1XK4A

Crystal structure of human calprotectin(s100a8/s100a9)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
87
structure length
87
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calgranulin A
publication title The crystal structure of the human (S100A8/S100A9)2 heterotetramer, calprotectin, illustrates how conformational changes of interacting alpha-helices can determine specific association of two EF-hand proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 87
sequence length 87
chains with identical sequence B, E, F, I, J
ec nomenclature
pdb deposition date 2004-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xk4A00
1F4QA 1OMDA 3PN7B 1KFXL 1LA0A 2L50A 2BE4A 3AAKA 2JT8A 1DJGA 3IQQA 1Q80A 3O2PA 2AAOA 2MBXA 4P5OE 1YUUA 1QX2A 1ALWA 1BJFA 1CLLA 2L0PA 1FBVA 4GNKB 1NPQA 2HQ8A 3SIAA 3FIAA 2I18A 2L51A 3A8RA 4NDDA 2M97A 4N1GA 1JFJA 1LVCD 1CDNA 1S3PA 1MXEA 2BCAA 1YTZC 2D8NA 4C0KA 2VRGA 1V1FA 2NCPA 1K9KA 2CTNA 3KO0A 3ZNIA 1LINA 2P6BB 4XJKA 3AAJA 3LCPC 4YI8A 1K93D 2PALA 3OB1B 1YX7A 2Y1NA 3SG5A 1SW8A 1DF0A 1YRTB 1NP8A 5TNCA 1UP5A 1J7QA 1B4CA 1LKJA 1RK9A 1DT7B 1YURA 1TNPA 1DVIA 4MRXA 3EVUA 1IKUA 3ICBA 1CFPA 3A4UB 1U5IA 3I5HC 3OP0A 3SIBA 4N5XA 5J3XA 1HT9A 1SNLA 3I5IB 3FWCA 1XVJA 1S5GZ 1IG5A 1JBAA 1DJZA 2M1KB 5CSJA 2KI4C 3PM8A 1CDMA 1SL8A 1SMGA 1M39A 4A4CA 3H4SE 2PASA 2WCFA 2F2PA 1YVLA 1AHRA 4YI9A 3TZ1A 1J1DA 2MHHA 3I5FC 1M45A 3KF9A 2L2EA 1SR6C 1XFUO 2JPTA 2KHNA 1CMFA 3TDZA 4PHKA 2K8MB 1FPWA 1NX2A 1KQMC 1OZSA 2JT3A 4QJ5B 1VRKA 1PSRA 1CNPA 2LVJA 2KGBC 4XJKB 1NX1A 2BBMA 1WDCB 1ZMZA 1QASA 2KI6D 5CSIA 3EVRA 3PLFB 2M7NA 2WCBA 1AJ4A 1DF0B 1UUSA 1V1GA 5GQQC 4WQ2A 2K61A 2LNKA 2LHLA 1YVHA 2HPSA 4ZCUA 4DRWA 2LLTA 5AERA 3NSIA 2OPOA 1TNXA 2LM5A 1K94A 2HQWA 2SCPA 4M2OA 3I5GC 2E6WA 3DD4A 4YBHB 1K2HA 1MQ1A 1PRWA 4AOMA 1Y1XA 2M1UA 1D1OA 1ZFSA 1ODBA 1SCMC 2F2OA 4GPLB 1YUTA 1FF1A 1G8IA 2JTZA 4HREE 2KDHA 2KFHA 5F6TA 1K9UA 1DJIA 3OX5A 4C0JA 4YGEB 1KK7Y 1Y6WA 3DF0A 4PDZA 1R2UA 2FOTA 5I2QA 1L2OC 4P2YB 1NCYA 1AUIB 1QATA 3IQOA 1TOPA 3I5HB 4YGBB 1XFYO 2JQ6A 1YRUB 2KAXA 2BBNA 2EC6C 3F45A 1DJHA 2KI4B 2FCEA 1MUXA 4F0ZB 2HF5A 1QXPA 3DVKA 3I5FB 1CFCA 1K95A 1SR6B 1CLBA 3AKBA 1AK8A 3TS5C 3O6BA 1KQMB 3HX4A 3LK1A 3ZWHA 1UHNA 5AANA 5HLVA 3KPXA 3D10A 1C7VA 3TUYB 2KBIA 1GQMA 5JJGA 3DVMA 4I5LB 4CPVA 1XFXO 1WY9A 5I2OA 1A4PA 1RTP1 1UHIA 5D7FA 4I5JA 1M31A 2KFGA 2G2BA 1WRLA 3CR5X 2JT0A 3EVVA 4OR9B 3RLZA 1B8LA 1SY9A 2JC2A 4BY4A 2KNEA 4DS7A 1A75A 5DKNA 1H4BA 5G08A 2BE6A 1SPYA 2ZNDA 4USLA 2CNPA 5I8NA 1LXFC 2KAYA 1TTXA 5AXIA 2GV5A 4GFTA 1SK6D 2LVKA 3JTDC 3I5GB 2LE9B 4JWQA 2JXLA 1YX8A 1N2DA 2BECA 5HYDA 1QLSA 1IGVA 1TNQA 1MXLC 4CFQA 5HKYA 4ORAB 1FI5A 1DGVA 3EKJA 3LLEA 2LHIA 2WCEA 2ZN9A 5AFPA 1Y0VH 3O78A 2LP3A 1GGZA 1S6IA 1CM4A 1EXRA 1IJ5A 1R6PA 2G9BA 1L2OB 3CR2A 2BKHB 3D0YA 3BOWA 2KYCA 2PRUA 1CB1A 2KFFA 4DUQA 4ICBA 4CLNA 1XFVO 1UURA 1KSOA 2NXQA 3DVEA 4MZJA 1F4OA 4FTGA 1W7IB 3KEVA 1B7TZ 2PMYA 3BXKA 2NZ0A 1ZACA 1EJ3A 4OKHA 1BU3A 1S5GY 4XYNA 3FWBA 1WLMA 2KYFA 4PCWA 5DKQA 1KFXS 2LLSA 5JOLA 3NSKA 2TN4A 1F71A 5ER4X 3SG7A 2BKIB 1QLKA 4JPZB 1DJYA 1G4YR 5CPVA 1C07A 2K2AA 1NSHA 2KQ6A 1FI6A 4FQOA 1QV1A 4ZCVA 1PULA 1NUBA 4DIRA 4PE4A 3VROA 1BR1B 1XA5A 5KTYA 1QV0A 2K2FA 2IS9A 2L4HA 2MRDA 3BUWB 1CLMA 2K7CA 1J7OA 4MN0A 1OZOA 1W7JB 5HLOA 1BLQA 1DMOA 2LCPA 1NCXA 2I7AA 4PALA 3HCMA 1LA3A 3IF7A 2M8UA 1CMGA 2JZIA 2WOSA 1H8BA 1IRJA 1U5IB 3SJSA 1OQPA 2FCDA 1AJ5A 1YUSA 3JTDB 2A4JA 1CFDA 2JULA 3BUNB 3NXAA 1F70A 1OSAA 1QX7A 3O4YA 3GK1A 2AUCA 3OB2B 1AVSA 1MF8B 1QIVA 1SKTA 3GOFA 1L7ZA 4PE1A 1Y1UA 1EG4A 4CIDA 1CTRA 3BYAA 4MBEA 1JC2A 1DJXA 1CDPA 4MRYA 3DVJA 2M7LA 1WRZA 4M2QA 1XYDA 2LV7A 1GJYA 4NDBA 1K8UA 3BUXB 5HKZA 1J1EA 2MLEC 4E68A 3KHEA 1KK8C 5I2LA 1PVBA 1F54A 3WNXB 4I5NB 2F3ZA 2I2RE 2M49B 4MVFA 4AQJA 2WC8A 2O60A 1DJWA 4PE0A 1C7WA 1J7RA 1S6CA 4I5KA 2ZKMX 1XK4C 1SL9A 2ZN8A 5CSNA 1UWOA 3WHTB 3EK8A 2F3YA 4PHJA 1EG3A 1RJVA 1S36A 4A4BA 5DKRA 3CTNA 1SBJA 2JOJA 1BR4B 1BOCA 2CXJA 2LANA 3CLNA 1EH2A 1PSBA 3JVTC 3VRQA 1TIZA 1M46A 1BMOA 4HRHA 1TN4A 1A03A 2L98A 4OCIA 4CFRA 3VRRA 2ZRTA 4HRGA 2MAZA 4NDCA 3PSRA 2Y5IA 5KSZA 1K96A 3WHUB 2HETA 3PATA 1JUOA 3PFVA 4HSZA 2GGMA 4BY5A 1RROA 3GK2A 4MLWA 1B9AA 1QX5B 1SL7A 5ER5A 1TCOB 2KQYA 4ETOA 1PK0D 1XK4A 2SASA 3DF0B 1SCVA 1RFJA 3C1VA 4AQIA 2ZFDA 1NWDA 2QACA 5B8IB 4GBAA 4ORBB 3M0WA 4C0LA 4MZLA 2LUXA 2KGRA 1WDCC 4QJ4B 3OX6A 1UHHA 1K90D 4UPGA 3LL8B 4MEWA 4U8DA 5HKWA 1RWYA 3NSOA 1SCMB 2CBLA 2LVVA 2WORA 3VGOA 1B47A 4OV2A 2ISDA 1CM1A 2KI6C 1NCZA 1J7PA 1DTLA 2WNDA 2L4IA 2Y4QA 3CZTX 1NIWA 2FJUB 2JTTA 1NYAA 5PALA 1XFZO 1KK8B 1KFUL 2Q91A 2JNXA 2LMTA 3NSLA 4R1EA 2K0JA 1BF5A 2BCBA 1WRKA 1IQ5A 2EC6B 2JXCA 1XO5A 1SYMA 1K9PA 2OS8C 2PVBA 4GGNA 5BPJA 2OTGC 2JWWA 1QJTA 1EL4A 3BQ3A 2BL0C 3SG4A 1PALA 1B7TY 1F8HA 2JRFA 1WLZA 1HQVA 1A75B 1XFWO 3TDIA 1BT6A 3BUOB 2H61C 1GGWA 5D69A 3TS5B 1JWDA 2R2IA 2Q4UA 1KWOC 5IBWA 2PSRA 1JF0A 1A2XA 4YRUA 1JF2A 3QRXA 2LUCA 3E3RA 1ZUZA 3JVTB 2F33A 5FYXA 1MWNA 2M0RA 4DCKA 1TNWA 3TDUA 4MZKA 1S6JA 2KBMA 2M29A 5K89A 1M63B 1JFKA 1OMVA 2CCMA 4YGDB 1OMRA 3LK0A 1ALVA 3K21A 2ZRSA 1CDLA 2K7OA 2LVIA 1X02A 5KU1A 4GUKA 4Q04A 1QIWA 1JSAA 4YGAA 2H61A 1PVAA 3EK4A 2AMIA 3BUMB 3D0YB 2KSPA 3BOWB 1CKKA 1UHJA 1FW4A 3CWGA 4OVNF 3PN7C 4WRIA 3TUYC 1CFFA 2EHBA 1N65A 2QPTA 2M3WA 1TRFA 2CT9A 3SG2A 1SRAA 2F8PA 3RM1A 3MSEB 3PALA 4QJ3B 1KCYA 1E8AA 1IH0A 1B8CA 2ZNEA 1KFUS 1B1GA 3VRPA 1ZOTB 4YGCB 1MHOA 1KQVA 2Y1MA 3FS7A 4GGFC 4PHNA 2JNFA 4GAOA 1DGUA 1QTXA 4WQ3A 2E30A 2LP2A 2GGZA 2EGDA 1BODA 4L9MA 3CS1A 1S1EA 1RECA 1S26D 2OS8B 2OTGB 4PE7A 1F55A 2LLUA 1IJ6A 2BL0B 4ORCB 3SG6A 3EKHA 1IWQA 1TCFA 1N0YA 1QVIZ 3CR4X 1OE9B 2MA2A 3GK4X 1IQ3A 1KK7Z 4JQ0D 5CSFA 1A29A 2I94A 1MR8A 2DOQA 2RGIA 3EK7A 1QVIY 3SG3A 2KOTA 2MJWB 2COLB 4GGFA 4M2PA 1KWOB 2KAVA 4D1EA 1QS7A 2LMVA 1NX0A 3AKAA 1J55A 1G33A 1YR5A 3OHMB 1BG1A 3I5IC 3CGAA 2L5XB 1Y1AA 2JU0A 2H2KA 2NLNA 4MSPA 2V53A 4N1FA 2LC5A 2NCOA 1AP4A 2LAPA 1B8RA 2MLFC 1UHKA 2B1UA 2K7DA 1KSMA 5AEQA 3VRNA 4IL1A 1NX3A 2BCXA 2LMUA 2M9GA 4PHMA 3WXAA 1OOJA 2O5GA 2K7BA 4NQGA 4TNCA
chains in the Genus database with same CATH superfamily
1F4QA 1OMDA 3PN7B 1KFXL 1LA0A 4E68A 2L50A 3DYEA 2BE4A 3AAKA 2JT8A 1DJGA 3IQQA 1Q80A 3O2PA 2AAOA 2MBXA 4P5OE 1YUUA 1QX2A 1ALWA 3S0FA 1BJFA 1CLLA 2L0PA 1FBVA 4GNKB 1NPQA 2HQ8A 3SIAA 3FIAA 2I18A 2L51A 3A8RA 4NDDA 2M97A 4N1GA 1JFJA 1LVCD 1CDNA 1S3PA 1MXEA 2BCAA 1YTZC 2D8NA 2WC6A 4C0KA 2VRGA 1V1FA 2NCPA 1K9KA 2CTNA 3KO0A 3ZNIA 1LINA 2P6BB 4XJKA 3AAJA 3LCPC 4IJ7A 4YI8A 1QWVA 1K93D 1OOFA 2PALA 3OB1B 1YX7A 2Y1NA 3SG5A 1SW8A 1DF0A 1YRTB 1NP8A 5TNCA 1UP5A 1J7QA 1B4CA 1LKJA 1RK9A 1DT7B 1YURA 1TNPA 1DVIA 2H8VA 4MRXA 3EVUA 5FI6A 1IKUA 3ICBA 4JKTA 1CFPA 3A4UB 1U5IA 3I5HC 3OP0A 3SIBA 4N5XA 5J3XA 1HT9A 1SNLA 3I5IB 3FWCA 2WCHA 1XVJA 1S5GZ 1IG5A 1JBAA 1DJZA 2M1KB 5CSJA 2KI4C 3CABA 1CDMA 1SL8A 1SMGA 1M39A 3N7HA 3PM8A 3SS5A 4A4CA 3H4SE 2PASA 2WCFA 2F2PA 1YVLA 1AHRA 4YI9A 3TZ1A 1SSEB 1J1DA 2MHHA 3I5FC 1M45A 2GTEA 3KF9A 2L2EA 1SR6C 1XFUO 2JPTA 2KHNA 2L2CA 2QEBA 3TDZA 4PHKA 1CMFA 2WCMA 3D73A 3UO9A 3QMEA 2K8MB 1FPWA 1NX2A 1KQMC 1OZSA 2JT3A 4QJ5B 5EL2A 1VRKA 1PSRA 1CNPA 2LVJA 2KGBC 4F7FA 4XJKB 1NX1A 2BBMA 1WDCB 1ZMZA 1QASA 1DELA 2KI6D 5CSIA 3EVRA 3UNWA 3PLFB 2M7NA 2WCBA 1AJ4A 1DF0B 1GM0A 1UUSA 1V1GA 5GQQC 4WQ2A 2K61A 2LNKA 2LHLA 1YVHA 2HPSA 4ZCUA 4DRWA 2LLTA 5AERA 3NSIA 2OPOA 1TNXA 2LM5A 3CZ0A 1K94A 2HQWA 2SCPA 4M2OA 3I5GC 3DY9A 2E6WA 3DD4A 4YBHB 1K2HA 1MQ1A 1PRWA 1DC1A 4AOMA 1Y1XA 2M1UA 1D1OA 1ZFSA 3DZTA 1ODBA 1SCMC 2F2OA 3BJHA 1YUTA 3L4LA 4GPLB 1FF1A 1G8IA 2JTZA 4HREE 2KDHA 2KFHA 3BFHA 5F6TA 1K9UA 1DJIA 3OX5A 4C0JA 4YGEB 1KK7Y 1Y6WA 3DF0A 4PDZA 3L47A 1R2UA 2FOTA 5I2QA 1L2OC 4P2YB 1NCYA 1AUIB 1QATA 3IQOA 1TOPA 3I5HB 3NGVA 4YGBB 1XFYO 2JQ6A 1YRUB 2KAXA 2BBNA 3R72A 2EC6C 3F45A 2QDIA 1DJHA 2KI4B 2PQLA 2FCEA 1MUXA 3D78A 4F0ZB 2HF5A 1QXPA 2BAPA 3DVKA 2P70A 3I5FB 1CFCA 1K95A 1SR6B 1CLBA 3AKBA 1AK8A 3NHTA 3TS5C 3O6BA 3Q8IA 1KQMB 3HX4A 3LK1A 3ZWHA 1UHNA 5AANA 5HLVA 3KPXA 3D10A 1C7VA 3TUYB 2KBIA 1GQMA 5JJGA 3DVMA 4I5LB 4CPVA 1XFXO 1WY9A 4FQTA 5I2OA 1A4PA 1RTP1 1UHIA 5D7FA 4I5JA 1M31A 2KFGA 2G2BA 1WRLA 3CR5X 2JT0A 3EVVA 4OR9B 3RLZA 1B8LA 1SY9A 2JC2A 4BY4A 2KNEA 2ERBA 4DS7A 1A75A 5DKNA 1H4BA 5G08A 2BE6A 1SPYA 2ZNDA 3IVTA 3PM2A 4USLA 2CNPA 5I8NA 1LXFC 2KAYA 1TTXA 5AXIA 2GV5A 4GFTA 1SK6D 2LVKA 3JTDC 3I5GB 2LE9B 4JWQA 2JXLA 1YX8A 4PT1A 1N2DA 2BECA 5HYDA 1QLSA 5I94A 1IGVA 2PYQA 1TNQA 1MXLC 4CFQA 5HKYA 4ORAB 1FI5A 1DGVA 3EKJA 3LLEA 2LHIA 2WCEA 2ZN9A 5AFPA 1Y0VH 3O78A 2LP3A 1GGZA 1S6IA 3R1OA 1CM4A 1EXRA 1IJ5A 1R6PA 2G9BA 1L2OB 3CR2A 2BKHB 3D0YA 3BOWA 2KYCA 2PRUA 3K1EA 1CB1A 3B88A 2KFFA 1TUJA 4DUQA 4ICBA 4CLNA 1XFVO 1UURA 1KSOA 2NXQA 3DVEA 4MZJA 1F4OA 4FTGA 1W7IB 3KEVA 1B7TZ 2PMYA 3BXKA 2NZ0A 1ZACA 1TWOA 1EJ3A 3D76A 4OKHA 1BU3A 1S5GY 4XYNA 3FWBA 1WLMA 2KYFA 4PCWA 5DKQA 1KFXS 2LLSA 5JOLA 3NSKA 2TN4A 1F71A 5ER4X 3SG7A 2BKIB 1QLKA 4JPZB 3OGNA 1DJYA 1G4YR 5CPVA 1C07A 2K2AA 1NSHA 2KQ6A 3FE8A 1FI6A 4FQOA 1QV1A 4ZCVA 1PULA 1NUBA 4DIRA 4PE4A 3VROA 1BR1B 1XA5A 1C3YA 1OOHA 5KTYA 1QV0A 2K2FA 2IS9A 3SS3A 2L4HA 2MRDA 3BUWB 2QEOA 1CLMA 2K7CA 1J7OA 3CDNA 4MN0A 1OZOA 1W7JB 5HLOA 1BLQA 1DMOA 2LCPA 3D74A 1NCXA 2KLDA 2I7AA 3D77A 3HCMA 4PALA 5FI7A 1LA3A 1P28A 2M8UA 3IF7A 2JZIA 1CMGA 2WOSA 1H8BA 1IRJA 1U5IB 3SJSA 1OQPA 2FCDA 1AJ5A 1YUSA 3JTDB 2A4JA 1CFDA 2JULA 3BUNB 3NXAA 3B86A 3S0BA 1F70A 1OSAA 1IIOA 1QX7A 3O4YA 3GK1A 2AUCA 3OB2B 1AVSA 1MF8B 1QIVA 1SKTA 3GOFA 1L7ZA 4PE1A 1Y1UA 1EG4A 4CIDA 1CTRA 3BYAA 4MBEA 5HL1A 1JC2A 1DJXA 1CDPA 4MRYA 3DVJA 2M7LA 1WRZA 4M2QA 1XYDA 2LV7A 1GJYA 2KLEA 1K8UA 4NDBA 3BUXB 5HKZA 1J1EA 2MLEC 3B7AA 3FE6A 5D3OA 3R1VA 3KHEA 1KK8C 5I2LA 1PVBA 1F54A 3WNXB 4I5NB 2F3ZA 2I2RE 1DEKA 2M49B 4MVFA 4AQJA 2WC8A 2O60A 3VB1A 1OOIX 1DJWA 4PE0A 1C7WA 1J7RA 1S6CA 3DXLA 4I5KA 3S0GA 5FI2A 2JPOA 2ZKMX 1XK4C 1SL9A 3CZ2A 2ZN8A 5CSNA 1UWOA 3WHTB 3EK8A 2F3YA 4PHJA 1EG3A 1RJVA 1S36A 3NHIA 4A4BA 4INXA 5DKRA 3CTNA 1ORGA 1SBJA 2JOJA 1BR4B 1BOCA 2CXJA 2LANA 3CLNA 1EH2A 1PSBA 3JVTC 3VRQA 1TIZA 1M46A 1BMOA 4HRHA 1TN4A 1A03A 2L98A 4OCIA 4CFRA 3VRRA 2ZRTA 4HRGA 2WCJA 2MAZA 4NDCA 3PSRA 2Y5IA 5KSZA 1K96A 3WHUB 2HETA 3PATA 1JUOA 3PFVA 4HSZA 2GGMA 4BY5A 1RROA 3GK2A 4MLWA 1B9AA 1QX5B 1SL7A 1C3ZA 1TCOB 2KQYA 5ER5A 1PK0D 1XK4A 4ETOA 2SASA 3DF0B 1SCVA 1RFJA 3R1PA 3C1VA 4AQIA 2ZFDA 1NWDA 2QACA 3EG5B 5B8IB 4GBAA 4ORBB 2QEVA 3M0WA 4C0LA 4MZLA 2LUXA 2KGRA 1WDCC 3FE9A 3OX6A 4QJ4B 1UHHA 1K90D 4UPGA 3LL8B 4MEWA 4U8DA 5HKWA 1RWYA 3NSOA 1SCMB 2CBLA 2LVVA 2WORA 3VGOA 1B47A 4OV2A 2ISDA 1CM1A 2KI6C 3D75A 1NCZA 1DQEA 1J7PA 1DTLA 2WNDA 2L4IA 2Y4QA 3CZTX 1NIWA 2FJUB 2JTTA 3L4AA 4OZDA 2KPHA 1NYAA 5PALA 1XFZO 1KK8B 1KFUL 2Q91A 2JNXA 2FJYA 2LMTA 3NSLA 4R1EA 2K0JA 1BF5A 1WRKA 2BCBA 1IQ5A 2EC6B 2JXCA 1XO5A 1SYMA 1K9PA 2OS8C 2PVBA 4GGNA 5BPJA 2OTGC 2JWWA 1QJTA 3O4XA 1EL4A 3BQ3A 2BL0C 3SG4A 1PALA 1B7TY 1F8HA 2JRFA 3CYZA 2YGUA 1WLZA 1HQVA 1A75B 1XFWO 3TDIA 1OOGA 2P71A 1BT6A 3BUOB 2H61C 1GGWA 5D69A 3TS5B 1JWDA 1TUZA 2R2IA 4KYNA 2Q4UA 1KWOC 3S0AA 5IBWA 2PSRA 1JF0A 1A2XA 4YRUA 1JF2A 3QRXA 2LUCA 3E3RA 1ZUZA 3JVTB 2F33A 5FYXA 1MWNA 2M0RA 4DCKA 1TNWA 3TDUA 4MZKA 1S6JA 2KBMA 2M29A 5K89A 1XFRA 1M63B 1JFKA 1OMVA 2CCMA 4YGDB 1OMRA 3LK0A 1ALVA 3K21A 1W9ZA 2ZRSA 1CDLA 2K7OA 2LVIA 1X02A 5KU1A 4GUKA 4Q04A 1QIWA 1JSAA 4YGAA 2H61A 1PVAA 3EK4A 2AMIA 3BUMB 3D0YB 2KSPA 3BOWB 1CKKA 1UHJA 1Z2CB 1FW4A 3CWGA 4OVNF 3PN7C 3SS4A 4WRIA 3CZ1A 3TUYC 1CFFA 2EHBA 3V2LA 1N65A 2QPTA 2M3WA 3RZSA 3S0EA 3BFBA 1TRFA 2CT9A 3SG2A 1SRAA 2F8PA 3RM1A 3MSEB 3PALA 4QJ3B 1KCYA 1E8AA 1IH0A 1B8CA 2ZNEA 1KFUS 1B1GA 3VRPA 1ZOTB 3B87A 3OBVA 4YGCB 1MHOA 2WCLA 2Y1MA 3FS7A 4GGFC 4PHNA 2JNFA 4GAOA 1DGUA 1KQVA 1QTXA 4WQ3A 2E30A 2LP2A 2GGZA 2EGDA 1BODA 4L9MA 3B6XA 2L5YA 3CS1A 2BNXA 1S1EA 1RECA 1S26D 2OS8B 2WC5A 4INWA 2OTGB 4PE7A 1F55A 2LLUA 1IJ6A 2BL0B 4ORCB 3SG6A 3EKHA 1IWQA 1TCFA 1N0YA 1QVIZ 3CR4X 1OE9B 2MA2A 3GK4X 1IQ3A 1KK7Z 5DICA 4JQ0D 5CSFA 1A29A 2I94A 1MR8A 2DOQA 2RGIA 3EK7A 3PJIA 1QVIY 3SG3A 1T14A 2KOTA 2MJWB 2COLB 4GGFA 4M2PA 2QEHA 1Z4HA 1KWOB 2KAVA 4D1EA 1QS7A 2LMVA 1NX0A 3AKAA 1J55A 1G33A 2WCKA 1YR5A 3OHMB 4JD9A 1BG1A 3I5IC 3CGAA 2L5XB 1Y1AA 2JU0A 2H2KA 2NLNA 4MSPA 2V53A 4N1FA 2LC5A 2NCOA 1AP4A 2LAPA 1B8RA 2MLFC 1UHKA 2B1UA 1LS8A 2K7DA 1OW4A 1KSMA 5AEQA 3S0DA 3VRNA 4IL1A 3BFAA 1NX3A 2BCXA 2LMUA 2K60A 2M9GA 4PHMA 3WXAA 1OOJA 2O5GA 2K7BA 4NQGA 4TNCA
chains in the Genus database with same CATH topology
1F4QA 1OMDA 3PN7B 1KFXL 1LA0A 2L50A 2BE4A 3AAKA 2JT8A 1DJGA 3IQQA 1Q80A 3O2PA 2AAOA 2MBXA 4P5OE 1YUUA 1QX2A 1ALWA 1BJFA 1CLLA 2L0PA 1FBVA 4GNKB 1NPQA 2HQ8A 3SIAA 3FIAA 2I18A 2L51A 3A8RA 4NDDA 2M97A 4N1GA 1JFJA 1LVCD 1CDNA 1S3PA 1MXEA 2BCAA 1YTZC 2D8NA 4C0KA 2VRGA 1V1FA 2NCPA 1K9KA 2CTNA 3KO0A 3ZNIA 1LINA 2P6BB 4XJKA 3AAJA 3LCPC 4YI8A 1K93D 2PALA 3OB1B 1YX7A 2Y1NA 3SG5A 1SW8A 1DF0A 1YRTB 1NP8A 5TNCA 1UP5A 1J7QA 1B4CA 1LKJA 1RK9A 1DT7B 1YURA 1TNPA 1DVIA 4MRXA 3EVUA 1IKUA 3ICBA 1CFPA 3A4UB 1U5IA 3I5HC 3OP0A 3SIBA 4N5XA 5J3XA 1HT9A 1SNLA 3I5IB 3FWCA 1XVJA 1S5GZ 1IG5A 1JBAA 1DJZA 2M1KB 5CSJA 2KI4C 3PM8A 1CDMA 1SL8A 1SMGA 1M39A 4A4CA 3H4SE 2PASA 2WCFA 2F2PA 1YVLA 1AHRA 4YI9A 3TZ1A 1J1DA 2MHHA 3I5FC 1M45A 3KF9A 2L2EA 1SR6C 1XFUO 2JPTA 2KHNA 1CMFA 3TDZA 4PHKA 2K8MB 1FPWA 1NX2A 1KQMC 1OZSA 2JT3A 4QJ5B 1VRKA 1PSRA 1CNPA 2LVJA 2KGBC 4XJKB 1NX1A 2BBMA 1WDCB 1ZMZA 1QASA 2KI6D 5CSIA 3EVRA 3PLFB 2M7NA 2WCBA 1AJ4A 1DF0B 1UUSA 1V1GA 5GQQC 4WQ2A 2K61A 2LNKA 2LHLA 1YVHA 2HPSA 4ZCUA 4DRWA 2LLTA 5AERA 3NSIA 2OPOA 1TNXA 2LM5A 1K94A 2HQWA 2SCPA 4M2OA 3I5GC 2E6WA 3DD4A 4YBHB 1K2HA 1MQ1A 1PRWA 4AOMA 1Y1XA 2M1UA 1D1OA 1ZFSA 1ODBA 1SCMC 2F2OA 4GPLB 1YUTA 1FF1A 1G8IA 2JTZA 4HREE 2KDHA 2KFHA 5F6TA 1K9UA 1DJIA 3OX5A 4C0JA 4YGEB 1KK7Y 1Y6WA 3DF0A 4PDZA 1R2UA 2FOTA 5I2QA 1L2OC 4P2YB 1NCYA 1AUIB 1QATA 3IQOA 1TOPA 3I5HB 4YGBB 1XFYO 2JQ6A 1YRUB 2KAXA 2BBNA 2EC6C 3F45A 1DJHA 2KI4B 2FCEA 1MUXA 4F0ZB 2HF5A 1QXPA 3DVKA 3I5FB 1CFCA 1K95A 1SR6B 1CLBA 3AKBA 1AK8A 3TS5C 3O6BA 1KQMB 3HX4A 3LK1A 3ZWHA 1UHNA 5AANA 5HLVA 3KPXA 3D10A 1C7VA 3TUYB 2KBIA 1GQMA 5JJGA 3DVMA 4I5LB 4CPVA 1XFXO 1WY9A 5I2OA 1A4PA 1RTP1 1UHIA 5D7FA 4I5JA 1M31A 2KFGA 2G2BA 1WRLA 3CR5X 2JT0A 3EVVA 4OR9B 3RLZA 1B8LA 1SY9A 2JC2A 4BY4A 2KNEA 4DS7A 1A75A 5DKNA 1H4BA 5G08A 2BE6A 1SPYA 2ZNDA 4USLA 2CNPA 5I8NA 1LXFC 2KAYA 1TTXA 5AXIA 2GV5A 4GFTA 1SK6D 2LVKA 3JTDC 3I5GB 2LE9B 4JWQA 2JXLA 1YX8A 1N2DA 2BECA 5HYDA 1QLSA 1IGVA 1TNQA 1MXLC 4CFQA 5HKYA 4ORAB 1FI5A 1DGVA 3EKJA 3LLEA 2LHIA 2WCEA 2ZN9A 5AFPA 1Y0VH 3O78A 2LP3A 1GGZA 1S6IA 1CM4A 1EXRA 1IJ5A 1R6PA 2G9BA 1L2OB 3CR2A 2BKHB 3D0YA 3BOWA 2KYCA 2PRUA 1CB1A 2KFFA 4DUQA 4ICBA 4CLNA 1XFVO 1UURA 1KSOA 2NXQA 3DVEA 4MZJA 1F4OA 4FTGA 1W7IB 3KEVA 1B7TZ 2PMYA 3BXKA 2NZ0A 1ZACA 1EJ3A 4OKHA 1BU3A 1S5GY 4XYNA 3FWBA 1WLMA 2KYFA 4PCWA 5DKQA 1KFXS 2LLSA 5JOLA 3NSKA 2TN4A 1F71A 5ER4X 3SG7A 2BKIB 1QLKA 4JPZB 1DJYA 1G4YR 5CPVA 1C07A 2K2AA 1NSHA 2KQ6A 1FI6A 4FQOA 1QV1A 4ZCVA 1PULA 1NUBA 4DIRA 4PE4A 3VROA 1BR1B 1XA5A 5KTYA 1QV0A 2K2FA 2IS9A 2L4HA 2MRDA 3BUWB 1CLMA 2K7CA 1J7OA 4MN0A 1OZOA 1W7JB 5HLOA 1BLQA 1DMOA 2LCPA 1NCXA 2I7AA 4PALA 3HCMA 1LA3A 3IF7A 2M8UA 1CMGA 2JZIA 2WOSA 1H8BA 1IRJA 1U5IB 3SJSA 1OQPA 2FCDA 1AJ5A 1YUSA 3JTDB 2A4JA 1CFDA 2JULA 3BUNB 3NXAA 1F70A 1OSAA 1QX7A 3O4YA 3GK1A 2AUCA 3OB2B 1AVSA 1MF8B 1QIVA 1SKTA 3GOFA 1L7ZA 4PE1A 1Y1UA 1EG4A 4CIDA 1CTRA 3BYAA 4MBEA 1JC2A 1DJXA 1CDPA 4MRYA 3DVJA 2M7LA 1WRZA 4M2QA 1XYDA 2LV7A 1GJYA 4NDBA 1K8UA 3BUXB 5HKZA 1J1EA 2MLEC 4E68A 3KHEA 1KK8C 5I2LA 1PVBA 1F54A 3WNXB 4I5NB 2F3ZA 2I2RE 2M49B 4MVFA 4AQJA 2WC8A 2O60A 1DJWA 4PE0A 1C7WA 1J7RA 1S6CA 4I5KA 2ZKMX 1XK4C 1SL9A 2ZN8A 5CSNA 1UWOA 3WHTB 3EK8A 2F3YA 4PHJA 1EG3A 1RJVA 1S36A 4A4BA 5DKRA 3CTNA 1SBJA 2JOJA 1BR4B 1BOCA 2CXJA 2LANA 3CLNA 1EH2A 1PSBA 3JVTC 3VRQA 1TIZA 1M46A 1BMOA 4HRHA 1TN4A 1A03A 2L98A 4OCIA 4CFRA 3VRRA 2ZRTA 4HRGA 2MAZA 4NDCA 3PSRA 2Y5IA 5KSZA 1K96A 3WHUB 2HETA 3PATA 1JUOA 3PFVA 4HSZA 2GGMA 4BY5A 1RROA 3GK2A 4MLWA 1B9AA 1QX5B 1SL7A 5ER5A 1TCOB 2KQYA 4ETOA 1PK0D 1XK4A 2SASA 3DF0B 1SCVA 1RFJA 3C1VA 4AQIA 2ZFDA 1NWDA 2QACA 5B8IB 4GBAA 4ORBB 3M0WA 4C0LA 4MZLA 2LUXA 2KGRA 1WDCC 4QJ4B 3OX6A 1UHHA 1K90D 4UPGA 3LL8B 4MEWA 4U8DA 5HKWA 1RWYA 3NSOA 1SCMB 2CBLA 2LVVA 2WORA 3VGOA 1B47A 4OV2A 2ISDA 1CM1A 2KI6C 1NCZA 1J7PA 1DTLA 2WNDA 2L4IA 2Y4QA 3CZTX 1NIWA 2FJUB 2JTTA 1NYAA 5PALA 1XFZO 1KK8B 1KFUL 2Q91A 2JNXA 2LMTA 3NSLA 4R1EA 2K0JA 1BF5A 2BCBA 1WRKA 1IQ5A 2EC6B 2JXCA 1XO5A 1SYMA 1K9PA 2OS8C 2PVBA 4GGNA 5BPJA 2OTGC 2JWWA 1QJTA 1EL4A 3BQ3A 2BL0C 3SG4A 1PALA 1B7TY 1F8HA 2JRFA 1WLZA 1HQVA 1A75B 1XFWO 3TDIA 1BT6A 3BUOB 2H61C 1GGWA 5D69A 3TS5B 1JWDA 2R2IA 2Q4UA 1KWOC 5IBWA 2PSRA 1JF0A 1A2XA 4YRUA 1JF2A 3QRXA 2LUCA 3E3RA 1ZUZA 3JVTB 2F33A 5FYXA 1MWNA 2M0RA 4DCKA 1TNWA 3TDUA 4MZKA 1S6JA 2KBMA 2M29A 5K89A 1M63B 1JFKA 1OMVA 2CCMA 4YGDB 1OMRA 3LK0A 1ALVA 3K21A 2ZRSA 1CDLA 2K7OA 2LVIA 1X02A 5KU1A 4GUKA 4Q04A 1QIWA 1JSAA 4YGAA 2H61A 1PVAA 3EK4A 2AMIA 3BUMB 3D0YB 2KSPA 3BOWB 1CKKA 1UHJA 1FW4A 3CWGA 4OVNF 3PN7C 4WRIA 3TUYC 1CFFA 2EHBA 1N65A 2QPTA 2M3WA 1TRFA 2CT9A 3SG2A 1SRAA 2F8PA 3RM1A 3MSEB 3PALA 4QJ3B 1KCYA 1E8AA 1IH0A 1B8CA 2ZNEA 1KFUS 1B1GA 3VRPA 1ZOTB 4YGCB 1MHOA 1KQVA 2Y1MA 3FS7A 4GGFC 4PHNA 2JNFA 4GAOA 1DGUA 1QTXA 4WQ3A 2E30A 2LP2A 2GGZA 2EGDA 1BODA 4L9MA 3CS1A 1S1EA 1RECA 1S26D 2OS8B 2OTGB 4PE7A 1F55A 2LLUA 1IJ6A 2BL0B 4ORCB 3SG6A 3EKHA 1IWQA 1TCFA 1N0YA 1QVIZ 3CR4X 1OE9B 2MA2A 3GK4X 1IQ3A 1KK7Z 4JQ0D 5CSFA 1A29A 2I94A 1MR8A 2DOQA 2RGIA 3EK7A 1QVIY 3SG3A 2KOTA 2MJWB 2COLB 4GGFA 4M2PA 1KWOB 2KAVA 4D1EA 1QS7A 2LMVA 1NX0A 3AKAA 1J55A 1G33A 1YR5A 3OHMB 1BG1A 3I5IC 3CGAA 2L5XB 1Y1AA 2JU0A 2H2KA 2NLNA 4MSPA 2V53A 4N1FA 2LC5A 2NCOA 1AP4A 2LAPA 1B8RA 2MLFC 1UHKA 2B1UA 2K7DA 1KSMA 5AEQA 3VRNA 4IL1A 1NX3A 2BCXA 2LMUA 2M9GA 4PHMA 3WXAA 1OOJA 2O5GA 2K7BA 4NQGA 4TNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4Q A;  1OMD A;  3PN7 B;  1KFX L;  1LA0 A;  2L50 A;  2BE4 A;  3AAK A;  2JT8 A;  1DJG A;  3IQQ A;  1Q80 A;  3O2P A;  2AAO A;  2MBX A;  4P5O E;  1YUU A;  1QX2 A;  1ALW A;  1BJF A;  1CLL A;  2L0P A;  1FBV A;  4GNK B;  1NPQ A;  2HQ8 A;  3SIA A;  3FIA A;  2I18 A;  2L51 A;  3A8R A;  4NDD A;  2M97 A;  4N1G A;  1JFJ A;  1LVC D;  1CDN A;  1S3P A;  1MXE A;  2BCA A;  1YTZ C;  2D8N A;  4C0K A;  2VRG A;  1V1F A;  2NCP A;  1K9K A;  2CTN A;  3KO0 A;  3ZNI A;  1LIN A;  2P6B B;  4XJK A;  3AAJ A;  3LCP C;  4YI8 A;  1K93 D;  2PAL A;  3OB1 B;  1YX7 A;  2Y1N A;  3SG5 A;  1SW8 A;  1DF0 A;  1YRT B;  1NP8 A;  5TNC A;  1UP5 A;  1J7Q A;  1B4C A;  1LKJ A;  1RK9 A;  1DT7 B;  1YUR A;  1TNP A;  1DVI A;  4MRX A;  3EVU A;  1IKU A;  3ICB A;  1CFP A;  3A4U B;  1U5I A;  3I5H C;  3OP0 A;  3SIB A;  4N5X A;  5J3X A;  1HT9 A;  1SNL A;  3I5I B;  3FWC A;  1XVJ A;  1S5G Z;  1IG5 A;  1JBA A;  1DJZ A;  2M1K B;  5CSJ A;  2KI4 C;  3PM8 A;  1CDM A;  1SL8 A;  1SMG A;  1M39 A;  4A4C A;  3H4S E;  2PAS A;  2WCF A;  2F2P A;  1YVL A;  1AHR A;  4YI9 A;  3TZ1 A;  1J1D A;  2MHH A;  3I5F C;  1M45 A;  3KF9 A;  2L2E A;  1SR6 C;  1XFU O;  2JPT A;  2KHN A;  1CMF A;  3TDZ A;  4PHK A;  2K8M B;  1FPW A;  1NX2 A;  1KQM C;  1OZS A;  2JT3 A;  4QJ5 B;  1VRK A;  1PSR A;  1CNP A;  2LVJ A;  2KGB C;  4XJK B;  1NX1 A;  2BBM A;  1WDC B;  1ZMZ A;  1QAS A;  2KI6 D;  5CSI A;  3EVR A;  3PLF B;  2M7N A;  2WCB A;  1AJ4 A;  1DF0 B;  1UUS A;  1V1G A;  5GQQ C;  4WQ2 A;  2K61 A;  2LNK A;  2LHL A;  1YVH A;  2HPS A;  4ZCU A;  4DRW A;  2LLT A;  5AER A;  3NSI A;  2OPO A;  1TNX A;  2LM5 A;  1K94 A;  2HQW A;  2SCP A;  4M2O A;  3I5G C;  2E6W A;  3DD4 A;  4YBH B;  1K2H A;  1MQ1 A;  1PRW A;  4AOM A;  1Y1X A;  2M1U A;  1D1O A;  1ZFS A;  1ODB A;  1SCM C;  2F2O A;  4GPL B;  1YUT A;  1FF1 A;  1G8I A;  2JTZ A;  4HRE E;  2KDH A;  2KFH A;  5F6T A;  1K9U A;  1DJI A;  3OX5 A;  4C0J A;  4YGE B;  1KK7 Y;  1Y6W A;  3DF0 A;  4PDZ A;  1R2U A;  2FOT A;  5I2Q A;  1L2O C;  4P2Y B;  1NCY A;  1AUI B;  1QAT A;  3IQO A;  1TOP A;  3I5H B;  4YGB B;  1XFY O;  2JQ6 A;  1YRU B;  2KAX A;  2BBN A;  2EC6 C;  3F45 A;  1DJH A;  2KI4 B;  2FCE A;  1MUX A;  4F0Z B;  2HF5 A;  1QXP A;  3DVK A;  3I5F B;  1CFC A;  1K95 A;  1SR6 B;  1CLB A;  3AKB A;  1AK8 A;  3TS5 C;  3O6B A;  1KQM B;  3HX4 A;  3LK1 A;  3ZWH A;  1UHN A;  5AAN A;  5HLV A;  3KPX A;  3D10 A;  1C7V A;  3TUY B;  2KBI A;  1GQM A;  5JJG A;  3DVM A;  4I5L B;  4CPV A;  1XFX O;  1WY9 A;  5I2O A;  1A4P A;  1RTP 1;  1UHI A;  5D7F A;  4I5J A;  1M31 A;  2KFG A;  2G2B A;  1WRL A;  3CR5 X;  2JT0 A;  3EVV A;  4OR9 B;  3RLZ A;  1B8L A;  1SY9 A;  2JC2 A;  4BY4 A;  2KNE A;  4DS7 A;  1A75 A;  5DKN A;  1H4B A;  5G08 A;  2BE6 A;  1SPY A;  2ZND A;  4USL A;  2CNP A;  5I8N A;  1LXF C;  2KAY A;  1TTX A;  5AXI A;  2GV5 A;  4GFT A;  1SK6 D;  2LVK A;  3JTD C;  3I5G B;  2LE9 B;  4JWQ A;  2JXL A;  1YX8 A;  1N2D A;  2BEC A;  5HYD A;  1QLS A;  1IGV A;  1TNQ A;  1MXL C;  4CFQ A;  5HKY A;  4ORA B;  1FI5 A;  1DGV A;  3EKJ A;  3LLE A;  2LHI A;  2WCE A;  2ZN9 A;  5AFP A;  1Y0V H;  3O78 A;  2LP3 A;  1GGZ A;  1S6I A;  1CM4 A;  1EXR A;  1IJ5 A;  1R6P A;  2G9B A;  1L2O B;  3CR2 A;  2BKH B;  3D0Y A;  3BOW A;  2KYC A;  2PRU A;  1CB1 A;  2KFF A;  4DUQ A;  4ICB A;  4CLN A;  1XFV O;  1UUR A;  1KSO A;  2NXQ A;  3DVE A;  4MZJ A;  1F4O A;  4FTG A;  1W7I B;  3KEV A;  1B7T Z;  2PMY A;  3BXK A;  2NZ0 A;  1ZAC A;  1EJ3 A;  4OKH A;  1BU3 A;  1S5G Y;  4XYN A;  3FWB A;  1WLM A;  2KYF A;  4PCW A;  5DKQ A;  1KFX S;  2LLS A;  5JOL A;  3NSK A;  2TN4 A;  1F71 A;  5ER4 X;  3SG7 A;  2BKI B;  1QLK A;  4JPZ B;  1DJY A;  1G4Y R;  5CPV A;  1C07 A;  2K2A A;  1NSH A;  2KQ6 A;  1FI6 A;  4FQO A;  1QV1 A;  4ZCV A;  1PUL A;  1NUB A;  4DIR A;  4PE4 A;  3VRO A;  1BR1 B;  1XA5 A;  5KTY A;  1QV0 A;  2K2F A;  2IS9 A;  2L4H A;  2MRD A;  3BUW B;  1CLM A;  2K7C A;  1J7O A;  4MN0 A;  1OZO A;  1W7J B;  5HLO A;  1BLQ A;  1DMO A;  2LCP A;  1NCX A;  2I7A A;  4PAL A;  3HCM A;  1LA3 A;  3IF7 A;  2M8U A;  1CMG A;  2JZI A;  2WOS A;  1H8B A;  1IRJ A;  1U5I B;  3SJS A;  1OQP A;  2FCD A;  1AJ5 A;  1YUS A;  3JTD B;  2A4J A;  1CFD A;  2JUL A;  3BUN B;  3NXA A;  1F70 A;  1OSA A;  1QX7 A;  3O4Y A;  3GK1 A;  2AUC A;  3OB2 B;  1AVS A;  1MF8 B;  1QIV A;  1SKT A;  3GOF A;  1L7Z A;  4PE1 A;  1Y1U A;  1EG4 A;  4CID A;  1CTR A;  3BYA A;  4MBE A;  1JC2 A;  1DJX A;  1CDP A;  4MRY A;  3DVJ A;  2M7L A;  1WRZ A;  4M2Q A;  1XYD A;  2LV7 A;  1GJY A;  4NDB A;  1K8U A;  3BUX B;  5HKZ A;  1J1E A;  2MLE C;  4E68 A;  3KHE A;  1KK8 C;  5I2L A;  1PVB A;  1F54 A;  3WNX B;  4I5N B;  2F3Z A;  2I2R E;  2M49 B;  4MVF A;  4AQJ A;  2WC8 A;  2O60 A;  1DJW A;  4PE0 A;  1C7W A;  1J7R A;  1S6C A;  4I5K A;  2ZKM X;  1XK4 C;  1SL9 A;  2ZN8 A;  5CSN A;  1UWO A;  3WHT B;  3EK8 A;  2F3Y A;  4PHJ A;  1EG3 A;  1RJV A;  1S36 A;  4A4B A;  5DKR A;  3CTN A;  1SBJ A;  2JOJ A;  1BR4 B;  1BOC A;  2CXJ A;  2LAN A;  3CLN A;  1EH2 A;  1PSB A;  3JVT C;  3VRQ A;  1TIZ A;  1M46 A;  1BMO A;  4HRH A;  1TN4 A;  1A03 A;  2L98 A;  4OCI A;  4CFR A;  3VRR A;  2ZRT A;  4HRG A;  2MAZ A;  4NDC A;  3PSR A;  2Y5I A;  5KSZ A;  1K96 A;  3WHU B;  2HET A;  3PAT A;  1JUO A;  3PFV A;  4HSZ A;  2GGM A;  4BY5 A;  1RRO A;  3GK2 A;  4MLW A;  1B9A A;  1QX5 B;  1SL7 A;  5ER5 A;  1TCO B;  2KQY A;  4ETO A;  1PK0 D;  1XK4 A;  2SAS A;  3DF0 B;  1SCV A;  1RFJ A;  3C1V A;  4AQI A;  2ZFD A;  1NWD A;  2QAC A;  5B8I B;  4GBA A;  4ORB B;  3M0W A;  4C0L A;  4MZL A;  2LUX A;  2KGR A;  1WDC C;  4QJ4 B;  3OX6 A;  1UHH A;  1K90 D;  4UPG A;  3LL8 B;  4MEW A;  4U8D A;  5HKW A;  1RWY A;  3NSO A;  1SCM B;  2CBL A;  2LVV A;  2WOR A;  3VGO A;  1B47 A;  4OV2 A;  2ISD A;  1CM1 A;  2KI6 C;  1NCZ A;  1J7P A;  1DTL A;  2WND A;  2L4I A;  2Y4Q A;  3CZT X;  1NIW A;  2FJU B;  2JTT A;  1NYA A;  5PAL A;  1XFZ O;  1KK8 B;  1KFU L;  2Q91 A;  2JNX A;  2LMT A;  3NSL A;  4R1E A;  2K0J A;  1BF5 A;  2BCB A;  1WRK A;  1IQ5 A;  2EC6 B;  2JXC A;  1XO5 A;  1SYM A;  1K9P A;  2OS8 C;  2PVB A;  4GGN A;  5BPJ A;  2OTG C;  2JWW A;  1QJT A;  1EL4 A;  3BQ3 A;  2BL0 C;  3SG4 A;  1PAL A;  1B7T Y;  1F8H A;  2JRF A;  1WLZ A;  1HQV A;  1A75 B;  1XFW O;  3TDI A;  1BT6 A;  3BUO B;  2H61 C;  1GGW A;  5D69 A;  3TS5 B;  1JWD A;  2R2I A;  2Q4U A;  1KWO C;  5IBW A;  2PSR A;  1JF0 A;  1A2X A;  4YRU A;  1JF2 A;  3QRX A;  2LUC A;  3E3R A;  1ZUZ A;  3JVT B;  2F33 A;  5FYX A;  1MWN A;  2M0R A;  4DCK A;  1TNW A;  3TDU A;  4MZK A;  1S6J A;  2KBM A;  2M29 A;  5K89 A;  1M63 B;  1JFK A;  1OMV A;  2CCM A;  4YGD B;  1OMR A;  3LK0 A;  1ALV A;  3K21 A;  2ZRS A;  1CDL A;  2K7O A;  2LVI A;  1X02 A;  5KU1 A;  4GUK A;  4Q04 A;  1QIW A;  1JSA A;  4YGA A;  2H61 A;  1PVA A;  3EK4 A;  2AMI A;  3BUM B;  3D0Y B;  2KSP A;  3BOW B;  1CKK A;  1UHJ A;  1FW4 A;  3CWG A;  4OVN F;  3PN7 C;  4WRI A;  3TUY C;  1CFF A;  2EHB A;  1N65 A;  2QPT A;  2M3W A;  1TRF A;  2CT9 A;  3SG2 A;  1SRA A;  2F8P A;  3RM1 A;  3MSE B;  3PAL A;  4QJ3 B;  1KCY A;  1E8A A;  1IH0 A;  1B8C A;  2ZNE A;  1KFU S;  1B1G A;  3VRP A;  1ZOT B;  4YGC B;  1MHO A;  1KQV A;  2Y1M A;  3FS7 A;  4GGF C;  4PHN A;  2JNF A;  4GAO A;  1DGU A;  1QTX A;  4WQ3 A;  2E30 A;  2LP2 A;  2GGZ A;  2EGD A;  1BOD A;  4L9M A;  3CS1 A;  1S1E A;  1REC A;  1S26 D;  2OS8 B;  2OTG B;  4PE7 A;  1F55 A;  2LLU A;  1IJ6 A;  2BL0 B;  4ORC B;  3SG6 A;  3EKH A;  1IWQ A;  1TCF A;  1N0Y A;  1QVI Z;  3CR4 X;  1OE9 B;  2MA2 A;  3GK4 X;  1IQ3 A;  1KK7 Z;  4JQ0 D;  5CSF A;  1A29 A;  2I94 A;  1MR8 A;  2DOQ A;  2RGI A;  3EK7 A;  1QVI Y;  3SG3 A;  2KOT A;  2MJW B;  2COL B;  4GGF A;  4M2P A;  1KWO B;  2KAV A;  4D1E A;  1QS7 A;  2LMV A;  1NX0 A;  3AKA A;  1J55 A;  1G33 A;  1YR5 A;  3OHM B;  1BG1 A;  3I5I C;  3CGA A;  2L5X B;  1Y1A A;  2JU0 A;  2H2K A;  2NLN A;  4MSP A;  2V53 A;  4N1F A;  2LC5 A;  2NCO A;  1AP4 A;  2LAP A;  1B8R A;  2MLF C;  1UHK A;  2B1U A;  2K7D A;  1KSM A;  5AEQ A;  3VRN A;  4IL1 A;  1NX3 A;  2BCX A;  2LMU A;  2M9G A;  4PHM A;  3WXA A;  1OOJ A;  2O5G A;  2K7B A;  4NQG A;  4TNC A; 
#chains in the Genus database with same CATH topology
 1F4Q A;  1OMD A;  3PN7 B;  1KFX L;  1LA0 A;  4E68 A;  2L50 A;  3DYE A;  2BE4 A;  3AAK A;  2JT8 A;  1DJG A;  3IQQ A;  1Q80 A;  3O2P A;  2AAO A;  2MBX A;  4P5O E;  1YUU A;  1QX2 A;  1ALW A;  3S0F A;  1BJF A;  1CLL A;  2L0P A;  1FBV A;  4GNK B;  1NPQ A;  2HQ8 A;  3SIA A;  3FIA A;  2I18 A;  2L51 A;  3A8R A;  4NDD A;  2M97 A;  4N1G A;  1JFJ A;  1LVC D;  1CDN A;  1S3P A;  1MXE A;  2BCA A;  1YTZ C;  2D8N A;  2WC6 A;  4C0K A;  2VRG A;  1V1F A;  2NCP A;  1K9K A;  2CTN A;  3KO0 A;  3ZNI A;  1LIN A;  2P6B B;  4XJK A;  3AAJ A;  3LCP C;  4IJ7 A;  4YI8 A;  1QWV A;  1K93 D;  1OOF A;  2PAL A;  3OB1 B;  1YX7 A;  2Y1N A;  3SG5 A;  1SW8 A;  1DF0 A;  1YRT B;  1NP8 A;  5TNC A;  1UP5 A;  1J7Q A;  1B4C A;  1LKJ A;  1RK9 A;  1DT7 B;  1YUR A;  1TNP A;  1DVI A;  2H8V A;  4MRX A;  3EVU A;  5FI6 A;  1IKU A;  3ICB A;  4JKT A;  1CFP A;  3A4U B;  1U5I A;  3I5H C;  3OP0 A;  3SIB A;  4N5X A;  5J3X A;  1HT9 A;  1SNL A;  3I5I B;  3FWC A;  2WCH A;  1XVJ A;  1S5G Z;  1IG5 A;  1JBA A;  1DJZ A;  2M1K B;  5CSJ A;  2KI4 C;  3CAB A;  1CDM A;  1SL8 A;  1SMG A;  1M39 A;  3N7H A;  3PM8 A;  3SS5 A;  4A4C A;  3H4S E;  2PAS A;  2WCF A;  2F2P A;  1YVL A;  1AHR A;  4YI9 A;  3TZ1 A;  1SSE B;  1J1D A;  2MHH A;  3I5F C;  1M45 A;  2GTE A;  3KF9 A;  2L2E A;  1SR6 C;  1XFU O;  2JPT A;  2KHN A;  2L2C A;  2QEB A;  3TDZ A;  4PHK A;  1CMF A;  2WCM A;  3D73 A;  3UO9 A;  3QME A;  2K8M B;  1FPW A;  1NX2 A;  1KQM C;  1OZS A;  2JT3 A;  4QJ5 B;  5EL2 A;  1VRK A;  1PSR A;  1CNP A;  2LVJ A;  2KGB C;  4F7F A;  4XJK B;  1NX1 A;  2BBM A;  1WDC B;  1ZMZ A;  1QAS A;  1DEL A;  2KI6 D;  5CSI A;  3EVR A;  3UNW A;  3PLF B;  2M7N A;  2WCB A;  1AJ4 A;  1DF0 B;  1GM0 A;  1UUS A;  1V1G A;  5GQQ C;  4WQ2 A;  2K61 A;  2LNK A;  2LHL A;  1YVH A;  2HPS A;  4ZCU A;  4DRW A;  2LLT A;  5AER A;  3NSI A;  2OPO A;  1TNX A;  2LM5 A;  3CZ0 A;  1K94 A;  2HQW A;  2SCP A;  4M2O A;  3I5G C;  3DY9 A;  2E6W A;  3DD4 A;  4YBH B;  1K2H A;  1MQ1 A;  1PRW A;  1DC1 A;  4AOM A;  1Y1X A;  2M1U A;  1D1O A;  1ZFS A;  3DZT A;  1ODB A;  1SCM C;  2F2O A;  3BJH A;  1YUT A;  3L4L A;  4GPL B;  1FF1 A;  1G8I A;  2JTZ A;  4HRE E;  2KDH A;  2KFH A;  3BFH A;  5F6T A;  1K9U A;  1DJI A;  3OX5 A;  4C0J A;  4YGE B;  1KK7 Y;  1Y6W A;  3DF0 A;  4PDZ A;  3L47 A;  1R2U A;  2FOT A;  5I2Q A;  1L2O C;  4P2Y B;  1NCY A;  1AUI B;  1QAT A;  3IQO A;  1TOP A;  3I5H B;  3NGV A;  4YGB B;  1XFY O;  2JQ6 A;  1YRU B;  2KAX A;  2BBN A;  3R72 A;  2EC6 C;  3F45 A;  2QDI A;  1DJH A;  2KI4 B;  2PQL A;  2FCE A;  1MUX A;  3D78 A;  4F0Z B;  2HF5 A;  1QXP A;  2BAP A;  3DVK A;  2P70 A;  3I5F B;  1CFC A;  1K95 A;  1SR6 B;  1CLB A;  3AKB A;  1AK8 A;  3NHT A;  3TS5 C;  3O6B A;  3Q8I A;  1KQM B;  3HX4 A;  3LK1 A;  3ZWH A;  1UHN A;  5AAN A;  5HLV A;  3KPX A;  3D10 A;  1C7V A;  3TUY B;  2KBI A;  1GQM A;  5JJG A;  3DVM A;  4I5L B;  4CPV A;  1XFX O;  1WY9 A;  4FQT A;  5I2O A;  1A4P A;  1RTP 1;  1UHI A;  5D7F A;  4I5J A;  1M31 A;  2KFG A;  2G2B A;  1WRL A;  3CR5 X;  2JT0 A;  3EVV A;  4OR9 B;  3RLZ A;  1B8L A;  1SY9 A;  2JC2 A;  4BY4 A;  2KNE A;  2ERB A;  4DS7 A;  1A75 A;  5DKN A;  1H4B A;  5G08 A;  2BE6 A;  1SPY A;  2ZND A;  3IVT A;  3PM2 A;  4USL A;  2CNP A;  5I8N A;  1LXF C;  2KAY A;  1TTX A;  5AXI A;  2GV5 A;  4GFT A;  1SK6 D;  2LVK A;  3JTD C;  3I5G B;  2LE9 B;  4JWQ A;  2JXL A;  1YX8 A;  4PT1 A;  1N2D A;  2BEC A;  5HYD A;  1QLS A;  5I94 A;  1IGV A;  2PYQ A;  1TNQ A;  1MXL C;  4CFQ A;  5HKY A;  4ORA B;  1FI5 A;  1DGV A;  3EKJ A;  3LLE A;  2LHI A;  2WCE A;  2ZN9 A;  5AFP A;  1Y0V H;  3O78 A;  2LP3 A;  1GGZ A;  1S6I A;  3R1O A;  1CM4 A;  1EXR A;  1IJ5 A;  1R6P A;  2G9B A;  1L2O B;  3CR2 A;  2BKH B;  3D0Y A;  3BOW A;  2KYC A;  2PRU A;  3K1E A;  1CB1 A;  3B88 A;  2KFF A;  1TUJ A;  4DUQ A;  4ICB A;  4CLN A;  1XFV O;  1UUR A;  1KSO A;  2NXQ A;  3DVE A;  4MZJ A;  1F4O A;  4FTG A;  1W7I B;  3KEV A;  1B7T Z;  2PMY A;  3BXK A;  2NZ0 A;  1ZAC A;  1TWO A;  1EJ3 A;  3D76 A;  4OKH A;  1BU3 A;  1S5G Y;  4XYN A;  3FWB A;  1WLM A;  2KYF A;  4PCW A;  5DKQ A;  1KFX S;  2LLS A;  5JOL A;  3NSK A;  2TN4 A;  1F71 A;  5ER4 X;  3SG7 A;  2BKI B;  1QLK A;  4JPZ B;  3OGN A;  1DJY A;  1G4Y R;  5CPV A;  1C07 A;  2K2A A;  1NSH A;  2KQ6 A;  3FE8 A;  1FI6 A;  4FQO A;  1QV1 A;  4ZCV A;  1PUL A;  1NUB A;  4DIR A;  4PE4 A;  3VRO A;  1BR1 B;  1XA5 A;  1C3Y A;  1OOH A;  5KTY A;  1QV0 A;  2K2F A;  2IS9 A;  3SS3 A;  2L4H A;  2MRD A;  3BUW B;  2QEO A;  1CLM A;  2K7C A;  1J7O A;  3CDN A;  4MN0 A;  1OZO A;  1W7J B;  5HLO A;  1BLQ A;  1DMO A;  2LCP A;  3D74 A;  1NCX A;  2KLD A;  2I7A A;  3D77 A;  3HCM A;  4PAL A;  5FI7 A;  1LA3 A;  1P28 A;  2M8U A;  3IF7 A;  2JZI A;  1CMG A;  2WOS A;  1H8B A;  1IRJ A;  1U5I B;  3SJS A;  1OQP A;  2FCD A;  1AJ5 A;  1YUS A;  3JTD B;  2A4J A;  1CFD A;  2JUL A;  3BUN B;  3NXA A;  3B86 A;  3S0B A;  1F70 A;  1OSA A;  1IIO A;  1QX7 A;  3O4Y A;  3GK1 A;  2AUC A;  3OB2 B;  1AVS A;  1MF8 B;  1QIV A;  1SKT A;  3GOF A;  1L7Z A;  4PE1 A;  1Y1U A;  1EG4 A;  4CID A;  1CTR A;  3BYA A;  4MBE A;  5HL1 A;  1JC2 A;  1DJX A;  1CDP A;  4MRY A;  3DVJ A;  2M7L A;  1WRZ A;  4M2Q A;  1XYD A;  2LV7 A;  1GJY A;  2KLE A;  1K8U A;  4NDB A;  3BUX B;  5HKZ A;  1J1E A;  2MLE C;  3B7A A;  3FE6 A;  5D3O A;  3R1V A;  3KHE A;  1KK8 C;  5I2L A;  1PVB A;  1F54 A;  3WNX B;  4I5N B;  2F3Z A;  2I2R E;  1DEK A;  2M49 B;  4MVF A;  4AQJ A;  2WC8 A;  2O60 A;  3VB1 A;  1OOI X;  1DJW A;  4PE0 A;  1C7W A;  1J7R A;  1S6C A;  3DXL A;  4I5K A;  3S0G A;  5FI2 A;  2JPO A;  2ZKM X;  1XK4 C;  1SL9 A;  3CZ2 A;  2ZN8 A;  5CSN A;  1UWO A;  3WHT B;  3EK8 A;  2F3Y A;  4PHJ A;  1EG3 A;  1RJV A;  1S36 A;  3NHI A;  4A4B A;  4INX A;  5DKR A;  3CTN A;  1ORG A;  1SBJ A;  2JOJ A;  1BR4 B;  1BOC A;  2CXJ A;  2LAN A;  3CLN A;  1EH2 A;  1PSB A;  3JVT C;  3VRQ A;  1TIZ A;  1M46 A;  1BMO A;  4HRH A;  1TN4 A;  1A03 A;  2L98 A;  4OCI A;  4CFR A;  3VRR A;  2ZRT A;  4HRG A;  2WCJ A;  2MAZ A;  4NDC A;  3PSR A;  2Y5I A;  5KSZ A;  1K96 A;  3WHU B;  2HET A;  3PAT A;  1JUO A;  3PFV A;  4HSZ A;  2GGM A;  4BY5 A;  1RRO A;  3GK2 A;  4MLW A;  1B9A A;  1QX5 B;  1SL7 A;  1C3Z A;  1TCO B;  2KQY A;  5ER5 A;  1PK0 D;  1XK4 A;  4ETO A;  2SAS A;  3DF0 B;  1SCV A;  1RFJ A;  3R1P A;  3C1V A;  4AQI A;  2ZFD A;  1NWD A;  2QAC A;  3EG5 B;  5B8I B;  4GBA A;  4ORB B;  2QEV A;  3M0W A;  4C0L A;  4MZL A;  2LUX A;  2KGR A;  1WDC C;  3FE9 A;  3OX6 A;  4QJ4 B;  1UHH A;  1K90 D;  4UPG A;  3LL8 B;  4MEW A;  4U8D A;  5HKW A;  1RWY A;  3NSO A;  1SCM B;  2CBL A;  2LVV A;  2WOR A;  3VGO A;  1B47 A;  4OV2 A;  2ISD A;  1CM1 A;  2KI6 C;  3D75 A;  1NCZ A;  1DQE A;  1J7P A;  1DTL A;  2WND A;  2L4I A;  2Y4Q A;  3CZT X;  1NIW A;  2FJU B;  2JTT A;  3L4A A;  4OZD A;  2KPH A;  1NYA A;  5PAL A;  1XFZ O;  1KK8 B;  1KFU L;  2Q91 A;  2JNX A;  2FJY A;  2LMT A;  3NSL A;  4R1E A;  2K0J A;  1BF5 A;  1WRK A;  2BCB A;  1IQ5 A;  2EC6 B;  2JXC A;  1XO5 A;  1SYM A;  1K9P A;  2OS8 C;  2PVB A;  4GGN A;  5BPJ A;  2OTG C;  2JWW A;  1QJT A;  3O4X A;  1EL4 A;  3BQ3 A;  2BL0 C;  3SG4 A;  1PAL A;  1B7T Y;  1F8H A;  2JRF A;  3CYZ A;  2YGU A;  1WLZ A;  1HQV A;  1A75 B;  1XFW O;  3TDI A;  1OOG A;  2P71 A;  1BT6 A;  3BUO B;  2H61 C;  1GGW A;  5D69 A;  3TS5 B;  1JWD A;  1TUZ A;  2R2I A;  4KYN A;  2Q4U A;  1KWO C;  3S0A A;  5IBW A;  2PSR A;  1JF0 A;  1A2X A;  4YRU A;  1JF2 A;  3QRX A;  2LUC A;  3E3R A;  1ZUZ A;  3JVT B;  2F33 A;  5FYX A;  1MWN A;  2M0R A;  4DCK A;  1TNW A;  3TDU A;  4MZK A;  1S6J A;  2KBM A;  2M29 A;  5K89 A;  1XFR A;  1M63 B;  1JFK A;  1OMV A;  2CCM A;  4YGD B;  1OMR A;  3LK0 A;  1ALV A;  3K21 A;  1W9Z A;  2ZRS A;  1CDL A;  2K7O A;  2LVI A;  1X02 A;  5KU1 A;  4GUK A;  4Q04 A;  1QIW A;  1JSA A;  4YGA A;  2H61 A;  1PVA A;  3EK4 A;  2AMI A;  3BUM B;  3D0Y B;  2KSP A;  3BOW B;  1CKK A;  1UHJ A;  1Z2C B;  1FW4 A;  3CWG A;  4OVN F;  3PN7 C;  3SS4 A;  4WRI A;  3CZ1 A;  3TUY C;  1CFF A;  2EHB A;  3V2L A;  1N65 A;  2QPT A;  2M3W A;  3RZS A;  3S0E A;  3BFB A;  1TRF A;  2CT9 A;  3SG2 A;  1SRA A;  2F8P A;  3RM1 A;  3MSE B;  3PAL A;  4QJ3 B;  1KCY A;  1E8A A;  1IH0 A;  1B8C A;  2ZNE A;  1KFU S;  1B1G A;  3VRP A;  1ZOT B;  3B87 A;  3OBV A;  4YGC B;  1MHO A;  2WCL A;  2Y1M A;  3FS7 A;  4GGF C;  4PHN A;  2JNF A;  4GAO A;  1DGU A;  1KQV A;  1QTX A;  4WQ3 A;  2E30 A;  2LP2 A;  2GGZ A;  2EGD A;  1BOD A;  4L9M A;  3B6X A;  2L5Y A;  3CS1 A;  2BNX A;  1S1E A;  1REC A;  1S26 D;  2OS8 B;  2WC5 A;  4INW A;  2OTG B;  4PE7 A;  1F55 A;  2LLU A;  1IJ6 A;  2BL0 B;  4ORC B;  3SG6 A;  3EKH A;  1IWQ A;  1TCF A;  1N0Y A;  1QVI Z;  3CR4 X;  1OE9 B;  2MA2 A;  3GK4 X;  1IQ3 A;  1KK7 Z;  5DIC A;  4JQ0 D;  5CSF A;  1A29 A;  2I94 A;  1MR8 A;  2DOQ A;  2RGI A;  3EK7 A;  3PJI A;  1QVI Y;  3SG3 A;  1T14 A;  2KOT A;  2MJW B;  2COL B;  4GGF A;  4M2P A;  2QEH A;  1Z4H A;  1KWO B;  2KAV A;  4D1E A;  1QS7 A;  2LMV A;  1NX0 A;  3AKA A;  1J55 A;  1G33 A;  2WCK A;  1YR5 A;  3OHM B;  4JD9 A;  1BG1 A;  3I5I C;  3CGA A;  2L5X B;  1Y1A A;  2JU0 A;  2H2K A;  2NLN A;  4MSP A;  2V53 A;  4N1F A;  2LC5 A;  2NCO A;  1AP4 A;  2LAP A;  1B8R A;  2MLF C;  1UHK A;  2B1U A;  1LS8 A;  2K7D A;  1OW4 A;  1KSM A;  5AEQ A;  3S0D A;  3VRN A;  4IL1 A;  3BFA A;  1NX3 A;  2BCX A;  2LMU A;  2K60 A;  2M9G A;  4PHM A;  3WXA A;  1OOJ A;  2O5G A;  2K7B A;  4NQG A;  4TNC A; 
#chains in the Genus database with same CATH homology
 1F4Q A;  1OMD A;  3PN7 B;  1KFX L;  1LA0 A;  2L50 A;  2BE4 A;  3AAK A;  2JT8 A;  1DJG A;  3IQQ A;  1Q80 A;  3O2P A;  2AAO A;  2MBX A;  4P5O E;  1YUU A;  1QX2 A;  1ALW A;  1BJF A;  1CLL A;  2L0P A;  1FBV A;  4GNK B;  1NPQ A;  2HQ8 A;  3SIA A;  3FIA A;  2I18 A;  2L51 A;  3A8R A;  4NDD A;  2M97 A;  4N1G A;  1JFJ A;  1LVC D;  1CDN A;  1S3P A;  1MXE A;  2BCA A;  1YTZ C;  2D8N A;  4C0K A;  2VRG A;  1V1F A;  2NCP A;  1K9K A;  2CTN A;  3KO0 A;  3ZNI A;  1LIN A;  2P6B B;  4XJK A;  3AAJ A;  3LCP C;  4YI8 A;  1K93 D;  2PAL A;  3OB1 B;  1YX7 A;  2Y1N A;  3SG5 A;  1SW8 A;  1DF0 A;  1YRT B;  1NP8 A;  5TNC A;  1UP5 A;  1J7Q A;  1B4C A;  1LKJ A;  1RK9 A;  1DT7 B;  1YUR A;  1TNP A;  1DVI A;  4MRX A;  3EVU A;  1IKU A;  3ICB A;  1CFP A;  3A4U B;  1U5I A;  3I5H C;  3OP0 A;  3SIB A;  4N5X A;  5J3X A;  1HT9 A;  1SNL A;  3I5I B;  3FWC A;  1XVJ A;  1S5G Z;  1IG5 A;  1JBA A;  1DJZ A;  2M1K B;  5CSJ A;  2KI4 C;  3PM8 A;  1CDM A;  1SL8 A;  1SMG A;  1M39 A;  4A4C A;  3H4S E;  2PAS A;  2WCF A;  2F2P A;  1YVL A;  1AHR A;  4YI9 A;  3TZ1 A;  1J1D A;  2MHH A;  3I5F C;  1M45 A;  3KF9 A;  2L2E A;  1SR6 C;  1XFU O;  2JPT A;  2KHN A;  1CMF A;  3TDZ A;  4PHK A;  2K8M B;  1FPW A;  1NX2 A;  1KQM C;  1OZS A;  2JT3 A;  4QJ5 B;  1VRK A;  1PSR A;  1CNP A;  2LVJ A;  2KGB C;  4XJK B;  1NX1 A;  2BBM A;  1WDC B;  1ZMZ A;  1QAS A;  2KI6 D;  5CSI A;  3EVR A;  3PLF B;  2M7N A;  2WCB A;  1AJ4 A;  1DF0 B;  1UUS A;  1V1G A;  5GQQ C;  4WQ2 A;  2K61 A;  2LNK A;  2LHL A;  1YVH A;  2HPS A;  4ZCU A;  4DRW A;  2LLT A;  5AER A;  3NSI A;  2OPO A;  1TNX A;  2LM5 A;  1K94 A;  2HQW A;  2SCP A;  4M2O A;  3I5G C;  2E6W A;  3DD4 A;  4YBH B;  1K2H A;  1MQ1 A;  1PRW A;  4AOM A;  1Y1X A;  2M1U A;  1D1O A;  1ZFS A;  1ODB A;  1SCM C;  2F2O A;  4GPL B;  1YUT A;  1FF1 A;  1G8I A;  2JTZ A;  4HRE E;  2KDH A;  2KFH A;  5F6T A;  1K9U A;  1DJI A;  3OX5 A;  4C0J A;  4YGE B;  1KK7 Y;  1Y6W A;  3DF0 A;  4PDZ A;  1R2U A;  2FOT A;  5I2Q A;  1L2O C;  4P2Y B;  1NCY A;  1AUI B;  1QAT A;  3IQO A;  1TOP A;  3I5H B;  4YGB B;  1XFY O;  2JQ6 A;  1YRU B;  2KAX A;  2BBN A;  2EC6 C;  3F45 A;  1DJH A;  2KI4 B;  2FCE A;  1MUX A;  4F0Z B;  2HF5 A;  1QXP A;  3DVK A;  3I5F B;  1CFC A;  1K95 A;  1SR6 B;  1CLB A;  3AKB A;  1AK8 A;  3TS5 C;  3O6B A;  1KQM B;  3HX4 A;  3LK1 A;  3ZWH A;  1UHN A;  5AAN A;  5HLV A;  3KPX A;  3D10 A;  1C7V A;  3TUY B;  2KBI A;  1GQM A;  5JJG A;  3DVM A;  4I5L B;  4CPV A;  1XFX O;  1WY9 A;  5I2O A;  1A4P A;  1RTP 1;  1UHI A;  5D7F A;  4I5J A;  1M31 A;  2KFG A;  2G2B A;  1WRL A;  3CR5 X;  2JT0 A;  3EVV A;  4OR9 B;  3RLZ A;  1B8L A;  1SY9 A;  2JC2 A;  4BY4 A;  2KNE A;  4DS7 A;  1A75 A;  5DKN A;  1H4B A;  5G08 A;  2BE6 A;  1SPY A;  2ZND A;  4USL A;  2CNP A;  5I8N A;  1LXF C;  2KAY A;  1TTX A;  5AXI A;  2GV5 A;  4GFT A;  1SK6 D;  2LVK A;  3JTD C;  3I5G B;  2LE9 B;  4JWQ A;  2JXL A;  1YX8 A;  1N2D A;  2BEC A;  5HYD A;  1QLS A;  1IGV A;  1TNQ A;  1MXL C;  4CFQ A;  5HKY A;  4ORA B;  1FI5 A;  1DGV A;  3EKJ A;  3LLE A;  2LHI A;  2WCE A;  2ZN9 A;  5AFP A;  1Y0V H;  3O78 A;  2LP3 A;  1GGZ A;  1S6I A;  1CM4 A;  1EXR A;  1IJ5 A;  1R6P A;  2G9B A;  1L2O B;  3CR2 A;  2BKH B;  3D0Y A;  3BOW A;  2KYC A;  2PRU A;  1CB1 A;  2KFF A;  4DUQ A;  4ICB A;  4CLN A;  1XFV O;  1UUR A;  1KSO A;  2NXQ A;  3DVE A;  4MZJ A;  1F4O A;  4FTG A;  1W7I B;  3KEV A;  1B7T Z;  2PMY A;  3BXK A;  2NZ0 A;  1ZAC A;  1EJ3 A;  4OKH A;  1BU3 A;  1S5G Y;  4XYN A;  3FWB A;  1WLM A;  2KYF A;  4PCW A;  5DKQ A;  1KFX S;  2LLS A;  5JOL A;  3NSK A;  2TN4 A;  1F71 A;  5ER4 X;  3SG7 A;  2BKI B;  1QLK A;  4JPZ B;  1DJY A;  1G4Y R;  5CPV A;  1C07 A;  2K2A A;  1NSH A;  2KQ6 A;  1FI6 A;  4FQO A;  1QV1 A;  4ZCV A;  1PUL A;  1NUB A;  4DIR A;  4PE4 A;  3VRO A;  1BR1 B;  1XA5 A;  5KTY A;  1QV0 A;  2K2F A;  2IS9 A;  2L4H A;  2MRD A;  3BUW B;  1CLM A;  2K7C A;  1J7O A;  4MN0 A;  1OZO A;  1W7J B;  5HLO A;  1BLQ A;  1DMO A;  2LCP A;  1NCX A;  2I7A A;  4PAL A;  3HCM A;  1LA3 A;  3IF7 A;  2M8U A;  1CMG A;  2JZI A;  2WOS A;  1H8B A;  1IRJ A;  1U5I B;  3SJS A;  1OQP A;  2FCD A;  1AJ5 A;  1YUS A;  3JTD B;  2A4J A;  1CFD A;  2JUL A;  3BUN B;  3NXA A;  1F70 A;  1OSA A;  1QX7 A;  3O4Y A;  3GK1 A;  2AUC A;  3OB2 B;  1AVS A;  1MF8 B;  1QIV A;  1SKT A;  3GOF A;  1L7Z A;  4PE1 A;  1Y1U A;  1EG4 A;  4CID A;  1CTR A;  3BYA A;  4MBE A;  1JC2 A;  1DJX A;  1CDP A;  4MRY A;  3DVJ A;  2M7L A;  1WRZ A;  4M2Q A;  1XYD A;  2LV7 A;  1GJY A;  4NDB A;  1K8U A;  3BUX B;  5HKZ A;  1J1E A;  2MLE C;  4E68 A;  3KHE A;  1KK8 C;  5I2L A;  1PVB A;  1F54 A;  3WNX B;  4I5N B;  2F3Z A;  2I2R E;  2M49 B;  4MVF A;  4AQJ A;  2WC8 A;  2O60 A;  1DJW A;  4PE0 A;  1C7W A;  1J7R A;  1S6C A;  4I5K A;  2ZKM X;  1XK4 C;  1SL9 A;  2ZN8 A;  5CSN A;  1UWO A;  3WHT B;  3EK8 A;  2F3Y A;  4PHJ A;  1EG3 A;  1RJV A;  1S36 A;  4A4B A;  5DKR A;  3CTN A;  1SBJ A;  2JOJ A;  1BR4 B;  1BOC A;  2CXJ A;  2LAN A;  3CLN A;  1EH2 A;  1PSB A;  3JVT C;  3VRQ A;  1TIZ A;  1M46 A;  1BMO A;  4HRH A;  1TN4 A;  1A03 A;  2L98 A;  4OCI A;  4CFR A;  3VRR A;  2ZRT A;  4HRG A;  2MAZ A;  4NDC A;  3PSR A;  2Y5I A;  5KSZ A;  1K96 A;  3WHU B;  2HET A;  3PAT A;  1JUO A;  3PFV A;  4HSZ A;  2GGM A;  4BY5 A;  1RRO A;  3GK2 A;  4MLW A;  1B9A A;  1QX5 B;  1SL7 A;  5ER5 A;  1TCO B;  2KQY A;  4ETO A;  1PK0 D;  1XK4 A;  2SAS A;  3DF0 B;  1SCV A;  1RFJ A;  3C1V A;  4AQI A;  2ZFD A;  1NWD A;  2QAC A;  5B8I B;  4GBA A;  4ORB B;  3M0W A;  4C0L A;  4MZL A;  2LUX A;  2KGR A;  1WDC C;  4QJ4 B;  3OX6 A;  1UHH A;  1K90 D;  4UPG A;  3LL8 B;  4MEW A;  4U8D A;  5HKW A;  1RWY A;  3NSO A;  1SCM B;  2CBL A;  2LVV A;  2WOR A;  3VGO A;  1B47 A;  4OV2 A;  2ISD A;  1CM1 A;  2KI6 C;  1NCZ A;  1J7P A;  1DTL A;  2WND A;  2L4I A;  2Y4Q A;  3CZT X;  1NIW A;  2FJU B;  2JTT A;  1NYA A;  5PAL A;  1XFZ O;  1KK8 B;  1KFU L;  2Q91 A;  2JNX A;  2LMT A;  3NSL A;  4R1E A;  2K0J A;  1BF5 A;  2BCB A;  1WRK A;  1IQ5 A;  2EC6 B;  2JXC A;  1XO5 A;  1SYM A;  1K9P A;  2OS8 C;  2PVB A;  4GGN A;  5BPJ A;  2OTG C;  2JWW A;  1QJT A;  1EL4 A;  3BQ3 A;  2BL0 C;  3SG4 A;  1PAL A;  1B7T Y;  1F8H A;  2JRF A;  1WLZ A;  1HQV A;  1A75 B;  1XFW O;  3TDI A;  1BT6 A;  3BUO B;  2H61 C;  1GGW A;  5D69 A;  3TS5 B;  1JWD A;  2R2I A;  2Q4U A;  1KWO C;  5IBW A;  2PSR A;  1JF0 A;  1A2X A;  4YRU A;  1JF2 A;  3QRX A;  2LUC A;  3E3R A;  1ZUZ A;  3JVT B;  2F33 A;  5FYX A;  1MWN A;  2M0R A;  4DCK A;  1TNW A;  3TDU A;  4MZK A;  1S6J A;  2KBM A;  2M29 A;  5K89 A;  1M63 B;  1JFK A;  1OMV A;  2CCM A;  4YGD B;  1OMR A;  3LK0 A;  1ALV A;  3K21 A;  2ZRS A;  1CDL A;  2K7O A;  2LVI A;  1X02 A;  5KU1 A;  4GUK A;  4Q04 A;  1QIW A;  1JSA A;  4YGA A;  2H61 A;  1PVA A;  3EK4 A;  2AMI A;  3BUM B;  3D0Y B;  2KSP A;  3BOW B;  1CKK A;  1UHJ A;  1FW4 A;  3CWG A;  4OVN F;  3PN7 C;  4WRI A;  3TUY C;  1CFF A;  2EHB A;  1N65 A;  2QPT A;  2M3W A;  1TRF A;  2CT9 A;  3SG2 A;  1SRA A;  2F8P A;  3RM1 A;  3MSE B;  3PAL A;  4QJ3 B;  1KCY A;  1E8A A;  1IH0 A;  1B8C A;  2ZNE A;  1KFU S;  1B1G A;  3VRP A;  1ZOT B;  4YGC B;  1MHO A;  1KQV A;  2Y1M A;  3FS7 A;  4GGF C;  4PHN A;  2JNF A;  4GAO A;  1DGU A;  1QTX A;  4WQ3 A;  2E30 A;  2LP2 A;  2GGZ A;  2EGD A;  1BOD A;  4L9M A;  3CS1 A;  1S1E A;  1REC A;  1S26 D;  2OS8 B;  2OTG B;  4PE7 A;  1F55 A;  2LLU A;  1IJ6 A;  2BL0 B;  4ORC B;  3SG6 A;  3EKH A;  1IWQ A;  1TCF A;  1N0Y A;  1QVI Z;  3CR4 X;  1OE9 B;  2MA2 A;  3GK4 X;  1IQ3 A;  1KK7 Z;  4JQ0 D;  5CSF A;  1A29 A;  2I94 A;  1MR8 A;  2DOQ A;  2RGI A;  3EK7 A;  1QVI Y;  3SG3 A;  2KOT A;  2MJW B;  2COL B;  4GGF A;  4M2P A;  1KWO B;  2KAV A;  4D1E A;  1QS7 A;  2LMV A;  1NX0 A;  3AKA A;  1J55 A;  1G33 A;  1YR5 A;  3OHM B;  1BG1 A;  3I5I C;  3CGA A;  2L5X B;  1Y1A A;  2JU0 A;  2H2K A;  2NLN A;  4MSP A;  2V53 A;  4N1F A;  2LC5 A;  2NCO A;  1AP4 A;  2LAP A;  1B8R A;  2MLF C;  1UHK A;  2B1U A;  2K7D A;  1KSM A;  5AEQ A;  3VRN A;  4IL1 A;  1NX3 A;  2BCX A;  2LMU A;  2M9G A;  4PHM A;  3WXA A;  1OOJ A;  2O5G A;  2K7B A;  4NQG A;  4TNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...