4PE7A

Crystal structure of calcium-loaded s100b bound to sc1982
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 35
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pe7A00
3EK4A 4MLWA 1YURA 4HREE 1D1OA 2OTGB 2JPTA 3SG6A 2WORA 1Q80A 4WQ2A 1BG1A 2JNXA 1YTZC 1DJYA 1C7VA 4OV2A 3LCPC 4FTGA 2WCFA 3PN7B 4DRWA 1NWDA 1JFKA 1NYAA 4N1GA 2B1UA 1SCMB 2WOSA 1KSMA 1QASA 2JXCA 3TDZA 1AP4A 2KI4B 1KK8B 5KU1A 3SG4A 5I2QA 4E68A 2BCAA 1NIWA 2LP2A 2ZKMX 1F4OA 1XFWO 5F6TA 3IQQA 1NSHA 3F45A 4YBHB 4MSPA 2AUCA 2FJUB 1PSRA 2JTTA 1M31A 4GUKA 2MBXA 4N5XA 2CT9A 2VRGA 2M3WA 2MAZA 1SYMA 2EGDA 4MRYA 1H4BA 1BR1B 4PE4A 1IH0A 4CPVA 1EJ3A 1SW8A 3TZ1A 2JZIA 1UHIA 4JWQA 1WRKA 4XJKB 2K2FA 4PHNA 1OZOA 3M0WA 1A75B 3D0YA 4I5LB 2F3YA 4GBAA 4QJ4B 2SCPA 1UUSA 1XA5A 1AK8A 3LL8B 4FQOA 2OS8C 5ER5A 1MWNA 1TNQA 3VGOA 1QTXA 3PSRA 2HETA 1W7JB 2L50A 3C1VA 2SASA 1F4QA 1UWOA 2BE6A 5I2LA 5AFPA 3O6BA 4GGNA 2IS9A 4PALA 3VRRA 2LLUA 4OR9B 1FI6A 4R1EA 4BY5A 1K9PA 3DVEA 1GGWA 1S3PA 1L7ZA 1SRAA 1FF1A 2K7DA 3HX4A 1KSOA 3OB2B 1OZSA 2L4IA 1BJFA 3AAKA 1CFDA 2WNDA 1A2XA 1YUUA 2K0JA 4DIRA 2I94A 5HKZA 1S6IA 3PFVA 1FW4A 2GGMA 1MQ1A 3DF0B 2CBLA 4M2PA 4F0ZB 3ZNIA 1BOCA 1PVBA 3O2PA 2BCXA 1M63B 3JVTC 5D7FA 2RGIA 4C0LA 1YX7A 2LVVA 1SBJA 1C7WA 2LLTA 1FI5A 1B47A 1SY9A 4MZJA 4A4BA 1K2HA 2KQYA 1DJHA 3JVTB 5I2OA 4NDCA 2BKHB 3LLEA 2CNPA 1NX2A 2TN4A 4HSZA 2BBMA 3NXAA 1NUBA 2PSRA 4HRGA 2M7LA 3OB1B 3SJSA 2BCBA 3TUYC 5HLVA 1XFUO 2LCPA 2ISDA 3VRPA 1XK4C 1KFXL 1X02A 1J7RA 3TDIA 1CTRA 1DF0B 4ORBB 1EXRA 5BPJA 4QJ3B 3GK2A 2KI6C 4Q04A 1JC2A 1JF2A 5K89A 2LV7A 1MHOA 2O5GA 1XFYO 1MXEA 3E3RA 4A4CA 3CR5X 3NSKA 5CSJA 1WDCC 3SIAA 3LK0A 2LVKA 2KBMA 3LK1A 2MJWB 3CZTX 1QVIY 2LP3A 4GGFA 3DD4A 1WRZA 2JT3A 3OX6A 4M2QA 5HKWA 4C0KA 1WDCB 2OTGC 2JT8A 1JFJA 2ZRTA 1B9AA 1QIVA 2BE4A 2KI6D 3VRNA 2COLB 4DS7A 1N0YA 2A4JA 1PULA 4PE7A 5TNCA 4I5JA 4QJ5B 1EH2A 1CDMA 1IWQA 3PN7C 4YGCB 1HT9A 1SCMC 2LMTA 2AMIA 1DJXA 2K2AA 3BOWA 1M45A 1J7PA 1V1FA 1QVIZ 2KI4C 3WHUB 1NX3A 1KK8C 2I18A 1XFVO 2HQWA 3FWBA 1U5IB 3KHEA 5I8NA 2JOJA 4NDDA 2P6BB 2KFHA 2I2RE 1S6CA 3BUWB 2H2KA 1BU3A 1TTXA 2F8PA 2KYFA 1TN4A 5JOLA 1WRLA 3I5GB 4PE1A 1LA3A 2Y1MA 4GNKB 2LHLA 5CSNA 1SNLA 2L0PA 1TNWA 1PSBA 1LXFC 1IQ3A 1CM1A 1CFFA 1CFPA 3CWGA 1Y6WA 1G8IA 1KFUS 4CFQA 1CLLA 1DVIA 5AXIA 1OOJA 1RTP1 3KF9A 2KGRA 3GK4X 1QX5B 3CR4X 4WRIA 1QV1A 1QIWA 2H61A 1JWDA 4MVFA 4D1EA 4OCIA 1YR5A 1MR8A 2MRDA 2KGBC 2CCMA 3PALA 2E6WA 2PRUA 5PALA 1SKTA 1XVJA 4BY4A 4YI9A 4MRXA 3BXKA 2KAYA 3SIBA 1DJZA 1AUIB 1DTLA 2JXLA 3KEVA 4PCWA 2M8UA 2L5XB 1V1GA 2D8NA 1AVSA 2KQ6A 1SR6C 2FOTA 5CSIA 1BLQA 1KWOB 1NP8A 1IGVA 1NCXA 1YUTA 1EG4A 1K93D 2PMYA 2Q4UA 4ICBA 1TCFA 5IBWA 1K90D 3CS1A 3GK1A 3PM8A 1B8LA 1R2UA 3NSOA 1NX1A 2EHBA 1SR6B 1YUSA 4GAOA 1SMGA 2KSPA 2V53A 1K94A 2F2PA 2JULA 1K96A 1F54A 1DJIA 4MZLA 2F2OA 1OE9B 4MBEA 5DKRA 5FYXA 1YX8A 1J7QA 4C0JA 4XJKA 3BQ3A 1PALA 4N1FA 1F8HA 1A75A 2I7AA 2LC5A 5J3XA 4IL1A 3SG7A 3EVRA 3WNXB 1E8AA 4GPLB 3CTNA 1NPQA 1UHHA 3EVUA 1M46A 2LNKA 3AKBA 3H4SE 1OSAA 3EKHA 4L9MA 2L51A 3DVKA 1EL4A 3KPXA 4JPZB 3JTDB 1C07A 3QRXA 1A4PA 1OMVA 2K7OA 3BUNB 1UURA 3BYAA 4PHKA 2ZFDA 3OHMB 2M49B 1YVLA 1ZACA 4I5KA 4M2OA 4XYNA 3BUMB 2G9BA 5AANA 2ZNEA 3O78A 1SK6D 2Y5IA 3ICBA 5DKNA 2PASA 1AJ4A 2L2EA 4JQ0D 1DGUA 1QJTA 2KYCA 1PRWA 1IG5A 2CTNA 2LUXA 1Y1UA 2LMVA 1UHJA 2JT0A 4AQJA 3CR2A 1L2OC 4YGBB 2WC8A 1G33A 3VROA 3WXAA 1J55A 2JTZA 1J7OA 3NSLA 1L2OB 4PHJA 3AKAA 1QS7A 4MEWA 2MHHA 1OMDA 1TNPA 2AAOA 1UHKA 5HLOA 1AJ5A 2PALA 5DKQA 2PVBA 2HPSA 1QLKA 4P5OE 1BT6A 3DVMA 2M97A 1RECA 3MSEB 2CXJA 1B1GA 4CFRA 3IF7A 1VRKA 3AAJA 1WY9A 1F70A 4WQ3A 5CSFA 1KCYA 2G2BA 2WCEA 3VRQA 2M29A 2OPOA 1CDNA 3EKJA 1LVCD 2Y1NA 3K21A 1DF0A 2FCEA 1CMGA 1YVHA 1MUXA 1A29A 4PE0A 1IKUA 2GV5A 1TNXA 1B4CA 3ZWHA 1XK4A 3EVVA 1KFXS 1B8RA 1RFJA 3I5GC 1ALWA 1G4YR 4OKHA 2K7BA 1PVAA 1CLBA 1XFXO 3EK7A 3NSIA 2M0RA 1RWYA 1DT7B 5AEQA 2MA2A 1A03A 5D69A 1JSAA 4YI8A 2F3ZA 1KQVA 3IQOA 3I5HB 3OX5A 2R2IA 2O60A 2KDHA 4HRHA 2EC6C 1XO5A 2M7NA 3RM1A 1SL7A 5HYDA 2NZ0A 3BUXB 3FIAA 1EG3A 4USLA 1NCZA 1QX2A 1JF0A 1TRFA 2MLEC 2JWWA 4TNCA 2NLNA 2KNEA 2LLSA 1RROA 2EC6B 1CNPA 3D10A 2NCOA 3WHTB 1CDLA 4ORCB 1JUOA 3D0YB 2JC2A 1U5IA 1Y1AA 2LVIA 2M9GA 5HKYA 4UPGA 1IRJA 1JBAA 1KQMC 2ZRSA 2BBNA 1N65A 5JJGA 1IJ5A 2KHNA 1WLZA 3FWCA 3PLFB 1CMFA 3SG3A 1KWOC 1YRTB 2LE9B 1K9UA 1KQMB 2NXQA 1QX7A 2DOQA 1AHRA 1MF8B 1R6PA 2L98A 5ER4X 1ZOTB 4ZCVA 2BECA 1SL9A 3RLZA 4U8DA 2QPTA 4CIDA 1LKJA 2LUCA 1GGZA 1LINA 1K9KA 2JRFA 4AQIA 1F55A 2Q91A 1N2DA 2FCDA 2QACA 3SG5A 4AOMA 4CLNA 1FBVA 2M1KB 1CM4A 3I5FC 2ZNDA 1IQ5A 1SCVA 3BUOB 1B8CA 3CLNA 1DMOA 1WLMA 1SL8A 1BMOA 2BKIB 1H8BA 3A4UB 2LVJA 3DVJA 2HF5A 3I5FB 4PHMA 1DJWA 2KFFA 1MXLC 4MZKA 4YRUA 4OVNF 1NX0A 4ORAB 3TS5C 2NCPA 1CLMA 2MLFC 3JTDC 1UP5A 2OS8B 2F33A 2M1UA 1J1EA 3OP0A 1K95A 2WCBA 3TS5B 1ZMZA 2KAVA 2ZN9A 1ALVA 1QLSA 2HQ8A 1CKKA 2KOTA 2K8MB 1SPYA 1GQMA 3CGAA 1BODA 1S36A 1QATA 5KTYA 1XFZO 5AERA 2E30A 1S5GY 5KSZA 2BL0C 1BF5A 4YGEB 1S6JA 1CFCA 1Y0VH 2K7CA 3FS7A 4YGDB 3PATA 3GOFA 4PDZA 1M39A 2KAXA 4NDBA 4GGFC 1Y1XA 4MN0A 3TDUA 2BL0B 3DF0A 1CDPA 1UHNA 2ZN8A 3HCMA 3EK8A 2LHIA 4DUQA 1KK7Y 1QXPA 1HQVA 1NCYA 1S5GZ 2JU0A 4DCKA 1DJGA 1BR4B 5CPVA 4NQGA 2JQ6A 3KO0A 1OQPA 1TOPA 4P2YB 1J1DA 1F71A 2LMUA 1RK9A 2GGZA 1YRUB 2JNFA 1B7TY 5GQQC 2L4HA 3TUYB 2Y4QA 3BOWB 3SG2A 2K61A 1LA0A 3I5IC 1ODBA 4YGAA 1OMRA 4ZCUA 1ZFSA 4GFTA 1S26D 1KK7Z 3A8RA 2LM5A 2KFGA 1W7IB 1TIZA 1XYDA 4I5NB 1QV0A 3I5IB 1GJYA 1CB1A 1FPWA 1TCOB 2LANA 5B8IB 2LAPA 1DGVA 5G08A 1KFUL 3O4YA 2KBIA 1B7TZ 4ETOA 1S1EA 3I5HC 1K8UA 2H61C 1ZUZA 1PK0D 1IJ6A 1RJVA
chains in the Genus database with same CATH superfamily
3EK4A 4MLWA 1YURA 4HREE 1D1OA 2OTGB 2JPTA 2WC6A 3SG6A 2WORA 1Q80A 4WQ2A 1BG1A 2JNXA 1YTZC 1DJYA 1C7VA 4OV2A 3LCPC 4FTGA 2WCFA 2WCKA 3PN7B 4DRWA 1NWDA 1JFKA 1NYAA 4N1GA 2B1UA 3PM2A 1SCMB 2PQLA 3NHTA 2WOSA 1KSMA 1QASA 2JXCA 3TDZA 1AP4A 2KI4B 1KK8B 5KU1A 3SG4A 5I2QA 4E68A 2BCAA 2L5YA 1NIWA 2LP2A 2ZKMX 1F4OA 1XFWO 5F6TA 3IQQA 1NSHA 3F45A 4YBHB 3CZ0A 2AUCA 2FJUB 1PSRA 4MSPA 5DICA 2JTTA 1M31A 4GUKA 1XFRA 2MBXA 4N5XA 2CT9A 2VRGA 4JD9A 2M3WA 2MAZA 1SYMA 2EGDA 4MRYA 1H4BA 1BR1B 4PE4A 4IJ7A 1IH0A 4CPVA 1EJ3A 1SW8A 3TZ1A 2JZIA 1UHIA 4JWQA 1WRKA 4XJKB 2K2FA 3D74A 3B88A 1OZOA 4JKTA 4PHNA 3M0WA 1A75B 3D0YA 4I5LB 2F3YA 4GBAA 4QJ4B 5I94A 2SCPA 1UUSA 1XA5A 3FE8A 2PYQA 3D77A 1AK8A 2WCJA 1DC1A 3LL8B 4FQOA 2OS8C 5ER5A 1MWNA 1TNQA 3VGOA 1QTXA 3PSRA 2HETA 1W7JB 2L50A 3C1VA 2SASA 1F4QA 1UWOA 2BE6A 5I2LA 3BFHA 3O6BA 4GGNA 4KYNA 2IS9A 4PALA 5AFPA 3VRRA 2LLUA 4OR9B 1FI6A 3UO9A 4R1EA 4BY5A 1K9PA 3DVEA 3S0EA 1GGWA 1S3PA 1L7ZA 1SRAA 3UNWA 1FF1A 2K7DA 3HX4A 1KSOA 3OB2B 1OZSA 2L4IA 1BJFA 3AAKA 1CFDA 2WNDA 1Z4HA 1A2XA 1YUUA 2K0JA 3S0DA 4DIRA 2I94A 1OOFA 1S6IA 3PFVA 5HKZA 1FW4A 2GGMA 1MQ1A 3DF0B 2CBLA 4M2PA 4F0ZB 3S0FA 3ZNIA 1BOCA 1PVBA 3O2PA 2BCXA 1M63B 3JVTC 5D7FA 2RGIA 4C0LA 3B87A 1YX7A 2LVVA 3EG5B 1SBJA 1C7WA 2LLTA 1OOHA 1FI5A 1B47A 1SY9A 4MZJA 4A4BA 1K2HA 2KQYA 1DJHA 3JVTB 5I2OA 4NDCA 2BKHB 3LLEA 2CNPA 1NX2A 2TN4A 4HSZA 4FQTA 3FE9A 2BBMA 3V2LA 3NXAA 1NUBA 1OW4A 2PSRA 3BFBA 4HRGA 2M7LA 3OB1B 3SJSA 2BCBA 3TUYC 5HLVA 1XFUO 2LCPA 3N7HA 2ISDA 3VRPA 1XK4C 1KFXL 1X02A 1J7RA 3TDIA 1CTRA 2KLEA 1DF0B 3S0BA 4ORBB 3SS4A 1EXRA 5BPJA 4QJ3B 3GK2A 2KI6C 3L47A 4Q04A 1JC2A 1JF2A 5K89A 2LV7A 3L4LA 1MHOA 2O5GA 1XFYO 1MXEA 3E3RA 4A4CA 3CR5X 3NSKA 2GTEA 3QMEA 5CSJA 1WDCC 3SIAA 3LK0A 2LVKA 2KBMA 3LK1A 2MJWB 3CZTX 1QVIY 2LP3A 4GGFA 3DD4A 1WRZA 2JT3A 3OX6A 4M2QA 5HKWA 4C0KA 1WDCB 2OTGC 2JT8A 5HL1A 2ZRTA 1B9AA 1QIVA 2BE4A 2KI6D 1JFJA 3VRNA 2COLB 4DS7A 1N0YA 2A4JA 1PULA 4PE7A 5TNCA 1T14A 4I5JA 4QJ5B 1EH2A 1CDMA 1IWQA 3PN7C 4YGCB 1HT9A 1SCMC 2LMTA 2AMIA 1DJXA 2K2AA 3BOWA 1M45A 1ORGA 1V1FA 1J7PA 1QVIZ 2KI4C 3WHUB 1NX3A 1KK8C 2I18A 1XFVO 2H8VA 2HQWA 1U5IB 3FE6A 3FWBA 2JOJA 3KHEA 4INXA 2P6BB 2KFHA 4NDDA 5I8NA 2I2RE 1S6CA 3BUWB 2H2KA 1BU3A 1TTXA 2F8PA 2KYFA 1TN4A 5JOLA 1WRLA 3I5GB 4PE1A 1LA3A 2Y1MA 3DXLA 3PJIA 4GNKB 2LHLA 2YGUA 5CSNA 1SNLA 2L0PA 2BAPA 1TNWA 1C3ZA 1PSBA 1GM0A 1LXFC 1IQ3A 1CM1A 1CFFA 1CFPA 3CWGA 1DQEA 1Y6WA 1G8IA 1KFUS 4CFQA 1CLLA 1DVIA 3BJHA 3NHIA 1OOJA 1RTP1 3KF9A 5AXIA 1TUZA 2KGRA 1QX5B 3CR4X 3GK4X 4WRIA 1QV1A 1QIWA 2H61A 1JWDA 4MVFA 4D1EA 4OCIA 1YR5A 1MR8A 2MRDA 2KGBC 2CCMA 3PALA 2E6WA 2PRUA 5PALA 1SKTA 1XVJA 4BY4A 4INWA 3S0AA 4YI9A 3SS5A 4MRXA 3BXKA 2KAYA 3SIBA 1DJZA 1AUIB 1DTLA 2JXLA 2FJYA 3KEVA 4PCWA 2M8UA 2L5XB 1V1GA 2D8NA 1AVSA 2KQ6A 1SR6C 2FOTA 5CSIA 1BLQA 1KWOB 1NP8A 1IGVA 1NCXA 3K1EA 1YUTA 1EG4A 1K93D 2PMYA 2Q4UA 4ICBA 5FI6A 1TCFA 5IBWA 1K90D 3CS1A 3D76A 3GK1A 1B8LA 1R2UA 3NSOA 3PM8A 1NX1A 5FI2A 2EHBA 1SR6B 1YUSA 4GAOA 1SMGA 2KSPA 2V53A 1K94A 2F2PA 2JULA 1K96A 1F54A 2QEOA 1DJIA 4MZLA 2F2OA 1OE9B 4MBEA 5DKRA 5FYXA 1YX8A 1J7QA 4C0JA 4XJKA 3BQ3A 1PALA 4N1FA 1F8HA 3R1OA 1A75A 2I7AA 2LC5A 5J3XA 2QDIA 4IL1A 3SG7A 3EVRA 3WNXB 1E8AA 3O4XA 3CTNA 4GPLB 3B7AA 1NPQA 1UHHA 3EVUA 1M46A 2LNKA 3AKBA 3H4SE 1OSAA 3EKHA 4L9MA 2L51A 3DVKA 1EL4A 3KPXA 4JPZB 3JTDB 1C07A 3QRXA 1A4PA 1OMVA 2K7OA 3BUNB 1UURA 3BYAA 4PHKA 2ZFDA 3OHMB 2M49B 1YVLA 3S0GA 1ZACA 4I5KA 4M2OA 4XYNA 3BUMB 2G9BA 5AANA 2ZNEA 3O78A 1SK6D 2Y5IA 3ICBA 5DKNA 2PASA 1AJ4A 2L2EA 4JQ0D 1DGUA 1QJTA 2KYCA 1PRWA 1IG5A 2CTNA 2LUXA 1Y1UA 2LMVA 1UHJA 2JT0A 4AQJA 3CR2A 1DELA 5EL2A 1L2OC 2KLDA 1OOIX 2JPOA 4YGBB 2WC8A 1G33A 3VROA 3WXAA 1J55A 2WCMA 2JTZA 1J7OA 3NSLA 1L2OB 4PHJA 3AKAA 1QS7A 3CZ2A 4MEWA 2MHHA 1OMDA 1TNPA 2AAOA 4OZDA 1UHKA 5HLOA 1AJ5A 2PALA 5DKQA 1C3YA 2PVBA 2HPSA 3D75A 1QLKA 1DEKA 4P5OE 1BT6A 3DVMA 2M97A 1RECA 3MSEB 2CXJA 5D3OA 4CFRA 3IF7A 1B1GA 1VRKA 3AAJA 1WY9A 3BFAA 1F70A 4WQ3A 5CSFA 1KCYA 2G2BA 2WCEA 3VRQA 2M29A 2OPOA 3R1VA 1CDNA 3EKJA 1LVCD 2Y1NA 3K21A 1DF0A 1IIOA 2FCEA 4PT1A 1CMGA 1YVHA 1MUXA 1A29A 4PE0A 1IKUA 2GV5A 1TNXA 1B4CA 3OGNA 3ZWHA 1XK4A 3EVVA 1KFXS 1B8RA 1RFJA 2P71A 3I5GC 1ALWA 1G4YR 4OKHA 2K7BA 1PVAA 1CLBA 1XFXO 3EK7A 3NSIA 2M0RA 1RWYA 1DT7B 5AEQA 2MA2A 1A03A 5D69A 1JSAA 4YI8A 2F3ZA 1KQVA 2WCLA 3IQOA 2WC5A 3I5HB 3OX5A 2R2IA 2O60A 2KDHA 4HRHA 2QEBA 2EC6C 1XO5A 2M7NA 3L4AA 3RM1A 1SL7A 1OOGA 1TUJA 5HYDA 2NZ0A 3BUXB 3IVTA 3FIAA 1EG3A 4USLA 1NCZA 1QX2A 1JF0A 1TRFA 3D78A 2MLEC 2JWWA 3D73A 4TNCA 2NLNA 2WCHA 2KNEA 2LLSA 1RROA 2EC6B 1CNPA 3D10A 2NCOA 3WHTB 1CDLA 4ORCB 1JUOA 3D0YB 2JC2A 1U5IA 1Y1AA 2LVIA 2M9GA 5HKYA 3CZ1A 4UPGA 1IRJA 3DY9A 1JBAA 1KQMC 2ZRSA 2BBNA 1N65A 3CABA 5JJGA 1IJ5A 2KHNA 1WLZA 3FWCA 3PLFB 1CMFA 3SG3A 1KWOC 1YRTB 2LE9B 1K9UA 1KQMB 3B86A 2NXQA 1QX7A 2DOQA 1AHRA 1MF8B 1R6PA 2L98A 3NGVA 5ER4X 1ZOTB 4ZCVA 1QWVA 2BECA 1SL9A 2QEHA 3RLZA 4U8DA 3R1PA 2QPTA 4CIDA 1LKJA 2LUCA 1GGZA 1LINA 1K9KA 2JRFA 4AQIA 1F55A 2Q91A 1N2DA 2FCDA 2QACA 3SG5A 1SSEB 4AOMA 1FBVA 4CLNA 2M1KB 1CM4A 3I5FC 2ZNDA 1IQ5A 1SCVA 3BUOB 1B8CA 3CLNA 1DMOA 1WLMA 1SL8A 1Z2CB 1BMOA 2BKIB 1H8BA 3A4UB 2LVJA 3DVJA 2HF5A 3I5FB 4PHMA 1DJWA 2KFFA 1MXLC 4MZKA 3SS3A 4OVNF 4YRUA 1NX0A 4ORAB 2KPHA 3TS5C 2NCPA 1CLMA 2MLFC 3JTDC 1UP5A 2OS8B 2F33A 2M1UA 1J1EA 3Q8IA 3OP0A 1K95A 2WCBA 3TS5B 1ZMZA 2BNXA 2KAVA 2ZN9A 1ALVA 1QLSA 1W9ZA 2HQ8A 1CKKA 2KOTA 2K8MB 1SPYA 1GQMA 3CGAA 1BODA 1S36A 1QATA 5KTYA 1XFZO 5AERA 2E30A 1S5GY 5KSZA 2BL0C 1BF5A 4YGEB 1S6JA 1CFCA 3OBVA 1Y0VH 2K7CA 3FS7A 4YGDB 3PATA 3GOFA 4PDZA 1M39A 2KAXA 4NDBA 4GGFC 1Y1XA 4MN0A 3TDUA 2BL0B 2L2CA 3DF0A 1CDPA 1UHNA 2ZN8A 3CDNA 4F7FA 3HCMA 3EK8A 1LS8A 2LHIA 4DUQA 1KK7Y 1QXPA 3RZSA 1HQVA 2ERBA 1NCYA 1S5GZ 2JU0A 4DCKA 1DJGA 1BR4B 3VB1A 5CPVA 4NQGA 2JQ6A 3KO0A 1OQPA 1TOPA 2QEVA 4P2YB 1J1DA 1F71A 2LMUA 1RK9A 2GGZA 1YRUB 2JNFA 1B7TY 5GQQC 2K60A 2L4HA 3TUYB 2Y4QA 3BOWB 3SG2A 2K61A 1LA0A 3I5IC 1ODBA 4YGAA 1OMRA 4ZCUA 1ZFSA 4GFTA 1S26D 1KK7Z 3A8RA 3CYZA 5FI7A 2LM5A 2KFGA 3DYEA 1W7IB 1TIZA 1XYDA 4I5NB 1QV0A 3I5IB 1GJYA 1CB1A 1FPWA 1TCOB 2LANA 5B8IB 2LAPA 2P70A 1DGVA 3DZTA 5G08A 1KFUL 3O4YA 1TWOA 2KBIA 1B7TZ 3R72A 4ETOA 1S1EA 3I5HC 1P28A 1K8UA 2H61C 1ZUZA 1PK0D 1IJ6A 3B6XA 1RJVA
chains in the Genus database with same CATH topology
3EK4A 4MLWA 1YURA 4HREE 1D1OA 2OTGB 2JPTA 3SG6A 2WORA 1Q80A 4WQ2A 1BG1A 2JNXA 1YTZC 1DJYA 1C7VA 4OV2A 3LCPC 4FTGA 2WCFA 3PN7B 4DRWA 1NWDA 1JFKA 1NYAA 4N1GA 2B1UA 1SCMB 2WOSA 1KSMA 1QASA 2JXCA 3TDZA 1AP4A 2KI4B 1KK8B 5KU1A 3SG4A 5I2QA 4E68A 2BCAA 1NIWA 2LP2A 2ZKMX 1F4OA 1XFWO 5F6TA 3IQQA 1NSHA 3F45A 4YBHB 4MSPA 2AUCA 2FJUB 1PSRA 2JTTA 1M31A 4GUKA 2MBXA 4N5XA 2CT9A 2VRGA 2M3WA 2MAZA 1SYMA 2EGDA 4MRYA 1H4BA 1BR1B 4PE4A 1IH0A 4CPVA 1EJ3A 1SW8A 3TZ1A 2JZIA 1UHIA 4JWQA 1WRKA 4XJKB 2K2FA 4PHNA 1OZOA 3M0WA 1A75B 3D0YA 4I5LB 2F3YA 4GBAA 4QJ4B 2SCPA 1UUSA 1XA5A 1AK8A 3LL8B 4FQOA 2OS8C 5ER5A 1MWNA 1TNQA 3VGOA 1QTXA 3PSRA 2HETA 1W7JB 2L50A 3C1VA 2SASA 1F4QA 1UWOA 2BE6A 5I2LA 5AFPA 3O6BA 4GGNA 2IS9A 4PALA 3VRRA 2LLUA 4OR9B 1FI6A 4R1EA 4BY5A 1K9PA 3DVEA 1GGWA 1S3PA 1L7ZA 1SRAA 1FF1A 2K7DA 3HX4A 1KSOA 3OB2B 1OZSA 2L4IA 1BJFA 3AAKA 1CFDA 2WNDA 1A2XA 1YUUA 2K0JA 4DIRA 2I94A 5HKZA 1S6IA 3PFVA 1FW4A 2GGMA 1MQ1A 3DF0B 2CBLA 4M2PA 4F0ZB 3ZNIA 1BOCA 1PVBA 3O2PA 2BCXA 1M63B 3JVTC 5D7FA 2RGIA 4C0LA 1YX7A 2LVVA 1SBJA 1C7WA 2LLTA 1FI5A 1B47A 1SY9A 4MZJA 4A4BA 1K2HA 2KQYA 1DJHA 3JVTB 5I2OA 4NDCA 2BKHB 3LLEA 2CNPA 1NX2A 2TN4A 4HSZA 2BBMA 3NXAA 1NUBA 2PSRA 4HRGA 2M7LA 3OB1B 3SJSA 2BCBA 3TUYC 5HLVA 1XFUO 2LCPA 2ISDA 3VRPA 1XK4C 1KFXL 1X02A 1J7RA 3TDIA 1CTRA 1DF0B 4ORBB 1EXRA 5BPJA 4QJ3B 3GK2A 2KI6C 4Q04A 1JC2A 1JF2A 5K89A 2LV7A 1MHOA 2O5GA 1XFYO 1MXEA 3E3RA 4A4CA 3CR5X 3NSKA 5CSJA 1WDCC 3SIAA 3LK0A 2LVKA 2KBMA 3LK1A 2MJWB 3CZTX 1QVIY 2LP3A 4GGFA 3DD4A 1WRZA 2JT3A 3OX6A 4M2QA 5HKWA 4C0KA 1WDCB 2OTGC 2JT8A 1JFJA 2ZRTA 1B9AA 1QIVA 2BE4A 2KI6D 3VRNA 2COLB 4DS7A 1N0YA 2A4JA 1PULA 4PE7A 5TNCA 4I5JA 4QJ5B 1EH2A 1CDMA 1IWQA 3PN7C 4YGCB 1HT9A 1SCMC 2LMTA 2AMIA 1DJXA 2K2AA 3BOWA 1M45A 1J7PA 1V1FA 1QVIZ 2KI4C 3WHUB 1NX3A 1KK8C 2I18A 1XFVO 2HQWA 3FWBA 1U5IB 3KHEA 5I8NA 2JOJA 4NDDA 2P6BB 2KFHA 2I2RE 1S6CA 3BUWB 2H2KA 1BU3A 1TTXA 2F8PA 2KYFA 1TN4A 5JOLA 1WRLA 3I5GB 4PE1A 1LA3A 2Y1MA 4GNKB 2LHLA 5CSNA 1SNLA 2L0PA 1TNWA 1PSBA 1LXFC 1IQ3A 1CM1A 1CFFA 1CFPA 3CWGA 1Y6WA 1G8IA 1KFUS 4CFQA 1CLLA 1DVIA 5AXIA 1OOJA 1RTP1 3KF9A 2KGRA 3GK4X 1QX5B 3CR4X 4WRIA 1QV1A 1QIWA 2H61A 1JWDA 4MVFA 4D1EA 4OCIA 1YR5A 1MR8A 2MRDA 2KGBC 2CCMA 3PALA 2E6WA 2PRUA 5PALA 1SKTA 1XVJA 4BY4A 4YI9A 4MRXA 3BXKA 2KAYA 3SIBA 1DJZA 1AUIB 1DTLA 2JXLA 3KEVA 4PCWA 2M8UA 2L5XB 1V1GA 2D8NA 1AVSA 2KQ6A 1SR6C 2FOTA 5CSIA 1BLQA 1KWOB 1NP8A 1IGVA 1NCXA 1YUTA 1EG4A 1K93D 2PMYA 2Q4UA 4ICBA 1TCFA 5IBWA 1K90D 3CS1A 3GK1A 3PM8A 1B8LA 1R2UA 3NSOA 1NX1A 2EHBA 1SR6B 1YUSA 4GAOA 1SMGA 2KSPA 2V53A 1K94A 2F2PA 2JULA 1K96A 1F54A 1DJIA 4MZLA 2F2OA 1OE9B 4MBEA 5DKRA 5FYXA 1YX8A 1J7QA 4C0JA 4XJKA 3BQ3A 1PALA 4N1FA 1F8HA 1A75A 2I7AA 2LC5A 5J3XA 4IL1A 3SG7A 3EVRA 3WNXB 1E8AA 4GPLB 3CTNA 1NPQA 1UHHA 3EVUA 1M46A 2LNKA 3AKBA 3H4SE 1OSAA 3EKHA 4L9MA 2L51A 3DVKA 1EL4A 3KPXA 4JPZB 3JTDB 1C07A 3QRXA 1A4PA 1OMVA 2K7OA 3BUNB 1UURA 3BYAA 4PHKA 2ZFDA 3OHMB 2M49B 1YVLA 1ZACA 4I5KA 4M2OA 4XYNA 3BUMB 2G9BA 5AANA 2ZNEA 3O78A 1SK6D 2Y5IA 3ICBA 5DKNA 2PASA 1AJ4A 2L2EA 4JQ0D 1DGUA 1QJTA 2KYCA 1PRWA 1IG5A 2CTNA 2LUXA 1Y1UA 2LMVA 1UHJA 2JT0A 4AQJA 3CR2A 1L2OC 4YGBB 2WC8A 1G33A 3VROA 3WXAA 1J55A 2JTZA 1J7OA 3NSLA 1L2OB 4PHJA 3AKAA 1QS7A 4MEWA 2MHHA 1OMDA 1TNPA 2AAOA 1UHKA 5HLOA 1AJ5A 2PALA 5DKQA 2PVBA 2HPSA 1QLKA 4P5OE 1BT6A 3DVMA 2M97A 1RECA 3MSEB 2CXJA 1B1GA 4CFRA 3IF7A 1VRKA 3AAJA 1WY9A 1F70A 4WQ3A 5CSFA 1KCYA 2G2BA 2WCEA 3VRQA 2M29A 2OPOA 1CDNA 3EKJA 1LVCD 2Y1NA 3K21A 1DF0A 2FCEA 1CMGA 1YVHA 1MUXA 1A29A 4PE0A 1IKUA 2GV5A 1TNXA 1B4CA 3ZWHA 1XK4A 3EVVA 1KFXS 1B8RA 1RFJA 3I5GC 1ALWA 1G4YR 4OKHA 2K7BA 1PVAA 1CLBA 1XFXO 3EK7A 3NSIA 2M0RA 1RWYA 1DT7B 5AEQA 2MA2A 1A03A 5D69A 1JSAA 4YI8A 2F3ZA 1KQVA 3IQOA 3I5HB 3OX5A 2R2IA 2O60A 2KDHA 4HRHA 2EC6C 1XO5A 2M7NA 3RM1A 1SL7A 5HYDA 2NZ0A 3BUXB 3FIAA 1EG3A 4USLA 1NCZA 1QX2A 1JF0A 1TRFA 2MLEC 2JWWA 4TNCA 2NLNA 2KNEA 2LLSA 1RROA 2EC6B 1CNPA 3D10A 2NCOA 3WHTB 1CDLA 4ORCB 1JUOA 3D0YB 2JC2A 1U5IA 1Y1AA 2LVIA 2M9GA 5HKYA 4UPGA 1IRJA 1JBAA 1KQMC 2ZRSA 2BBNA 1N65A 5JJGA 1IJ5A 2KHNA 1WLZA 3FWCA 3PLFB 1CMFA 3SG3A 1KWOC 1YRTB 2LE9B 1K9UA 1KQMB 2NXQA 1QX7A 2DOQA 1AHRA 1MF8B 1R6PA 2L98A 5ER4X 1ZOTB 4ZCVA 2BECA 1SL9A 3RLZA 4U8DA 2QPTA 4CIDA 1LKJA 2LUCA 1GGZA 1LINA 1K9KA 2JRFA 4AQIA 1F55A 2Q91A 1N2DA 2FCDA 2QACA 3SG5A 4AOMA 4CLNA 1FBVA 2M1KB 1CM4A 3I5FC 2ZNDA 1IQ5A 1SCVA 3BUOB 1B8CA 3CLNA 1DMOA 1WLMA 1SL8A 1BMOA 2BKIB 1H8BA 3A4UB 2LVJA 3DVJA 2HF5A 3I5FB 4PHMA 1DJWA 2KFFA 1MXLC 4MZKA 4YRUA 4OVNF 1NX0A 4ORAB 3TS5C 2NCPA 1CLMA 2MLFC 3JTDC 1UP5A 2OS8B 2F33A 2M1UA 1J1EA 3OP0A 1K95A 2WCBA 3TS5B 1ZMZA 2KAVA 2ZN9A 1ALVA 1QLSA 2HQ8A 1CKKA 2KOTA 2K8MB 1SPYA 1GQMA 3CGAA 1BODA 1S36A 1QATA 5KTYA 1XFZO 5AERA 2E30A 1S5GY 5KSZA 2BL0C 1BF5A 4YGEB 1S6JA 1CFCA 1Y0VH 2K7CA 3FS7A 4YGDB 3PATA 3GOFA 4PDZA 1M39A 2KAXA 4NDBA 4GGFC 1Y1XA 4MN0A 3TDUA 2BL0B 3DF0A 1CDPA 1UHNA 2ZN8A 3HCMA 3EK8A 2LHIA 4DUQA 1KK7Y 1QXPA 1HQVA 1NCYA 1S5GZ 2JU0A 4DCKA 1DJGA 1BR4B 5CPVA 4NQGA 2JQ6A 3KO0A 1OQPA 1TOPA 4P2YB 1J1DA 1F71A 2LMUA 1RK9A 2GGZA 1YRUB 2JNFA 1B7TY 5GQQC 2L4HA 3TUYB 2Y4QA 3BOWB 3SG2A 2K61A 1LA0A 3I5IC 1ODBA 4YGAA 1OMRA 4ZCUA 1ZFSA 4GFTA 1S26D 1KK7Z 3A8RA 2LM5A 2KFGA 1W7IB 1TIZA 1XYDA 4I5NB 1QV0A 3I5IB 1GJYA 1CB1A 1FPWA 1TCOB 2LANA 5B8IB 2LAPA 1DGVA 5G08A 1KFUL 3O4YA 2KBIA 1B7TZ 4ETOA 1S1EA 3I5HC 1K8UA 2H61C 1ZUZA 1PK0D 1IJ6A 1RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EK4 A;  4MLW A;  1YUR A;  4HRE E;  1D1O A;  2OTG B;  2JPT A;  3SG6 A;  2WOR A;  1Q80 A;  4WQ2 A;  1BG1 A;  2JNX A;  1YTZ C;  1DJY A;  1C7V A;  4OV2 A;  3LCP C;  4FTG A;  2WCF A;  3PN7 B;  4DRW A;  1NWD A;  1JFK A;  1NYA A;  4N1G A;  2B1U A;  1SCM B;  2WOS A;  1KSM A;  1QAS A;  2JXC A;  3TDZ A;  1AP4 A;  2KI4 B;  1KK8 B;  5KU1 A;  3SG4 A;  5I2Q A;  4E68 A;  2BCA A;  1NIW A;  2LP2 A;  2ZKM X;  1F4O A;  1XFW O;  5F6T A;  3IQQ A;  1NSH A;  3F45 A;  4YBH B;  4MSP A;  2AUC A;  2FJU B;  1PSR A;  2JTT A;  1M31 A;  4GUK A;  2MBX A;  4N5X A;  2CT9 A;  2VRG A;  2M3W A;  2MAZ A;  1SYM A;  2EGD A;  4MRY A;  1H4B A;  1BR1 B;  4PE4 A;  1IH0 A;  4CPV A;  1EJ3 A;  1SW8 A;  3TZ1 A;  2JZI A;  1UHI A;  4JWQ A;  1WRK A;  4XJK B;  2K2F A;  4PHN A;  1OZO A;  3M0W A;  1A75 B;  3D0Y A;  4I5L B;  2F3Y A;  4GBA A;  4QJ4 B;  2SCP A;  1UUS A;  1XA5 A;  1AK8 A;  3LL8 B;  4FQO A;  2OS8 C;  5ER5 A;  1MWN A;  1TNQ A;  3VGO A;  1QTX A;  3PSR A;  2HET A;  1W7J B;  2L50 A;  3C1V A;  2SAS A;  1F4Q A;  1UWO A;  2BE6 A;  5I2L A;  5AFP A;  3O6B A;  4GGN A;  2IS9 A;  4PAL A;  3VRR A;  2LLU A;  4OR9 B;  1FI6 A;  4R1E A;  4BY5 A;  1K9P A;  3DVE A;  1GGW A;  1S3P A;  1L7Z A;  1SRA A;  1FF1 A;  2K7D A;  3HX4 A;  1KSO A;  3OB2 B;  1OZS A;  2L4I A;  1BJF A;  3AAK A;  1CFD A;  2WND A;  1A2X A;  1YUU A;  2K0J A;  4DIR A;  2I94 A;  5HKZ A;  1S6I A;  3PFV A;  1FW4 A;  2GGM A;  1MQ1 A;  3DF0 B;  2CBL A;  4M2P A;  4F0Z B;  3ZNI A;  1BOC A;  1PVB A;  3O2P A;  2BCX A;  1M63 B;  3JVT C;  5D7F A;  2RGI A;  4C0L A;  1YX7 A;  2LVV A;  1SBJ A;  1C7W A;  2LLT A;  1FI5 A;  1B47 A;  1SY9 A;  4MZJ A;  4A4B A;  1K2H A;  2KQY A;  1DJH A;  3JVT B;  5I2O A;  4NDC A;  2BKH B;  3LLE A;  2CNP A;  1NX2 A;  2TN4 A;  4HSZ A;  2BBM A;  3NXA A;  1NUB A;  2PSR A;  4HRG A;  2M7L A;  3OB1 B;  3SJS A;  2BCB A;  3TUY C;  5HLV A;  1XFU O;  2LCP A;  2ISD A;  3VRP A;  1XK4 C;  1KFX L;  1X02 A;  1J7R A;  3TDI A;  1CTR A;  1DF0 B;  4ORB B;  1EXR A;  5BPJ A;  4QJ3 B;  3GK2 A;  2KI6 C;  4Q04 A;  1JC2 A;  1JF2 A;  5K89 A;  2LV7 A;  1MHO A;  2O5G A;  1XFY O;  1MXE A;  3E3R A;  4A4C A;  3CR5 X;  3NSK A;  5CSJ A;  1WDC C;  3SIA A;  3LK0 A;  2LVK A;  2KBM A;  3LK1 A;  2MJW B;  3CZT X;  1QVI Y;  2LP3 A;  4GGF A;  3DD4 A;  1WRZ A;  2JT3 A;  3OX6 A;  4M2Q A;  5HKW A;  4C0K A;  1WDC B;  2OTG C;  2JT8 A;  1JFJ A;  2ZRT A;  1B9A A;  1QIV A;  2BE4 A;  2KI6 D;  3VRN A;  2COL B;  4DS7 A;  1N0Y A;  2A4J A;  1PUL A;  4PE7 A;  5TNC A;  4I5J A;  4QJ5 B;  1EH2 A;  1CDM A;  1IWQ A;  3PN7 C;  4YGC B;  1HT9 A;  1SCM C;  2LMT A;  2AMI A;  1DJX A;  2K2A A;  3BOW A;  1M45 A;  1J7P A;  1V1F A;  1QVI Z;  2KI4 C;  3WHU B;  1NX3 A;  1KK8 C;  2I18 A;  1XFV O;  2HQW A;  3FWB A;  1U5I B;  3KHE A;  5I8N A;  2JOJ A;  4NDD A;  2P6B B;  2KFH A;  2I2R E;  1S6C A;  3BUW B;  2H2K A;  1BU3 A;  1TTX A;  2F8P A;  2KYF A;  1TN4 A;  5JOL A;  1WRL A;  3I5G B;  4PE1 A;  1LA3 A;  2Y1M A;  4GNK B;  2LHL A;  5CSN A;  1SNL A;  2L0P A;  1TNW A;  1PSB A;  1LXF C;  1IQ3 A;  1CM1 A;  1CFF A;  1CFP A;  3CWG A;  1Y6W A;  1G8I A;  1KFU S;  4CFQ A;  1CLL A;  1DVI A;  5AXI A;  1OOJ A;  1RTP 1;  3KF9 A;  2KGR A;  3GK4 X;  1QX5 B;  3CR4 X;  4WRI A;  1QV1 A;  1QIW A;  2H61 A;  1JWD A;  4MVF A;  4D1E A;  4OCI A;  1YR5 A;  1MR8 A;  2MRD A;  2KGB C;  2CCM A;  3PAL A;  2E6W A;  2PRU A;  5PAL A;  1SKT A;  1XVJ A;  4BY4 A;  4YI9 A;  4MRX A;  3BXK A;  2KAY A;  3SIB A;  1DJZ A;  1AUI B;  1DTL A;  2JXL A;  3KEV A;  4PCW A;  2M8U A;  2L5X B;  1V1G A;  2D8N A;  1AVS A;  2KQ6 A;  1SR6 C;  2FOT A;  5CSI A;  1BLQ A;  1KWO B;  1NP8 A;  1IGV A;  1NCX A;  1YUT A;  1EG4 A;  1K93 D;  2PMY A;  2Q4U A;  4ICB A;  1TCF A;  5IBW A;  1K90 D;  3CS1 A;  3GK1 A;  3PM8 A;  1B8L A;  1R2U A;  3NSO A;  1NX1 A;  2EHB A;  1SR6 B;  1YUS A;  4GAO A;  1SMG A;  2KSP A;  2V53 A;  1K94 A;  2F2P A;  2JUL A;  1K96 A;  1F54 A;  1DJI A;  4MZL A;  2F2O A;  1OE9 B;  4MBE A;  5DKR A;  5FYX A;  1YX8 A;  1J7Q A;  4C0J A;  4XJK A;  3BQ3 A;  1PAL A;  4N1F A;  1F8H A;  1A75 A;  2I7A A;  2LC5 A;  5J3X A;  4IL1 A;  3SG7 A;  3EVR A;  3WNX B;  1E8A A;  4GPL B;  3CTN A;  1NPQ A;  1UHH A;  3EVU A;  1M46 A;  2LNK A;  3AKB A;  3H4S E;  1OSA A;  3EKH A;  4L9M A;  2L51 A;  3DVK A;  1EL4 A;  3KPX A;  4JPZ B;  3JTD B;  1C07 A;  3QRX A;  1A4P A;  1OMV A;  2K7O A;  3BUN B;  1UUR A;  3BYA A;  4PHK A;  2ZFD A;  3OHM B;  2M49 B;  1YVL A;  1ZAC A;  4I5K A;  4M2O A;  4XYN A;  3BUM B;  2G9B A;  5AAN A;  2ZNE A;  3O78 A;  1SK6 D;  2Y5I A;  3ICB A;  5DKN A;  2PAS A;  1AJ4 A;  2L2E A;  4JQ0 D;  1DGU A;  1QJT A;  2KYC A;  1PRW A;  1IG5 A;  2CTN A;  2LUX A;  1Y1U A;  2LMV A;  1UHJ A;  2JT0 A;  4AQJ A;  3CR2 A;  1L2O C;  4YGB B;  2WC8 A;  1G33 A;  3VRO A;  3WXA A;  1J55 A;  2JTZ A;  1J7O A;  3NSL A;  1L2O B;  4PHJ A;  3AKA A;  1QS7 A;  4MEW A;  2MHH A;  1OMD A;  1TNP A;  2AAO A;  1UHK A;  5HLO A;  1AJ5 A;  2PAL A;  5DKQ A;  2PVB A;  2HPS A;  1QLK A;  4P5O E;  1BT6 A;  3DVM A;  2M97 A;  1REC A;  3MSE B;  2CXJ A;  1B1G A;  4CFR A;  3IF7 A;  1VRK A;  3AAJ A;  1WY9 A;  1F70 A;  4WQ3 A;  5CSF A;  1KCY A;  2G2B A;  2WCE A;  3VRQ A;  2M29 A;  2OPO A;  1CDN A;  3EKJ A;  1LVC D;  2Y1N A;  3K21 A;  1DF0 A;  2FCE A;  1CMG A;  1YVH A;  1MUX A;  1A29 A;  4PE0 A;  1IKU A;  2GV5 A;  1TNX A;  1B4C A;  3ZWH A;  1XK4 A;  3EVV A;  1KFX S;  1B8R A;  1RFJ A;  3I5G C;  1ALW A;  1G4Y R;  4OKH A;  2K7B A;  1PVA A;  1CLB A;  1XFX O;  3EK7 A;  3NSI A;  2M0R A;  1RWY A;  1DT7 B;  5AEQ A;  2MA2 A;  1A03 A;  5D69 A;  1JSA A;  4YI8 A;  2F3Z A;  1KQV A;  3IQO A;  3I5H B;  3OX5 A;  2R2I A;  2O60 A;  2KDH A;  4HRH A;  2EC6 C;  1XO5 A;  2M7N A;  3RM1 A;  1SL7 A;  5HYD A;  2NZ0 A;  3BUX B;  3FIA A;  1EG3 A;  4USL A;  1NCZ A;  1QX2 A;  1JF0 A;  1TRF A;  2MLE C;  2JWW A;  4TNC A;  2NLN A;  2KNE A;  2LLS A;  1RRO A;  2EC6 B;  1CNP A;  3D10 A;  2NCO A;  3WHT B;  1CDL A;  4ORC B;  1JUO A;  3D0Y B;  2JC2 A;  1U5I A;  1Y1A A;  2LVI A;  2M9G A;  5HKY A;  4UPG A;  1IRJ A;  1JBA A;  1KQM C;  2ZRS A;  2BBN A;  1N65 A;  5JJG A;  1IJ5 A;  2KHN A;  1WLZ A;  3FWC A;  3PLF B;  1CMF A;  3SG3 A;  1KWO C;  1YRT B;  2LE9 B;  1K9U A;  1KQM B;  2NXQ A;  1QX7 A;  2DOQ A;  1AHR A;  1MF8 B;  1R6P A;  2L98 A;  5ER4 X;  1ZOT B;  4ZCV A;  2BEC A;  1SL9 A;  3RLZ A;  4U8D A;  2QPT A;  4CID A;  1LKJ A;  2LUC A;  1GGZ A;  1LIN A;  1K9K A;  2JRF A;  4AQI A;  1F55 A;  2Q91 A;  1N2D A;  2FCD A;  2QAC A;  3SG5 A;  4AOM A;  4CLN A;  1FBV A;  2M1K B;  1CM4 A;  3I5F C;  2ZND A;  1IQ5 A;  1SCV A;  3BUO B;  1B8C A;  3CLN A;  1DMO A;  1WLM A;  1SL8 A;  1BMO A;  2BKI B;  1H8B A;  3A4U B;  2LVJ A;  3DVJ A;  2HF5 A;  3I5F B;  4PHM A;  1DJW A;  2KFF A;  1MXL C;  4MZK A;  4YRU A;  4OVN F;  1NX0 A;  4ORA B;  3TS5 C;  2NCP A;  1CLM A;  2MLF C;  3JTD C;  1UP5 A;  2OS8 B;  2F33 A;  2M1U A;  1J1E A;  3OP0 A;  1K95 A;  2WCB A;  3TS5 B;  1ZMZ A;  2KAV A;  2ZN9 A;  1ALV A;  1QLS A;  2HQ8 A;  1CKK A;  2KOT A;  2K8M B;  1SPY A;  1GQM A;  3CGA A;  1BOD A;  1S36 A;  1QAT A;  5KTY A;  1XFZ O;  5AER A;  2E30 A;  1S5G Y;  5KSZ A;  2BL0 C;  1BF5 A;  4YGE B;  1S6J A;  1CFC A;  1Y0V H;  2K7C A;  3FS7 A;  4YGD B;  3PAT A;  3GOF A;  4PDZ A;  1M39 A;  2KAX A;  4NDB A;  4GGF C;  1Y1X A;  4MN0 A;  3TDU A;  2BL0 B;  3DF0 A;  1CDP A;  1UHN A;  2ZN8 A;  3HCM A;  3EK8 A;  2LHI A;  4DUQ A;  1KK7 Y;  1QXP A;  1HQV A;  1NCY A;  1S5G Z;  2JU0 A;  4DCK A;  1DJG A;  1BR4 B;  5CPV A;  4NQG A;  2JQ6 A;  3KO0 A;  1OQP A;  1TOP A;  4P2Y B;  1J1D A;  1F71 A;  2LMU A;  1RK9 A;  2GGZ A;  1YRU B;  2JNF A;  1B7T Y;  5GQQ C;  2L4H A;  3TUY B;  2Y4Q A;  3BOW B;  3SG2 A;  2K61 A;  1LA0 A;  3I5I C;  1ODB A;  4YGA A;  1OMR A;  4ZCU A;  1ZFS A;  4GFT A;  1S26 D;  1KK7 Z;  3A8R A;  2LM5 A;  2KFG A;  1W7I B;  1TIZ A;  1XYD A;  4I5N B;  1QV0 A;  3I5I B;  1GJY A;  1CB1 A;  1FPW A;  1TCO B;  2LAN A;  5B8I B;  2LAP A;  1DGV A;  5G08 A;  1KFU L;  3O4Y A;  2KBI A;  1B7T Z;  4ETO A;  1S1E A;  3I5H C;  1K8U A;  2H61 C;  1ZUZ A;  1PK0 D;  1IJ6 A;  1RJV A; 
#chains in the Genus database with same CATH topology
 3EK4 A;  4MLW A;  1YUR A;  4HRE E;  1D1O A;  2OTG B;  2JPT A;  2WC6 A;  3SG6 A;  2WOR A;  1Q80 A;  4WQ2 A;  1BG1 A;  2JNX A;  1YTZ C;  1DJY A;  1C7V A;  4OV2 A;  3LCP C;  4FTG A;  2WCF A;  2WCK A;  3PN7 B;  4DRW A;  1NWD A;  1JFK A;  1NYA A;  4N1G A;  2B1U A;  3PM2 A;  1SCM B;  2PQL A;  3NHT A;  2WOS A;  1KSM A;  1QAS A;  2JXC A;  3TDZ A;  1AP4 A;  2KI4 B;  1KK8 B;  5KU1 A;  3SG4 A;  5I2Q A;  4E68 A;  2BCA A;  2L5Y A;  1NIW A;  2LP2 A;  2ZKM X;  1F4O A;  1XFW O;  5F6T A;  3IQQ A;  1NSH A;  3F45 A;  4YBH B;  3CZ0 A;  2AUC A;  2FJU B;  1PSR A;  4MSP A;  5DIC A;  2JTT A;  1M31 A;  4GUK A;  1XFR A;  2MBX A;  4N5X A;  2CT9 A;  2VRG A;  4JD9 A;  2M3W A;  2MAZ A;  1SYM A;  2EGD A;  4MRY A;  1H4B A;  1BR1 B;  4PE4 A;  4IJ7 A;  1IH0 A;  4CPV A;  1EJ3 A;  1SW8 A;  3TZ1 A;  2JZI A;  1UHI A;  4JWQ A;  1WRK A;  4XJK B;  2K2F A;  3D74 A;  3B88 A;  1OZO A;  4JKT A;  4PHN A;  3M0W A;  1A75 B;  3D0Y A;  4I5L B;  2F3Y A;  4GBA A;  4QJ4 B;  5I94 A;  2SCP A;  1UUS A;  1XA5 A;  3FE8 A;  2PYQ A;  3D77 A;  1AK8 A;  2WCJ A;  1DC1 A;  3LL8 B;  4FQO A;  2OS8 C;  5ER5 A;  1MWN A;  1TNQ A;  3VGO A;  1QTX A;  3PSR A;  2HET A;  1W7J B;  2L50 A;  3C1V A;  2SAS A;  1F4Q A;  1UWO A;  2BE6 A;  5I2L A;  3BFH A;  3O6B A;  4GGN A;  4KYN A;  2IS9 A;  4PAL A;  5AFP A;  3VRR A;  2LLU A;  4OR9 B;  1FI6 A;  3UO9 A;  4R1E A;  4BY5 A;  1K9P A;  3DVE A;  3S0E A;  1GGW A;  1S3P A;  1L7Z A;  1SRA A;  3UNW A;  1FF1 A;  2K7D A;  3HX4 A;  1KSO A;  3OB2 B;  1OZS A;  2L4I A;  1BJF A;  3AAK A;  1CFD A;  2WND A;  1Z4H A;  1A2X A;  1YUU A;  2K0J A;  3S0D A;  4DIR A;  2I94 A;  1OOF A;  1S6I A;  3PFV A;  5HKZ A;  1FW4 A;  2GGM A;  1MQ1 A;  3DF0 B;  2CBL A;  4M2P A;  4F0Z B;  3S0F A;  3ZNI A;  1BOC A;  1PVB A;  3O2P A;  2BCX A;  1M63 B;  3JVT C;  5D7F A;  2RGI A;  4C0L A;  3B87 A;  1YX7 A;  2LVV A;  3EG5 B;  1SBJ A;  1C7W A;  2LLT A;  1OOH A;  1FI5 A;  1B47 A;  1SY9 A;  4MZJ A;  4A4B A;  1K2H A;  2KQY A;  1DJH A;  3JVT B;  5I2O A;  4NDC A;  2BKH B;  3LLE A;  2CNP A;  1NX2 A;  2TN4 A;  4HSZ A;  4FQT A;  3FE9 A;  2BBM A;  3V2L A;  3NXA A;  1NUB A;  1OW4 A;  2PSR A;  3BFB A;  4HRG A;  2M7L A;  3OB1 B;  3SJS A;  2BCB A;  3TUY C;  5HLV A;  1XFU O;  2LCP A;  3N7H A;  2ISD A;  3VRP A;  1XK4 C;  1KFX L;  1X02 A;  1J7R A;  3TDI A;  1CTR A;  2KLE A;  1DF0 B;  3S0B A;  4ORB B;  3SS4 A;  1EXR A;  5BPJ A;  4QJ3 B;  3GK2 A;  2KI6 C;  3L47 A;  4Q04 A;  1JC2 A;  1JF2 A;  5K89 A;  2LV7 A;  3L4L A;  1MHO A;  2O5G A;  1XFY O;  1MXE A;  3E3R A;  4A4C A;  3CR5 X;  3NSK A;  2GTE A;  3QME A;  5CSJ A;  1WDC C;  3SIA A;  3LK0 A;  2LVK A;  2KBM A;  3LK1 A;  2MJW B;  3CZT X;  1QVI Y;  2LP3 A;  4GGF A;  3DD4 A;  1WRZ A;  2JT3 A;  3OX6 A;  4M2Q A;  5HKW A;  4C0K A;  1WDC B;  2OTG C;  2JT8 A;  5HL1 A;  2ZRT A;  1B9A A;  1QIV A;  2BE4 A;  2KI6 D;  1JFJ A;  3VRN A;  2COL B;  4DS7 A;  1N0Y A;  2A4J A;  1PUL A;  4PE7 A;  5TNC A;  1T14 A;  4I5J A;  4QJ5 B;  1EH2 A;  1CDM A;  1IWQ A;  3PN7 C;  4YGC B;  1HT9 A;  1SCM C;  2LMT A;  2AMI A;  1DJX A;  2K2A A;  3BOW A;  1M45 A;  1ORG A;  1V1F A;  1J7P A;  1QVI Z;  2KI4 C;  3WHU B;  1NX3 A;  1KK8 C;  2I18 A;  1XFV O;  2H8V A;  2HQW A;  1U5I B;  3FE6 A;  3FWB A;  2JOJ A;  3KHE A;  4INX A;  2P6B B;  2KFH A;  4NDD A;  5I8N A;  2I2R E;  1S6C A;  3BUW B;  2H2K A;  1BU3 A;  1TTX A;  2F8P A;  2KYF A;  1TN4 A;  5JOL A;  1WRL A;  3I5G B;  4PE1 A;  1LA3 A;  2Y1M A;  3DXL A;  3PJI A;  4GNK B;  2LHL A;  2YGU A;  5CSN A;  1SNL A;  2L0P A;  2BAP A;  1TNW A;  1C3Z A;  1PSB A;  1GM0 A;  1LXF C;  1IQ3 A;  1CM1 A;  1CFF A;  1CFP A;  3CWG A;  1DQE A;  1Y6W A;  1G8I A;  1KFU S;  4CFQ A;  1CLL A;  1DVI A;  3BJH A;  3NHI A;  1OOJ A;  1RTP 1;  3KF9 A;  5AXI A;  1TUZ A;  2KGR A;  1QX5 B;  3CR4 X;  3GK4 X;  4WRI A;  1QV1 A;  1QIW A;  2H61 A;  1JWD A;  4MVF A;  4D1E A;  4OCI A;  1YR5 A;  1MR8 A;  2MRD A;  2KGB C;  2CCM A;  3PAL A;  2E6W A;  2PRU A;  5PAL A;  1SKT A;  1XVJ A;  4BY4 A;  4INW A;  3S0A A;  4YI9 A;  3SS5 A;  4MRX A;  3BXK A;  2KAY A;  3SIB A;  1DJZ A;  1AUI B;  1DTL A;  2JXL A;  2FJY A;  3KEV A;  4PCW A;  2M8U A;  2L5X B;  1V1G A;  2D8N A;  1AVS A;  2KQ6 A;  1SR6 C;  2FOT A;  5CSI A;  1BLQ A;  1KWO B;  1NP8 A;  1IGV A;  1NCX A;  3K1E A;  1YUT A;  1EG4 A;  1K93 D;  2PMY A;  2Q4U A;  4ICB A;  5FI6 A;  1TCF A;  5IBW A;  1K90 D;  3CS1 A;  3D76 A;  3GK1 A;  1B8L A;  1R2U A;  3NSO A;  3PM8 A;  1NX1 A;  5FI2 A;  2EHB A;  1SR6 B;  1YUS A;  4GAO A;  1SMG A;  2KSP A;  2V53 A;  1K94 A;  2F2P A;  2JUL A;  1K96 A;  1F54 A;  2QEO A;  1DJI A;  4MZL A;  2F2O A;  1OE9 B;  4MBE A;  5DKR A;  5FYX A;  1YX8 A;  1J7Q A;  4C0J A;  4XJK A;  3BQ3 A;  1PAL A;  4N1F A;  1F8H A;  3R1O A;  1A75 A;  2I7A A;  2LC5 A;  5J3X A;  2QDI A;  4IL1 A;  3SG7 A;  3EVR A;  3WNX B;  1E8A A;  3O4X A;  3CTN A;  4GPL B;  3B7A A;  1NPQ A;  1UHH A;  3EVU A;  1M46 A;  2LNK A;  3AKB A;  3H4S E;  1OSA A;  3EKH A;  4L9M A;  2L51 A;  3DVK A;  1EL4 A;  3KPX A;  4JPZ B;  3JTD B;  1C07 A;  3QRX A;  1A4P A;  1OMV A;  2K7O A;  3BUN B;  1UUR A;  3BYA A;  4PHK A;  2ZFD A;  3OHM B;  2M49 B;  1YVL A;  3S0G A;  1ZAC A;  4I5K A;  4M2O A;  4XYN A;  3BUM B;  2G9B A;  5AAN A;  2ZNE A;  3O78 A;  1SK6 D;  2Y5I A;  3ICB A;  5DKN A;  2PAS A;  1AJ4 A;  2L2E A;  4JQ0 D;  1DGU A;  1QJT A;  2KYC A;  1PRW A;  1IG5 A;  2CTN A;  2LUX A;  1Y1U A;  2LMV A;  1UHJ A;  2JT0 A;  4AQJ A;  3CR2 A;  1DEL A;  5EL2 A;  1L2O C;  2KLD A;  1OOI X;  2JPO A;  4YGB B;  2WC8 A;  1G33 A;  3VRO A;  3WXA A;  1J55 A;  2WCM A;  2JTZ A;  1J7O A;  3NSL A;  1L2O B;  4PHJ A;  3AKA A;  1QS7 A;  3CZ2 A;  4MEW A;  2MHH A;  1OMD A;  1TNP A;  2AAO A;  4OZD A;  1UHK A;  5HLO A;  1AJ5 A;  2PAL A;  5DKQ A;  1C3Y A;  2PVB A;  2HPS A;  3D75 A;  1QLK A;  1DEK A;  4P5O E;  1BT6 A;  3DVM A;  2M97 A;  1REC A;  3MSE B;  2CXJ A;  5D3O A;  4CFR A;  3IF7 A;  1B1G A;  1VRK A;  3AAJ A;  1WY9 A;  3BFA A;  1F70 A;  4WQ3 A;  5CSF A;  1KCY A;  2G2B A;  2WCE A;  3VRQ A;  2M29 A;  2OPO A;  3R1V A;  1CDN A;  3EKJ A;  1LVC D;  2Y1N A;  3K21 A;  1DF0 A;  1IIO A;  2FCE A;  4PT1 A;  1CMG A;  1YVH A;  1MUX A;  1A29 A;  4PE0 A;  1IKU A;  2GV5 A;  1TNX A;  1B4C A;  3OGN A;  3ZWH A;  1XK4 A;  3EVV A;  1KFX S;  1B8R A;  1RFJ A;  2P71 A;  3I5G C;  1ALW A;  1G4Y R;  4OKH A;  2K7B A;  1PVA A;  1CLB A;  1XFX O;  3EK7 A;  3NSI A;  2M0R A;  1RWY A;  1DT7 B;  5AEQ A;  2MA2 A;  1A03 A;  5D69 A;  1JSA A;  4YI8 A;  2F3Z A;  1KQV A;  2WCL A;  3IQO A;  2WC5 A;  3I5H B;  3OX5 A;  2R2I A;  2O60 A;  2KDH A;  4HRH A;  2QEB A;  2EC6 C;  1XO5 A;  2M7N A;  3L4A A;  3RM1 A;  1SL7 A;  1OOG A;  1TUJ A;  5HYD A;  2NZ0 A;  3BUX B;  3IVT A;  3FIA A;  1EG3 A;  4USL A;  1NCZ A;  1QX2 A;  1JF0 A;  1TRF A;  3D78 A;  2MLE C;  2JWW A;  3D73 A;  4TNC A;  2NLN A;  2WCH A;  2KNE A;  2LLS A;  1RRO A;  2EC6 B;  1CNP A;  3D10 A;  2NCO A;  3WHT B;  1CDL A;  4ORC B;  1JUO A;  3D0Y B;  2JC2 A;  1U5I A;  1Y1A A;  2LVI A;  2M9G A;  5HKY A;  3CZ1 A;  4UPG A;  1IRJ A;  3DY9 A;  1JBA A;  1KQM C;  2ZRS A;  2BBN A;  1N65 A;  3CAB A;  5JJG A;  1IJ5 A;  2KHN A;  1WLZ A;  3FWC A;  3PLF B;  1CMF A;  3SG3 A;  1KWO C;  1YRT B;  2LE9 B;  1K9U A;  1KQM B;  3B86 A;  2NXQ A;  1QX7 A;  2DOQ A;  1AHR A;  1MF8 B;  1R6P A;  2L98 A;  3NGV A;  5ER4 X;  1ZOT B;  4ZCV A;  1QWV A;  2BEC A;  1SL9 A;  2QEH A;  3RLZ A;  4U8D A;  3R1P A;  2QPT A;  4CID A;  1LKJ A;  2LUC A;  1GGZ A;  1LIN A;  1K9K A;  2JRF A;  4AQI A;  1F55 A;  2Q91 A;  1N2D A;  2FCD A;  2QAC A;  3SG5 A;  1SSE B;  4AOM A;  1FBV A;  4CLN A;  2M1K B;  1CM4 A;  3I5F C;  2ZND A;  1IQ5 A;  1SCV A;  3BUO B;  1B8C A;  3CLN A;  1DMO A;  1WLM A;  1SL8 A;  1Z2C B;  1BMO A;  2BKI B;  1H8B A;  3A4U B;  2LVJ A;  3DVJ A;  2HF5 A;  3I5F B;  4PHM A;  1DJW A;  2KFF A;  1MXL C;  4MZK A;  3SS3 A;  4OVN F;  4YRU A;  1NX0 A;  4ORA B;  2KPH A;  3TS5 C;  2NCP A;  1CLM A;  2MLF C;  3JTD C;  1UP5 A;  2OS8 B;  2F33 A;  2M1U A;  1J1E A;  3Q8I A;  3OP0 A;  1K95 A;  2WCB A;  3TS5 B;  1ZMZ A;  2BNX A;  2KAV A;  2ZN9 A;  1ALV A;  1QLS A;  1W9Z A;  2HQ8 A;  1CKK A;  2KOT A;  2K8M B;  1SPY A;  1GQM A;  3CGA A;  1BOD A;  1S36 A;  1QAT A;  5KTY A;  1XFZ O;  5AER A;  2E30 A;  1S5G Y;  5KSZ A;  2BL0 C;  1BF5 A;  4YGE B;  1S6J A;  1CFC A;  3OBV A;  1Y0V H;  2K7C A;  3FS7 A;  4YGD B;  3PAT A;  3GOF A;  4PDZ A;  1M39 A;  2KAX A;  4NDB A;  4GGF C;  1Y1X A;  4MN0 A;  3TDU A;  2BL0 B;  2L2C A;  3DF0 A;  1CDP A;  1UHN A;  2ZN8 A;  3CDN A;  4F7F A;  3HCM A;  3EK8 A;  1LS8 A;  2LHI A;  4DUQ A;  1KK7 Y;  1QXP A;  3RZS A;  1HQV A;  2ERB A;  1NCY A;  1S5G Z;  2JU0 A;  4DCK A;  1DJG A;  1BR4 B;  3VB1 A;  5CPV A;  4NQG A;  2JQ6 A;  3KO0 A;  1OQP A;  1TOP A;  2QEV A;  4P2Y B;  1J1D A;  1F71 A;  2LMU A;  1RK9 A;  2GGZ A;  1YRU B;  2JNF A;  1B7T Y;  5GQQ C;  2K60 A;  2L4H A;  3TUY B;  2Y4Q A;  3BOW B;  3SG2 A;  2K61 A;  1LA0 A;  3I5I C;  1ODB A;  4YGA A;  1OMR A;  4ZCU A;  1ZFS A;  4GFT A;  1S26 D;  1KK7 Z;  3A8R A;  3CYZ A;  5FI7 A;  2LM5 A;  2KFG A;  3DYE A;  1W7I B;  1TIZ A;  1XYD A;  4I5N B;  1QV0 A;  3I5I B;  1GJY A;  1CB1 A;  1FPW A;  1TCO B;  2LAN A;  5B8I B;  2LAP A;  2P70 A;  1DGV A;  3DZT A;  5G08 A;  1KFU L;  3O4Y A;  1TWO A;  2KBI A;  1B7T Z;  3R72 A;  4ETO A;  1S1E A;  3I5H C;  1P28 A;  1K8U A;  2H61 C;  1ZUZ A;  1PK0 D;  1IJ6 A;  3B6X A;  1RJV A; 
#chains in the Genus database with same CATH homology
 3EK4 A;  4MLW A;  1YUR A;  4HRE E;  1D1O A;  2OTG B;  2JPT A;  3SG6 A;  2WOR A;  1Q80 A;  4WQ2 A;  1BG1 A;  2JNX A;  1YTZ C;  1DJY A;  1C7V A;  4OV2 A;  3LCP C;  4FTG A;  2WCF A;  3PN7 B;  4DRW A;  1NWD A;  1JFK A;  1NYA A;  4N1G A;  2B1U A;  1SCM B;  2WOS A;  1KSM A;  1QAS A;  2JXC A;  3TDZ A;  1AP4 A;  2KI4 B;  1KK8 B;  5KU1 A;  3SG4 A;  5I2Q A;  4E68 A;  2BCA A;  1NIW A;  2LP2 A;  2ZKM X;  1F4O A;  1XFW O;  5F6T A;  3IQQ A;  1NSH A;  3F45 A;  4YBH B;  4MSP A;  2AUC A;  2FJU B;  1PSR A;  2JTT A;  1M31 A;  4GUK A;  2MBX A;  4N5X A;  2CT9 A;  2VRG A;  2M3W A;  2MAZ A;  1SYM A;  2EGD A;  4MRY A;  1H4B A;  1BR1 B;  4PE4 A;  1IH0 A;  4CPV A;  1EJ3 A;  1SW8 A;  3TZ1 A;  2JZI A;  1UHI A;  4JWQ A;  1WRK A;  4XJK B;  2K2F A;  4PHN A;  1OZO A;  3M0W A;  1A75 B;  3D0Y A;  4I5L B;  2F3Y A;  4GBA A;  4QJ4 B;  2SCP A;  1UUS A;  1XA5 A;  1AK8 A;  3LL8 B;  4FQO A;  2OS8 C;  5ER5 A;  1MWN A;  1TNQ A;  3VGO A;  1QTX A;  3PSR A;  2HET A;  1W7J B;  2L50 A;  3C1V A;  2SAS A;  1F4Q A;  1UWO A;  2BE6 A;  5I2L A;  5AFP A;  3O6B A;  4GGN A;  2IS9 A;  4PAL A;  3VRR A;  2LLU A;  4OR9 B;  1FI6 A;  4R1E A;  4BY5 A;  1K9P A;  3DVE A;  1GGW A;  1S3P A;  1L7Z A;  1SRA A;  1FF1 A;  2K7D A;  3HX4 A;  1KSO A;  3OB2 B;  1OZS A;  2L4I A;  1BJF A;  3AAK A;  1CFD A;  2WND A;  1A2X A;  1YUU A;  2K0J A;  4DIR A;  2I94 A;  5HKZ A;  1S6I A;  3PFV A;  1FW4 A;  2GGM A;  1MQ1 A;  3DF0 B;  2CBL A;  4M2P A;  4F0Z B;  3ZNI A;  1BOC A;  1PVB A;  3O2P A;  2BCX A;  1M63 B;  3JVT C;  5D7F A;  2RGI A;  4C0L A;  1YX7 A;  2LVV A;  1SBJ A;  1C7W A;  2LLT A;  1FI5 A;  1B47 A;  1SY9 A;  4MZJ A;  4A4B A;  1K2H A;  2KQY A;  1DJH A;  3JVT B;  5I2O A;  4NDC A;  2BKH B;  3LLE A;  2CNP A;  1NX2 A;  2TN4 A;  4HSZ A;  2BBM A;  3NXA A;  1NUB A;  2PSR A;  4HRG A;  2M7L A;  3OB1 B;  3SJS A;  2BCB A;  3TUY C;  5HLV A;  1XFU O;  2LCP A;  2ISD A;  3VRP A;  1XK4 C;  1KFX L;  1X02 A;  1J7R A;  3TDI A;  1CTR A;  1DF0 B;  4ORB B;  1EXR A;  5BPJ A;  4QJ3 B;  3GK2 A;  2KI6 C;  4Q04 A;  1JC2 A;  1JF2 A;  5K89 A;  2LV7 A;  1MHO A;  2O5G A;  1XFY O;  1MXE A;  3E3R A;  4A4C A;  3CR5 X;  3NSK A;  5CSJ A;  1WDC C;  3SIA A;  3LK0 A;  2LVK A;  2KBM A;  3LK1 A;  2MJW B;  3CZT X;  1QVI Y;  2LP3 A;  4GGF A;  3DD4 A;  1WRZ A;  2JT3 A;  3OX6 A;  4M2Q A;  5HKW A;  4C0K A;  1WDC B;  2OTG C;  2JT8 A;  1JFJ A;  2ZRT A;  1B9A A;  1QIV A;  2BE4 A;  2KI6 D;  3VRN A;  2COL B;  4DS7 A;  1N0Y A;  2A4J A;  1PUL A;  4PE7 A;  5TNC A;  4I5J A;  4QJ5 B;  1EH2 A;  1CDM A;  1IWQ A;  3PN7 C;  4YGC B;  1HT9 A;  1SCM C;  2LMT A;  2AMI A;  1DJX A;  2K2A A;  3BOW A;  1M45 A;  1J7P A;  1V1F A;  1QVI Z;  2KI4 C;  3WHU B;  1NX3 A;  1KK8 C;  2I18 A;  1XFV O;  2HQW A;  3FWB A;  1U5I B;  3KHE A;  5I8N A;  2JOJ A;  4NDD A;  2P6B B;  2KFH A;  2I2R E;  1S6C A;  3BUW B;  2H2K A;  1BU3 A;  1TTX A;  2F8P A;  2KYF A;  1TN4 A;  5JOL A;  1WRL A;  3I5G B;  4PE1 A;  1LA3 A;  2Y1M A;  4GNK B;  2LHL A;  5CSN A;  1SNL A;  2L0P A;  1TNW A;  1PSB A;  1LXF C;  1IQ3 A;  1CM1 A;  1CFF A;  1CFP A;  3CWG A;  1Y6W A;  1G8I A;  1KFU S;  4CFQ A;  1CLL A;  1DVI A;  5AXI A;  1OOJ A;  1RTP 1;  3KF9 A;  2KGR A;  3GK4 X;  1QX5 B;  3CR4 X;  4WRI A;  1QV1 A;  1QIW A;  2H61 A;  1JWD A;  4MVF A;  4D1E A;  4OCI A;  1YR5 A;  1MR8 A;  2MRD A;  2KGB C;  2CCM A;  3PAL A;  2E6W A;  2PRU A;  5PAL A;  1SKT A;  1XVJ A;  4BY4 A;  4YI9 A;  4MRX A;  3BXK A;  2KAY A;  3SIB A;  1DJZ A;  1AUI B;  1DTL A;  2JXL A;  3KEV A;  4PCW A;  2M8U A;  2L5X B;  1V1G A;  2D8N A;  1AVS A;  2KQ6 A;  1SR6 C;  2FOT A;  5CSI A;  1BLQ A;  1KWO B;  1NP8 A;  1IGV A;  1NCX A;  1YUT A;  1EG4 A;  1K93 D;  2PMY A;  2Q4U A;  4ICB A;  1TCF A;  5IBW A;  1K90 D;  3CS1 A;  3GK1 A;  3PM8 A;  1B8L A;  1R2U A;  3NSO A;  1NX1 A;  2EHB A;  1SR6 B;  1YUS A;  4GAO A;  1SMG A;  2KSP A;  2V53 A;  1K94 A;  2F2P A;  2JUL A;  1K96 A;  1F54 A;  1DJI A;  4MZL A;  2F2O A;  1OE9 B;  4MBE A;  5DKR A;  5FYX A;  1YX8 A;  1J7Q A;  4C0J A;  4XJK A;  3BQ3 A;  1PAL A;  4N1F A;  1F8H A;  1A75 A;  2I7A A;  2LC5 A;  5J3X A;  4IL1 A;  3SG7 A;  3EVR A;  3WNX B;  1E8A A;  4GPL B;  3CTN A;  1NPQ A;  1UHH A;  3EVU A;  1M46 A;  2LNK A;  3AKB A;  3H4S E;  1OSA A;  3EKH A;  4L9M A;  2L51 A;  3DVK A;  1EL4 A;  3KPX A;  4JPZ B;  3JTD B;  1C07 A;  3QRX A;  1A4P A;  1OMV A;  2K7O A;  3BUN B;  1UUR A;  3BYA A;  4PHK A;  2ZFD A;  3OHM B;  2M49 B;  1YVL A;  1ZAC A;  4I5K A;  4M2O A;  4XYN A;  3BUM B;  2G9B A;  5AAN A;  2ZNE A;  3O78 A;  1SK6 D;  2Y5I A;  3ICB A;  5DKN A;  2PAS A;  1AJ4 A;  2L2E A;  4JQ0 D;  1DGU A;  1QJT A;  2KYC A;  1PRW A;  1IG5 A;  2CTN A;  2LUX A;  1Y1U A;  2LMV A;  1UHJ A;  2JT0 A;  4AQJ A;  3CR2 A;  1L2O C;  4YGB B;  2WC8 A;  1G33 A;  3VRO A;  3WXA A;  1J55 A;  2JTZ A;  1J7O A;  3NSL A;  1L2O B;  4PHJ A;  3AKA A;  1QS7 A;  4MEW A;  2MHH A;  1OMD A;  1TNP A;  2AAO A;  1UHK A;  5HLO A;  1AJ5 A;  2PAL A;  5DKQ A;  2PVB A;  2HPS A;  1QLK A;  4P5O E;  1BT6 A;  3DVM A;  2M97 A;  1REC A;  3MSE B;  2CXJ A;  1B1G A;  4CFR A;  3IF7 A;  1VRK A;  3AAJ A;  1WY9 A;  1F70 A;  4WQ3 A;  5CSF A;  1KCY A;  2G2B A;  2WCE A;  3VRQ A;  2M29 A;  2OPO A;  1CDN A;  3EKJ A;  1LVC D;  2Y1N A;  3K21 A;  1DF0 A;  2FCE A;  1CMG A;  1YVH A;  1MUX A;  1A29 A;  4PE0 A;  1IKU A;  2GV5 A;  1TNX A;  1B4C A;  3ZWH A;  1XK4 A;  3EVV A;  1KFX S;  1B8R A;  1RFJ A;  3I5G C;  1ALW A;  1G4Y R;  4OKH A;  2K7B A;  1PVA A;  1CLB A;  1XFX O;  3EK7 A;  3NSI A;  2M0R A;  1RWY A;  1DT7 B;  5AEQ A;  2MA2 A;  1A03 A;  5D69 A;  1JSA A;  4YI8 A;  2F3Z A;  1KQV A;  3IQO A;  3I5H B;  3OX5 A;  2R2I A;  2O60 A;  2KDH A;  4HRH A;  2EC6 C;  1XO5 A;  2M7N A;  3RM1 A;  1SL7 A;  5HYD A;  2NZ0 A;  3BUX B;  3FIA A;  1EG3 A;  4USL A;  1NCZ A;  1QX2 A;  1JF0 A;  1TRF A;  2MLE C;  2JWW A;  4TNC A;  2NLN A;  2KNE A;  2LLS A;  1RRO A;  2EC6 B;  1CNP A;  3D10 A;  2NCO A;  3WHT B;  1CDL A;  4ORC B;  1JUO A;  3D0Y B;  2JC2 A;  1U5I A;  1Y1A A;  2LVI A;  2M9G A;  5HKY A;  4UPG A;  1IRJ A;  1JBA A;  1KQM C;  2ZRS A;  2BBN A;  1N65 A;  5JJG A;  1IJ5 A;  2KHN A;  1WLZ A;  3FWC A;  3PLF B;  1CMF A;  3SG3 A;  1KWO C;  1YRT B;  2LE9 B;  1K9U A;  1KQM B;  2NXQ A;  1QX7 A;  2DOQ A;  1AHR A;  1MF8 B;  1R6P A;  2L98 A;  5ER4 X;  1ZOT B;  4ZCV A;  2BEC A;  1SL9 A;  3RLZ A;  4U8D A;  2QPT A;  4CID A;  1LKJ A;  2LUC A;  1GGZ A;  1LIN A;  1K9K A;  2JRF A;  4AQI A;  1F55 A;  2Q91 A;  1N2D A;  2FCD A;  2QAC A;  3SG5 A;  4AOM A;  4CLN A;  1FBV A;  2M1K B;  1CM4 A;  3I5F C;  2ZND A;  1IQ5 A;  1SCV A;  3BUO B;  1B8C A;  3CLN A;  1DMO A;  1WLM A;  1SL8 A;  1BMO A;  2BKI B;  1H8B A;  3A4U B;  2LVJ A;  3DVJ A;  2HF5 A;  3I5F B;  4PHM A;  1DJW A;  2KFF A;  1MXL C;  4MZK A;  4YRU A;  4OVN F;  1NX0 A;  4ORA B;  3TS5 C;  2NCP A;  1CLM A;  2MLF C;  3JTD C;  1UP5 A;  2OS8 B;  2F33 A;  2M1U A;  1J1E A;  3OP0 A;  1K95 A;  2WCB A;  3TS5 B;  1ZMZ A;  2KAV A;  2ZN9 A;  1ALV A;  1QLS A;  2HQ8 A;  1CKK A;  2KOT A;  2K8M B;  1SPY A;  1GQM A;  3CGA A;  1BOD A;  1S36 A;  1QAT A;  5KTY A;  1XFZ O;  5AER A;  2E30 A;  1S5G Y;  5KSZ A;  2BL0 C;  1BF5 A;  4YGE B;  1S6J A;  1CFC A;  1Y0V H;  2K7C A;  3FS7 A;  4YGD B;  3PAT A;  3GOF A;  4PDZ A;  1M39 A;  2KAX A;  4NDB A;  4GGF C;  1Y1X A;  4MN0 A;  3TDU A;  2BL0 B;  3DF0 A;  1CDP A;  1UHN A;  2ZN8 A;  3HCM A;  3EK8 A;  2LHI A;  4DUQ A;  1KK7 Y;  1QXP A;  1HQV A;  1NCY A;  1S5G Z;  2JU0 A;  4DCK A;  1DJG A;  1BR4 B;  5CPV A;  4NQG A;  2JQ6 A;  3KO0 A;  1OQP A;  1TOP A;  4P2Y B;  1J1D A;  1F71 A;  2LMU A;  1RK9 A;  2GGZ A;  1YRU B;  2JNF A;  1B7T Y;  5GQQ C;  2L4H A;  3TUY B;  2Y4Q A;  3BOW B;  3SG2 A;  2K61 A;  1LA0 A;  3I5I C;  1ODB A;  4YGA A;  1OMR A;  4ZCU A;  1ZFS A;  4GFT A;  1S26 D;  1KK7 Z;  3A8R A;  2LM5 A;  2KFG A;  1W7I B;  1TIZ A;  1XYD A;  4I5N B;  1QV0 A;  3I5I B;  1GJY A;  1CB1 A;  1FPW A;  1TCO B;  2LAN A;  5B8I B;  2LAP A;  1DGV A;  5G08 A;  1KFU L;  3O4Y A;  2KBI A;  1B7T Z;  4ETO A;  1S1E A;  3I5H C;  1K8U A;  2H61 C;  1ZUZ A;  1PK0 D;  1IJ6 A;  1RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...