4PE7A

Crystal structure of calcium-loaded s100b bound to sc1982
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 35
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pe7A00
1KQMB 2PMYA 3DD4A 1F4QA 2HETA 1RK9A 1YTZC 1PVBA 1YURA 5DKRA 1QLKA 1DVIA 1DJXA 1KFUS 2MHHA 3CS1A 1BT6A 2D8NA 1IQ3A 4A4CA 2F3YA 2KI4B 5D7FA 4GUKA 1MR8A 1UHNA 5HKWA 4USLA 4U8DA 4ZCVA 4MZJA 4ORBB 1J55A 1SL8A 1IJ5A 1KK7Y 1WDCB 4YRUA 5KTYA 3CWGA 2LP3A 4ORCB 4I5LB 1AJ5A 4E68A 1ZUZA 5HYDA 2LVJA 1A75A 2FJUB 3VRPA 4YI8A 4OVNF 3TUYB 2WOSA 2RGIA 4XYNA 1JFKA 3EK7A 1F54A 1J7RA 2M0RA 1NIWA 2LP2A 1XFYO 4PHMA 3PLFB 2E30A 2FCEA 3KEVA 2KHNA 1A4PA 4Q04A 2JC2A 4HREE 5HKZA 1G8IA 2L2EA 1CM1A 1MQ1A 1B9AA 2PSRA 1S6CA 5TNCA 1BLQA 1CLBA 1NX3A 1S6JA 1OMDA 1SCVA 1C7WA 1KSMA 4C0JA 3SG7A 5I2QA 1HT9A 2EC6C 2KFHA 4JQ0D 2CXJA 2SCPA 1L7ZA 3VGOA 3WNXB 1IGVA 2F2PA 2KYFA 3D0YA 3LL8B 1TRFA 4MLWA 4JWQA 4BY4A 1CDMA 2K0JA 2KFGA 2A4JA 1IRJA 5ER4X 2M29A 1KFUL 1GJYA 1SYMA 5HLVA 2WCEA 1S26D 2MRDA 4TNCA 1NX1A 2BBMA 3BUNB 2KQ6A 3O78A 1IQ5A 1UWOA 2P6BB 2WNDA 1B7TY 1XVJA 1S3PA 2KFFA 2BCBA 2K7OA 3F45A 2LE9B 1C07A 3RLZA 5I8NA 3ZNIA 4DUQA 3LK1A 1MXEA 2ZRTA 3SG2A 5AANA 4GPLB 1WRLA 4M2PA 1UUSA 1LA3A 3TDZA 1F8HA 2F2OA 3QRXA 3DF0B 1ALVA 4PE4A 1YUTA 4F0ZB 5J3XA 4CIDA 1BODA 2EC6B 1DJZA 2I2RE 1FW4A 1BR4B 2WCBA 4PE0A 4PHJA 5CSNA 1H4BA 1TNXA 5FYXA 1OMRA 1FF1A 1DJYA 4AOMA 2Y1NA 1WY9A 5AFPA 2HQWA 3BXKA 5DKNA 3DVJA 3FIAA 5IBWA 1PSRA 1AK8A 4DRWA 1B1GA 2M97A 2PASA 1M45A 3A8RA 3PATA 3LK0A 1SL7A 2BKHB 3EKHA 1S5GZ 1GQMA 3LLEA 1SNLA 1AHRA 1ODBA 2KYCA 2ZN8A 1K2HA 2IS9A 3HX4A 2CCMA 2GGMA 1N65A 3BUXB 1A29A 5GQQC 1QATA 2KI6C 1QVIY 1YVHA 4CPVA 1FI5A 1M63B 4NDDA 2KDHA 3NSLA 2KOTA 1Y1AA 5DKQA 1DJHA 1ALWA 1Y1XA 2BCAA 3CR2A 1ZFSA 2M49B 1J1EA 1SW8A 2KI6D 2NCPA 1XK4C 5F6TA 1NPQA 1B8CA 1UHHA 1A03A 1UURA 2MLEC 2MBXA 1PK0D 1LKJA 3OX5A 4I5KA 1ZMZA 2H61C 1BU3A 4AQJA 3FWBA 2GGZA 1F70A 3KHEA 2LMTA 1K96A 2NXQA 1SMGA 1J7QA 1RJVA 1K9UA 2KGBC 2JU0A 2LV7A 1QV1A 4L9MA 1V1FA 1MUXA 2BCXA 2MLFC 1M31A 2L5XB 4C0KA 3SG3A 1J7OA 1BF5A 1D1OA 1EJ3A 1PSBA 2R2IA 1CTRA 1NCZA 2K8MB 1GGZA 3ICBA 2MAZA 1MF8B 3SG6A 1DF0B 2L98A 2LC5A 2LUXA 1CB1A 5D69A 2JULA 3TZ1A 3KO0A 1B7TZ 2VRGA 3O4YA 1LA0A 1TN4A 4HRGA 2M1UA 2KBMA 2QACA 2WCFA 4PDZA 3TS5C 4DCKA 1J7PA 2AMIA 2LANA 5HKYA 1SR6C 1K8UA 2JNFA 2LMUA 2L51A 1DTLA 4GGNA 2LNKA 1YRTB 2JT0A 3I5FC 3TDUA 1NYAA 2L4IA 2TN4A 3DVMA 4UPGA 2KNEA 4YI9A 1SBJA 2LM5A 2JOJA 2KBIA 3SIBA 1E8AA 2GV5A 3SJSA 1FI6A 4MVFA 1W7JB 1AVSA 1IJ6A 1DT7B 3DF0A 2M7NA 3IQQA 2G2BA 3VRQA 3TDIA 1SK6D 1R6PA 1UP5A 2K7BA 4MN0A 1V1GA 4GFTA 1H8BA 2ZFDA 3JTDC 1CMGA 5HLOA 5AEQA 4WQ3A 3I5GC 4YBHB 2JT3A 4FQOA 1Q80A 3TS5B 4PHKA 1HQVA 4YGBB 2M3WA 1RFJA 2BE6A 1SR6B 3CTNA 5PALA 4GGFC 2CT9A 1JFJA 3I5FB 2MJWB 2OS8C 3DVKA 1DJGA 1SCMC 3GK4X 2JTZA 3VROA 2KAYA 1K95A 2HQ8A 3EVRA 1XFVO 3GK2A 2ZKMX 5AXIA 1UHKA 5JOLA 1F71A 4ETOA 4OKHA 2F3ZA 3D10A 1R2UA 4MRXA 1JF2A 4XJKA 4R1EA 4MBEA 4YGDB 1Y6WA 1K9PA 3LCPC 1NX0A 1EH2A 1NCYA 1TNPA 1GGWA 1A75B 4C0LA 2LLUA 2ZRSA 2LLTA 2M8UA 3JTDB 4MZKA 4N1GA 1A2XA 3C1VA 2CTNA 1B8LA 4JPZB 1KQVA 1KSOA 3I5GB 3AAKA 2F8PA 2LHLA 1XYDA 4P2YB 2BL0C 1KCYA 1B8RA 1EL4A 1NUBA 1K94A 2M1KB 1X02A 3MSEB 1B47A 4WRIA 3SG4A 1S36A 1M39A 1S6IA 1WLZA 2JWWA 2HF5A 3BUOB 4NQGA 2K7DA 5G08A 3EVVA 2OS8B 1KK7Z 1SCMB 1ZACA 2WORA 2E6WA 5KU1A 4OR9B 1MXLC 1JSAA 1PRWA 2COLB 4MZLA 1BMOA 1NSHA 5CSFA 1EXRA 3VRRA 3PFVA 5AERA 3OHMB 1G33A 1QASA 4PE7A 1DF0A 3JVTC 2JZIA 1U5IB 3OB2B 3A4UB 3FWCA 1YR5A 1VRKA 2ZNDA 2JT8A 4PHNA 1XK4A 1TCFA 1KWOC 2K7CA 3EVUA 4DIRA 4QJ3B 2BL0B 1K90D 1QTXA 2O5GA 2WC8A 4HSZA 3KPXA 3M0WA 1NX2A 2CNPA 2H61A 2SASA 3BOWB 3BQ3A 2M7LA 4ORAB 1JF0A 3GOFA 4CFQA 1M46A 3FS7A 1XA5A 3BUMB 4CLNA 1OZSA 1BOCA 2F33A 3H4SE 4NDBA 1FBVA 1OOJA 2DOQA 3BYAA 4WQ2A 3DVEA 4DS7A 1QX7A 3EKJA 2Q91A 1F4OA 1CFCA 1B4CA 4I5NB 3PN7C 2KAXA 1PULA 2KQYA 1JBAA 2KSPA 2JXLA 2G9BA 1CKKA 2FOTA 2PVBA 3JVTB 5ER5A 4MEWA 3ZWHA 1LINA 1OSAA 1SKTA 5JJGA 1NP8A 2AAOA 2LAPA 3KF9A 3NSIA 1W7IB 3NSOA 3PM8A 1MWNA 1KWOB 4I5JA 1SL9A 1YUUA 1YX7A 3EK8A 3PSRA 1LVCD 4BY5A 3I5IC 4M2OA 4CFRA 1K9KA 2JXCA 3CR4X 3WHTB 1JUOA 1Y1UA 2ZNEA 1L2OC 1RTP1 1DGUA 3VRNA 1EG3A 1PALA 2O60A 4QJ4B 5I2LA 2H2KA 4PALA 1G4YR 1S5GY 2L50A 1OMVA 2MA2A 2PRUA 3NSKA 2NZ0A 4IL1A 4D1EA 4YGAA 1QXPA 2L0PA 4MRYA 1QIWA 1XFUO 1J1DA 3PN7B 1N2DA 5K89A 1NWDA 1JWDA 5B8IB 1UHIA 1QS7A 3AAJA 1QX5B 1AP4A 1OZOA 3RM1A 3CR5X 4HRHA 2EGDA 2JNXA 1RWYA 2Q4UA 3AKBA 4NDCA 1XO5A 3BUWB 3OB1B 1TNWA 2JRFA 1XFWO 1QLSA 4ZCUA 1XFZO 3I5IB 4FTGA 1YVLA 2Y5IA 4GGFA 4N5XA 4M2QA 1FPWA 1L2OB 1YX8A 1CDNA 2Y4QA 4P5OE 1QVIZ 1TNQA 1ZOTB 2ISDA 3SIAA 1SPYA 1LXFC 1DJWA 1CDLA 2Y1MA 1KFXS 2AUCA 1PVAA 1KK8C 3AKAA 4A4BA 2KAVA 1N0YA 1TOPA 1NCXA 3OX6A 3CZTX 1U5IA 2K61A 1OE9B 2QPTA 1F55A 4N1FA 1DJIA 3O6BA 4GBAA 1S1EA 1CM4A 3E3RA 1C7VA 5I2OA 1IH0A 2BECA 2LLSA 1MHOA 1QIVA 1OQPA 2CBLA 2PALA 4GNKB 2V53A 1CFPA 4OCIA 3BOWA 3CLNA 1Y0VH 1QJTA 4ICBA 1BJFA 2LVVA 1TIZA 2LHIA 3EK4A 3CGAA 5CSIA 1DGVA 2BE4A 1CDPA 2NCOA 3I5HC 2JTTA 1RECA 2JQ6A 1WRZA 2HPSA 1AUIB 1KK8B 2JPTA 1TTXA 1WRKA 2OTGC 2FCDA 3IQOA 1DMOA 1YRUB 3D0YB 3GK1A 1SRAA 1QV0A 1YUSA 4PCWA 5BPJA 1KQMC 2NLNA 3K21A 3HCMA 2BBNA 3SG5A 4OV2A 4AQIA 1IWQA 1CFFA 1JC2A 1RROA 5CSJA 2EHBA 1TCOB 3NXAA 5KSZA 2LUCA 2I18A 1IG5A 4MSPA 2K2FA 1CLMA 5CPVA 3OP0A 4GAOA 1CFDA 2KI4C 4PE1A 4QJ5B 1CMFA 1AJ4A 1KFXL 2LMVA 1K93D 2LVKA 3PALA 3WHUB 2B1UA 1EG4A 1WDCC 4YGEB 1QX2A 1IKUA 1XFXO 3I5HB 4XJKB 2BKIB 2OPOA 4YGCB 2ZN9A 1CNPA 1BG1A 3O2PA 1WLMA 2M9GA 3IF7A 2KGRA 1UHJA 2LCPA 2I94A 2I7AA 2L4HA 3TUYC 2OTGB 1SY9A 1CLLA 2K2AA 3WXAA 2LVIA 1BR1B
chains in the Genus database with same CATH superfamily
1KQMB 2KLDA 2PMYA 3DD4A 1F4QA 2HETA 1RK9A 3S0GA 1YTZC 1PVBA 1YURA 5DKRA 2BAPA 1QLKA 1DVIA 1DJXA 1KFUS 2MHHA 3CS1A 3B86A 1BT6A 2D8NA 3B7AA 1IQ3A 4A4CA 3D78A 2F3YA 2KI4B 5D7FA 4GUKA 1MR8A 1UHNA 5HKWA 4USLA 4U8DA 4ZCVA 4MZJA 2WC6A 3Q8IA 1J55A 1SL8A 4ORBB 1IJ5A 1KK7Y 1WDCB 4YRUA 5KTYA 3CWGA 2LP3A 4ORCB 4I5LB 1AJ5A 1OW4A 4E68A 1ZUZA 5HYDA 3R1PA 2LVJA 1A75A 2FJUB 3VRPA 4YI8A 4OVNF 3TUYB 2WOSA 2RGIA 4XYNA 1JFKA 2ERBA 3EK7A 1F54A 1J7RA 2M0RA 1NIWA 2LP2A 1XFYO 4PT1A 4PHMA 3PLFB 4JD9A 3BFBA 2E30A 2FCEA 3KEVA 2KHNA 1A4PA 2PYQA 4Q04A 2JC2A 4HREE 5HKZA 1G8IA 2L2EA 1CM1A 3RZSA 1MQ1A 1B9AA 2PSRA 1S6CA 5TNCA 1BLQA 1CLBA 3DYEA 1NX3A 1S6JA 1OMDA 1SCVA 1C7WA 1KSMA 3EG5B 3SS5A 4C0JA 1TWOA 3SG7A 5I2QA 1HT9A 2EC6C 2KFHA 4JQ0D 2CXJA 2SCPA 1L7ZA 3VGOA 3WNXB 1IGVA 2F2PA 2KYFA 3D0YA 3LL8B 1TRFA 4MLWA 4JWQA 4BY4A 1CDMA 2K0JA 2KFGA 2A4JA 1IRJA 5ER4X 2M29A 1KFUL 1GJYA 1SYMA 5HLVA 3R1VA 2WCEA 1S26D 2MRDA 4TNCA 1NX1A 5FI2A 2BBMA 2YGUA 3BUNB 2KQ6A 3O78A 1IQ5A 1UWOA 2P6BB 2WNDA 1B7TY 1XVJA 1S3PA 2KFFA 2WC5A 2BCBA 3BFHA 2K7OA 3F45A 2LE9B 3CABA 1C07A 5I94A 3RLZA 5I8NA 3ZNIA 4DUQA 3LK1A 1OOGA 1MXEA 2K60A 2ZRTA 3D77A 3SG2A 5AANA 4GPLB 1DC1A 1WRLA 4M2PA 1UUSA 1LA3A 3TDZA 1F8HA 2F2OA 3QRXA 2GTEA 3DF0B 1ALVA 4PE4A 2WCJA 1YUTA 4F0ZB 5J3XA 4CIDA 1BODA 2EC6B 1DJZA 2I2RE 1FW4A 1BR4B 2WCBA 4PE0A 4PHJA 5CSNA 1H4BA 1TNXA 5FYXA 2WCMA 1OMRA 1FF1A 2PQLA 1DJYA 3S0AA 4AOMA 2Y1NA 1WY9A 5AFPA 2HQWA 3BXKA 5DKNA 3DVJA 3FIAA 5IBWA 1PSRA 1AK8A 4DRWA 1B1GA 2M97A 2PASA 1M45A 2L2CA 3A8RA 3PATA 3S0EA 3LK0A 1SL7A 2BKHB 3EKHA 1S5GZ 1GQMA 3LLEA 1SNLA 1AHRA 1ODBA 2KYCA 2ZN8A 3PJIA 2IS9A 1K2HA 3HX4A 2CCMA 2GGMA 1N65A 3CDNA 1C3YA 3BUXB 1A29A 5GQQC 1OOHA 1QATA 1QVIY 2KI6C 3NHIA 1YVHA 4CPVA 1FI5A 1M63B 4NDDA 2KDHA 3NSLA 2KOTA 5D3OA 1Y1AA 3D75A 5DKQA 1DJHA 1ALWA 1Y1XA 2BCAA 3CR2A 1ZFSA 2M49B 1J1EA 1SW8A 2KI6D 2NCPA 1XK4C 5F6TA 1NPQA 1B8CA 1UHHA 1A03A 1UURA 2MLEC 2MBXA 1PK0D 1LKJA 3OX5A 4I5KA 1ZMZA 2H61C 4IJ7A 5FI6A 1BU3A 4AQJA 3FWBA 2GGZA 1F70A 3KHEA 2LMTA 1K96A 2NXQA 1SMGA 1J7QA 1RJVA 1K9UA 2KGBC 2JU0A 2LV7A 1QV1A 3K1EA 4L9MA 1V1FA 1MUXA 2BCXA 2MLFC 1M31A 2L5XB 4C0KA 3SG3A 1J7OA 1BF5A 1D1OA 1EJ3A 1PSBA 2R2IA 1CTRA 1NCZA 2K8MB 1GGZA 3ICBA 2MAZA 1MF8B 3SG6A 1DF0B 2L98A 2LC5A 2LUXA 1CB1A 5D69A 1TUZA 2JULA 3TZ1A 3KO0A 1B7TZ 2VRGA 3O4YA 1LA0A 5DICA 1TN4A 4HRGA 2M1UA 2KBMA 2QACA 2WCFA 4PDZA 3TS5C 4DCKA 1J7PA 2AMIA 2LANA 5HKYA 1SR6C 1K8UA 3CZ0A 2JNFA 2LMUA 2L51A 1DTLA 4GGNA 2LNKA 1YRTB 2JT0A 3I5FC 3TDUA 1NYAA 2L4IA 2TN4A 3DVMA 4UPGA 2KNEA 4YI9A 1TUJA 1SBJA 2LM5A 2JOJA 2KBIA 3SIBA 1E8AA 2GV5A 3SJSA 1FI6A 4MVFA 1W7JB 1AVSA 1IJ6A 3N7HA 1DT7B 3DF0A 2M7NA 3IQQA 2G2BA 3VRQA 3TDIA 1SK6D 1R6PA 1UP5A 2K7BA 4MN0A 1V1GA 4GFTA 1H8BA 2ZFDA 3JTDC 2FJYA 1CMGA 5HLOA 5AEQA 4WQ3A 3BFAA 3S0BA 3I5GC 4YBHB 2JT3A 4FQOA 1Q80A 3TS5B 4PHKA 1HQVA 4YGBB 2M3WA 1RFJA 2BE6A 1SR6B 3CTNA 5PALA 4GGFC 2CT9A 1JFJA 3I5FB 2MJWB 2OS8C 3DVKA 1DJGA 1SCMC 3GK4X 2JTZA 3VROA 2KAYA 1K95A 2HQ8A 2BNXA 3EVRA 1XFVO 3GK2A 2ZKMX 5AXIA 1UHKA 5JOLA 1F71A 3D76A 4ETOA 4OKHA 2F3ZA 3D10A 1R2UA 4MRXA 1JF2A 4XJKA 4R1EA 4MBEA 4YGDB 1Y6WA 1K9PA 3LCPC 1NX0A 3D73A 1EH2A 1NCYA 1TNPA 1GGWA 1A75B 4C0LA 2LLUA 2WCHA 2ZRSA 2LLTA 2M8UA 2WCKA 3L4LA 3JTDB 4MZKA 2P71A 4N1GA 1A2XA 3C1VA 2CTNA 1B8LA 2QDIA 4JPZB 3SS4A 1Z4HA 1KQVA 1KSOA 3I5GB 3AAKA 2F8PA 2LHLA 1XYDA 4P2YB 2BL0C 1KCYA 1B8RA 1EL4A 1NUBA 1K94A 2M1KB 1X02A 3MSEB 1B47A 4WRIA 3SG4A 3VB1A 1S36A 1M39A 1S6IA 1WLZA 2JWWA 2HF5A 3BUOB 3R1OA 2K7DA 4NQGA 5G08A 3EVVA 2OS8B 1KK7Z 1SCMB 1ZACA 2WORA 2E6WA 5KU1A 4OR9B 1MXLC 1JSAA 1PRWA 2KPHA 2COLB 4MZLA 1BMOA 3DY9A 1NSHA 5CSFA 1EXRA 3VRRA 3PFVA 5AERA 3OHMB 1G33A 1QASA 4PE7A 1DF0A 3JVTC 2JZIA 3QMEA 3S0FA 3SS3A 1U5IB 3OB2B 1W9ZA 3A4UB 3FWCA 1YR5A 1VRKA 3CZ2A 2ZNDA 2JT8A 4PHNA 1XK4A 1TCFA 1KWOC 1QWVA 2K7CA 3EVUA 3CYZA 4DIRA 4QJ3B 2BL0B 1K90D 1QTXA 2O5GA 2WC8A 1ORGA 4HSZA 3L4AA 3DXLA 3KPXA 1T14A 1NX2A 2CNPA 2H61A 2L5YA 2SASA 3BOWB 3BQ3A 3M0WA 2M7LA 4ORAB 1JF0A 3GOFA 4CFQA 1M46A 3FS7A 1XA5A 3BUMB 4CLNA 1OZSA 2QEVA 1BOCA 2F33A 3H4SE 4NDBA 2JPOA 1FBVA 1OOJA 2DOQA 3BYAA 3PM2A 3DVEA 4WQ2A 1QX7A 3EKJA 4DS7A 4INWA 2Q91A 1F4OA 1CFCA 1B4CA 4I5NB 3PN7C 2KAXA 3L47A 1PULA 2KQYA 1JBAA 2KSPA 2JXLA 2G9BA 1CKKA 2FOTA 2PVBA 3JVTB 5ER5A 1P28A 4MEWA 3ZWHA 1LINA 1OSAA 1SKTA 5JJGA 1NP8A 2AAOA 2LAPA 1OOFA 3KF9A 3NSIA 1W7IB 3NSOA 3PM8A 1MWNA 2QEHA 1KWOB 4I5JA 1SL9A 1YUUA 1YX7A 3EK8A 3PSRA 1LVCD 2WCLA 3I5IC 4BY5A 4M2OA 4CFRA 1K9KA 2JXCA 3CR4X 3WHTB 1JUOA 1Y1UA 2ZNEA 1L2OC 1RTP1 1DGUA 3VRNA 1EG3A 1PALA 2O60A 4QJ4B 5I2LA 4KYNA 2H2KA 4PALA 2QEOA 1G4YR 1S5GY 2L50A 1OMVA 2MA2A 3FE6A 3OBVA 2PRUA 5EL2A 3NSKA 2NZ0A 4IL1A 4D1EA 4YGAA 1QXPA 2L0PA 4MRYA 1QIWA 1XFUO 1J1DA 3PN7B 1N2DA 5K89A 1NWDA 4F7FA 1JWDA 5B8IB 1UHIA 1QS7A 2H8VA 1QX5B 3AAJA 2P70A 1AP4A 1OZOA 3RM1A 3CR5X 4HRHA 2EGDA 2JNXA 1RWYA 2Q4UA 3AKBA 4NDCA 1XO5A 3B88A 3BUWB 3OB1B 1TNWA 2JRFA 1XFWO 3BJHA 1QLSA 3B6XA 4ZCUA 1XFZO 3I5IB 4FTGA 1YVLA 2Y5IA 4GGFA 4N5XA 3S0DA 4M2QA 1FPWA 1L2OB 3IVTA 1YX8A 3UO9A 1Z2CB 2Y4QA 1QVIZ 1TNQA 1XFRA 1ZOTB 4P5OE 1CDNA 2ISDA 3SIAA 4OZDA 1SPYA 1LXFC 1DJWA 1CDLA 2Y1MA 1KFXS 2AUCA 1PVAA 1DEKA 1KK8C 3AKAA 4A4BA 2KAVA 1N0YA 1TOPA 3NHTA 1NCXA 3OX6A 1SSEB 3CZTX 1U5IA 2K61A 1OE9B 2QPTA 1F55A 4N1FA 1DJIA 3O6BA 3B87A 5FI7A 4GBAA 1S1EA 1CM4A 5HL1A 3E3RA 1C7VA 5I2OA 1IH0A 2BECA 2LLSA 1MHOA 1QIVA 1OOIX 1OQPA 2CBLA 2PALA 2QEBA 2V53A 4GNKB 4OCIA 1CFPA 3BOWA 2KLEA 3CLNA 1Y0VH 1QJTA 4ICBA 1BJFA 2LVVA 1C3ZA 1TIZA 2LHIA 3EK4A 3CGAA 3OGNA 5CSIA 1DGVA 1LS8A 2BE4A 1CDPA 2NCOA 3I5HC 1GM0A 2JTTA 1RECA 2JQ6A 1WRZA 2HPSA 3FE8A 1IIOA 3UNWA 1AUIB 1KK8B 4FQTA 2JPTA 1TTXA 1WRKA 2OTGC 1DELA 2FCDA 3IQOA 1DMOA 1YRUB 3D0YB 3GK1A 3FE9A 1SRAA 1QV0A 1YUSA 4PCWA 5BPJA 1KQMC 2NLNA 3K21A 3HCMA 2BBNA 3SG5A 3D74A 3O4XA 4OV2A 4AQIA 1IWQA 1CFFA 1JC2A 1RROA 5CSJA 2EHBA 1TCOB 3NXAA 5KSZA 2LUCA 2I18A 1IG5A 4MSPA 1DQEA 1CLMA 2K2FA 5CPVA 3OP0A 4GAOA 1CFDA 2KI4C 4PE1A 4QJ5B 1CMFA 1AJ4A 1KFXL 2LMVA 3NGVA 1K93D 2LVKA 3PALA 3WHUB 2B1UA 1EG4A 1WDCC 4YGEB 1QX2A 1IKUA 1XFXO 3I5HB 4XJKB 2BKIB 2OPOA 4YGCB 2ZN9A 1CNPA 1BG1A 3O2PA 4JKTA 1WLMA 3V2LA 2M9GA 3IF7A 2KGRA 1UHJA 2LCPA 2I94A 2I7AA 3R72A 2L4HA 3TUYC 2OTGB 4INXA 3CZ1A 1SY9A 1CLLA 3DZTA 2K2AA 3WXAA 2LVIA 1BR1B
chains in the Genus database with same CATH topology
1KQMB 2PMYA 3DD4A 1F4QA 2HETA 1RK9A 1YTZC 1PVBA 1YURA 5DKRA 1QLKA 1DVIA 1DJXA 1KFUS 2MHHA 3CS1A 1BT6A 2D8NA 1IQ3A 4A4CA 2F3YA 2KI4B 5D7FA 4GUKA 1MR8A 1UHNA 5HKWA 4USLA 4U8DA 4ZCVA 4MZJA 4ORBB 1J55A 1SL8A 1IJ5A 1KK7Y 1WDCB 4YRUA 5KTYA 3CWGA 2LP3A 4ORCB 4I5LB 1AJ5A 4E68A 1ZUZA 5HYDA 2LVJA 1A75A 2FJUB 3VRPA 4YI8A 4OVNF 3TUYB 2WOSA 2RGIA 4XYNA 1JFKA 3EK7A 1F54A 1J7RA 2M0RA 1NIWA 2LP2A 1XFYO 4PHMA 3PLFB 2E30A 2FCEA 3KEVA 2KHNA 1A4PA 4Q04A 2JC2A 4HREE 5HKZA 1G8IA 2L2EA 1CM1A 1MQ1A 1B9AA 2PSRA 1S6CA 5TNCA 1BLQA 1CLBA 1NX3A 1S6JA 1OMDA 1SCVA 1C7WA 1KSMA 4C0JA 3SG7A 5I2QA 1HT9A 2EC6C 2KFHA 4JQ0D 2CXJA 2SCPA 1L7ZA 3VGOA 3WNXB 1IGVA 2F2PA 2KYFA 3D0YA 3LL8B 1TRFA 4MLWA 4JWQA 4BY4A 1CDMA 2K0JA 2KFGA 2A4JA 1IRJA 5ER4X 2M29A 1KFUL 1GJYA 1SYMA 5HLVA 2WCEA 1S26D 2MRDA 4TNCA 1NX1A 2BBMA 3BUNB 2KQ6A 3O78A 1IQ5A 1UWOA 2P6BB 2WNDA 1B7TY 1XVJA 1S3PA 2KFFA 2BCBA 2K7OA 3F45A 2LE9B 1C07A 3RLZA 5I8NA 3ZNIA 4DUQA 3LK1A 1MXEA 2ZRTA 3SG2A 5AANA 4GPLB 1WRLA 4M2PA 1UUSA 1LA3A 3TDZA 1F8HA 2F2OA 3QRXA 3DF0B 1ALVA 4PE4A 1YUTA 4F0ZB 5J3XA 4CIDA 1BODA 2EC6B 1DJZA 2I2RE 1FW4A 1BR4B 2WCBA 4PE0A 4PHJA 5CSNA 1H4BA 1TNXA 5FYXA 1OMRA 1FF1A 1DJYA 4AOMA 2Y1NA 1WY9A 5AFPA 2HQWA 3BXKA 5DKNA 3DVJA 3FIAA 5IBWA 1PSRA 1AK8A 4DRWA 1B1GA 2M97A 2PASA 1M45A 3A8RA 3PATA 3LK0A 1SL7A 2BKHB 3EKHA 1S5GZ 1GQMA 3LLEA 1SNLA 1AHRA 1ODBA 2KYCA 2ZN8A 1K2HA 2IS9A 3HX4A 2CCMA 2GGMA 1N65A 3BUXB 1A29A 5GQQC 1QATA 2KI6C 1QVIY 1YVHA 4CPVA 1FI5A 1M63B 4NDDA 2KDHA 3NSLA 2KOTA 1Y1AA 5DKQA 1DJHA 1ALWA 1Y1XA 2BCAA 3CR2A 1ZFSA 2M49B 1J1EA 1SW8A 2KI6D 2NCPA 1XK4C 5F6TA 1NPQA 1B8CA 1UHHA 1A03A 1UURA 2MLEC 2MBXA 1PK0D 1LKJA 3OX5A 4I5KA 1ZMZA 2H61C 1BU3A 4AQJA 3FWBA 2GGZA 1F70A 3KHEA 2LMTA 1K96A 2NXQA 1SMGA 1J7QA 1RJVA 1K9UA 2KGBC 2JU0A 2LV7A 1QV1A 4L9MA 1V1FA 1MUXA 2BCXA 2MLFC 1M31A 2L5XB 4C0KA 3SG3A 1J7OA 1BF5A 1D1OA 1EJ3A 1PSBA 2R2IA 1CTRA 1NCZA 2K8MB 1GGZA 3ICBA 2MAZA 1MF8B 3SG6A 1DF0B 2L98A 2LC5A 2LUXA 1CB1A 5D69A 2JULA 3TZ1A 3KO0A 1B7TZ 2VRGA 3O4YA 1LA0A 1TN4A 4HRGA 2M1UA 2KBMA 2QACA 2WCFA 4PDZA 3TS5C 4DCKA 1J7PA 2AMIA 2LANA 5HKYA 1SR6C 1K8UA 2JNFA 2LMUA 2L51A 1DTLA 4GGNA 2LNKA 1YRTB 2JT0A 3I5FC 3TDUA 1NYAA 2L4IA 2TN4A 3DVMA 4UPGA 2KNEA 4YI9A 1SBJA 2LM5A 2JOJA 2KBIA 3SIBA 1E8AA 2GV5A 3SJSA 1FI6A 4MVFA 1W7JB 1AVSA 1IJ6A 1DT7B 3DF0A 2M7NA 3IQQA 2G2BA 3VRQA 3TDIA 1SK6D 1R6PA 1UP5A 2K7BA 4MN0A 1V1GA 4GFTA 1H8BA 2ZFDA 3JTDC 1CMGA 5HLOA 5AEQA 4WQ3A 3I5GC 4YBHB 2JT3A 4FQOA 1Q80A 3TS5B 4PHKA 1HQVA 4YGBB 2M3WA 1RFJA 2BE6A 1SR6B 3CTNA 5PALA 4GGFC 2CT9A 1JFJA 3I5FB 2MJWB 2OS8C 3DVKA 1DJGA 1SCMC 3GK4X 2JTZA 3VROA 2KAYA 1K95A 2HQ8A 3EVRA 1XFVO 3GK2A 2ZKMX 5AXIA 1UHKA 5JOLA 1F71A 4ETOA 4OKHA 2F3ZA 3D10A 1R2UA 4MRXA 1JF2A 4XJKA 4R1EA 4MBEA 4YGDB 1Y6WA 1K9PA 3LCPC 1NX0A 1EH2A 1NCYA 1TNPA 1GGWA 1A75B 4C0LA 2LLUA 2ZRSA 2LLTA 2M8UA 3JTDB 4MZKA 4N1GA 1A2XA 3C1VA 2CTNA 1B8LA 4JPZB 1KQVA 1KSOA 3I5GB 3AAKA 2F8PA 2LHLA 1XYDA 4P2YB 2BL0C 1KCYA 1B8RA 1EL4A 1NUBA 1K94A 2M1KB 1X02A 3MSEB 1B47A 4WRIA 3SG4A 1S36A 1M39A 1S6IA 1WLZA 2JWWA 2HF5A 3BUOB 4NQGA 2K7DA 5G08A 3EVVA 2OS8B 1KK7Z 1SCMB 1ZACA 2WORA 2E6WA 5KU1A 4OR9B 1MXLC 1JSAA 1PRWA 2COLB 4MZLA 1BMOA 1NSHA 5CSFA 1EXRA 3VRRA 3PFVA 5AERA 3OHMB 1G33A 1QASA 4PE7A 1DF0A 3JVTC 2JZIA 1U5IB 3OB2B 3A4UB 3FWCA 1YR5A 1VRKA 2ZNDA 2JT8A 4PHNA 1XK4A 1TCFA 1KWOC 2K7CA 3EVUA 4DIRA 4QJ3B 2BL0B 1K90D 1QTXA 2O5GA 2WC8A 4HSZA 3KPXA 3M0WA 1NX2A 2CNPA 2H61A 2SASA 3BOWB 3BQ3A 2M7LA 4ORAB 1JF0A 3GOFA 4CFQA 1M46A 3FS7A 1XA5A 3BUMB 4CLNA 1OZSA 1BOCA 2F33A 3H4SE 4NDBA 1FBVA 1OOJA 2DOQA 3BYAA 4WQ2A 3DVEA 4DS7A 1QX7A 3EKJA 2Q91A 1F4OA 1CFCA 1B4CA 4I5NB 3PN7C 2KAXA 1PULA 2KQYA 1JBAA 2KSPA 2JXLA 2G9BA 1CKKA 2FOTA 2PVBA 3JVTB 5ER5A 4MEWA 3ZWHA 1LINA 1OSAA 1SKTA 5JJGA 1NP8A 2AAOA 2LAPA 3KF9A 3NSIA 1W7IB 3NSOA 3PM8A 1MWNA 1KWOB 4I5JA 1SL9A 1YUUA 1YX7A 3EK8A 3PSRA 1LVCD 4BY5A 3I5IC 4M2OA 4CFRA 1K9KA 2JXCA 3CR4X 3WHTB 1JUOA 1Y1UA 2ZNEA 1L2OC 1RTP1 1DGUA 3VRNA 1EG3A 1PALA 2O60A 4QJ4B 5I2LA 2H2KA 4PALA 1G4YR 1S5GY 2L50A 1OMVA 2MA2A 2PRUA 3NSKA 2NZ0A 4IL1A 4D1EA 4YGAA 1QXPA 2L0PA 4MRYA 1QIWA 1XFUO 1J1DA 3PN7B 1N2DA 5K89A 1NWDA 1JWDA 5B8IB 1UHIA 1QS7A 3AAJA 1QX5B 1AP4A 1OZOA 3RM1A 3CR5X 4HRHA 2EGDA 2JNXA 1RWYA 2Q4UA 3AKBA 4NDCA 1XO5A 3BUWB 3OB1B 1TNWA 2JRFA 1XFWO 1QLSA 4ZCUA 1XFZO 3I5IB 4FTGA 1YVLA 2Y5IA 4GGFA 4N5XA 4M2QA 1FPWA 1L2OB 1YX8A 1CDNA 2Y4QA 4P5OE 1QVIZ 1TNQA 1ZOTB 2ISDA 3SIAA 1SPYA 1LXFC 1DJWA 1CDLA 2Y1MA 1KFXS 2AUCA 1PVAA 1KK8C 3AKAA 4A4BA 2KAVA 1N0YA 1TOPA 1NCXA 3OX6A 3CZTX 1U5IA 2K61A 1OE9B 2QPTA 1F55A 4N1FA 1DJIA 3O6BA 4GBAA 1S1EA 1CM4A 3E3RA 1C7VA 5I2OA 1IH0A 2BECA 2LLSA 1MHOA 1QIVA 1OQPA 2CBLA 2PALA 4GNKB 2V53A 1CFPA 4OCIA 3BOWA 3CLNA 1Y0VH 1QJTA 4ICBA 1BJFA 2LVVA 1TIZA 2LHIA 3EK4A 3CGAA 5CSIA 1DGVA 2BE4A 1CDPA 2NCOA 3I5HC 2JTTA 1RECA 2JQ6A 1WRZA 2HPSA 1AUIB 1KK8B 2JPTA 1TTXA 1WRKA 2OTGC 2FCDA 3IQOA 1DMOA 1YRUB 3D0YB 3GK1A 1SRAA 1QV0A 1YUSA 4PCWA 5BPJA 1KQMC 2NLNA 3K21A 3HCMA 2BBNA 3SG5A 4OV2A 4AQIA 1IWQA 1CFFA 1JC2A 1RROA 5CSJA 2EHBA 1TCOB 3NXAA 5KSZA 2LUCA 2I18A 1IG5A 4MSPA 2K2FA 1CLMA 5CPVA 3OP0A 4GAOA 1CFDA 2KI4C 4PE1A 4QJ5B 1CMFA 1AJ4A 1KFXL 2LMVA 1K93D 2LVKA 3PALA 3WHUB 2B1UA 1EG4A 1WDCC 4YGEB 1QX2A 1IKUA 1XFXO 3I5HB 4XJKB 2BKIB 2OPOA 4YGCB 2ZN9A 1CNPA 1BG1A 3O2PA 1WLMA 2M9GA 3IF7A 2KGRA 1UHJA 2LCPA 2I94A 2I7AA 2L4HA 3TUYC 2OTGB 1SY9A 1CLLA 2K2AA 3WXAA 2LVIA 1BR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQM B;  2PMY A;  3DD4 A;  1F4Q A;  2HET A;  1RK9 A;  1YTZ C;  1PVB A;  1YUR A;  5DKR A;  1QLK A;  1DVI A;  1DJX A;  1KFU S;  2MHH A;  3CS1 A;  1BT6 A;  2D8N A;  1IQ3 A;  4A4C A;  2F3Y A;  2KI4 B;  5D7F A;  4GUK A;  1MR8 A;  1UHN A;  5HKW A;  4USL A;  4U8D A;  4ZCV A;  4MZJ A;  4ORB B;  1J55 A;  1SL8 A;  1IJ5 A;  1KK7 Y;  1WDC B;  4YRU A;  5KTY A;  3CWG A;  2LP3 A;  4ORC B;  4I5L B;  1AJ5 A;  4E68 A;  1ZUZ A;  5HYD A;  2LVJ A;  1A75 A;  2FJU B;  3VRP A;  4YI8 A;  4OVN F;  3TUY B;  2WOS A;  2RGI A;  4XYN A;  1JFK A;  3EK7 A;  1F54 A;  1J7R A;  2M0R A;  1NIW A;  2LP2 A;  1XFY O;  4PHM A;  3PLF B;  2E30 A;  2FCE A;  3KEV A;  2KHN A;  1A4P A;  4Q04 A;  2JC2 A;  4HRE E;  5HKZ A;  1G8I A;  2L2E A;  1CM1 A;  1MQ1 A;  1B9A A;  2PSR A;  1S6C A;  5TNC A;  1BLQ A;  1CLB A;  1NX3 A;  1S6J A;  1OMD A;  1SCV A;  1C7W A;  1KSM A;  4C0J A;  3SG7 A;  5I2Q A;  1HT9 A;  2EC6 C;  2KFH A;  4JQ0 D;  2CXJ A;  2SCP A;  1L7Z A;  3VGO A;  3WNX B;  1IGV A;  2F2P A;  2KYF A;  3D0Y A;  3LL8 B;  1TRF A;  4MLW A;  4JWQ A;  4BY4 A;  1CDM A;  2K0J A;  2KFG A;  2A4J A;  1IRJ A;  5ER4 X;  2M29 A;  1KFU L;  1GJY A;  1SYM A;  5HLV A;  2WCE A;  1S26 D;  2MRD A;  4TNC A;  1NX1 A;  2BBM A;  3BUN B;  2KQ6 A;  3O78 A;  1IQ5 A;  1UWO A;  2P6B B;  2WND A;  1B7T Y;  1XVJ A;  1S3P A;  2KFF A;  2BCB A;  2K7O A;  3F45 A;  2LE9 B;  1C07 A;  3RLZ A;  5I8N A;  3ZNI A;  4DUQ A;  3LK1 A;  1MXE A;  2ZRT A;  3SG2 A;  5AAN A;  4GPL B;  1WRL A;  4M2P A;  1UUS A;  1LA3 A;  3TDZ A;  1F8H A;  2F2O A;  3QRX A;  3DF0 B;  1ALV A;  4PE4 A;  1YUT A;  4F0Z B;  5J3X A;  4CID A;  1BOD A;  2EC6 B;  1DJZ A;  2I2R E;  1FW4 A;  1BR4 B;  2WCB A;  4PE0 A;  4PHJ A;  5CSN A;  1H4B A;  1TNX A;  5FYX A;  1OMR A;  1FF1 A;  1DJY A;  4AOM A;  2Y1N A;  1WY9 A;  5AFP A;  2HQW A;  3BXK A;  5DKN A;  3DVJ A;  3FIA A;  5IBW A;  1PSR A;  1AK8 A;  4DRW A;  1B1G A;  2M97 A;  2PAS A;  1M45 A;  3A8R A;  3PAT A;  3LK0 A;  1SL7 A;  2BKH B;  3EKH A;  1S5G Z;  1GQM A;  3LLE A;  1SNL A;  1AHR A;  1ODB A;  2KYC A;  2ZN8 A;  1K2H A;  2IS9 A;  3HX4 A;  2CCM A;  2GGM A;  1N65 A;  3BUX B;  1A29 A;  5GQQ C;  1QAT A;  2KI6 C;  1QVI Y;  1YVH A;  4CPV A;  1FI5 A;  1M63 B;  4NDD A;  2KDH A;  3NSL A;  2KOT A;  1Y1A A;  5DKQ A;  1DJH A;  1ALW A;  1Y1X A;  2BCA A;  3CR2 A;  1ZFS A;  2M49 B;  1J1E A;  1SW8 A;  2KI6 D;  2NCP A;  1XK4 C;  5F6T A;  1NPQ A;  1B8C A;  1UHH A;  1A03 A;  1UUR A;  2MLE C;  2MBX A;  1PK0 D;  1LKJ A;  3OX5 A;  4I5K A;  1ZMZ A;  2H61 C;  1BU3 A;  4AQJ A;  3FWB A;  2GGZ A;  1F70 A;  3KHE A;  2LMT A;  1K96 A;  2NXQ A;  1SMG A;  1J7Q A;  1RJV A;  1K9U A;  2KGB C;  2JU0 A;  2LV7 A;  1QV1 A;  4L9M A;  1V1F A;  1MUX A;  2BCX A;  2MLF C;  1M31 A;  2L5X B;  4C0K A;  3SG3 A;  1J7O A;  1BF5 A;  1D1O A;  1EJ3 A;  1PSB A;  2R2I A;  1CTR A;  1NCZ A;  2K8M B;  1GGZ A;  3ICB A;  2MAZ A;  1MF8 B;  3SG6 A;  1DF0 B;  2L98 A;  2LC5 A;  2LUX A;  1CB1 A;  5D69 A;  2JUL A;  3TZ1 A;  3KO0 A;  1B7T Z;  2VRG A;  3O4Y A;  1LA0 A;  1TN4 A;  4HRG A;  2M1U A;  2KBM A;  2QAC A;  2WCF A;  4PDZ A;  3TS5 C;  4DCK A;  1J7P A;  2AMI A;  2LAN A;  5HKY A;  1SR6 C;  1K8U A;  2JNF A;  2LMU A;  2L51 A;  1DTL A;  4GGN A;  2LNK A;  1YRT B;  2JT0 A;  3I5F C;  3TDU A;  1NYA A;  2L4I A;  2TN4 A;  3DVM A;  4UPG A;  2KNE A;  4YI9 A;  1SBJ A;  2LM5 A;  2JOJ A;  2KBI A;  3SIB A;  1E8A A;  2GV5 A;  3SJS A;  1FI6 A;  4MVF A;  1W7J B;  1AVS A;  1IJ6 A;  1DT7 B;  3DF0 A;  2M7N A;  3IQQ A;  2G2B A;  3VRQ A;  3TDI A;  1SK6 D;  1R6P A;  1UP5 A;  2K7B A;  4MN0 A;  1V1G A;  4GFT A;  1H8B A;  2ZFD A;  3JTD C;  1CMG A;  5HLO A;  5AEQ A;  4WQ3 A;  3I5G C;  4YBH B;  2JT3 A;  4FQO A;  1Q80 A;  3TS5 B;  4PHK A;  1HQV A;  4YGB B;  2M3W A;  1RFJ A;  2BE6 A;  1SR6 B;  3CTN A;  5PAL A;  4GGF C;  2CT9 A;  1JFJ A;  3I5F B;  2MJW B;  2OS8 C;  3DVK A;  1DJG A;  1SCM C;  3GK4 X;  2JTZ A;  3VRO A;  2KAY A;  1K95 A;  2HQ8 A;  3EVR A;  1XFV O;  3GK2 A;  2ZKM X;  5AXI A;  1UHK A;  5JOL A;  1F71 A;  4ETO A;  4OKH A;  2F3Z A;  3D10 A;  1R2U A;  4MRX A;  1JF2 A;  4XJK A;  4R1E A;  4MBE A;  4YGD B;  1Y6W A;  1K9P A;  3LCP C;  1NX0 A;  1EH2 A;  1NCY A;  1TNP A;  1GGW A;  1A75 B;  4C0L A;  2LLU A;  2ZRS A;  2LLT A;  2M8U A;  3JTD B;  4MZK A;  4N1G A;  1A2X A;  3C1V A;  2CTN A;  1B8L A;  4JPZ B;  1KQV A;  1KSO A;  3I5G B;  3AAK A;  2F8P A;  2LHL A;  1XYD A;  4P2Y B;  2BL0 C;  1KCY A;  1B8R A;  1EL4 A;  1NUB A;  1K94 A;  2M1K B;  1X02 A;  3MSE B;  1B47 A;  4WRI A;  3SG4 A;  1S36 A;  1M39 A;  1S6I A;  1WLZ A;  2JWW A;  2HF5 A;  3BUO B;  4NQG A;  2K7D A;  5G08 A;  3EVV A;  2OS8 B;  1KK7 Z;  1SCM B;  1ZAC A;  2WOR A;  2E6W A;  5KU1 A;  4OR9 B;  1MXL C;  1JSA A;  1PRW A;  2COL B;  4MZL A;  1BMO A;  1NSH A;  5CSF A;  1EXR A;  3VRR A;  3PFV A;  5AER A;  3OHM B;  1G33 A;  1QAS A;  4PE7 A;  1DF0 A;  3JVT C;  2JZI A;  1U5I B;  3OB2 B;  3A4U B;  3FWC A;  1YR5 A;  1VRK A;  2ZND A;  2JT8 A;  4PHN A;  1XK4 A;  1TCF A;  1KWO C;  2K7C A;  3EVU A;  4DIR A;  4QJ3 B;  2BL0 B;  1K90 D;  1QTX A;  2O5G A;  2WC8 A;  4HSZ A;  3KPX A;  3M0W A;  1NX2 A;  2CNP A;  2H61 A;  2SAS A;  3BOW B;  3BQ3 A;  2M7L A;  4ORA B;  1JF0 A;  3GOF A;  4CFQ A;  1M46 A;  3FS7 A;  1XA5 A;  3BUM B;  4CLN A;  1OZS A;  1BOC A;  2F33 A;  3H4S E;  4NDB A;  1FBV A;  1OOJ A;  2DOQ A;  3BYA A;  4WQ2 A;  3DVE A;  4DS7 A;  1QX7 A;  3EKJ A;  2Q91 A;  1F4O A;  1CFC A;  1B4C A;  4I5N B;  3PN7 C;  2KAX A;  1PUL A;  2KQY A;  1JBA A;  2KSP A;  2JXL A;  2G9B A;  1CKK A;  2FOT A;  2PVB A;  3JVT B;  5ER5 A;  4MEW A;  3ZWH A;  1LIN A;  1OSA A;  1SKT A;  5JJG A;  1NP8 A;  2AAO A;  2LAP A;  3KF9 A;  3NSI A;  1W7I B;  3NSO A;  3PM8 A;  1MWN A;  1KWO B;  4I5J A;  1SL9 A;  1YUU A;  1YX7 A;  3EK8 A;  3PSR A;  1LVC D;  4BY5 A;  3I5I C;  4M2O A;  4CFR A;  1K9K A;  2JXC A;  3CR4 X;  3WHT B;  1JUO A;  1Y1U A;  2ZNE A;  1L2O C;  1RTP 1;  1DGU A;  3VRN A;  1EG3 A;  1PAL A;  2O60 A;  4QJ4 B;  5I2L A;  2H2K A;  4PAL A;  1G4Y R;  1S5G Y;  2L50 A;  1OMV A;  2MA2 A;  2PRU A;  3NSK A;  2NZ0 A;  4IL1 A;  4D1E A;  4YGA A;  1QXP A;  2L0P A;  4MRY A;  1QIW A;  1XFU O;  1J1D A;  3PN7 B;  1N2D A;  5K89 A;  1NWD A;  1JWD A;  5B8I B;  1UHI A;  1QS7 A;  3AAJ A;  1QX5 B;  1AP4 A;  1OZO A;  3RM1 A;  3CR5 X;  4HRH A;  2EGD A;  2JNX A;  1RWY A;  2Q4U A;  3AKB A;  4NDC A;  1XO5 A;  3BUW B;  3OB1 B;  1TNW A;  2JRF A;  1XFW O;  1QLS A;  4ZCU A;  1XFZ O;  3I5I B;  4FTG A;  1YVL A;  2Y5I A;  4GGF A;  4N5X A;  4M2Q A;  1FPW A;  1L2O B;  1YX8 A;  1CDN A;  2Y4Q A;  4P5O E;  1QVI Z;  1TNQ A;  1ZOT B;  2ISD A;  3SIA A;  1SPY A;  1LXF C;  1DJW A;  1CDL A;  2Y1M A;  1KFX S;  2AUC A;  1PVA A;  1KK8 C;  3AKA A;  4A4B A;  2KAV A;  1N0Y A;  1TOP A;  1NCX A;  3OX6 A;  3CZT X;  1U5I A;  2K61 A;  1OE9 B;  2QPT A;  1F55 A;  4N1F A;  1DJI A;  3O6B A;  4GBA A;  1S1E A;  1CM4 A;  3E3R A;  1C7V A;  5I2O A;  1IH0 A;  2BEC A;  2LLS A;  1MHO A;  1QIV A;  1OQP A;  2CBL A;  2PAL A;  4GNK B;  2V53 A;  1CFP A;  4OCI A;  3BOW A;  3CLN A;  1Y0V H;  1QJT A;  4ICB A;  1BJF A;  2LVV A;  1TIZ A;  2LHI A;  3EK4 A;  3CGA A;  5CSI A;  1DGV A;  2BE4 A;  1CDP A;  2NCO A;  3I5H C;  2JTT A;  1REC A;  2JQ6 A;  1WRZ A;  2HPS A;  1AUI B;  1KK8 B;  2JPT A;  1TTX A;  1WRK A;  2OTG C;  2FCD A;  3IQO A;  1DMO A;  1YRU B;  3D0Y B;  3GK1 A;  1SRA A;  1QV0 A;  1YUS A;  4PCW A;  5BPJ A;  1KQM C;  2NLN A;  3K21 A;  3HCM A;  2BBN A;  3SG5 A;  4OV2 A;  4AQI A;  1IWQ A;  1CFF A;  1JC2 A;  1RRO A;  5CSJ A;  2EHB A;  1TCO B;  3NXA A;  5KSZ A;  2LUC A;  2I18 A;  1IG5 A;  4MSP A;  2K2F A;  1CLM A;  5CPV A;  3OP0 A;  4GAO A;  1CFD A;  2KI4 C;  4PE1 A;  4QJ5 B;  1CMF A;  1AJ4 A;  1KFX L;  2LMV A;  1K93 D;  2LVK A;  3PAL A;  3WHU B;  2B1U A;  1EG4 A;  1WDC C;  4YGE B;  1QX2 A;  1IKU A;  1XFX O;  3I5H B;  4XJK B;  2BKI B;  2OPO A;  4YGC B;  2ZN9 A;  1CNP A;  1BG1 A;  3O2P A;  1WLM A;  2M9G A;  3IF7 A;  2KGR A;  1UHJ A;  2LCP A;  2I94 A;  2I7A A;  2L4H A;  3TUY C;  2OTG B;  1SY9 A;  1CLL A;  2K2A A;  3WXA A;  2LVI A;  1BR1 B; 
#chains in the Genus database with same CATH topology
 1KQM B;  2KLD A;  2PMY A;  3DD4 A;  1F4Q A;  2HET A;  1RK9 A;  3S0G A;  1YTZ C;  1PVB A;  1YUR A;  5DKR A;  2BAP A;  1QLK A;  1DVI A;  1DJX A;  1KFU S;  2MHH A;  3CS1 A;  3B86 A;  1BT6 A;  2D8N A;  3B7A A;  1IQ3 A;  4A4C A;  3D78 A;  2F3Y A;  2KI4 B;  5D7F A;  4GUK A;  1MR8 A;  1UHN A;  5HKW A;  4USL A;  4U8D A;  4ZCV A;  4MZJ A;  2WC6 A;  3Q8I A;  1J55 A;  1SL8 A;  4ORB B;  1IJ5 A;  1KK7 Y;  1WDC B;  4YRU A;  5KTY A;  3CWG A;  2LP3 A;  4ORC B;  4I5L B;  1AJ5 A;  1OW4 A;  4E68 A;  1ZUZ A;  5HYD A;  3R1P A;  2LVJ A;  1A75 A;  2FJU B;  3VRP A;  4YI8 A;  4OVN F;  3TUY B;  2WOS A;  2RGI A;  4XYN A;  1JFK A;  2ERB A;  3EK7 A;  1F54 A;  1J7R A;  2M0R A;  1NIW A;  2LP2 A;  1XFY O;  4PT1 A;  4PHM A;  3PLF B;  4JD9 A;  3BFB A;  2E30 A;  2FCE A;  3KEV A;  2KHN A;  1A4P A;  2PYQ A;  4Q04 A;  2JC2 A;  4HRE E;  5HKZ A;  1G8I A;  2L2E A;  1CM1 A;  3RZS A;  1MQ1 A;  1B9A A;  2PSR A;  1S6C A;  5TNC A;  1BLQ A;  1CLB A;  3DYE A;  1NX3 A;  1S6J A;  1OMD A;  1SCV A;  1C7W A;  1KSM A;  3EG5 B;  3SS5 A;  4C0J A;  1TWO A;  3SG7 A;  5I2Q A;  1HT9 A;  2EC6 C;  2KFH A;  4JQ0 D;  2CXJ A;  2SCP A;  1L7Z A;  3VGO A;  3WNX B;  1IGV A;  2F2P A;  2KYF A;  3D0Y A;  3LL8 B;  1TRF A;  4MLW A;  4JWQ A;  4BY4 A;  1CDM A;  2K0J A;  2KFG A;  2A4J A;  1IRJ A;  5ER4 X;  2M29 A;  1KFU L;  1GJY A;  1SYM A;  5HLV A;  3R1V A;  2WCE A;  1S26 D;  2MRD A;  4TNC A;  1NX1 A;  5FI2 A;  2BBM A;  2YGU A;  3BUN B;  2KQ6 A;  3O78 A;  1IQ5 A;  1UWO A;  2P6B B;  2WND A;  1B7T Y;  1XVJ A;  1S3P A;  2KFF A;  2WC5 A;  2BCB A;  3BFH A;  2K7O A;  3F45 A;  2LE9 B;  3CAB A;  1C07 A;  5I94 A;  3RLZ A;  5I8N A;  3ZNI A;  4DUQ A;  3LK1 A;  1OOG A;  1MXE A;  2K60 A;  2ZRT A;  3D77 A;  3SG2 A;  5AAN A;  4GPL B;  1DC1 A;  1WRL A;  4M2P A;  1UUS A;  1LA3 A;  3TDZ A;  1F8H A;  2F2O A;  3QRX A;  2GTE A;  3DF0 B;  1ALV A;  4PE4 A;  2WCJ A;  1YUT A;  4F0Z B;  5J3X A;  4CID A;  1BOD A;  2EC6 B;  1DJZ A;  2I2R E;  1FW4 A;  1BR4 B;  2WCB A;  4PE0 A;  4PHJ A;  5CSN A;  1H4B A;  1TNX A;  5FYX A;  2WCM A;  1OMR A;  1FF1 A;  2PQL A;  1DJY A;  3S0A A;  4AOM A;  2Y1N A;  1WY9 A;  5AFP A;  2HQW A;  3BXK A;  5DKN A;  3DVJ A;  3FIA A;  5IBW A;  1PSR A;  1AK8 A;  4DRW A;  1B1G A;  2M97 A;  2PAS A;  1M45 A;  2L2C A;  3A8R A;  3PAT A;  3S0E A;  3LK0 A;  1SL7 A;  2BKH B;  3EKH A;  1S5G Z;  1GQM A;  3LLE A;  1SNL A;  1AHR A;  1ODB A;  2KYC A;  2ZN8 A;  3PJI A;  2IS9 A;  1K2H A;  3HX4 A;  2CCM A;  2GGM A;  1N65 A;  3CDN A;  1C3Y A;  3BUX B;  1A29 A;  5GQQ C;  1OOH A;  1QAT A;  1QVI Y;  2KI6 C;  3NHI A;  1YVH A;  4CPV A;  1FI5 A;  1M63 B;  4NDD A;  2KDH A;  3NSL A;  2KOT A;  5D3O A;  1Y1A A;  3D75 A;  5DKQ A;  1DJH A;  1ALW A;  1Y1X A;  2BCA A;  3CR2 A;  1ZFS A;  2M49 B;  1J1E A;  1SW8 A;  2KI6 D;  2NCP A;  1XK4 C;  5F6T A;  1NPQ A;  1B8C A;  1UHH A;  1A03 A;  1UUR A;  2MLE C;  2MBX A;  1PK0 D;  1LKJ A;  3OX5 A;  4I5K A;  1ZMZ A;  2H61 C;  4IJ7 A;  5FI6 A;  1BU3 A;  4AQJ A;  3FWB A;  2GGZ A;  1F70 A;  3KHE A;  2LMT A;  1K96 A;  2NXQ A;  1SMG A;  1J7Q A;  1RJV A;  1K9U A;  2KGB C;  2JU0 A;  2LV7 A;  1QV1 A;  3K1E A;  4L9M A;  1V1F A;  1MUX A;  2BCX A;  2MLF C;  1M31 A;  2L5X B;  4C0K A;  3SG3 A;  1J7O A;  1BF5 A;  1D1O A;  1EJ3 A;  1PSB A;  2R2I A;  1CTR A;  1NCZ A;  2K8M B;  1GGZ A;  3ICB A;  2MAZ A;  1MF8 B;  3SG6 A;  1DF0 B;  2L98 A;  2LC5 A;  2LUX A;  1CB1 A;  5D69 A;  1TUZ A;  2JUL A;  3TZ1 A;  3KO0 A;  1B7T Z;  2VRG A;  3O4Y A;  1LA0 A;  5DIC A;  1TN4 A;  4HRG A;  2M1U A;  2KBM A;  2QAC A;  2WCF A;  4PDZ A;  3TS5 C;  4DCK A;  1J7P A;  2AMI A;  2LAN A;  5HKY A;  1SR6 C;  1K8U A;  3CZ0 A;  2JNF A;  2LMU A;  2L51 A;  1DTL A;  4GGN A;  2LNK A;  1YRT B;  2JT0 A;  3I5F C;  3TDU A;  1NYA A;  2L4I A;  2TN4 A;  3DVM A;  4UPG A;  2KNE A;  4YI9 A;  1TUJ A;  1SBJ A;  2LM5 A;  2JOJ A;  2KBI A;  3SIB A;  1E8A A;  2GV5 A;  3SJS A;  1FI6 A;  4MVF A;  1W7J B;  1AVS A;  1IJ6 A;  3N7H A;  1DT7 B;  3DF0 A;  2M7N A;  3IQQ A;  2G2B A;  3VRQ A;  3TDI A;  1SK6 D;  1R6P A;  1UP5 A;  2K7B A;  4MN0 A;  1V1G A;  4GFT A;  1H8B A;  2ZFD A;  3JTD C;  2FJY A;  1CMG A;  5HLO A;  5AEQ A;  4WQ3 A;  3BFA A;  3S0B A;  3I5G C;  4YBH B;  2JT3 A;  4FQO A;  1Q80 A;  3TS5 B;  4PHK A;  1HQV A;  4YGB B;  2M3W A;  1RFJ A;  2BE6 A;  1SR6 B;  3CTN A;  5PAL A;  4GGF C;  2CT9 A;  1JFJ A;  3I5F B;  2MJW B;  2OS8 C;  3DVK A;  1DJG A;  1SCM C;  3GK4 X;  2JTZ A;  3VRO A;  2KAY A;  1K95 A;  2HQ8 A;  2BNX A;  3EVR A;  1XFV O;  3GK2 A;  2ZKM X;  5AXI A;  1UHK A;  5JOL A;  1F71 A;  3D76 A;  4ETO A;  4OKH A;  2F3Z A;  3D10 A;  1R2U A;  4MRX A;  1JF2 A;  4XJK A;  4R1E A;  4MBE A;  4YGD B;  1Y6W A;  1K9P A;  3LCP C;  1NX0 A;  3D73 A;  1EH2 A;  1NCY A;  1TNP A;  1GGW A;  1A75 B;  4C0L A;  2LLU A;  2WCH A;  2ZRS A;  2LLT A;  2M8U A;  2WCK A;  3L4L A;  3JTD B;  4MZK A;  2P71 A;  4N1G A;  1A2X A;  3C1V A;  2CTN A;  1B8L A;  2QDI A;  4JPZ B;  3SS4 A;  1Z4H A;  1KQV A;  1KSO A;  3I5G B;  3AAK A;  2F8P A;  2LHL A;  1XYD A;  4P2Y B;  2BL0 C;  1KCY A;  1B8R A;  1EL4 A;  1NUB A;  1K94 A;  2M1K B;  1X02 A;  3MSE B;  1B47 A;  4WRI A;  3SG4 A;  3VB1 A;  1S36 A;  1M39 A;  1S6I A;  1WLZ A;  2JWW A;  2HF5 A;  3BUO B;  3R1O A;  2K7D A;  4NQG A;  5G08 A;  3EVV A;  2OS8 B;  1KK7 Z;  1SCM B;  1ZAC A;  2WOR A;  2E6W A;  5KU1 A;  4OR9 B;  1MXL C;  1JSA A;  1PRW A;  2KPH A;  2COL B;  4MZL A;  1BMO A;  3DY9 A;  1NSH A;  5CSF A;  1EXR A;  3VRR A;  3PFV A;  5AER A;  3OHM B;  1G33 A;  1QAS A;  4PE7 A;  1DF0 A;  3JVT C;  2JZI A;  3QME A;  3S0F A;  3SS3 A;  1U5I B;  3OB2 B;  1W9Z A;  3A4U B;  3FWC A;  1YR5 A;  1VRK A;  3CZ2 A;  2ZND A;  2JT8 A;  4PHN A;  1XK4 A;  1TCF A;  1KWO C;  1QWV A;  2K7C A;  3EVU A;  3CYZ A;  4DIR A;  4QJ3 B;  2BL0 B;  1K90 D;  1QTX A;  2O5G A;  2WC8 A;  1ORG A;  4HSZ A;  3L4A A;  3DXL A;  3KPX A;  1T14 A;  1NX2 A;  2CNP A;  2H61 A;  2L5Y A;  2SAS A;  3BOW B;  3BQ3 A;  3M0W A;  2M7L A;  4ORA B;  1JF0 A;  3GOF A;  4CFQ A;  1M46 A;  3FS7 A;  1XA5 A;  3BUM B;  4CLN A;  1OZS A;  2QEV A;  1BOC A;  2F33 A;  3H4S E;  4NDB A;  2JPO A;  1FBV A;  1OOJ A;  2DOQ A;  3BYA A;  3PM2 A;  3DVE A;  4WQ2 A;  1QX7 A;  3EKJ A;  4DS7 A;  4INW A;  2Q91 A;  1F4O A;  1CFC A;  1B4C A;  4I5N B;  3PN7 C;  2KAX A;  3L47 A;  1PUL A;  2KQY A;  1JBA A;  2KSP A;  2JXL A;  2G9B A;  1CKK A;  2FOT A;  2PVB A;  3JVT B;  5ER5 A;  1P28 A;  4MEW A;  3ZWH A;  1LIN A;  1OSA A;  1SKT A;  5JJG A;  1NP8 A;  2AAO A;  2LAP A;  1OOF A;  3KF9 A;  3NSI A;  1W7I B;  3NSO A;  3PM8 A;  1MWN A;  2QEH A;  1KWO B;  4I5J A;  1SL9 A;  1YUU A;  1YX7 A;  3EK8 A;  3PSR A;  1LVC D;  2WCL A;  3I5I C;  4BY5 A;  4M2O A;  4CFR A;  1K9K A;  2JXC A;  3CR4 X;  3WHT B;  1JUO A;  1Y1U A;  2ZNE A;  1L2O C;  1RTP 1;  1DGU A;  3VRN A;  1EG3 A;  1PAL A;  2O60 A;  4QJ4 B;  5I2L A;  4KYN A;  2H2K A;  4PAL A;  2QEO A;  1G4Y R;  1S5G Y;  2L50 A;  1OMV A;  2MA2 A;  3FE6 A;  3OBV A;  2PRU A;  5EL2 A;  3NSK A;  2NZ0 A;  4IL1 A;  4D1E A;  4YGA A;  1QXP A;  2L0P A;  4MRY A;  1QIW A;  1XFU O;  1J1D A;  3PN7 B;  1N2D A;  5K89 A;  1NWD A;  4F7F A;  1JWD A;  5B8I B;  1UHI A;  1QS7 A;  2H8V A;  1QX5 B;  3AAJ A;  2P70 A;  1AP4 A;  1OZO A;  3RM1 A;  3CR5 X;  4HRH A;  2EGD A;  2JNX A;  1RWY A;  2Q4U A;  3AKB A;  4NDC A;  1XO5 A;  3B88 A;  3BUW B;  3OB1 B;  1TNW A;  2JRF A;  1XFW O;  3BJH A;  1QLS A;  3B6X A;  4ZCU A;  1XFZ O;  3I5I B;  4FTG A;  1YVL A;  2Y5I A;  4GGF A;  4N5X A;  3S0D A;  4M2Q A;  1FPW A;  1L2O B;  3IVT A;  1YX8 A;  3UO9 A;  1Z2C B;  2Y4Q A;  1QVI Z;  1TNQ A;  1XFR A;  1ZOT B;  4P5O E;  1CDN A;  2ISD A;  3SIA A;  4OZD A;  1SPY A;  1LXF C;  1DJW A;  1CDL A;  2Y1M A;  1KFX S;  2AUC A;  1PVA A;  1DEK A;  1KK8 C;  3AKA A;  4A4B A;  2KAV A;  1N0Y A;  1TOP A;  3NHT A;  1NCX A;  3OX6 A;  1SSE B;  3CZT X;  1U5I A;  2K61 A;  1OE9 B;  2QPT A;  1F55 A;  4N1F A;  1DJI A;  3O6B A;  3B87 A;  5FI7 A;  4GBA A;  1S1E A;  1CM4 A;  5HL1 A;  3E3R A;  1C7V A;  5I2O A;  1IH0 A;  2BEC A;  2LLS A;  1MHO A;  1QIV A;  1OOI X;  1OQP A;  2CBL A;  2PAL A;  2QEB A;  2V53 A;  4GNK B;  4OCI A;  1CFP A;  3BOW A;  2KLE A;  3CLN A;  1Y0V H;  1QJT A;  4ICB A;  1BJF A;  2LVV A;  1C3Z A;  1TIZ A;  2LHI A;  3EK4 A;  3CGA A;  3OGN A;  5CSI A;  1DGV A;  1LS8 A;  2BE4 A;  1CDP A;  2NCO A;  3I5H C;  1GM0 A;  2JTT A;  1REC A;  2JQ6 A;  1WRZ A;  2HPS A;  3FE8 A;  1IIO A;  3UNW A;  1AUI B;  1KK8 B;  4FQT A;  2JPT A;  1TTX A;  1WRK A;  2OTG C;  1DEL A;  2FCD A;  3IQO A;  1DMO A;  1YRU B;  3D0Y B;  3GK1 A;  3FE9 A;  1SRA A;  1QV0 A;  1YUS A;  4PCW A;  5BPJ A;  1KQM C;  2NLN A;  3K21 A;  3HCM A;  2BBN A;  3SG5 A;  3D74 A;  3O4X A;  4OV2 A;  4AQI A;  1IWQ A;  1CFF A;  1JC2 A;  1RRO A;  5CSJ A;  2EHB A;  1TCO B;  3NXA A;  5KSZ A;  2LUC A;  2I18 A;  1IG5 A;  4MSP A;  1DQE A;  1CLM A;  2K2F A;  5CPV A;  3OP0 A;  4GAO A;  1CFD A;  2KI4 C;  4PE1 A;  4QJ5 B;  1CMF A;  1AJ4 A;  1KFX L;  2LMV A;  3NGV A;  1K93 D;  2LVK A;  3PAL A;  3WHU B;  2B1U A;  1EG4 A;  1WDC C;  4YGE B;  1QX2 A;  1IKU A;  1XFX O;  3I5H B;  4XJK B;  2BKI B;  2OPO A;  4YGC B;  2ZN9 A;  1CNP A;  1BG1 A;  3O2P A;  4JKT A;  1WLM A;  3V2L A;  2M9G A;  3IF7 A;  2KGR A;  1UHJ A;  2LCP A;  2I94 A;  2I7A A;  3R72 A;  2L4H A;  3TUY C;  2OTG B;  4INX A;  3CZ1 A;  1SY9 A;  1CLL A;  3DZT A;  2K2A A;  3WXA A;  2LVI A;  1BR1 B; 
#chains in the Genus database with same CATH homology
 1KQM B;  2PMY A;  3DD4 A;  1F4Q A;  2HET A;  1RK9 A;  1YTZ C;  1PVB A;  1YUR A;  5DKR A;  1QLK A;  1DVI A;  1DJX A;  1KFU S;  2MHH A;  3CS1 A;  1BT6 A;  2D8N A;  1IQ3 A;  4A4C A;  2F3Y A;  2KI4 B;  5D7F A;  4GUK A;  1MR8 A;  1UHN A;  5HKW A;  4USL A;  4U8D A;  4ZCV A;  4MZJ A;  4ORB B;  1J55 A;  1SL8 A;  1IJ5 A;  1KK7 Y;  1WDC B;  4YRU A;  5KTY A;  3CWG A;  2LP3 A;  4ORC B;  4I5L B;  1AJ5 A;  4E68 A;  1ZUZ A;  5HYD A;  2LVJ A;  1A75 A;  2FJU B;  3VRP A;  4YI8 A;  4OVN F;  3TUY B;  2WOS A;  2RGI A;  4XYN A;  1JFK A;  3EK7 A;  1F54 A;  1J7R A;  2M0R A;  1NIW A;  2LP2 A;  1XFY O;  4PHM A;  3PLF B;  2E30 A;  2FCE A;  3KEV A;  2KHN A;  1A4P A;  4Q04 A;  2JC2 A;  4HRE E;  5HKZ A;  1G8I A;  2L2E A;  1CM1 A;  1MQ1 A;  1B9A A;  2PSR A;  1S6C A;  5TNC A;  1BLQ A;  1CLB A;  1NX3 A;  1S6J A;  1OMD A;  1SCV A;  1C7W A;  1KSM A;  4C0J A;  3SG7 A;  5I2Q A;  1HT9 A;  2EC6 C;  2KFH A;  4JQ0 D;  2CXJ A;  2SCP A;  1L7Z A;  3VGO A;  3WNX B;  1IGV A;  2F2P A;  2KYF A;  3D0Y A;  3LL8 B;  1TRF A;  4MLW A;  4JWQ A;  4BY4 A;  1CDM A;  2K0J A;  2KFG A;  2A4J A;  1IRJ A;  5ER4 X;  2M29 A;  1KFU L;  1GJY A;  1SYM A;  5HLV A;  2WCE A;  1S26 D;  2MRD A;  4TNC A;  1NX1 A;  2BBM A;  3BUN B;  2KQ6 A;  3O78 A;  1IQ5 A;  1UWO A;  2P6B B;  2WND A;  1B7T Y;  1XVJ A;  1S3P A;  2KFF A;  2BCB A;  2K7O A;  3F45 A;  2LE9 B;  1C07 A;  3RLZ A;  5I8N A;  3ZNI A;  4DUQ A;  3LK1 A;  1MXE A;  2ZRT A;  3SG2 A;  5AAN A;  4GPL B;  1WRL A;  4M2P A;  1UUS A;  1LA3 A;  3TDZ A;  1F8H A;  2F2O A;  3QRX A;  3DF0 B;  1ALV A;  4PE4 A;  1YUT A;  4F0Z B;  5J3X A;  4CID A;  1BOD A;  2EC6 B;  1DJZ A;  2I2R E;  1FW4 A;  1BR4 B;  2WCB A;  4PE0 A;  4PHJ A;  5CSN A;  1H4B A;  1TNX A;  5FYX A;  1OMR A;  1FF1 A;  1DJY A;  4AOM A;  2Y1N A;  1WY9 A;  5AFP A;  2HQW A;  3BXK A;  5DKN A;  3DVJ A;  3FIA A;  5IBW A;  1PSR A;  1AK8 A;  4DRW A;  1B1G A;  2M97 A;  2PAS A;  1M45 A;  3A8R A;  3PAT A;  3LK0 A;  1SL7 A;  2BKH B;  3EKH A;  1S5G Z;  1GQM A;  3LLE A;  1SNL A;  1AHR A;  1ODB A;  2KYC A;  2ZN8 A;  1K2H A;  2IS9 A;  3HX4 A;  2CCM A;  2GGM A;  1N65 A;  3BUX B;  1A29 A;  5GQQ C;  1QAT A;  2KI6 C;  1QVI Y;  1YVH A;  4CPV A;  1FI5 A;  1M63 B;  4NDD A;  2KDH A;  3NSL A;  2KOT A;  1Y1A A;  5DKQ A;  1DJH A;  1ALW A;  1Y1X A;  2BCA A;  3CR2 A;  1ZFS A;  2M49 B;  1J1E A;  1SW8 A;  2KI6 D;  2NCP A;  1XK4 C;  5F6T A;  1NPQ A;  1B8C A;  1UHH A;  1A03 A;  1UUR A;  2MLE C;  2MBX A;  1PK0 D;  1LKJ A;  3OX5 A;  4I5K A;  1ZMZ A;  2H61 C;  1BU3 A;  4AQJ A;  3FWB A;  2GGZ A;  1F70 A;  3KHE A;  2LMT A;  1K96 A;  2NXQ A;  1SMG A;  1J7Q A;  1RJV A;  1K9U A;  2KGB C;  2JU0 A;  2LV7 A;  1QV1 A;  4L9M A;  1V1F A;  1MUX A;  2BCX A;  2MLF C;  1M31 A;  2L5X B;  4C0K A;  3SG3 A;  1J7O A;  1BF5 A;  1D1O A;  1EJ3 A;  1PSB A;  2R2I A;  1CTR A;  1NCZ A;  2K8M B;  1GGZ A;  3ICB A;  2MAZ A;  1MF8 B;  3SG6 A;  1DF0 B;  2L98 A;  2LC5 A;  2LUX A;  1CB1 A;  5D69 A;  2JUL A;  3TZ1 A;  3KO0 A;  1B7T Z;  2VRG A;  3O4Y A;  1LA0 A;  1TN4 A;  4HRG A;  2M1U A;  2KBM A;  2QAC A;  2WCF A;  4PDZ A;  3TS5 C;  4DCK A;  1J7P A;  2AMI A;  2LAN A;  5HKY A;  1SR6 C;  1K8U A;  2JNF A;  2LMU A;  2L51 A;  1DTL A;  4GGN A;  2LNK A;  1YRT B;  2JT0 A;  3I5F C;  3TDU A;  1NYA A;  2L4I A;  2TN4 A;  3DVM A;  4UPG A;  2KNE A;  4YI9 A;  1SBJ A;  2LM5 A;  2JOJ A;  2KBI A;  3SIB A;  1E8A A;  2GV5 A;  3SJS A;  1FI6 A;  4MVF A;  1W7J B;  1AVS A;  1IJ6 A;  1DT7 B;  3DF0 A;  2M7N A;  3IQQ A;  2G2B A;  3VRQ A;  3TDI A;  1SK6 D;  1R6P A;  1UP5 A;  2K7B A;  4MN0 A;  1V1G A;  4GFT A;  1H8B A;  2ZFD A;  3JTD C;  1CMG A;  5HLO A;  5AEQ A;  4WQ3 A;  3I5G C;  4YBH B;  2JT3 A;  4FQO A;  1Q80 A;  3TS5 B;  4PHK A;  1HQV A;  4YGB B;  2M3W A;  1RFJ A;  2BE6 A;  1SR6 B;  3CTN A;  5PAL A;  4GGF C;  2CT9 A;  1JFJ A;  3I5F B;  2MJW B;  2OS8 C;  3DVK A;  1DJG A;  1SCM C;  3GK4 X;  2JTZ A;  3VRO A;  2KAY A;  1K95 A;  2HQ8 A;  3EVR A;  1XFV O;  3GK2 A;  2ZKM X;  5AXI A;  1UHK A;  5JOL A;  1F71 A;  4ETO A;  4OKH A;  2F3Z A;  3D10 A;  1R2U A;  4MRX A;  1JF2 A;  4XJK A;  4R1E A;  4MBE A;  4YGD B;  1Y6W A;  1K9P A;  3LCP C;  1NX0 A;  1EH2 A;  1NCY A;  1TNP A;  1GGW A;  1A75 B;  4C0L A;  2LLU A;  2ZRS A;  2LLT A;  2M8U A;  3JTD B;  4MZK A;  4N1G A;  1A2X A;  3C1V A;  2CTN A;  1B8L A;  4JPZ B;  1KQV A;  1KSO A;  3I5G B;  3AAK A;  2F8P A;  2LHL A;  1XYD A;  4P2Y B;  2BL0 C;  1KCY A;  1B8R A;  1EL4 A;  1NUB A;  1K94 A;  2M1K B;  1X02 A;  3MSE B;  1B47 A;  4WRI A;  3SG4 A;  1S36 A;  1M39 A;  1S6I A;  1WLZ A;  2JWW A;  2HF5 A;  3BUO B;  4NQG A;  2K7D A;  5G08 A;  3EVV A;  2OS8 B;  1KK7 Z;  1SCM B;  1ZAC A;  2WOR A;  2E6W A;  5KU1 A;  4OR9 B;  1MXL C;  1JSA A;  1PRW A;  2COL B;  4MZL A;  1BMO A;  1NSH A;  5CSF A;  1EXR A;  3VRR A;  3PFV A;  5AER A;  3OHM B;  1G33 A;  1QAS A;  4PE7 A;  1DF0 A;  3JVT C;  2JZI A;  1U5I B;  3OB2 B;  3A4U B;  3FWC A;  1YR5 A;  1VRK A;  2ZND A;  2JT8 A;  4PHN A;  1XK4 A;  1TCF A;  1KWO C;  2K7C A;  3EVU A;  4DIR A;  4QJ3 B;  2BL0 B;  1K90 D;  1QTX A;  2O5G A;  2WC8 A;  4HSZ A;  3KPX A;  3M0W A;  1NX2 A;  2CNP A;  2H61 A;  2SAS A;  3BOW B;  3BQ3 A;  2M7L A;  4ORA B;  1JF0 A;  3GOF A;  4CFQ A;  1M46 A;  3FS7 A;  1XA5 A;  3BUM B;  4CLN A;  1OZS A;  1BOC A;  2F33 A;  3H4S E;  4NDB A;  1FBV A;  1OOJ A;  2DOQ A;  3BYA A;  4WQ2 A;  3DVE A;  4DS7 A;  1QX7 A;  3EKJ A;  2Q91 A;  1F4O A;  1CFC A;  1B4C A;  4I5N B;  3PN7 C;  2KAX A;  1PUL A;  2KQY A;  1JBA A;  2KSP A;  2JXL A;  2G9B A;  1CKK A;  2FOT A;  2PVB A;  3JVT B;  5ER5 A;  4MEW A;  3ZWH A;  1LIN A;  1OSA A;  1SKT A;  5JJG A;  1NP8 A;  2AAO A;  2LAP A;  3KF9 A;  3NSI A;  1W7I B;  3NSO A;  3PM8 A;  1MWN A;  1KWO B;  4I5J A;  1SL9 A;  1YUU A;  1YX7 A;  3EK8 A;  3PSR A;  1LVC D;  4BY5 A;  3I5I C;  4M2O A;  4CFR A;  1K9K A;  2JXC A;  3CR4 X;  3WHT B;  1JUO A;  1Y1U A;  2ZNE A;  1L2O C;  1RTP 1;  1DGU A;  3VRN A;  1EG3 A;  1PAL A;  2O60 A;  4QJ4 B;  5I2L A;  2H2K A;  4PAL A;  1G4Y R;  1S5G Y;  2L50 A;  1OMV A;  2MA2 A;  2PRU A;  3NSK A;  2NZ0 A;  4IL1 A;  4D1E A;  4YGA A;  1QXP A;  2L0P A;  4MRY A;  1QIW A;  1XFU O;  1J1D A;  3PN7 B;  1N2D A;  5K89 A;  1NWD A;  1JWD A;  5B8I B;  1UHI A;  1QS7 A;  3AAJ A;  1QX5 B;  1AP4 A;  1OZO A;  3RM1 A;  3CR5 X;  4HRH A;  2EGD A;  2JNX A;  1RWY A;  2Q4U A;  3AKB A;  4NDC A;  1XO5 A;  3BUW B;  3OB1 B;  1TNW A;  2JRF A;  1XFW O;  1QLS A;  4ZCU A;  1XFZ O;  3I5I B;  4FTG A;  1YVL A;  2Y5I A;  4GGF A;  4N5X A;  4M2Q A;  1FPW A;  1L2O B;  1YX8 A;  1CDN A;  2Y4Q A;  4P5O E;  1QVI Z;  1TNQ A;  1ZOT B;  2ISD A;  3SIA A;  1SPY A;  1LXF C;  1DJW A;  1CDL A;  2Y1M A;  1KFX S;  2AUC A;  1PVA A;  1KK8 C;  3AKA A;  4A4B A;  2KAV A;  1N0Y A;  1TOP A;  1NCX A;  3OX6 A;  3CZT X;  1U5I A;  2K61 A;  1OE9 B;  2QPT A;  1F55 A;  4N1F A;  1DJI A;  3O6B A;  4GBA A;  1S1E A;  1CM4 A;  3E3R A;  1C7V A;  5I2O A;  1IH0 A;  2BEC A;  2LLS A;  1MHO A;  1QIV A;  1OQP A;  2CBL A;  2PAL A;  4GNK B;  2V53 A;  1CFP A;  4OCI A;  3BOW A;  3CLN A;  1Y0V H;  1QJT A;  4ICB A;  1BJF A;  2LVV A;  1TIZ A;  2LHI A;  3EK4 A;  3CGA A;  5CSI A;  1DGV A;  2BE4 A;  1CDP A;  2NCO A;  3I5H C;  2JTT A;  1REC A;  2JQ6 A;  1WRZ A;  2HPS A;  1AUI B;  1KK8 B;  2JPT A;  1TTX A;  1WRK A;  2OTG C;  2FCD A;  3IQO A;  1DMO A;  1YRU B;  3D0Y B;  3GK1 A;  1SRA A;  1QV0 A;  1YUS A;  4PCW A;  5BPJ A;  1KQM C;  2NLN A;  3K21 A;  3HCM A;  2BBN A;  3SG5 A;  4OV2 A;  4AQI A;  1IWQ A;  1CFF A;  1JC2 A;  1RRO A;  5CSJ A;  2EHB A;  1TCO B;  3NXA A;  5KSZ A;  2LUC A;  2I18 A;  1IG5 A;  4MSP A;  2K2F A;  1CLM A;  5CPV A;  3OP0 A;  4GAO A;  1CFD A;  2KI4 C;  4PE1 A;  4QJ5 B;  1CMF A;  1AJ4 A;  1KFX L;  2LMV A;  1K93 D;  2LVK A;  3PAL A;  3WHU B;  2B1U A;  1EG4 A;  1WDC C;  4YGE B;  1QX2 A;  1IKU A;  1XFX O;  3I5H B;  4XJK B;  2BKI B;  2OPO A;  4YGC B;  2ZN9 A;  1CNP A;  1BG1 A;  3O2P A;  1WLM A;  2M9G A;  3IF7 A;  2KGR A;  1UHJ A;  2LCP A;  2I94 A;  2I7A A;  2L4H A;  3TUY C;  2OTG B;  1SY9 A;  1CLL A;  2K2A A;  3WXA A;  2LVI A;  1BR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...