA 4PHNA 1SYMA 1OOJA 3PN7B 1NX3A 1K93D 2JC2A 1DVIA 4MVFA 4E68A 1CFDA 3DVJA 4YGCB 1S36A 2L51A 4F0ZB 4PE7A 2WORA 1K94A 3M0WA 1J7PA 2I94A 2KYCA 4USLA 1QS7A 1A75B 1KK8C 1BODA 1ZMZA 2M1KB 2LVJA 2Y1MA 1SL7A 4WQ2A 1BT6A 2M29A 3I5FC 3O4YA 2Q91A 3NSIA 5D69A 2HETA 1UP5A 2AUCA 3H4SE 5PALA 2JRFA 2KAXA 2HQ8A 4PHKA 3VRPA 1LXFC 2WNDA 2R2IA 2G2BA 1BG1A 1BMOA 4YGBB 1K9PA 1W7JB 1SCVA 1JC2A 1UHIA 2AAOA 1M39A 2K61A 1WRZA 1PSRA 1S6JA 2BL0B 2KFGA 2LUCA 3BUOB 1KQMC 1AJ4A 1XFVO 3I5HB 3PLFB 1Q80A 1SCMC 1AUIB 4MSPA 3OB1B 2ZN8A 4C0JA 4JPZB 1CFCA 4DRWA 2JULA 2NCPA 4BY5A 1CMFA 2LMTA 1KWOB 1PVAA 2KYFA 2L50A 3VRNA 4MBEA 1KK7Y 1TRFA 5KU1A 3JTDC 3CLNA 1K90D 1K9KA 2A4JA 2JTTA 1CM4A 2NXQA 3PALA 2FJUB 4ORBB 2LHLA 1AK8A 3O78A 1GJYA 1RK9A 2BBMA 3PN7C 3I5GB 3SG3A 1S26D 4PHMA 1MWNA 4WQ3A 3VROA 3EVUA 2KQ6A 1SMGA 1A03A 1OMDA 2LNKA 2Y1NA 1SY9A 1YR5A 2ZKMX 2OTGB 1BOCA 1YRTB 2I2RE 2COLB 2KNEA 4ORAB 4OV2A 2KGBC 2KQYA 1F8HA 1UHHA 1K9UA 1A2XA 1B8LA 2KAYA 1TNQA 1CDMA 2P6BB 4ZCUA 2MAZA 1DT7B 1IQ3A 1Y1XA 2KFFA 2LLSA 1DJYA 3PSRA 1S5GZ 1MF8B 3D0YA 4FTGA 1JFJA 5CSNA 1IKUA 1B4CA 4NDCA 2QPTA 2LP2A 1XO5A 1TOPA 4CFRA 1N65A 1PALA 4M2OA 1XFZO 1CDPA 1QX5B 3BQ3A 1KFUS 2BL0C 1JSAA 1TNXA 1CLLA 2HQWA 1FW4A 1L2OB 2LMUA 2HF5A 1RFJA 1G4YR 3CZTX 1CB1A 1C7WA 4Q04A 1LA0A 2CBLA 3ZWHA 2KAVA 1RWYA 1ZACA 1DMOA 2LCPA 4DCKA 4N1GA 2Q4UA 1R6PA 3FIAA 3JVTB 2F2OA 2JPTA 1KCYA 2PRUA 5I2OA 4ETOA 4DIRA 4I5NB 3RM1A 3NSKA 2KBIA 1KFXS 3I5GC 4PDZA 3CR5X 1TCOB 4GUKA 1FPWA 2BKHB 1MXEA 1ZFSA 4YI8A 1B9AA 3FWCA 5KSZA 2M9GA 2PSRA 1AP4A 1VRKA 2OTGC 1SW8A 2KBMA 2K7OA 3TDZA 2GV5A 2LVIA 4HREE 2DOQA 1MQ1A 2H2KA 4YGAA 1WRLA 3SG6A 2MA2A 1SPYA 1F4OA 4IL1A 4YI9A 4BY4A 1IH0A 4MZJA 1SK6D 1WRKA 3A8RA 5BPJA 1B47A 1RJVA 1BLQA 1QX7A 2M0RA 1NP8A 2V53A 1TN4A 3EKHA 1V1FA 4CFQA 3O2PA 1DJHA 1XFWO 4XJKB 4R1EA 3SG4A 4PCWA 2LANA 3ZNIA 1NX0A 1NCZA 1MUXA 1QATA 2JXLA 1IRJA 4GFTA 4YGDB 1L2OC 5CPVA 1EJ3A 1B7TY 2I7AA 1J7QA 5HKZA 1YX8A 1QX2A 3FS7A 2NZ0A 2JU0A 1JWDA 3D0YB 2CNPA 1J7RA 5HKWA 3EKJA 1Y1AA 1N2DA 1JFKA 1J7OA 1B8RA 1DJIA 4U8DA 1K8UA 1NWDA 2L0PA 3PM8A 4FQOA 2ZNDA 2D8NA 1ODBA 5JOLA 2MLFC 1FI5A 5AFPA 2JNXA 2K2AA 5K89A 1CDLA 1KFUL 4YBHB 5I2LA 2JT8A 2Y5IA 3GK1A 5HLVA 1YRUB 4NDBA 4MLWA 2LVVA 4GBAA 5FYXA 1SNLA 4AQJA 1GQMA 5F6TA 1U5IA 2M49B 1AVSA 5DKNA 1PULA 4L9MA 1K2HA 2ZRTA 4OCIA 1B8CA 1CKKA 5J3XA 1NX2A 5TNCA 3TS5B 1CFFA 3CTNA 3BXKA 3EK7A 2LC5A 2K8MB 3AKBA 2KI4B 4GGFC 1CLMA 1K96A 1KFXL 1IG5A 4M2PA 4DS7A 1TTXA 1UUSA 2WC8A 3DF0A 1XYDA 2I18A 1DJZA 1OE9B 2WCBA 3WHTB 1SR6B 5HYDA 1EH2A 1DJWA 1HQVA 1NCXA 3SG7A 3CR4X 3DVKA 3CS1A 1F54A 1FI6A 3HCMA 2BBNA 2PVBA 3AKAA 1EG3A 5AERA 1QVIZ 4ICBA 2BCXA 4I5JA 1JF2A 1B1GA 3ICBA 2SASA 1A4PA 2M7LA 4UPGA 1UHJA 2L98A 1QASA 1BR4B 4MRYA 3WHUB 4GNKB 2WCEA 4WRIA 2HPSA 3KHEA 3C1VA 1FBVA 1YURA 1QIWA 3NXAA 1S6CA 4AOMA 1X02A 5KTYA 1EG4A 3CWGA 5HLOA 4PHJA 1LVCD 3MSEB 4N1FA 1WY9A 3DVEA 2BCBA 2BE6A 1XFYO 2F8PA 2BCAA 3LLEA 4CPVA 4PE4A 3I5HC 1XK4A 4YGEB 1DJGA 2LAPA 3GK4X 3I5IB 1QXPA 1QV0A 2K7BA 1IQ5A 1KWOC 1L7ZA 1WDCB 1OQPA 3TS5C 3LK0A 1SL8A 2Y4QA 3NSLA 3KEVA 2ISDA 2WOSA 1W7IB 1UWOA 1CM1A 1BU3A 1AJ5A 1SR6C 1U5IB 4XYNA 3VRRA 1CFPA 3SIAA 3OX6A 2PMYA 3EVVA 2M3WA 1TIZA 4OKHA 1Y6WA 1BJFA 3TZ1A 5CSIA 2BKIB 1N0YA 1CNPA 3VRQA 1KK7Z 1PRWA 3VGOA 5G08A 4PE1A 4AQIA 3DF0B 3I5FB 1QTXA 1JF0A 3KPXA 1RTP1 1F71A 1OZSA 1F70A 2JTZA 3BYAA 5I2QA 1LKJA 3KF9A 4P5OE 3BOWA 3NSOA 3WXAA 1WLZA 1DGUA 1MR8A 5CSJA 1DF0A 1IJ5A 1RECA 2OPOA 1Y0VH 1AHRA 2M1UA 3BUWB 2WCFA 4MEWA 5CSFA 2K2FA 2ZNEA 1M63B 2TN4A 2CCMA 2IS9A 1SCMB 2H61A 1C07A 1IGVA 2JZIA 2OS8B 3LCPC 2KGRA 1ZOTB 2AMIA 2ZN9A 4NQGA 4PALA 4A4BA 2FCDA 3A4UB 1WLMA 2E30A 2F33A 2FOTA 1V1GA 2BE4A 3CR2A 1DGVA 1ALVA 5IBWA 2EHBA 2LLUA 3AAKA 5D7FA 1GGZA 3IQQA 1J1DA 3K21A 4GPLB 1S3PA 4C0KA 3JVTC 1DJXA 3QRXA 1BR1B 2LP3A 1XFXO 2LMVA 1CDNA 1TNWA 2L4HA 4MN0A 1M46A 2KFHA 1XA5A 1SBJA 3HX4A 3O6BA 1YX7A 1OMRA 1S5GY 3OX5A 5AANA 3SG5A 1NCYA 5I8NA 3TDIA 1OMVA 2MLEC 5ER5A 2LLTA 2BECA 4PE0A 2PASA 5JJGA 2MRDA 4GAOA 1TCFA 2KOTA 3SJSA 1EL4A 3OP0A 4TNCA 2O5GA 2L2EA 1YVLA 4I5KA 4CIDA 1YVHA 3TDUA 4OVNF 1H8BA 4A4CA 1SKTA 1S6IA 1XVJA 2PALA 2L5XB 1J55A 2B1UA 1NX1A 4P2YB 4QJ4B 2SCPA 1CMGA 2LE9B 4HRGA 1R2UA 4JQ0D 3CGAA 1NPQA 4MRXA 1M31A 1UURA 3PATA 3BUXB 1QV1A 2OS8C 3BUNB 4ZCVA 1BF5A 5DKRA 1MXLC 3TUYB 1QJTA 2G9BA 1F4QA 2KI6C 2LUXA 3RLZA 1TNPA 3BOWB 2K0JA 1H4BA 3DVMA 1C7VA 3WNXB 1OSAA 1DF0B 1NYAA 3F45A 1SL9A 1S1EA 1NUBA 2JT0A 5B8IB 2KDHA 4JWQA 2ZFDA 2EGDA 1XK4C 2KHNA 1K95A 1QLKA 3FWBA 1QIVA 4GGFA 4QJ5B 2F2PA 2O60A 1YUTA 1B7TZ 1PVBA 1KQVA 4HRHA 4ORCB 5GQQC 2LV7A 2K7DA 1MHOA 1RROA 3IQOA 1PK0D 4XJKA 1YUSA 2EC6B 1ZUZA 3LK1A 4MZLA 4NDDA 2JQ6A 2KI6D 2MJWB 4M2QA 1CTRA 1QLSA 1OZOA 2LVKA 1JBAA 4I5LB 1XFUO 2K7CA 1A75A 2NLNA 4N5XA 2KI4C 1ALWA 1D1OA 2CTNA 1GGWA 1CLBA 2MHHA 1NSHA 2JXCA 1IWQA 1NIWA 4QJ3B 4CLNA 3EK4A 1M45A 5ER4X 1KSOA 1EXRA 2JWWA 3GOFA 1FF1A 1G33A 1KSMA 1E8AA 2LM5A 1KK8B 2E6WA 2L4IA 1YTZC 3TUYC 2JOJA 1UHKA 3EVRA 2VRGA 2JNFA 4D1EA 4GGNA 3E3RA 4OR9B 2MBXA 2F3ZA 2QACA 3PFVA 3SIBA 3OB2B 3D10A 1YUUA 2H61C 1JUOA 2CXJA 5AXIA 3SG2A 3DD4A 3KO0A 1A29A 1Y1UA 1G8IA 1J1EA 1LINA 2M7NA 2M8UA 4YRUA 3BUMB 1KQMB 5DKQA 2GGZA 1DTLA 3OHMB 4MZKA 1LA3A 1IJ6A 2CT9A 1PSBA 5AEQA 2KSPA 3AAJA 2EC6C 3GK2A 2M97A 4DUQA 5HKYA 2FCEA 3I5IC 1F55A 1QVIY 2NCOA 1UHNA 3EK8A 3IF7A 1WDCC 4C0LA 2F3YA 3LL8B 3JTDB 1HT9A 4HSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHI A;  2GGM A;  2JT3 A;  2ZRS A;  1SRA A;  2RGI A;  4PHN A;  1SYM A;  1OOJ A;  3PN7 B;  1NX3 A;  1K93 D;  2JC2 A;  1DVI A;  4MVF A;  4E68 A;  1CFD A;  3DVJ A;  4YGC B;  1S36 A;  2L51 A;  4F0Z B;  4PE7 A;  2WOR A;  1K94 A;  3M0W A;  1J7P A;  2I94 A;  2KYC A;  4USL A;  1QS7 A;  1A75 B;  1KK8 C;  1BOD A;  1ZMZ A;  2M1K B;  2LVJ A;  2Y1M A;  1SL7 A;  4WQ2 A;  1BT6 A;  2M29 A;  3I5F C;  3O4Y A;  2Q91 A;  3NSI A;  5D69 A;  2HET A;  1UP5 A;  2AUC A;  3H4S E;  5PAL A;  2JRF A;  2KAX A;  2HQ8 A;  4PHK A;  3VRP A;  1LXF C;  2WND A;  2R2I A;  2G2B A;  1BG1 A;  1BMO A;  4YGB B;  1K9P A;  1W7J B;  1SCV A;  1JC2 A;  1UHI A;  2AAO A;  1M39 A;  2K61 A;  1WRZ A;  1PSR A;  1S6J A;  2BL0 B;  2KFG A;  2LUC A;  3BUO B;  1KQM C;  1AJ4 A;  1XFV O;  3I5H B;  3PLF B;  1Q80 A;  1SCM C;  1AUI B;  4MSP A;  3OB1 B;  2ZN8 A;  4C0J A;  4JPZ B;  1CFC A;  4DRW A;  2JUL A;  2NCP A;  4BY5 A;  1CMF A;  2LMT A;  1KWO B;  1PVA A;  2KYF A;  2L50 A;  3VRN A;  4MBE A;  1KK7 Y;  1TRF A;  5KU1 A;  3JTD C;  3CLN A;  1K90 D;  1K9K A;  2A4J A;  2JTT A;  1CM4 A;  2NXQ A;  3PAL A;  2FJU B;  4ORB B;  2LHL A;  1AK8 A;  3O78 A;  1GJY A;  1RK9 A;  2BBM A;  3PN7 C;  3I5G B;  3SG3 A;  1S26 D;  4PHM A;  1MWN A;  4WQ3 A;  3VRO A;  3EVU A;  2KQ6 A;  1SMG A;  1A03 A;  1OMD A;  2LNK A;  2Y1N A;  1SY9 A;  1YR5 A;  2ZKM X;  2OTG B;  1BOC A;  1YRT B;  2I2R E;  2COL B;  2KNE A;  4ORA B;  4OV2 A;  2KGB C;  2KQY A;  1F8H A;  1UHH A;  1K9U A;  1A2X A;  1B8L A;  2KAY A;  1TNQ A;  1CDM A;  2P6B B;  4ZCU A;  2MAZ A;  1DT7 B;  1IQ3 A;  1Y1X A;  2KFF A;  2LLS A;  1DJY A;  3PSR A;  1S5G Z;  1MF8 B;  3D0Y A;  4FTG A;  1JFJ A;  5CSN A;  1IKU A;  1B4C A;  4NDC A;  2QPT A;  2LP2 A;  1XO5 A;  1TOP A;  4CFR A;  1N65 A;  1PAL A;  4M2O A;  1XFZ O;  1CDP A;  1QX5 B;  3BQ3 A;  1KFU S;  2BL0 C;  1JSA A;  1TNX A;  1CLL A;  2HQW A;  1FW4 A;  1L2O B;  2LMU A;  2HF5 A;  1RFJ A;  1G4Y R;  3CZT X;  1CB1 A;  1C7W A;  4Q04 A;  1LA0 A;  2CBL A;  3ZWH A;  2KAV A;  1RWY A;  1ZAC A;  1DMO A;  2LCP A;  4DCK A;  4N1G A;  2Q4U A;  1R6P A;  3FIA A;  3JVT B;  2F2O A;  2JPT A;  1KCY A;  2PRU A;  5I2O A;  4ETO A;  4DIR A;  4I5N B;  3RM1 A;  3NSK A;  2KBI A;  1KFX S;  3I5G C;  4PDZ A;  3CR5 X;  1TCO B;  4GUK A;  1FPW A;  2BKH B;  1MXE A;  1ZFS A;  4YI8 A;  1B9A A;  3FWC A;  5KSZ A;  2M9G A;  2PSR A;  1AP4 A;  1VRK A;  2OTG C;  1SW8 A;  2KBM A;  2K7O A;  3TDZ A;  2GV5 A;  2LVI A;  4HRE E;  2DOQ A;  1MQ1 A;  2H2K A;  4YGA A;  1WRL A;  3SG6 A;  2MA2 A;  1SPY A;  1F4O A;  4IL1 A;  4YI9 A;  4BY4 A;  1IH0 A;  4MZJ A;  1SK6 D;  1WRK A;  3A8R A;  5BPJ A;  1B47 A;  1RJV A;  1BLQ A;  1QX7 A;  2M0R A;  1NP8 A;  2V53 A;  1TN4 A;  3EKH A;  1V1F A;  4CFQ A;  3O2P A;  1DJH A;  1XFW O;  4XJK B;  4R1E A;  3SG4 A;  4PCW A;  2LAN A;  3ZNI A;  1NX0 A;  1NCZ A;  1MUX A;  1QAT A;  2JXL A;  1IRJ A;  4GFT A;  4YGD B;  1L2O C;  5CPV A;  1EJ3 A;  1B7T Y;  2I7A A;  1J7Q A;  5HKZ A;  1YX8 A;  1QX2 A;  3FS7 A;  2NZ0 A;  2JU0 A;  1JWD A;  3D0Y B;  2CNP A;  1J7R A;  5HKW A;  3EKJ A;  1Y1A A;  1N2D A;  1JFK A;  1J7O A;  1B8R A;  1DJI A;  4U8D A;  1K8U A;  1NWD A;  2L0P A;  3PM8 A;  4FQO A;  2ZND A;  2D8N A;  1ODB A;  5JOL A;  2MLF C;  1FI5 A;  5AFP A;  2JNX A;  2K2A A;  5K89 A;  1CDL A;  1KFU L;  4YBH B;  5I2L A;  2JT8 A;  2Y5I A;  3GK1 A;  5HLV A;  1YRU B;  4NDB A;  4MLW A;  2LVV A;  4GBA A;  5FYX A;  1SNL A;  4AQJ A;  1GQM A;  5F6T A;  1U5I A;  2M49 B;  1AVS A;  5DKN A;  1PUL A;  4L9M A;  1K2H A;  2ZRT A;  4OCI A;  1B8C A;  1CKK A;  5J3X A;  1NX2 A;  5TNC A;  3TS5 B;  1CFF A;  3CTN A;  3BXK A;  3EK7 A;  2LC5 A;  2K8M B;  3AKB A;  2KI4 B;  4GGF C;  1CLM A;  1K96 A;  1KFX L;  1IG5 A;  4M2P A;  4DS7 A;  1TTX A;  1UUS A;  2WC8 A;  3DF0 A;  1XYD A;  2I18 A;  1DJZ A;  1OE9 B;  2WCB A;  3WHT B;  1SR6 B;  5HYD A;  1EH2 A;  1DJW A;  1HQV A;  1NCX A;  3SG7 A;  3CR4 X;  3DVK A;  3CS1 A;  1F54 A;  1FI6 A;  3HCM A;  2BBN A;  2PVB A;  3AKA A;  1EG3 A;  5AER A;  1QVI Z;  4ICB A;  2BCX A;  4I5J A;  1JF2 A;  1B1G A;  3ICB A;  2SAS A;  1A4P A;  2M7L A;  4UPG A;  1UHJ A;  2L98 A;  1QAS A;  1BR4 B;  4MRY A;  3WHU B;  4GNK B;  2WCE A;  4WRI A;  2HPS A;  3KHE A;  3C1V A;  1FBV A;  1YUR A;  1QIW A;  3NXA A;  1S6C A;  4AOM A;  1X02 A;  5KTY A;  1EG4 A;  3CWG A;  5HLO A;  4PHJ A;  1LVC D;  3MSE B;  4N1F A;  1WY9 A;  3DVE A;  2BCB A;  2BE6 A;  1XFY O;  2F8P A;  2BCA A;  3LLE A;  4CPV A;  4PE4 A;  3I5H C;  1XK4 A;  4YGE B;  1DJG A;  2LAP A;  3GK4 X;  3I5I B;  1QXP A;  1QV0 A;  2K7B A;  1IQ5 A;  1KWO C;  1L7Z A;  1WDC B;  1OQP A;  3TS5 C;  3LK0 A;  1SL8 A;  2Y4Q A;  3NSL A;  3KEV A;  2ISD A;  2WOS A;  1W7I B;  1UWO A;  1CM1 A;  1BU3 A;  1AJ5 A;  1SR6 C;  1U5I B;  4XYN A;  3VRR A;  1CFP A;  3SIA A;  3OX6 A;  2PMY A;  3EVV A;  2M3W A;  1TIZ A;  4OKH A;  1Y6W A;  1BJF A;  3TZ1 A;  5CSI A;  2BKI B;  1N0Y A;  1CNP A;  3VRQ A;  1KK7 Z;  1PRW A;  3VGO A;  5G08 A;  4PE1 A;  4AQI A;  3DF0 B;  3I5F B;  1QTX A;  1JF0 A;  3KPX A;  1RTP 1;  1F71 A;  1OZS A;  1F70 A;  2JTZ A;  3BYA A;  5I2Q A;  1LKJ A;  3KF9 A;  4P5O E;  3BOW A;  3NSO A;  3WXA A;  1WLZ A;  1DGU A;  1MR8 A;  5CSJ A;  1DF0 A;  1IJ5 A;  1REC A;  2OPO A;  1Y0V H;  1AHR A;  2M1U A;  3BUW B;  2WCF A;  4MEW A;  5CSF A;  2K2F A;  2ZNE A;  1M63 B;  2TN4 A;  2CCM A;  2IS9 A;  1SCM B;  2H61 A;  1C07 A;  1IGV A;  2JZI A;  2OS8 B;  3LCP C;  2KGR A;  1ZOT B;  2AMI A;  2ZN9 A;  4NQG A;  4PAL A;  4A4B A;  2FCD A;  3A4U B;  1WLM A;  2E30 A;  2F33 A;  2FOT A;  1V1G A;  2BE4 A;  3CR2 A;  1DGV A;  1ALV A;  5IBW A;  2EHB A;  2LLU A;  3AAK A;  5D7F A;  1GGZ A;  3IQQ A;  1J1D A;  3K21 A;  4GPL B;  1S3P A;  4C0K A;  3JVT C;  1DJX A;  3QRX A;  1BR1 B;  2LP3 A;  1XFX O;  2LMV A;  1CDN A;  1TNW A;  2L4H A;  4MN0 A;  1M46 A;  2KFH A;  1XA5 A;  1SBJ A;  3HX4 A;  3O6B A;  1YX7 A;  1OMR A;  1S5G Y;  3OX5 A;  5AAN A;  3SG5 A;  1NCY A;  5I8N A;  3TDI A;  1OMV A;  2MLE C;  5ER5 A;  2LLT A;  2BEC A;  4PE0 A;  2PAS A;  5JJG A;  2MRD A;  4GAO A;  1TCF A;  2KOT A;  3SJS A;  1EL4 A;  3OP0 A;  4TNC A;  2O5G A;  2L2E A;  1YVL A;  4I5K A;  4CID A;  1YVH A;  3TDU A;  4OVN F;  1H8B A;  4A4C A;  1SKT A;  1S6I A;  1XVJ A;  2PAL A;  2L5X B;  1J55 A;  2B1U A;  1NX1 A;  4P2Y B;  4QJ4 B;  2SCP A;  1CMG A;  2LE9 B;  4HRG A;  1R2U A;  4JQ0 D;  3CGA A;  1NPQ A;  4MRX A;  1M31 A;  1UUR A;  3PAT A;  3BUX B;  1QV1 A;  2OS8 C;  3BUN B;  4ZCV A;  1BF5 A;  5DKR A;  1MXL C;  3TUY B;  1QJT A;  2G9B A;  1F4Q A;  2KI6 C;  2LUX A;  3RLZ A;  1TNP A;  3BOW B;  2K0J A;  1H4B A;  3DVM A;  1C7V A;  3WNX B;  1OSA A;  1DF0 B;  1NYA A;  3F45 A;  1SL9 A;  1S1E A;  1NUB A;  2JT0 A;  5B8I B;  2KDH A;  4JWQ A;  2ZFD A;  2EGD A;  1XK4 C;  2KHN A;  1K95 A;  1QLK A;  3FWB A;  1QIV A;  4GGF A;  4QJ5 B;  2F2P A;  2O60 A;  1YUT A;  1B7T Z;  1PVB A;  1KQV A;  4HRH A;  4ORC B;  5GQQ C;  2LV7 A;  2K7D A;  1MHO A;  1RRO A;  3IQO A;  1PK0 D;  4XJK A;  1YUS A;  2EC6 B;  1ZUZ A;  3LK1 A;  4MZL A;  4NDD A;  2JQ6 A;  2KI6 D;  2MJW B;  4M2Q A;  1CTR A;  1QLS A;  1OZO A;  2LVK A;  1JBA A;  4I5L B;  1XFU O;  2K7C A;  1A75 A;  2NLN A;  4N5X A;  2KI4 C;  1ALW A;  1D1O A;  2CTN A;  1GGW A;  1CLB A;  2MHH A;  1NSH A;  2JXC A;  1IWQ A;  1NIW A;  4QJ3 B;  4CLN A;  3EK4 A;  1M45 A;  5ER4 X;  1KSO A;  1EXR A;  2JWW A;  3GOF A;  1FF1 A;  1G33 A;  1KSM A;  1E8A A;  2LM5 A;  1KK8 B;  2E6W A;  2L4I A;  1YTZ C;  3TUY C;  2JOJ A;  1UHK A;  3EVR A;  2VRG A;  2JNF A;  4D1E A;  4GGN A;  3E3R A;  4OR9 B;  2MBX A;  2F3Z A;  2QAC A;  3PFV A;  3SIB A;  3OB2 B;  3D10 A;  1YUU A;  2H61 C;  1JUO A;  2CXJ A;  5AXI A;  3SG2 A;  3DD4 A;  3KO0 A;  1A29 A;  1Y1U A;  1G8I A;  1J1E A;  1LIN A;  2M7N A;  2M8U A;  4YRU A;  3BUM B;  1KQM B;  5DKQ A;  2GGZ A;  1DTL A;  3OHM B;  4MZK A;  1LA3 A;  1IJ6 A;  2CT9 A;  1PSB A;  5AEQ A;  2KSP A;  3AAJ A;  2EC6 C;  3GK2 A;  2M97 A;  4DUQ A;  5HKY A;  2FCE A;  3I5I C;  1F55 A;  1QVI Y;  2NCO A;  1UHN A;  3EK8 A;  3IF7 A;  1WDC C;  4C0L A;  2F3Y A;  3LL8 B;  3JTD B;  1HT9 A;  4HSZ A; 
#chains in the Genus database with same CATH topology
 2LHI A;  2GGM A;  3L47 A;  2JT3 A;  2ZRS A;  1SRA A;  2RGI A;  4PHN A;  1SYM A;  1OOJ A;  3PN7 B;  1NX3 A;  1K93 D;  2JC2 A;  1DVI A;  4MVF A;  4E68 A;  1CFD A;  3DVJ A;  4YGC B;  1S36 A;  2L51 A;  4F0Z B;  4PE7 A;  2WOR A;  1K94 A;  3M0W A;  1J7P A;  2WCM A;  2I94 A;  2KYC A;  4USL A;  1QS7 A;  1A75 B;  1KK8 C;  1C3Y A;  1BOD A;  1ZMZ A;  2M1K B;  2LVJ A;  2Y1M A;  4PT1 A;  1SL7 A;  4WQ2 A;  2K60 A;  1BT6 A;  2M29 A;  3I5F C;  3O4Y A;  2Q91 A;  3NSI A;  5D69 A;  2HET A;  1UP5 A;  2AUC A;  3H4S E;  5PAL A;  2JRF A;  2KAX A;  2HQ8 A;  4PHK A;  3VRP A;  1LXF C;  2WND A;  3SS5 A;  2R2I A;  2G2B A;  1BG1 A;  1DQE A;  3D76 A;  5EL2 A;  1BMO A;  4YGB B;  1K9P A;  1W7J B;  1SCV A;  1T14 A;  3D75 A;  1UHI A;  2AAO A;  3OGN A;  1JC2 A;  1C3Z A;  1M39 A;  3B6X A;  1DC1 A;  2K61 A;  1WRZ A;  1PSR A;  1S6J A;  2BL0 B;  2KFG A;  2LUC A;  3BUO B;  1KQM C;  1AJ4 A;  1XFV O;  3I5H B;  3PLF B;  1Q80 A;  1SCM C;  1AUI B;  2WC5 A;  4MSP A;  3OB1 B;  2ZN8 A;  4C0J A;  4JPZ B;  1CFC A;  4DRW A;  2JUL A;  2NCP A;  4BY5 A;  1CMF A;  2LMT A;  1KWO B;  3D77 A;  5DIC A;  1PVA A;  2KYF A;  2L50 A;  3VRN A;  4MBE A;  1KK7 Y;  1TRF A;  5KU1 A;  3JTD C;  3CLN A;  1K90 D;  1K9K A;  2YGU A;  2A4J A;  2JTT A;  1CM4 A;  2NXQ A;  1TUJ A;  3PAL A;  2FJU B;  4ORB B;  2LHL A;  1AK8 A;  3O78 A;  1GJY A;  1RK9 A;  2BBM A;  3PN7 C;  3I5G B;  3CZ0 A;  3SG3 A;  1S26 D;  4PHM A;  1MWN A;  4WQ3 A;  3VRO A;  3EVU A;  2KQ6 A;  3V2L A;  1SMG A;  1A03 A;  1OMD A;  2LNK A;  2Y1N A;  1SY9 A;  1YR5 A;  2QEH A;  2ZKM X;  2OTG B;  1BOC A;  1OOF A;  1YRT B;  2QEV A;  2I2R E;  2COL B;  2KNE A;  4ORA B;  4OV2 A;  2KGB C;  2KQY A;  1F8H A;  1UHH A;  1K9U A;  1A2X A;  1B8L A;  2KAY A;  1TNQ A;  1CDM A;  2P6B B;  4ZCU A;  2MAZ A;  1DT7 B;  1IQ3 A;  1Y1X A;  2KFF A;  2LLS A;  1DJY A;  3OBV A;  1S5G Z;  1MF8 B;  3BFH A;  3D0Y A;  3PSR A;  4FTG A;  1JFJ A;  5CSN A;  3UO9 A;  1IKU A;  1B4C A;  4NDC A;  2QPT A;  2LP2 A;  1XO5 A;  1TOP A;  3DXL A;  4CFR A;  1N65 A;  1PAL A;  4M2O A;  1XFZ O;  1CDP A;  1QX5 B;  1OOG A;  1KFU S;  2BL0 C;  3BQ3 A;  1JSA A;  3CDN A;  1TNX A;  1CLL A;  2HQW A;  1FW4 A;  1L2O B;  2LMU A;  2HF5 A;  2WCJ A;  1RFJ A;  1G4Y R;  2L2C A;  3CZT X;  1CB1 A;  1C7W A;  4Q04 A;  1LA0 A;  2CBL A;  3ZWH A;  2KAV A;  3S0G A;  1RWY A;  1ZAC A;  1DMO A;  2LCP A;  4DCK A;  4N1G A;  2P71 A;  2Q4U A;  3NGV A;  1R6P A;  3FIA A;  3JVT B;  2F2O A;  2JPT A;  1KCY A;  2PRU A;  5I2O A;  4ETO A;  4DIR A;  2PYQ A;  4I5N B;  3RM1 A;  3NSK A;  2KBI A;  1KFX S;  3S0D A;  3FE8 A;  3I5G C;  4PDZ A;  3CR5 X;  3FE6 A;  1TCO B;  2H8V A;  4GUK A;  1FPW A;  2BKH B;  1MXE A;  1ZFS A;  4YI8 A;  1B9A A;  3FWC A;  5KSZ A;  2JPO A;  2M9G A;  2PSR A;  2WCL A;  5D3O A;  1AP4 A;  1VRK A;  2OTG C;  4FQT A;  1SW8 A;  2KBM A;  2K7O A;  3TDZ A;  2GV5 A;  2LVI A;  4HRE E;  2DOQ A;  1MQ1 A;  2H2K A;  4YGA A;  1WRL A;  3SG6 A;  2MA2 A;  1SPY A;  1F4O A;  4IL1 A;  4YI9 A;  4BY4 A;  1IH0 A;  4MZJ A;  1SK6 D;  1WRK A;  3A8R A;  5BPJ A;  1ORG A;  1B47 A;  1RJV A;  2BAP A;  1BLQ A;  1QX7 A;  2M0R A;  1NP8 A;  3S0A A;  1SSE B;  1TN4 A;  2V53 A;  1V1F A;  3EKH A;  3Q8I A;  4CFQ A;  3O2P A;  1DJH A;  1XFW O;  3DYE A;  3FE9 A;  4XJK B;  4F7F A;  4R1E A;  3SG4 A;  4PCW A;  2LAN A;  3ZNI A;  1NX0 A;  1NCZ A;  1MUX A;  1QAT A;  2L5Y A;  2JXL A;  1IRJ A;  4GFT A;  4YGD B;  1L2O C;  5CPV A;  3R72 A;  1EJ3 A;  1B7T Y;  2I7A A;  1J7Q A;  5HKZ A;  1YX8 A;  1QX2 A;  3FS7 A;  2NZ0 A;  2JU0 A;  1JWD A;  3D0Y B;  2CNP A;  1J7R A;  5HKW A;  3EKJ A;  1Y1A A;  1N2D A;  1JFK A;  1J7O A;  1B8R A;  1DJI A;  3SS3 A;  4U8D A;  1K8U A;  1NWD A;  2L0P A;  3PM8 A;  4FQO A;  2ZND A;  2D8N A;  1ODB A;  5JOL A;  2MLF C;  1FI5 A;  5AFP A;  2JNX A;  2K2A A;  5K89 A;  1CDL A;  1KFU L;  4YBH B;  5I2L A;  2JT8 A;  2Y5I A;  3GK1 A;  5HLV A;  1YRU B;  2P70 A;  4MLW A;  4NDB A;  2LVV A;  1XFR A;  4GBA A;  5FYX A;  1SNL A;  4AQJ A;  3B87 A;  1GQM A;  5F6T A;  1U5I A;  2M49 B;  1AVS A;  3BJH A;  5DKN A;  1PUL A;  4L9M A;  1K2H A;  2ZRT A;  4OCI A;  1B8C A;  1CKK A;  5J3X A;  1NX2 A;  3CAB A;  5TNC A;  3TS5 B;  1CFF A;  3CTN A;  1P28 A;  3BXK A;  3EK7 A;  2LC5 A;  2K8M B;  3AKB A;  2KI4 B;  4GGF C;  1CLM A;  1K96 A;  3L4L A;  1KFX L;  1IG5 A;  4M2P A;  4DS7 A;  1TTX A;  1UUS A;  2WC8 A;  3DF0 A;  1XYD A;  2I18 A;  1DJZ A;  1OE9 B;  2WCB A;  3WHT B;  1SR6 B;  5HYD A;  1EH2 A;  1DJW A;  1HQV A;  1NCX A;  3SG7 A;  3CR4 X;  3DVK A;  4OZD A;  3CS1 A;  1F54 A;  1FI6 A;  3HCM A;  2BBN A;  2PVB A;  3AKA A;  1EG3 A;  3R1V A;  5AER A;  1QVI Z;  4ICB A;  2KLE A;  2BCX A;  4I5J A;  1JF2 A;  1B1G A;  3ICB A;  2SAS A;  1A4P A;  1LS8 A;  2M7L A;  1OW4 A;  4UPG A;  5HL1 A;  1UHJ A;  2L98 A;  1QAS A;  1BR4 B;  4MRY A;  3WHU B;  4GNK B;  2WCE A;  4WRI A;  2HPS A;  3KHE A;  1Z4H A;  3C1V A;  3L4A A;  1FBV A;  2ERB A;  1YUR A;  1QIW A;  3NXA A;  1S6C A;  4AOM A;  1X02 A;  3EG5 B;  5KTY A;  1EG4 A;  3CWG A;  5HLO A;  4PHJ A;  1LVC D;  3K1E A;  3MSE B;  4N1F A;  5I94 A;  1WY9 A;  3DVE A;  2BCB A;  2BE6 A;  1XFY O;  2F8P A;  2BCA A;  3LLE A;  4CPV A;  4PE4 A;  3I5H C;  1XK4 A;  4YGE B;  1DJG A;  2LAP A;  3GK4 X;  3I5I B;  1OOI X;  1QXP A;  1QV0 A;  2K7B A;  1IQ5 A;  1IIO A;  1KWO C;  1L7Z A;  1WDC B;  1OQP A;  3S0B A;  3LK0 A;  3TS5 C;  1SL8 A;  2Y4Q A;  3NSL A;  3D78 A;  3KEV A;  2ISD A;  2WOS A;  1W7I B;  1UWO A;  1DEK A;  4INW A;  1CM1 A;  1BU3 A;  1AJ5 A;  1SR6 C;  1U5I B;  4XYN A;  3VRR A;  1CFP A;  3SIA A;  3OX6 A;  2PMY A;  3EVV A;  2M3W A;  1TIZ A;  4OKH A;  1Y6W A;  2BNX A;  1BJF A;  3TZ1 A;  5CSI A;  2BKI B;  1N0Y A;  1CNP A;  3VRQ A;  3B86 A;  1KK7 Z;  1PRW A;  3VGO A;  5G08 A;  4PE1 A;  3S0F A;  3SS4 A;  4AQI A;  3DF0 B;  3I5F B;  1QTX A;  3B7A A;  1JF0 A;  3KPX A;  1RTP 1;  1F71 A;  1OZS A;  3VB1 A;  1F70 A;  2QEO A;  2JTZ A;  3BYA A;  5I2Q A;  1LKJ A;  3KF9 A;  4P5O E;  3D74 A;  3PJI A;  3BOW A;  3NSO A;  3WXA A;  1WLZ A;  1DGU A;  1MR8 A;  5CSJ A;  1DF0 A;  1IJ5 A;  1REC A;  2OPO A;  1Y0V H;  1AHR A;  2M1U A;  3BUW B;  2WCF A;  4MEW A;  5CSF A;  2K2F A;  2ZNE A;  1M63 B;  2TN4 A;  2CCM A;  2IS9 A;  1SCM B;  2H61 A;  1C07 A;  1IGV A;  2JZI A;  2OS8 B;  3LCP C;  2KGR A;  1ZOT B;  2AMI A;  2ZN9 A;  4NQG A;  4PAL A;  4A4B A;  2FCD A;  3A4U B;  1WLM A;  3D73 A;  2E30 A;  2F33 A;  2FOT A;  1V1G A;  2BE4 A;  3CR2 A;  5FI7 A;  1DGV A;  1ALV A;  3CZ2 A;  5IBW A;  2EHB A;  2LLU A;  3AAK A;  5D7F A;  3B88 A;  1GGZ A;  3IQQ A;  1J1D A;  3K21 A;  4GPL B;  1S3P A;  2WCK A;  3JVT C;  1DJX A;  3QRX A;  4C0K A;  1BR1 B;  2LP3 A;  1XFX O;  1OOH A;  2LMV A;  1CDN A;  1TNW A;  2L4H A;  2FJY A;  4MN0 A;  3BFB A;  1M46 A;  2KFH A;  1XA5 A;  1SBJ A;  3HX4 A;  3O6B A;  1YX7 A;  1OMR A;  3BFA A;  1S5G Y;  3OX5 A;  5AAN A;  3SG5 A;  1NCY A;  5I8N A;  3TDI A;  1OMV A;  2MLE C;  5ER5 A;  2LLT A;  2BEC A;  4PE0 A;  2PAS A;  5JJG A;  2MRD A;  4GAO A;  1TCF A;  3NHT A;  2KOT A;  3SJS A;  1EL4 A;  3OP0 A;  4TNC A;  2O5G A;  2L2E A;  3RZS A;  1YVL A;  3CYZ A;  4I5K A;  4CID A;  1YVH A;  2WC6 A;  4OVN F;  3TDU A;  2QDI A;  4A4C A;  1H8B A;  1SKT A;  1S6I A;  1XVJ A;  2PAL A;  2L5X B;  1J55 A;  2B1U A;  2PQL A;  1NX1 A;  4P2Y B;  4QJ4 B;  2SCP A;  1CMG A;  2LE9 B;  4HRG A;  1R2U A;  4JQ0 D;  3CGA A;  3DY9 A;  1NPQ A;  4MRX A;  1M31 A;  1UUR A;  3PAT A;  3BUX B;  1QV1 A;  3CZ1 A;  2WCH A;  2OS8 C;  3BUN B;  4ZCV A;  1BF5 A;  5DKR A;  1MXL C;  3TUY B;  1QJT A;  2G9B A;  1Z2C B;  1F4Q A;  2KI6 C;  5FI2 A;  2LUX A;  3RLZ A;  1TNP A;  1W9Z A;  3BOW B;  2K0J A;  1H4B A;  2QEB A;  3DVM A;  3O4X A;  3WNX B;  1C7V A;  1OSA A;  1DF0 B;  4IJ7 A;  1NYA A;  3F45 A;  3QME A;  1SL9 A;  3R1O A;  1S1E A;  1NUB A;  2JT0 A;  5B8I B;  2KPH A;  2KDH A;  1DEL A;  2ZFD A;  2EGD A;  1XK4 C;  2KHN A;  4JWQ A;  1K95 A;  1QLK A;  3FWB A;  1QIV A;  4GGF A;  4QJ5 B;  2F2P A;  2GTE A;  2O60 A;  1YUT A;  1B7T Z;  1PVB A;  3NHI A;  4KYN A;  4HRH A;  4ORC B;  5GQQ C;  1KQV A;  2LV7 A;  2K7D A;  1MHO A;  1RRO A;  3IQO A;  1GM0 A;  1PK0 D;  4XJK A;  1YUS A;  2EC6 B;  1ZUZ A;  3LK1 A;  4MZL A;  4NDD A;  2JQ6 A;  1TWO A;  2KI6 D;  2MJW B;  4M2Q A;  1CTR A;  1QLS A;  1OZO A;  2LVK A;  3DZT A;  1JBA A;  4I5L B;  1XFU O;  4INX A;  3IVT A;  2K7C A;  1A75 A;  2NLN A;  4N5X A;  2KI4 C;  1ALW A;  3N7H A;  1D1O A;  2CTN A;  1GGW A;  1CLB A;  2MHH A;  1NSH A;  2JXC A;  1IWQ A;  1NIW A;  4QJ3 B;  4CLN A;  3EK4 A;  1M45 A;  5ER4 X;  1KSO A;  1EXR A;  2JWW A;  3GOF A;  1FF1 A;  1G33 A;  1KSM A;  2KLD A;  1E8A A;  2LM5 A;  1KK8 B;  2E6W A;  2L4I A;  1YTZ C;  3TUY C;  2JOJ A;  1UHK A;  3EVR A;  1QWV A;  2VRG A;  2JNF A;  4D1E A;  4GGN A;  3E3R A;  4OR9 B;  4JKT A;  2F3Z A;  2MBX A;  2QAC A;  3PFV A;  3SIB A;  3OB2 B;  3D10 A;  1YUU A;  5FI6 A;  3S0E A;  2H61 C;  1JUO A;  2CXJ A;  5AXI A;  3SG2 A;  3DD4 A;  3KO0 A;  1A29 A;  1Y1U A;  3R1P A;  1G8I A;  1J1E A;  1LIN A;  2M7N A;  2M8U A;  4YRU A;  3BUM B;  1KQM B;  5DKQ A;  2GGZ A;  1DTL A;  3OHM B;  4MZK A;  4JD9 A;  1LA3 A;  1IJ6 A;  2CT9 A;  1PSB A;  3UNW A;  5AEQ A;  2KSP A;  3AAJ A;  2EC6 C;  3GK2 A;  2M97 A;  4DUQ A;  5HKY A;  2FCE A;  3I5I C;  1F55 A;  1QVI Y;  2NCO A;  1TUZ A;  1UHN A;  3EK8 A;  3IF7 A;  1WDC C;  4C0L A;  2F3Y A;  3LL8 B;  3PM2 A;  3JTD B;  1HT9 A;  4HSZ A; 
#chains in the Genus database with same CATH homology
 2LHI A;  2GGM A;  2JT3 A;  2ZRS A;  1SRA A;  2RGI A;  4PHN A;  1SYM A;  1OOJ A;  3PN7 B;  1NX3 A;  1K93 D;  2JC2 A;  1DVI A;  4MVF A;  4E68 A;  1CFD A;  3DVJ A;  4YGC B;  1S36 A;  2L51 A;  4F0Z B;  4PE7 A;  2WOR A;  1K94 A;  3M0W A;  1J7P A;  2I94 A;  2KYC A;  4USL A;  1QS7 A;  1A75 B;  1KK8 C;  1BOD A;  1ZMZ A;  2M1K B;  2LVJ A;  2Y1M A;  1SL7 A;  4WQ2 A;  1BT6 A;  2M29 A;  3I5F C;  3O4Y A;  2Q91 A;  3NSI A;  5D69 A;  2HET A;  1UP5 A;  2AUC A;  3H4S E;  5PAL A;  2JRF A;  2KAX A;  2HQ8 A;  4PHK A;  3VRP A;  1LXF C;  2WND A;  2R2I A;  2G2B A;  1BG1 A;  1BMO A;  4YGB B;  1K9P A;  1W7J B;  1SCV A;  1JC2 A;  1UHI A;  2AAO A;  1M39 A;  2K61 A;  1WRZ A;  1PSR A;  1S6J A;  2BL0 B;  2KFG A;  2LUC A;  3BUO B;  1KQM C;  1AJ4 A;  1XFV O;  3I5H B;  3PLF B;  1Q80 A;  1SCM C;  1AUI B;  4MSP A;  3OB1 B;  2ZN8 A;  4C0J A;  4JPZ B;  1CFC A;  4DRW A;  2JUL A;  2NCP A;  4BY5 A;  1CMF A;  2LMT A;  1KWO B;  1PVA A;  2KYF A;  2L50 A;  3VRN A;  4MBE A;  1KK7 Y;  1TRF A;  5KU1 A;  3JTD C;  3CLN A;  1K90 D;  1K9K A;  2A4J A;  2JTT A;  1CM4 A;  2NXQ A;  3PAL A;  2FJU B;  4ORB B;  2LHL A;  1AK8 A;  3O78 A;  1GJY A;  1RK9 A;  2BBM A;  3PN7 C;  3I5G B;  3SG3 A;  1S26 D;  4PHM A;  1MWN A;  4WQ3 A;  3VRO A;  3EVU A;  2KQ6 A;  1SMG A;  1A03 A;  1OMD A;  2LNK A;  2Y1N A;  1SY9 A;  1YR5 A;  2ZKM X;  2OTG B;  1BOC A;  1YRT B;  2I2R E;  2COL B;  2KNE A;  4ORA B;  4OV2 A;  2KGB C;  2KQY A;  1F8H A;  1UHH A;  1K9U A;  1A2X A;  1B8L A;  2KAY A;  1TNQ A;  1CDM A;  2P6B B;  4ZCU A;  2MAZ A;  1DT7 B;  1IQ3 A;  1Y1X A;  2KFF A;  2LLS A;  1DJY A;  3PSR A;  1S5G Z;  1MF8 B;  3D0Y A;  4FTG A;  1JFJ A;  5CSN A;  1IKU A;  1B4C A;  4NDC A;  2QPT A;  2LP2 A;  1XO5 A;  1TOP A;  4CFR A;  1N65 A;  1PAL A;  4M2O A;  1XFZ O;  1CDP A;  1QX5 B;  3BQ3 A;  1KFU S;  2BL0 C;  1JSA A;  1TNX A;  1CLL A;  2HQW A;  1FW4 A;  1L2O B;  2LMU A;  2HF5 A;  1RFJ A;  1G4Y R;  3CZT X;  1CB1 A;  1C7W A;  4Q04 A;  1LA0 A;  2CBL A;  3ZWH A;  2KAV A;  1RWY A;  1ZAC A;  1DMO A;  2LCP A;  4DCK A;  4N1G A;  2Q4U A;  1R6P A;  3FIA A;  3JVT B;  2F2O A;  2JPT A;  1KCY A;  2PRU A;  5I2O A;  4ETO A;  4DIR A;  4I5N B;  3RM1 A;  3NSK A;  2KBI A;  1KFX S;  3I5G C;  4PDZ A;  3CR5 X;  1TCO B;  4GUK A;  1FPW A;  2BKH B;  1MXE A;  1ZFS A;  4YI8 A;  1B9A A;  3FWC A;  5KSZ A;  2M9G A;  2PSR A;  1AP4 A;  1VRK A;  2OTG C;  1SW8 A;  2KBM A;  2K7O A;  3TDZ A;  2GV5 A;  2LVI A;  4HRE E;  2DOQ A;  1MQ1 A;  2H2K A;  4YGA A;  1WRL A;  3SG6 A;  2MA2 A;  1SPY A;  1F4O A;  4IL1 A;  4YI9 A;  4BY4 A;  1IH0 A;  4MZJ A;  1SK6 D;  1WRK A;  3A8R A;  5BPJ A;  1B47 A;  1RJV A;  1BLQ A;  1QX7 A;  2M0R A;  1NP8 A;  2V53 A;  1TN4 A;  3EKH A;  1V1F A;  4CFQ A;  3O2P A;  1DJH A;  1XFW O;  4XJK B;  4R1E A;  3SG4 A;  4PCW A;  2LAN A;  3ZNI A;  1NX0 A;  1NCZ A;  1MUX A;  1QAT A;  2JXL A;  1IRJ A;  4GFT A;  4YGD B;  1L2O C;  5CPV A;  1EJ3 A;  1B7T Y;  2I7A A;  1J7Q A;  5HKZ A;  1YX8 A;  1QX2 A;  3FS7 A;  2NZ0 A;  2JU0 A;  1JWD A;  3D0Y B;  2CNP A;  1J7R A;  5HKW A;  3EKJ A;  1Y1A A;  1N2D A;  1JFK A;  1J7O A;  1B8R A;  1DJI A;  4U8D A;  1K8U A;  1NWD A;  2L0P A;  3PM8 A;  4FQO A;  2ZND A;  2D8N A;  1ODB A;  5JOL A;  2MLF C;  1FI5 A;  5AFP A;  2JNX A;  2K2A A;  5K89 A;  1CDL A;  1KFU L;  4YBH B;  5I2L A;  2JT8 A;  2Y5I A;  3GK1 A;  5HLV A;  1YRU B;  4NDB A;  4MLW A;  2LVV A;  4GBA A;  5FYX A;  1SNL A;  4AQJ A;  1GQM A;  5F6T A;  1U5I A;  2M49 B;  1AVS A;  5DKN A;  1PUL A;  4L9M A;  1K2H A;  2ZRT A;  4OCI A;  1B8C A;  1CKK A;  5J3X A;  1NX2 A;  5TNC A;  3TS5 B;  1CFF A;  3CTN A;  3BXK A;  3EK7 A;  2LC5 A;  2K8M B;  3AKB A;  2KI4 B;  4GGF C;  1CLM A;  1K96 A;  1KFX L;  1IG5 A;  4M2P A;  4DS7 A;  1TTX A;  1UUS A;  2WC8 A;  3DF0 A;  1XYD A;  2I18 A;  1DJZ A;  1OE9 B;  2WCB A;  3WHT B;  1SR6 B;  5HYD A;  1EH2 A;  1DJW A;  1HQV A;  1NCX A;  3SG7 A;  3CR4 X;  3DVK A;  3CS1 A;  1F54 A;  1FI6 A;  3HCM A;  2BBN A;  2PVB A;  3AKA A;  1EG3 A;  5AER A;  1QVI Z;  4ICB A;  2BCX A;  4I5J A;  1JF2 A;  1B1G A;  3ICB A;  2SAS A;  1A4P A;  2M7L A;  4UPG A;  1UHJ A;  2L98 A;  1QAS A;  1BR4 B;  4MRY A;  3WHU B;  4GNK B;  2WCE A;  4WRI A;  2HPS A;  3KHE A;  3C1V A;  1FBV A;  1YUR A;  1QIW A;  3NXA A;  1S6C A;  4AOM A;  1X02 A;  5KTY A;  1EG4 A;  3CWG A;  5HLO A;  4PHJ A;  1LVC D;  3MSE B;  4N1F A;  1WY9 A;  3DVE A;  2BCB A;  2BE6 A;  1XFY O;  2F8P A;  2BCA A;  3LLE A;  4CPV A;  4PE4 A;  3I5H C;  1XK4 A;  4YGE B;  1DJG A;  2LAP A;  3GK4 X;  3I5I B;  1QXP A;  1QV0 A;  2K7B A;  1IQ5 A;  1KWO C;  1L7Z A;  1WDC B;  1OQP A;  3TS5 C;  3LK0 A;  1SL8 A;  2Y4Q A;  3NSL A;  3KEV A;  2ISD A;  2WOS A;  1W7I B;  1UWO A;  1CM1 A;  1BU3 A;  1AJ5 A;  1SR6 C;  1U5I B;  4XYN A;  3VRR A;  1CFP A;  3SIA A;  3OX6 A;  2PMY A;  3EVV A;  2M3W A;  1TIZ A;  4OKH A;  1Y6W A;  1BJF A;  3TZ1 A;  5CSI A;  2BKI B;  1N0Y A;  1CNP A;  3VRQ A;  1KK7 Z;  1PRW A;  3VGO A;  5G08 A;  4PE1 A;  4AQI A;  3DF0 B;  3I5F B;  1QTX A;  1JF0 A;  3KPX A;  1RTP 1;  1F71 A;  1OZS A;  1F70 A;  2JTZ A;  3BYA A;  5I2Q A;  1LKJ A;  3KF9 A;  4P5O E;  3BOW A;  3NSO A;  3WXA A;  1WLZ A;  1DGU A;  1MR8 A;  5CSJ A;  1DF0 A;  1IJ5 A;  1REC A;  2OPO A;  1Y0V H;  1AHR A;  2M1U A;  3BUW B;  2WCF A;  4MEW A;  5CSF A;  2K2F A;  2ZNE A;  1M63 B;  2TN4 A;  2CCM A;  2IS9 A;  1SCM B;  2H61 A;  1C07 A;  1IGV A;  2JZI A;  2OS8 B;  3LCP C;  2KGR A;  1ZOT B;  2AMI A;  2ZN9 A;  4NQG A;  4PAL A;  4A4B A;  2FCD A;  3A4U B;  1WLM A;  2E30 A;  2F33 A;  2FOT A;  1V1G A;  2BE4 A;  3CR2 A;  1DGV A;  1ALV A;  5IBW A;  2EHB A;  2LLU A;  3AAK A;  5D7F A;  1GGZ A;  3IQQ A;  1J1D A;  3K21 A;  4GPL B;  1S3P A;  4C0K A;  3JVT C;  1DJX A;  3QRX A;  1BR1 B;  2LP3 A;  1XFX O;  2LMV A;  1CDN A;  1TNW A;  2L4H A;  4MN0 A;  1M46 A;  2KFH A;  1XA5 A;  1SBJ A;  3HX4 A;  3O6B A;  1YX7 A;  1OMR A;  1S5G Y;  3OX5 A;  5AAN A;  3SG5 A;  1NCY A;  5I8N A;  3TDI A;  1OMV A;  2MLE C;  5ER5 A;  2LLT A;  2BEC A;  4PE0 A;  2PAS A;  5JJG A;  2MRD A;  4GAO A;  1TCF A;  2KOT A;  3SJS A;  1EL4 A;  3OP0 A;  4TNC A;  2O5G A;  2L2E A;  1YVL A;  4I5K A;  4CID A;  1YVH A;  3TDU A;  4OVN F;  1H8B A;  4A4C A;  1SKT A;  1S6I A;  1XVJ A;  2PAL A;  2L5X B;  1J55 A;  2B1U A;  1NX1 A;  4P2Y B;  4QJ4 B;  2SCP A;  1CMG A;  2LE9 B;  4HRG A;  1R2U A;  4JQ0 D;  3CGA A;  1NPQ A;  4MRX A;  1M31 A;  1UUR A;  3PAT A;  3BUX B;  1QV1 A;  2OS8 C;  3BUN B;  4ZCV A;  1BF5 A;  5DKR A;  1MXL C;  3TUY B;  1QJT A;  2G9B A;  1F4Q A;  2KI6 C;  2LUX A;  3RLZ A;  1TNP A;  3BOW B;  2K0J A;  1H4B A;  3DVM A;  1C7V A;  3WNX B;  1OSA A;  1DF0 B;  1NYA A;  3F45 A;  1SL9 A;  1S1E A;  1NUB A;  2JT0 A;  5B8I B;  2KDH A;  4JWQ A;  2ZFD A;  2EGD A;  1XK4 C;  2KHN A;  1K95 A;  1QLK A;  3FWB A;  1QIV A;  4GGF A;  4QJ5 B;  2F2P A;  2O60 A;  1YUT A;  1B7T Z;  1PVB A;  1KQV A;  4HRH A;  4ORC B;  5GQQ C;  2LV7 A;  2K7D A;  1MHO A;  1RRO A;  3IQO A;  1PK0 D;  4XJK A;  1YUS A;  2EC6 B;  1ZUZ A;  3LK1 A;  4MZL A;  4NDD A;  2JQ6 A;  2KI6 D;  2MJW B;  4M2Q A;  1CTR A;  1QLS A;  1OZO A;  2LVK A;  1JBA A;  4I5L B;  1XFU O;  2K7C A;  1A75 A;  2NLN A;  4N5X A;  2KI4 C;  1ALW A;  1D1O A;  2CTN A;  1GGW A;  1CLB A;  2MHH A;  1NSH A;  2JXC A;  1IWQ A;  1NIW A;  4QJ3 B;  4CLN A;  3EK4 A;  1M45 A;  5ER4 X;  1KSO A;  1EXR A;  2JWW A;  3GOF A;  1FF1 A;  1G33 A;  1KSM A;  1E8A A;  2LM5 A;  1KK8 B;  2E6W A;  2L4I A;  1YTZ C;  3TUY C;  2JOJ A;  1UHK A;  3EVR A;  2VRG A;  2JNF A;  4D1E A;  4GGN A;  3E3R A;  4OR9 B;  2MBX A;  2F3Z A;  2QAC A;  3PFV A;  3SIB A;  3OB2 B;  3D10 A;  1YUU A;  2H61 C;  1JUO A;  2CXJ A;  5AXI A;  3SG2 A;  3DD4 A;  3KO0 A;  1A29 A;  1Y1U A;  1G8I A;  1J1E A;  1LIN A;  2M7N A;  2M8U A;  4YRU A;  3BUM B;  1KQM B;  5DKQ A;  2GGZ A;  1DTL A;  3OHM B;  4MZK A;  1LA3 A;  1IJ6 A;  2CT9 A;  1PSB A;  5AEQ A;  2KSP A;  3AAJ A;  2EC6 C;  3GK2 A;  2M97 A;  4DUQ A;  5HKY A;  2FCE A;  3I5I C;  1F55 A;  1QVI Y;  2NCO A;  1UHN A;  3EK8 A;  3IF7 A;  1WDC C;  4C0L A;  2F3Y A;  3LL8 B;  3JTD B;  1HT9 A;  4HSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...