4PE7A

Crystal structure of calcium-loaded s100b bound to sc1982
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 35
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pe7A00
4GGFA 2JNFA 1SCMC 1C07A 1RECA 1J7PA 1S26D 1S5GY 1FBVA 2GGMA 1YUTA 3PLFB 2NCOA 1C7WA 1CM4A 4I5LB 4CIDA 4CLNA 2LM5A 1BR1B 1GJYA 4DIRA 1YURA 1KFUL 1XFVO 1UUSA 1XYDA 1DGUA 2EC6C 2BECA 1D1OA 1QASA 4WQ3A 1N65A 2JTTA 2NZ0A 3EK8A 1SY9A 2EGDA 1SL8A 2DOQA 1B7TY 5AXIA 2LCPA 1S3PA 2BL0B 2K7BA 4CFQA 1SYMA 3VROA 1IJ5A 1K9KA 2LVKA 1SK6D 1BLQA 2M3WA 2AAOA 1BG1A 1SR6C 1Y1XA 2MLEC 2NXQA 4MSPA 4C0KA 3KF9A 1K9PA 3SG5A 2OS8C 3DVEA 2AMIA 3F45A 2BE4A 1L7ZA 3TDIA 1J1DA 3CWGA 2JXCA 5K89A 2JULA 1ALWA 1IQ5A 1OMRA 1XA5A 1JF0A 3DVMA 2K2FA 4PE4A 2OPOA 5FYXA 3TUYB 2ISDA 3SG2A 4AOMA 3SJSA 3O78A 4NDBA 5DKNA 2JZIA 2K7CA 2LLUA 1NWDA 1YUSA 3MSEB 1AHRA 1RK9A 2Q91A 3BUOB 5D69A 5CSFA 2I94A 3OX5A 1QVIZ 1YVLA 1BF5A 4U8DA 1KWOB 1W7IB 1MF8B 4GNKB 1LA0A 1Y0VH 2CT9A 3SIAA 2JNXA 5TNCA 2MJWB 1M45A 4HSZA 1GQMA 2G2BA 1ALVA 1K9UA 2SCPA 1QV0A 3KPXA 1M31A 2WORA 1DJGA 2GV5A 4GAOA 1NCXA 4FTGA 2JU0A 2H2KA 1LKJA 4QJ3B 1QX5B 1UURA 2KQYA 3VGOA 1DJXA 3EVVA 1OQPA 3KEVA 2RGIA 3BYAA 1KSOA 2JQ6A 5JJGA 1WLZA 1RROA 4JWQA 3EKJA 1B1GA 1QX2A 1F54A 2BKHB 1E8AA 1QVIY 1F71A 3TUYC 1NX2A 1JF2A 1WLMA 1S5GZ 4HREE 3FWCA 1GGWA 1QLKA 2WOSA 4PHMA 3BUWB 3EKHA 3FWBA 2MRDA 2ZFDA 3TS5C 4AQJA 3TDUA 2OTGC 3KO0A 3PM8A 2M7LA 3H4SE 1NP8A 2KYFA 1KWOC 1SPYA 1KCYA 3BUXB 4USLA 1KFUS 1DJZA 1ZUZA 5J3XA 3I5GC 1B7TZ 3GK2A 1IQ3A 1JWDA 2I18A 1U5IA 1TNPA 1B8LA 2KI6C 2MLFC 1TTXA 1AJ4A 1Y1AA 2O5GA 5HKZA 1PK0D 1OZSA 2KBMA 4WRIA 1EL4A 1DJHA 4MZJA 1YX7A 3OHMB 2ZRTA 1N0YA 3AKBA 3WHUB 2O60A 2SASA 1AK8A 1YUUA 4C0LA 2K2AA 1F4QA 1KFXL 2F3YA 4GUKA 1J7RA 1KQMB 2PASA 4IL1A 1EG3A 1MWNA 2EHBA 3DVJA 3JVTB 4PE7A 1VRKA 1MUXA 3LK0A 1CLBA 2F3ZA 3AAJA 1YRUB 2E6WA 2MHHA 1XFYO 5BPJA 2KFFA 3VRRA 2LV7A 3KHEA 1TNWA 2KFGA 1B8CA 2Y4QA 2Q4UA 4YBHB 1QIWA 2KDHA 5DKQA 1TNXA 1B9AA 2PSRA 1UWOA 3D0YA 1CTRA 4GPLB 1R6PA 2E30A 2R2IA 1JUOA 1F70A 4PHJA 3SIBA 5I2QA 2LMUA 2WCBA 4ICBA 1ZMZA 3A4UB 2VRGA 2ZRSA 1ODBA 3D10A 4ETOA 2F2OA 1CDPA 3DF0B 1OMVA 1SRAA 1CLLA 1S6IA 1SL9A 1XO5A 1BMOA 2HPSA 2JT0A 1DGVA 4WQ2A 1TRFA 3DVKA 3IF7A 1QLSA 1G33A 4YI8A 1SCVA 1A29A 1PALA 4PE1A 1KK7Y 1K8UA 1QV1A 4HRGA 1J1EA 2KGBC 4MRYA 5CSNA 1F8HA 1RWYA 2I7AA 1KQMC 1M39A 1UHHA 2COLB 1A75A 2PALA 4MN0A 1A2XA 2CNPA 3JVTC 4OV2A 4PHKA 4XJKA 2K61A 4TNCA 5KTYA 1Q80A 1AUIB 4YGCB 1FI5A 4PCWA 5KSZA 2WNDA 3ICBA 3NXAA 4DRWA 1CNPA 3I5HB 4QJ5B 3BXKA 1OZOA 4PE0A 1QX7A 2B1UA 1CFDA 3HCMA 3O6BA 4MZKA 2BE6A 3SG7A 4CFRA 4ORBB 2LP3A 1X02A 3LCPC 2L51A 5ER4X 3SG3A 1JFJA 2LHIA 1V1GA 3RLZA 2LC5A 3IQQA 3FS7A 2BL0C 4N1GA 1CDMA 1YRTB 2KQ6A 1WRZA 2JWWA 1DF0A 1OOJA 1MHOA 2GGZA 2KAXA 3BOWA 3FIAA 2JC2A 5HLOA 1H8BA 1CFCA 1DMOA 1XFUO 1WRKA 3O2PA 2L98A 2L2EA 2LVVA 1JFKA 2MAZA 2K7OA 1LVCD 2BCBA 2KOTA 2ZKMX 3C1VA 2K0JA 5CPVA 4YGAA 4CPVA 4NQGA 1RTP1 1KK8B 4I5KA 1F4OA 2KFHA 3CGAA 2KGRA 2WCFA 2MA2A 2Y5IA 3EK4A 1JBAA 5CSJA 2K7DA 1PVBA 2M97A 3LL8B 4JQ0D 1BU3A 1LXFC 4NDDA 4P2YB 3VRQA 1SNLA 4GGNA 4OKHA 1KFXS 2LUXA 4ORCB 5AERA 3NSIA 1L2OB 1AVSA 1B8RA 1MQ1A 2JT3A 4MRXA 3E3RA 2A4JA 3IQOA 1R2UA 1SCMB 3WNXB 4ZCVA 1NCYA 4YGEB 2ZN9A 4L9MA 3TDZA 4D1EA 4GGFC 5B8IB 3GK4X 3BUNB 3PATA 1V1FA 1QS7A 2D8NA 5PALA 1RFJA 1YVHA 3GK1A 4NDCA 1K96A 3EVRA 3PN7B 2WCEA 2Y1MA 1CFPA 1NUBA 1PSRA 1XFWO 1BJFA 2L50A 4JPZB 2LP2A 2LMVA 2LNKA 2LUCA 3LLEA 3PALA 1KQVA 2LVIA 1CLMA 2M9GA 1TIZA 1DJWA 5HLVA 3GOFA 1JC2A 1EXRA 1KK8C 1PSBA 1CFFA 2NCPA 2MBXA 2BBMA 2I2RE 3PSRA 2LMTA 3I5IB 1G4YR 4OCIA 4R1EA 1IKUA 1QXPA 4A4BA 1KK7Z 2M7NA 1B4CA 2CTNA 1BOCA 1J7QA 1JSAA 2LE9B 2M49B 1OMDA 4PDZA 4BY5A 2K8MB 2KBIA 1S6CA 2KSPA 5I2LA 1L2OC 1PRWA 3CR2A 1WDCB 4F0ZB 2OS8B 2FOTA 3NSLA 2LLTA 2PRUA 1GGZA 1CDNA 1AP4A 2M8UA 3I5FB 3CR5X 5AANA 2KI4B 1J7OA 5I8NA 2KHNA 2HETA 2L0PA 3O4YA 5KU1A 2HQ8A 2CBLA 1TNQA 4N1FA 1NYAA 3ZNIA 2LVJA 4BY4A 3PN7C 1QIVA 1EH2A 4OVNF 5F6TA 1IWQA 1QTXA 1SBJA 2HQWA 5AFPA 1UHNA 2KAVA 1C7VA 1Y1UA 2LHLA 1RJVA 1TCFA 1K95A 2KI6D 1M46A 2NLNA 3JTDB 5D7FA 3CZTX 2L4IA 3VRPA 4OR9B 2F33A 1N2DA 1FI6A 2QPTA 2IS9A 2TN4A 1DJIA 3HX4A 1SMGA 4M2OA 2PVBA 3I5IC 3SG6A 5HKYA 1W7JB 5HYDA 1TOPA 1BR4B 1XK4C 1QJTA 4M2PA 3CLNA 1U5IB 4MZLA 4PHNA 2L4HA 1UHJA 1CMFA 2WC8A 2PMYA 2ZNDA 1CKKA 3OX6A 2F8PA 3NSKA 5CSIA 2KYCA 1QATA 1DT7B 2M1KB 3A8RA 3LK1A 4DCKA 5I2OA 2KNEA 4YRUA 2LLSA 1B47A 1WDCC 1YTZC 3CS1A 1IRJA 5IBWA 1A4PA 2JRFA 4UPGA 2AUCA 3OB1B 1WY9A 4YGDB 3I5FC 1OSAA 2FJUB 2KI4C 1S36A 5JOLA 2HF5A 1FW4A 1SW8A 1XFXO 1MXLC 2BBNA 4XYNA 4N5XA 1YR5A 1PULA 4MBEA 3TS5B 1CB1A 1ZFSA 2OTGB 2M1UA 1ZOTB 1S1EA 3AAKA 2JPTA 1PVAA 4YI9A 1YX8A 2LANA 3JTDC 4M2QA 3OP0A 1BT6A 1NSHA 3D0YB 2Y1NA 3I5GB 2L5XB 2BCAA 1F55A 1XK4A 3OB2B 3VRNA 4E68A 1UHKA 2H61C 3NSOA 3ZWHA 2KAYA 3EVUA 1LINA 4MLWA 4C0JA 5GQQC 1Y6WA 4FQOA 4PALA 3CTNA 3I5HC 1IJ6A 2LAPA 1CM1A 1MR8A 2BKIB 1SL7A 1TCOB 1SKTA 5ER5A 4YGBB 3AKAA 1NX1A 1NX3A 4ZCUA 1G8IA 5G08A 3TZ1A 1BODA 1K94A 1NIWA 3QRXA 1WRLA 1DVIA 4DUQA 1NX0A 1XVJA 2ZNEA 5DKRA 2CXJA 1A03A 1A75B 3DF0A 1M63B 4MVFA 2ZN8A 1IGVA 4XJKB 1NPQA 1DJYA 5HKWA 2EC6B 3BQ3A 2BCXA 1UP5A 1HQVA 4MEWA 1UHIA 3EK7A 2JOJA 2QACA 1IG5A 3M0WA 4QJ4B 1FPWA 1H4BA 4DS7A 1LA3A 3K21A 1AJ5A 1J55A 1KSMA 1NCZA 3PFVA 1EJ3A 2H61A 1S6JA 1K2HA 1DTLA 4GFTA 4GBAA 2JT8A 4AQIA 1CMGA 1OE9B 4Q04A 3CR4X 1EG4A 2F2PA 3WHTB 2JXLA 1K90D 1IH0A 4A4CA 2CCMA 2M29A 2JTZA 1DF0B 3SG4A 1SR6B 1CDLA 3BOWB 4ORAB 4HRHA 4I5NB 2FCEA 1FF1A 2FCDA 1XFZO 4I5JA 5AEQA 3WXAA 3BUMB 2P6BB 2V53A 1K93D 3RM1A 1TN4A 4P5OE 3DD4A 1ZACA 2M0RA 1HT9A 2G9BA 1MXEA
chains in the Genus database with same CATH superfamily
4GGFA 2JNFA 1SCMC 1C07A 1RECA 1J7PA 1S26D 1S5GY 1FBVA 2GGMA 1YUTA 3B6XA 3PLFB 2NCOA 1C7WA 1XFRA 1CM4A 4I5LB 4CIDA 4CLNA 2LM5A 1BR1B 1GJYA 4DIRA 1YURA 1KFUL 1XFVO 1UUSA 1XYDA 1DGUA 2EC6C 2BECA 3OGNA 1QASA 1D1OA 4WQ3A 3CYZA 1N65A 2JTTA 2NZ0A 3EK8A 1SY9A 2EGDA 1SL8A 2DOQA 1B7TY 5AXIA 2LCPA 1S3PA 2BL0B 2K7BA 4CFQA 1SYMA 3VROA 1DEKA 1IJ5A 1K9KA 2LVKA 1SK6D 1BLQA 3L4AA 2M3WA 2AAOA 2PYQA 1BG1A 1SR6C 4INXA 1Y1XA 2MLEC 2NXQA 4MSPA 4C0KA 3KF9A 1DC1A 1K9PA 3SG5A 2OS8C 2WCKA 2AMIA 3DVEA 2BE4A 3F45A 2JPOA 1L7ZA 1OOIX 1Z2CB 3TDIA 1J1DA 3CWGA 2JXCA 4JD9A 2JULA 2KLDA 1ALWA 1IQ5A 1OMRA 1XA5A 2P71A 1JF0A 3DVMA 2K2FA 4PE4A 2OPOA 3B7AA 1OOHA 3R1OA 5FYXA 3TUYB 2ISDA 3SG2A 4AOMA 3SJSA 3O78A 4NDBA 5DKNA 2JZIA 2K7CA 2LLUA 1NWDA 1YUSA 2WC5A 3MSEB 1AHRA 1RK9A 2Q91A 3BUOB 5D69A 1OOFA 5CSFA 2I94A 3OX5A 3VB1A 1QVIZ 1YVLA 1BF5A 4U8DA 1KWOB 1W7IB 1MF8B 3D77A 4GNKB 1LA0A 3B86A 1Y0VH 2CT9A 3SIAA 2JNXA 5TNCA 2MJWB 1M45A 4HSZA 1GQMA 2G2BA 1ALVA 1K9UA 2SCPA 1QV0A 3KPXA 1M31A 2WORA 1DJGA 2GV5A 4GAOA 1NCXA 4FTGA 2JU0A 2H2KA 1LKJA 4QJ3B 1QX5B 1UURA 2KQYA 3VGOA 1DJXA 3BFBA 3EVVA 1OQPA 3NGVA 1DELA 3S0AA 3QMEA 3KEVA 2RGIA 3BYAA 1KSOA 2JQ6A 5JJGA 1WLZA 1RROA 4JWQA 3EKJA 4KYNA 2WCHA 1B1GA 3V2LA 1QX2A 1F54A 2BKHB 3D73A 1E8AA 1QVIY 1F71A 3TUYC 1NX2A 1JF2A 1WLMA 1S5GZ 4HREE 3FWCA 1GGWA 4PT1A 1QLKA 2WOSA 4PHMA 3BUWB 3EKHA 3FWBA 2MRDA 2ZFDA 3N7HA 3D78A 3TS5C 3TDUA 4AQJA 1TWOA 2OTGC 3CABA 3KO0A 3PM8A 2M7LA 3H4SE 1NP8A 2KYFA 1KWOC 1SPYA 1KCYA 3BUXB 4USLA 1KFUS 3PJIA 1DJZA 1QWVA 1ZUZA 5J3XA 3I5GC 1B7TZ 3GK2A 1IQ3A 1JWDA 2I18A 1U5IA 1LS8A 1TNPA 1B8LA 2KI6C 2MLFC 1TTXA 1AJ4A 1Y1AA 2O5GA 5HKZA 3PM2A 1PK0D 1OZSA 2KBMA 4WRIA 1EL4A 1DJHA 3S0EA 3UNWA 4MZJA 1YX7A 3L4LA 3OHMB 2ZRTA 1N0YA 3AKBA 3WHUB 2O60A 2SASA 1AK8A 1YUUA 4IJ7A 2WCJA 4C0LA 3R1PA 1GM0A 2K2AA 1F4QA 1KFXL 2F3YA 2FJYA 3NHIA 1J7RA 1KQMB 2PASA 3L47A 4GUKA 4IL1A 5K89A 1EG3A 1MWNA 2EHBA 3DVJA 3JVTB 4PE7A 1VRKA 1MUXA 3LK0A 1CLBA 2F3ZA 3AAJA 3SS5A 1YRUB 2E6WA 2MHHA 1XFYO 5BPJA 2KFFA 3VRRA 2LV7A 3KHEA 1TNWA 2KFGA 1B8CA 2Y4QA 2Q4UA 4YBHB 1QIWA 2KDHA 3BFHA 5DKQA 1TNXA 1B9AA 2PSRA 1UWOA 3D0YA 1CTRA 4GPLB 1R6PA 2E30A 2R2IA 1JUOA 1F70A 1OW4A 1C3ZA 4PHJA 3SIBA 5I2QA 2LMUA 1W9ZA 1TUJA 2WCBA 3R1VA 3CDNA 4ICBA 1ZMZA 3A4UB 2VRGA 2ZRSA 1ODBA 3D10A 4ETOA 2F2OA 1CDPA 3DF0B 1OMVA 1SRAA 1CLLA 1S6IA 1SL9A 1XO5A 1BMOA 2HPSA 2JT0A 2ERBA 1DGVA 4WQ2A 1TRFA 3DVKA 3IF7A 1QLSA 4JKTA 2QDIA 1G33A 4YI8A 5FI7A 1SCVA 1A29A 5I94A 1PALA 4PE1A 1KK7Y 1K8UA 1QV1A 4HRGA 1C3YA 1J1EA 2KGBC 2QEVA 4MRYA 5CSNA 1RWYA 2I7AA 1F8HA 1KQMC 1M39A 1UHHA 2COLB 1A75A 2PALA 4MN0A 1A2XA 2CNPA 3JVTC 4OV2A 4PHKA 4XJKA 2K61A 4TNCA 5KTYA 1Q80A 1AUIB 4YGCB 1FI5A 4PCWA 3S0BA 5KSZA 2WNDA 3ICBA 3NXAA 4DRWA 1CNPA 3I5HB 4QJ5B 3BXKA 1OZOA 4PE0A 1QX7A 2B1UA 3S0DA 1CFDA 3HCMA 3O6BA 4MZKA 2BE6A 2BNXA 4OZDA 3SG7A 4CFRA 4ORBB 2LP3A 1X02A 3LCPC 2L51A 5ER4X 3SG3A 1JFJA 2PQLA 2LHIA 5HL1A 1V1GA 3RLZA 2LC5A 3IQQA 3FS7A 2BL0C 4N1GA 1CDMA 1YRTB 2KQ6A 1WRZA 2JWWA 1DF0A 2L2CA 1OOJA 1MHOA 2GGZA 2KAXA 3BOWA 3FIAA 2JC2A 5HLOA 1H8BA 1DQEA 1CFCA 1DMOA 1XFUO 1WRKA 3O2PA 3D76A 5DICA 2L98A 2L2EA 2LVVA 1JFKA 2MAZA 2K7OA 1LVCD 3UO9A 2BCBA 2KOTA 3CZ0A 2ZKMX 3C1VA 2K0JA 5CPVA 4YGAA 4CPVA 4NQGA 1RTP1 1KK8B 4I5KA 1F4OA 2KFHA 3CGAA 2KGRA 2WCFA 2MA2A 2Y5IA 3EK4A 1JBAA 5CSJA 2K7DA 1PVBA 2M97A 3LL8B 4JQ0D 1BU3A 1LXFC 4NDDA 4P2YB 3DXLA 3VRQA 1SNLA 4GGNA 4OKHA 1KFXS 3CZ2A 2LUXA 4ORCB 5AERA 3NSIA 1L2OB 1AVSA 1B8RA 2KPHA 1MQ1A 2WC6A 2JT3A 4MRXA 3E3RA 2A4JA 3IQOA 1R2UA 1SCMB 3WNXB 4ZCVA 1NCYA 4YGEB 2ZN9A 4L9MA 3TDZA 4D1EA 4GGFC 5B8IB 3RZSA 3S0FA 3D75A 3GK4X 3BUNB 3PATA 3FE8A 1V1FA 1QS7A 2D8NA 3R72A 5PALA 1RFJA 1YVHA 3GK1A 4NDCA 1K96A 3EVRA 3PN7B 2WCEA 2Y1MA 1CFPA 1NUBA 1PSRA 1XFWO 2KLEA 3BJHA 1BJFA 2L50A 4JPZB 2LP2A 2LMVA 2LNKA 2LUCA 3LLEA 3PALA 4F7FA 1KQVA 2LVIA 1CLMA 4FQTA 2M9GA 1TIZA 1DJWA 5HLVA 3GOFA 1JC2A 1EXRA 1KK8C 1PSBA 1CFFA 2NCPA 2P70A 2MBXA 2BBMA 2I2RE 3PSRA 2LMTA 3I5IB 1G4YR 4OCIA 4R1EA 1IKUA 1QXPA 4A4BA 1KK7Z 2M7NA 3DYEA 1B4CA 2CTNA 1BOCA 1J7QA 2QEOA 1JSAA 2LE9B 2M49B 1OMDA 4PDZA 4BY5A 2K8MB 2KBIA 1S6CA 2KSPA 5I2LA 3OBVA 1L2OC 1PRWA 3O4XA 3CR2A 1WDCB 1TUZA 4F0ZB 2OS8B 2FOTA 3NSLA 2LLTA 2PRUA 1GGZA 5D3OA 1CDNA 1AP4A 2M8UA 3I5FB 3CR5X 5AANA 2KI4B 1J7OA 3B88A 5I8NA 3S0GA 2KHNA 2HETA 3BFAA 2L0PA 3O4YA 5KU1A 2HQ8A 2CBLA 1TNQA 1Z4HA 4N1FA 1NYAA 3DY9A 5FI2A 3ZNIA 2LVJA 4BY4A 3PN7C 1QIVA 1EH2A 4OVNF 5F6TA 1IWQA 2QEBA 1QTXA 1SBJA 2HQWA 5AFPA 1UHNA 2KAVA 1C7VA 1Y1UA 2LHLA 5FI6A 2YGUA 1RJVA 1TCFA 1K95A 2KI6D 3IVTA 1M46A 2NLNA 3JTDB 3K1EA 3CZTX 2L4IA 1SSEB 4INWA 5D7FA 3VRPA 4OR9B 2F33A 1N2DA 1FI6A 2QPTA 2IS9A 2TN4A 1DJIA 3HX4A 1SMGA 4M2OA 2PVBA 3I5IC 3SG6A 5HKYA 1W7JB 5HYDA 3EG5B 1TOPA 1BR4B 1XK4C 1QJTA 4M2PA 3CLNA 1U5IB 4MZLA 4PHNA 2L4HA 1UHJA 5EL2A 2WC8A 2PMYA 2ZNDA 1CMFA 1CKKA 3OX6A 2F8PA 3NSKA 5CSIA 2KYCA 1QATA 1DT7B 2M1KB 3A8RA 3LK1A 4DCKA 5I2OA 2KNEA 4YRUA 2LLSA 1B47A 1WDCC 1YTZC 3CS1A 1IRJA 5IBWA 1A4PA 2JRFA 2L5YA 2AUCA 4UPGA 3OB1B 1WY9A 4YGDB 3FE6A 3I5FC 1OSAA 2FJUB 2KI4C 2WCMA 1S36A 5JOLA 2HF5A 1FW4A 1SW8A 1XFXO 1MXLC 2BBNA 3CZ1A 4XYNA 1P28A 3D74A 4N5XA 1YR5A 1PULA 4MBEA 3TS5B 1CB1A 1ZFSA 2OTGB 2M1UA 1ZOTB 1S1EA 3AAKA 2JPTA 1ORGA 1T14A 1PVAA 4YI9A 1YX8A 2LANA 3JTDC 4M2QA 3OP0A 1BT6A 1NSHA 3D0YB 2Y1NA 3I5GB 2L5XB 2BCAA 1F55A 1XK4A 3OB2B 3VRNA 4E68A 1UHKA 2H61C 3NSOA 3ZWHA 2KAYA 3EVUA 1LINA 4MLWA 4C0JA 5GQQC 1Y6WA 3SS3A 4FQOA 4PALA 3CTNA 3I5HC 1IJ6A 3FE9A 2LAPA 1CM1A 2BAPA 1MR8A 2BKIB 1SL7A 1TCOB 1SKTA 3B87A 5ER5A 4YGBB 3AKAA 1NX1A 1NX3A 4ZCUA 1IIOA 1G8IA 5G08A 3TZ1A 1BODA 3NHTA 1K94A 1NIWA 3QRXA 1WRLA 1DVIA 4DUQA 1NX0A 1XVJA 2ZNEA 5DKRA 2CXJA 1A03A 1A75B 2GTEA 3DF0A 1M63B 4MVFA 2ZN8A 1IGVA 4XJKB 1NPQA 1DJYA 5HKWA 2EC6B 3BQ3A 2BCXA 1UP5A 1HQVA 4MEWA 3SS4A 1UHIA 2H8VA 2QEHA 3EK7A 2JOJA 2QACA 1IG5A 3M0WA 3Q8IA 4QJ4B 1FPWA 1H4BA 4DS7A 1LA3A 3K21A 1AJ5A 1J55A 1KSMA 1NCZA 3PFVA 2K60A 1EJ3A 2H61A 1S6JA 1K2HA 1DTLA 4GFTA 4GBAA 2JT8A 2WCLA 4AQIA 1OE9B 4Q04A 3CR4X 1EG4A 1CMGA 2F2PA 3WHTB 3DZTA 2JXLA 1K90D 1IH0A 1OOGA 4A4CA 2CCMA 2M29A 2JTZA 1DF0B 3SG4A 1SR6B 1CDLA 3BOWB 4ORAB 4HRHA 4I5NB 2FCEA 1FF1A 2FCDA 1XFZO 4I5JA 5AEQA 3WXAA 3BUMB 2P6BB 2V53A 1K93D 3RM1A 1TN4A 4P5OE 3DD4A 1ZACA 2M0RA 1HT9A 2G9BA 1MXEA
chains in the Genus database with same CATH topology
4GGFA 2JNFA 1SCMC 1C07A 1RECA 1J7PA 1S26D 1S5GY 1FBVA 2GGMA 1YUTA 3PLFB 2NCOA 1C7WA 1CM4A 4I5LB 4CIDA 4CLNA 2LM5A 1BR1B 1GJYA 4DIRA 1YURA 1KFUL 1XFVO 1UUSA 1XYDA 1DGUA 2EC6C 2BECA 1D1OA 1QASA 4WQ3A 1N65A 2JTTA 2NZ0A 3EK8A 1SY9A 2EGDA 1SL8A 2DOQA 1B7TY 5AXIA 2LCPA 1S3PA 2BL0B 2K7BA 4CFQA 1SYMA 3VROA 1IJ5A 1K9KA 2LVKA 1SK6D 1BLQA 2M3WA 2AAOA 1BG1A 1SR6C 1Y1XA 2MLEC 2NXQA 4MSPA 4C0KA 3KF9A 1K9PA 3SG5A 2OS8C 3DVEA 2AMIA 3F45A 2BE4A 1L7ZA 3TDIA 1J1DA 3CWGA 2JXCA 5K89A 2JULA 1ALWA 1IQ5A 1OMRA 1XA5A 1JF0A 3DVMA 2K2FA 4PE4A 2OPOA 5FYXA 3TUYB 2ISDA 3SG2A 4AOMA 3SJSA 3O78A 4NDBA 5DKNA 2JZIA 2K7CA 2LLUA 1NWDA 1YUSA 3MSEB 1AHRA 1RK9A 2Q91A 3BUOB 5D69A 5CSFA 2I94A 3OX5A 1QVIZ 1YVLA 1BF5A 4U8DA 1KWOB 1W7IB 1MF8B 4GNKB 1LA0A 1Y0VH 2CT9A 3SIAA 2JNXA 5TNCA 2MJWB 1M45A 4HSZA 1GQMA 2G2BA 1ALVA 1K9UA 2SCPA 1QV0A 3KPXA 1M31A 2WORA 1DJGA 2GV5A 4GAOA 1NCXA 4FTGA 2JU0A 2H2KA 1LKJA 4QJ3B 1QX5B 1UURA 2KQYA 3VGOA 1DJXA 3EVVA 1OQPA 3KEVA 2RGIA 3BYAA 1KSOA 2JQ6A 5JJGA 1WLZA 1RROA 4JWQA 3EKJA 1B1GA 1QX2A 1F54A 2BKHB 1E8AA 1QVIY 1F71A 3TUYC 1NX2A 1JF2A 1WLMA 1S5GZ 4HREE 3FWCA 1GGWA 1QLKA 2WOSA 4PHMA 3BUWB 3EKHA 3FWBA 2MRDA 2ZFDA 3TS5C 4AQJA 3TDUA 2OTGC 3KO0A 3PM8A 2M7LA 3H4SE 1NP8A 2KYFA 1KWOC 1SPYA 1KCYA 3BUXB 4USLA 1KFUS 1DJZA 1ZUZA 5J3XA 3I5GC 1B7TZ 3GK2A 1IQ3A 1JWDA 2I18A 1U5IA 1TNPA 1B8LA 2KI6C 2MLFC 1TTXA 1AJ4A 1Y1AA 2O5GA 5HKZA 1PK0D 1OZSA 2KBMA 4WRIA 1EL4A 1DJHA 4MZJA 1YX7A 3OHMB 2ZRTA 1N0YA 3AKBA 3WHUB 2O60A 2SASA 1AK8A 1YUUA 4C0LA 2K2AA 1F4QA 1KFXL 2F3YA 4GUKA 1J7RA 1KQMB 2PASA 4IL1A 1EG3A 1MWNA 2EHBA 3DVJA 3JVTB 4PE7A 1VRKA 1MUXA 3LK0A 1CLBA 2F3ZA 3AAJA 1YRUB 2E6WA 2MHHA 1XFYO 5BPJA 2KFFA 3VRRA 2LV7A 3KHEA 1TNWA 2KFGA 1B8CA 2Y4QA 2Q4UA 4YBHB 1QIWA 2KDHA 5DKQA 1TNXA 1B9AA 2PSRA 1UWOA 3D0YA 1CTRA 4GPLB 1R6PA 2E30A 2R2IA 1JUOA 1F70A 4PHJA 3SIBA 5I2QA 2LMUA 2WCBA 4ICBA 1ZMZA 3A4UB 2VRGA 2ZRSA 1ODBA 3D10A 4ETOA 2F2OA 1CDPA 3DF0B 1OMVA 1SRAA 1CLLA 1S6IA 1SL9A 1XO5A 1BMOA 2HPSA 2JT0A 1DGVA 4WQ2A 1TRFA 3DVKA 3IF7A 1QLSA 1G33A 4YI8A 1SCVA 1A29A 1PALA 4PE1A 1KK7Y 1K8UA 1QV1A 4HRGA 1J1EA 2KGBC 4MRYA 5CSNA 1F8HA 1RWYA 2I7AA 1KQMC 1M39A 1UHHA 2COLB 1A75A 2PALA 4MN0A 1A2XA 2CNPA 3JVTC 4OV2A 4PHKA 4XJKA 2K61A 4TNCA 5KTYA 1Q80A 1AUIB 4YGCB 1FI5A 4PCWA 5KSZA 2WNDA 3ICBA 3NXAA 4DRWA 1CNPA 3I5HB 4QJ5B 3BXKA 1OZOA 4PE0A 1QX7A 2B1UA 1CFDA 3HCMA 3O6BA 4MZKA 2BE6A 3SG7A 4CFRA 4ORBB 2LP3A 1X02A 3LCPC 2L51A 5ER4X 3SG3A 1JFJA 2LHIA 1V1GA 3RLZA 2LC5A 3IQQA 3FS7A 2BL0C 4N1GA 1CDMA 1YRTB 2KQ6A 1WRZA 2JWWA 1DF0A 1OOJA 1MHOA 2GGZA 2KAXA 3BOWA 3FIAA 2JC2A 5HLOA 1H8BA 1CFCA 1DMOA 1XFUO 1WRKA 3O2PA 2L98A 2L2EA 2LVVA 1JFKA 2MAZA 2K7OA 1LVCD 2BCBA 2KOTA 2ZKMX 3C1VA 2K0JA 5CPVA 4YGAA 4CPVA 4NQGA 1RTP1 1KK8B 4I5KA 1F4OA 2KFHA 3CGAA 2KGRA 2WCFA 2MA2A 2Y5IA 3EK4A 1JBAA 5CSJA 2K7DA 1PVBA 2M97A 3LL8B 4JQ0D 1BU3A 1LXFC 4NDDA 4P2YB 3VRQA 1SNLA 4GGNA 4OKHA 1KFXS 2LUXA 4ORCB 5AERA 3NSIA 1L2OB 1AVSA 1B8RA 1MQ1A 2JT3A 4MRXA 3E3RA 2A4JA 3IQOA 1R2UA 1SCMB 3WNXB 4ZCVA 1NCYA 4YGEB 2ZN9A 4L9MA 3TDZA 4D1EA 4GGFC 5B8IB 3GK4X 3BUNB 3PATA 1V1FA 1QS7A 2D8NA 5PALA 1RFJA 1YVHA 3GK1A 4NDCA 1K96A 3EVRA 3PN7B 2WCEA 2Y1MA 1CFPA 1NUBA 1PSRA 1XFWO 1BJFA 2L50A 4JPZB 2LP2A 2LMVA 2LNKA 2LUCA 3LLEA 3PALA 1KQVA 2LVIA 1CLMA 2M9GA 1TIZA 1DJWA 5HLVA 3GOFA 1JC2A 1EXRA 1KK8C 1PSBA 1CFFA 2NCPA 2MBXA 2BBMA 2I2RE 3PSRA 2LMTA 3I5IB 1G4YR 4OCIA 4R1EA 1IKUA 1QXPA 4A4BA 1KK7Z 2M7NA 1B4CA 2CTNA 1BOCA 1J7QA 1JSAA 2LE9B 2M49B 1OMDA 4PDZA 4BY5A 2K8MB 2KBIA 1S6CA 2KSPA 5I2LA 1L2OC 1PRWA 3CR2A 1WDCB 4F0ZB 2OS8B 2FOTA 3NSLA 2LLTA 2PRUA 1GGZA 1CDNA 1AP4A 2M8UA 3I5FB 3CR5X 5AANA 2KI4B 1J7OA 5I8NA 2KHNA 2HETA 2L0PA 3O4YA 5KU1A 2HQ8A 2CBLA 1TNQA 4N1FA 1NYAA 3ZNIA 2LVJA 4BY4A 3PN7C 1QIVA 1EH2A 4OVNF 5F6TA 1IWQA 1QTXA 1SBJA 2HQWA 5AFPA 1UHNA 2KAVA 1C7VA 1Y1UA 2LHLA 1RJVA 1TCFA 1K95A 2KI6D 1M46A 2NLNA 3JTDB 5D7FA 3CZTX 2L4IA 3VRPA 4OR9B 2F33A 1N2DA 1FI6A 2QPTA 2IS9A 2TN4A 1DJIA 3HX4A 1SMGA 4M2OA 2PVBA 3I5IC 3SG6A 5HKYA 1W7JB 5HYDA 1TOPA 1BR4B 1XK4C 1QJTA 4M2PA 3CLNA 1U5IB 4MZLA 4PHNA 2L4HA 1UHJA 1CMFA 2WC8A 2PMYA 2ZNDA 1CKKA 3OX6A 2F8PA 3NSKA 5CSIA 2KYCA 1QATA 1DT7B 2M1KB 3A8RA 3LK1A 4DCKA 5I2OA 2KNEA 4YRUA 2LLSA 1B47A 1WDCC 1YTZC 3CS1A 1IRJA 5IBWA 1A4PA 2JRFA 4UPGA 2AUCA 3OB1B 1WY9A 4YGDB 3I5FC 1OSAA 2FJUB 2KI4C 1S36A 5JOLA 2HF5A 1FW4A 1SW8A 1XFXO 1MXLC 2BBNA 4XYNA 4N5XA 1YR5A 1PULA 4MBEA 3TS5B 1CB1A 1ZFSA 2OTGB 2M1UA 1ZOTB 1S1EA 3AAKA 2JPTA 1PVAA 4YI9A 1YX8A 2LANA 3JTDC 4M2QA 3OP0A 1BT6A 1NSHA 3D0YB 2Y1NA 3I5GB 2L5XB 2BCAA 1F55A 1XK4A 3OB2B 3VRNA 4E68A 1UHKA 2H61C 3NSOA 3ZWHA 2KAYA 3EVUA 1LINA 4MLWA 4C0JA 5GQQC 1Y6WA 4FQOA 4PALA 3CTNA 3I5HC 1IJ6A 2LAPA 1CM1A 1MR8A 2BKIB 1SL7A 1TCOB 1SKTA 5ER5A 4YGBB 3AKAA 1NX1A 1NX3A 4ZCUA 1G8IA 5G08A 3TZ1A 1BODA 1K94A 1NIWA 3QRXA 1WRLA 1DVIA 4DUQA 1NX0A 1XVJA 2ZNEA 5DKRA 2CXJA 1A03A 1A75B 3DF0A 1M63B 4MVFA 2ZN8A 1IGVA 4XJKB 1NPQA 1DJYA 5HKWA 2EC6B 3BQ3A 2BCXA 1UP5A 1HQVA 4MEWA 1UHIA 3EK7A 2JOJA 2QACA 1IG5A 3M0WA 4QJ4B 1FPWA 1H4BA 4DS7A 1LA3A 3K21A 1AJ5A 1J55A 1KSMA 1NCZA 3PFVA 1EJ3A 2H61A 1S6JA 1K2HA 1DTLA 4GFTA 4GBAA 2JT8A 4AQIA 1CMGA 1OE9B 4Q04A 3CR4X 1EG4A 2F2PA 3WHTB 2JXLA 1K90D 1IH0A 4A4CA 2CCMA 2M29A 2JTZA 1DF0B 3SG4A 1SR6B 1CDLA 3BOWB 4ORAB 4HRHA 4I5NB 2FCEA 1FF1A 2FCDA 1XFZO 4I5JA 5AEQA 3WXAA 3BUMB 2P6BB 2V53A 1K93D 3RM1A 1TN4A 4P5OE 3DD4A 1ZACA 2M0RA 1HT9A 2G9BA 1MXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGF A;  2JNF A;  1SCM C;  1C07 A;  1REC A;  1J7P A;  1S26 D;  1S5G Y;  1FBV A;  2GGM A;  1YUT A;  3PLF B;  2NCO A;  1C7W A;  1CM4 A;  4I5L B;  4CID A;  4CLN A;  2LM5 A;  1BR1 B;  1GJY A;  4DIR A;  1YUR A;  1KFU L;  1XFV O;  1UUS A;  1XYD A;  1DGU A;  2EC6 C;  2BEC A;  1D1O A;  1QAS A;  4WQ3 A;  1N65 A;  2JTT A;  2NZ0 A;  3EK8 A;  1SY9 A;  2EGD A;  1SL8 A;  2DOQ A;  1B7T Y;  5AXI A;  2LCP A;  1S3P A;  2BL0 B;  2K7B A;  4CFQ A;  1SYM A;  3VRO A;  1IJ5 A;  1K9K A;  2LVK A;  1SK6 D;  1BLQ A;  2M3W A;  2AAO A;  1BG1 A;  1SR6 C;  1Y1X A;  2MLE C;  2NXQ A;  4MSP A;  4C0K A;  3KF9 A;  1K9P A;  3SG5 A;  2OS8 C;  3DVE A;  2AMI A;  3F45 A;  2BE4 A;  1L7Z A;  3TDI A;  1J1D A;  3CWG A;  2JXC A;  5K89 A;  2JUL A;  1ALW A;  1IQ5 A;  1OMR A;  1XA5 A;  1JF0 A;  3DVM A;  2K2F A;  4PE4 A;  2OPO A;  5FYX A;  3TUY B;  2ISD A;  3SG2 A;  4AOM A;  3SJS A;  3O78 A;  4NDB A;  5DKN A;  2JZI A;  2K7C A;  2LLU A;  1NWD A;  1YUS A;  3MSE B;  1AHR A;  1RK9 A;  2Q91 A;  3BUO B;  5D69 A;  5CSF A;  2I94 A;  3OX5 A;  1QVI Z;  1YVL A;  1BF5 A;  4U8D A;  1KWO B;  1W7I B;  1MF8 B;  4GNK B;  1LA0 A;  1Y0V H;  2CT9 A;  3SIA A;  2JNX A;  5TNC A;  2MJW B;  1M45 A;  4HSZ A;  1GQM A;  2G2B A;  1ALV A;  1K9U A;  2SCP A;  1QV0 A;  3KPX A;  1M31 A;  2WOR A;  1DJG A;  2GV5 A;  4GAO A;  1NCX A;  4FTG A;  2JU0 A;  2H2K A;  1LKJ A;  4QJ3 B;  1QX5 B;  1UUR A;  2KQY A;  3VGO A;  1DJX A;  3EVV A;  1OQP A;  3KEV A;  2RGI A;  3BYA A;  1KSO A;  2JQ6 A;  5JJG A;  1WLZ A;  1RRO A;  4JWQ A;  3EKJ A;  1B1G A;  1QX2 A;  1F54 A;  2BKH B;  1E8A A;  1QVI Y;  1F71 A;  3TUY C;  1NX2 A;  1JF2 A;  1WLM A;  1S5G Z;  4HRE E;  3FWC A;  1GGW A;  1QLK A;  2WOS A;  4PHM A;  3BUW B;  3EKH A;  3FWB A;  2MRD A;  2ZFD A;  3TS5 C;  4AQJ A;  3TDU A;  2OTG C;  3KO0 A;  3PM8 A;  2M7L A;  3H4S E;  1NP8 A;  2KYF A;  1KWO C;  1SPY A;  1KCY A;  3BUX B;  4USL A;  1KFU S;  1DJZ A;  1ZUZ A;  5J3X A;  3I5G C;  1B7T Z;  3GK2 A;  1IQ3 A;  1JWD A;  2I18 A;  1U5I A;  1TNP A;  1B8L A;  2KI6 C;  2MLF C;  1TTX A;  1AJ4 A;  1Y1A A;  2O5G A;  5HKZ A;  1PK0 D;  1OZS A;  2KBM A;  4WRI A;  1EL4 A;  1DJH A;  4MZJ A;  1YX7 A;  3OHM B;  2ZRT A;  1N0Y A;  3AKB A;  3WHU B;  2O60 A;  2SAS A;  1AK8 A;  1YUU A;  4C0L A;  2K2A A;  1F4Q A;  1KFX L;  2F3Y A;  4GUK A;  1J7R A;  1KQM B;  2PAS A;  4IL1 A;  1EG3 A;  1MWN A;  2EHB A;  3DVJ A;  3JVT B;  4PE7 A;  1VRK A;  1MUX A;  3LK0 A;  1CLB A;  2F3Z A;  3AAJ A;  1YRU B;  2E6W A;  2MHH A;  1XFY O;  5BPJ A;  2KFF A;  3VRR A;  2LV7 A;  3KHE A;  1TNW A;  2KFG A;  1B8C A;  2Y4Q A;  2Q4U A;  4YBH B;  1QIW A;  2KDH A;  5DKQ A;  1TNX A;  1B9A A;  2PSR A;  1UWO A;  3D0Y A;  1CTR A;  4GPL B;  1R6P A;  2E30 A;  2R2I A;  1JUO A;  1F70 A;  4PHJ A;  3SIB A;  5I2Q A;  2LMU A;  2WCB A;  4ICB A;  1ZMZ A;  3A4U B;  2VRG A;  2ZRS A;  1ODB A;  3D10 A;  4ETO A;  2F2O A;  1CDP A;  3DF0 B;  1OMV A;  1SRA A;  1CLL A;  1S6I A;  1SL9 A;  1XO5 A;  1BMO A;  2HPS A;  2JT0 A;  1DGV A;  4WQ2 A;  1TRF A;  3DVK A;  3IF7 A;  1QLS A;  1G33 A;  4YI8 A;  1SCV A;  1A29 A;  1PAL A;  4PE1 A;  1KK7 Y;  1K8U A;  1QV1 A;  4HRG A;  1J1E A;  2KGB C;  4MRY A;  5CSN A;  1F8H A;  1RWY A;  2I7A A;  1KQM C;  1M39 A;  1UHH A;  2COL B;  1A75 A;  2PAL A;  4MN0 A;  1A2X A;  2CNP A;  3JVT C;  4OV2 A;  4PHK A;  4XJK A;  2K61 A;  4TNC A;  5KTY A;  1Q80 A;  1AUI B;  4YGC B;  1FI5 A;  4PCW A;  5KSZ A;  2WND A;  3ICB A;  3NXA A;  4DRW A;  1CNP A;  3I5H B;  4QJ5 B;  3BXK A;  1OZO A;  4PE0 A;  1QX7 A;  2B1U A;  1CFD A;  3HCM A;  3O6B A;  4MZK A;  2BE6 A;  3SG7 A;  4CFR A;  4ORB B;  2LP3 A;  1X02 A;  3LCP C;  2L51 A;  5ER4 X;  3SG3 A;  1JFJ A;  2LHI A;  1V1G A;  3RLZ A;  2LC5 A;  3IQQ A;  3FS7 A;  2BL0 C;  4N1G A;  1CDM A;  1YRT B;  2KQ6 A;  1WRZ A;  2JWW A;  1DF0 A;  1OOJ A;  1MHO A;  2GGZ A;  2KAX A;  3BOW A;  3FIA A;  2JC2 A;  5HLO A;  1H8B A;  1CFC A;  1DMO A;  1XFU O;  1WRK A;  3O2P A;  2L98 A;  2L2E A;  2LVV A;  1JFK A;  2MAZ A;  2K7O A;  1LVC D;  2BCB A;  2KOT A;  2ZKM X;  3C1V A;  2K0J A;  5CPV A;  4YGA A;  4CPV A;  4NQG A;  1RTP 1;  1KK8 B;  4I5K A;  1F4O A;  2KFH A;  3CGA A;  2KGR A;  2WCF A;  2MA2 A;  2Y5I A;  3EK4 A;  1JBA A;  5CSJ A;  2K7D A;  1PVB A;  2M97 A;  3LL8 B;  4JQ0 D;  1BU3 A;  1LXF C;  4NDD A;  4P2Y B;  3VRQ A;  1SNL A;  4GGN A;  4OKH A;  1KFX S;  2LUX A;  4ORC B;  5AER A;  3NSI A;  1L2O B;  1AVS A;  1B8R A;  1MQ1 A;  2JT3 A;  4MRX A;  3E3R A;  2A4J A;  3IQO A;  1R2U A;  1SCM B;  3WNX B;  4ZCV A;  1NCY A;  4YGE B;  2ZN9 A;  4L9M A;  3TDZ A;  4D1E A;  4GGF C;  5B8I B;  3GK4 X;  3BUN B;  3PAT A;  1V1F A;  1QS7 A;  2D8N A;  5PAL A;  1RFJ A;  1YVH A;  3GK1 A;  4NDC A;  1K96 A;  3EVR A;  3PN7 B;  2WCE A;  2Y1M A;  1CFP A;  1NUB A;  1PSR A;  1XFW O;  1BJF A;  2L50 A;  4JPZ B;  2LP2 A;  2LMV A;  2LNK A;  2LUC A;  3LLE A;  3PAL A;  1KQV A;  2LVI A;  1CLM A;  2M9G A;  1TIZ A;  1DJW A;  5HLV A;  3GOF A;  1JC2 A;  1EXR A;  1KK8 C;  1PSB A;  1CFF A;  2NCP A;  2MBX A;  2BBM A;  2I2R E;  3PSR A;  2LMT A;  3I5I B;  1G4Y R;  4OCI A;  4R1E A;  1IKU A;  1QXP A;  4A4B A;  1KK7 Z;  2M7N A;  1B4C A;  2CTN A;  1BOC A;  1J7Q A;  1JSA A;  2LE9 B;  2M49 B;  1OMD A;  4PDZ A;  4BY5 A;  2K8M B;  2KBI A;  1S6C A;  2KSP A;  5I2L A;  1L2O C;  1PRW A;  3CR2 A;  1WDC B;  4F0Z B;  2OS8 B;  2FOT A;  3NSL A;  2LLT A;  2PRU A;  1GGZ A;  1CDN A;  1AP4 A;  2M8U A;  3I5F B;  3CR5 X;  5AAN A;  2KI4 B;  1J7O A;  5I8N A;  2KHN A;  2HET A;  2L0P A;  3O4Y A;  5KU1 A;  2HQ8 A;  2CBL A;  1TNQ A;  4N1F A;  1NYA A;  3ZNI A;  2LVJ A;  4BY4 A;  3PN7 C;  1QIV A;  1EH2 A;  4OVN F;  5F6T A;  1IWQ A;  1QTX A;  1SBJ A;  2HQW A;  5AFP A;  1UHN A;  2KAV A;  1C7V A;  1Y1U A;  2LHL A;  1RJV A;  1TCF A;  1K95 A;  2KI6 D;  1M46 A;  2NLN A;  3JTD B;  5D7F A;  3CZT X;  2L4I A;  3VRP A;  4OR9 B;  2F33 A;  1N2D A;  1FI6 A;  2QPT A;  2IS9 A;  2TN4 A;  1DJI A;  3HX4 A;  1SMG A;  4M2O A;  2PVB A;  3I5I C;  3SG6 A;  5HKY A;  1W7J B;  5HYD A;  1TOP A;  1BR4 B;  1XK4 C;  1QJT A;  4M2P A;  3CLN A;  1U5I B;  4MZL A;  4PHN A;  2L4H A;  1UHJ A;  1CMF A;  2WC8 A;  2PMY A;  2ZND A;  1CKK A;  3OX6 A;  2F8P A;  3NSK A;  5CSI A;  2KYC A;  1QAT A;  1DT7 B;  2M1K B;  3A8R A;  3LK1 A;  4DCK A;  5I2O A;  2KNE A;  4YRU A;  2LLS A;  1B47 A;  1WDC C;  1YTZ C;  3CS1 A;  1IRJ A;  5IBW A;  1A4P A;  2JRF A;  4UPG A;  2AUC A;  3OB1 B;  1WY9 A;  4YGD B;  3I5F C;  1OSA A;  2FJU B;  2KI4 C;  1S36 A;  5JOL A;  2HF5 A;  1FW4 A;  1SW8 A;  1XFX O;  1MXL C;  2BBN A;  4XYN A;  4N5X A;  1YR5 A;  1PUL A;  4MBE A;  3TS5 B;  1CB1 A;  1ZFS A;  2OTG B;  2M1U A;  1ZOT B;  1S1E A;  3AAK A;  2JPT A;  1PVA A;  4YI9 A;  1YX8 A;  2LAN A;  3JTD C;  4M2Q A;  3OP0 A;  1BT6 A;  1NSH A;  3D0Y B;  2Y1N A;  3I5G B;  2L5X B;  2BCA A;  1F55 A;  1XK4 A;  3OB2 B;  3VRN A;  4E68 A;  1UHK A;  2H61 C;  3NSO A;  3ZWH A;  2KAY A;  3EVU A;  1LIN A;  4MLW A;  4C0J A;  5GQQ C;  1Y6W A;  4FQO A;  4PAL A;  3CTN A;  3I5H C;  1IJ6 A;  2LAP A;  1CM1 A;  1MR8 A;  2BKI B;  1SL7 A;  1TCO B;  1SKT A;  5ER5 A;  4YGB B;  3AKA A;  1NX1 A;  1NX3 A;  4ZCU A;  1G8I A;  5G08 A;  3TZ1 A;  1BOD A;  1K94 A;  1NIW A;  3QRX A;  1WRL A;  1DVI A;  4DUQ A;  1NX0 A;  1XVJ A;  2ZNE A;  5DKR A;  2CXJ A;  1A03 A;  1A75 B;  3DF0 A;  1M63 B;  4MVF A;  2ZN8 A;  1IGV A;  4XJK B;  1NPQ A;  1DJY A;  5HKW A;  2EC6 B;  3BQ3 A;  2BCX A;  1UP5 A;  1HQV A;  4MEW A;  1UHI A;  3EK7 A;  2JOJ A;  2QAC A;  1IG5 A;  3M0W A;  4QJ4 B;  1FPW A;  1H4B A;  4DS7 A;  1LA3 A;  3K21 A;  1AJ5 A;  1J55 A;  1KSM A;  1NCZ A;  3PFV A;  1EJ3 A;  2H61 A;  1S6J A;  1K2H A;  1DTL A;  4GFT A;  4GBA A;  2JT8 A;  4AQI A;  1CMG A;  1OE9 B;  4Q04 A;  3CR4 X;  1EG4 A;  2F2P A;  3WHT B;  2JXL A;  1K90 D;  1IH0 A;  4A4C A;  2CCM A;  2M29 A;  2JTZ A;  1DF0 B;  3SG4 A;  1SR6 B;  1CDL A;  3BOW B;  4ORA B;  4HRH A;  4I5N B;  2FCE A;  1FF1 A;  2FCD A;  1XFZ O;  4I5J A;  5AEQ A;  3WXA A;  3BUM B;  2P6B B;  2V53 A;  1K93 D;  3RM1 A;  1TN4 A;  4P5O E;  3DD4 A;  1ZAC A;  2M0R A;  1HT9 A;  2G9B A;  1MXE A; 
#chains in the Genus database with same CATH topology
 4GGF A;  2JNF A;  1SCM C;  1C07 A;  1REC A;  1J7P A;  1S26 D;  1S5G Y;  1FBV A;  2GGM A;  1YUT A;  3B6X A;  3PLF B;  2NCO A;  1C7W A;  1XFR A;  1CM4 A;  4I5L B;  4CID A;  4CLN A;  2LM5 A;  1BR1 B;  1GJY A;  4DIR A;  1YUR A;  1KFU L;  1XFV O;  1UUS A;  1XYD A;  1DGU A;  2EC6 C;  2BEC A;  3OGN A;  1QAS A;  1D1O A;  4WQ3 A;  3CYZ A;  1N65 A;  2JTT A;  2NZ0 A;  3EK8 A;  1SY9 A;  2EGD A;  1SL8 A;  2DOQ A;  1B7T Y;  5AXI A;  2LCP A;  1S3P A;  2BL0 B;  2K7B A;  4CFQ A;  1SYM A;  3VRO A;  1DEK A;  1IJ5 A;  1K9K A;  2LVK A;  1SK6 D;  1BLQ A;  3L4A A;  2M3W A;  2AAO A;  2PYQ A;  1BG1 A;  1SR6 C;  4INX A;  1Y1X A;  2MLE C;  2NXQ A;  4MSP A;  4C0K A;  3KF9 A;  1DC1 A;  1K9P A;  3SG5 A;  2OS8 C;  2WCK A;  2AMI A;  3DVE A;  2BE4 A;  3F45 A;  2JPO A;  1L7Z A;  1OOI X;  1Z2C B;  3TDI A;  1J1D A;  3CWG A;  2JXC A;  4JD9 A;  2JUL A;  2KLD A;  1ALW A;  1IQ5 A;  1OMR A;  1XA5 A;  2P71 A;  1JF0 A;  3DVM A;  2K2F A;  4PE4 A;  2OPO A;  3B7A A;  1OOH A;  3R1O A;  5FYX A;  3TUY B;  2ISD A;  3SG2 A;  4AOM A;  3SJS A;  3O78 A;  4NDB A;  5DKN A;  2JZI A;  2K7C A;  2LLU A;  1NWD A;  1YUS A;  2WC5 A;  3MSE B;  1AHR A;  1RK9 A;  2Q91 A;  3BUO B;  5D69 A;  1OOF A;  5CSF A;  2I94 A;  3OX5 A;  3VB1 A;  1QVI Z;  1YVL A;  1BF5 A;  4U8D A;  1KWO B;  1W7I B;  1MF8 B;  3D77 A;  4GNK B;  1LA0 A;  3B86 A;  1Y0V H;  2CT9 A;  3SIA A;  2JNX A;  5TNC A;  2MJW B;  1M45 A;  4HSZ A;  1GQM A;  2G2B A;  1ALV A;  1K9U A;  2SCP A;  1QV0 A;  3KPX A;  1M31 A;  2WOR A;  1DJG A;  2GV5 A;  4GAO A;  1NCX A;  4FTG A;  2JU0 A;  2H2K A;  1LKJ A;  4QJ3 B;  1QX5 B;  1UUR A;  2KQY A;  3VGO A;  1DJX A;  3BFB A;  3EVV A;  1OQP A;  3NGV A;  1DEL A;  3S0A A;  3QME A;  3KEV A;  2RGI A;  3BYA A;  1KSO A;  2JQ6 A;  5JJG A;  1WLZ A;  1RRO A;  4JWQ A;  3EKJ A;  4KYN A;  2WCH A;  1B1G A;  3V2L A;  1QX2 A;  1F54 A;  2BKH B;  3D73 A;  1E8A A;  1QVI Y;  1F71 A;  3TUY C;  1NX2 A;  1JF2 A;  1WLM A;  1S5G Z;  4HRE E;  3FWC A;  1GGW A;  4PT1 A;  1QLK A;  2WOS A;  4PHM A;  3BUW B;  3EKH A;  3FWB A;  2MRD A;  2ZFD A;  3N7H A;  3D78 A;  3TS5 C;  3TDU A;  4AQJ A;  1TWO A;  2OTG C;  3CAB A;  3KO0 A;  3PM8 A;  2M7L A;  3H4S E;  1NP8 A;  2KYF A;  1KWO C;  1SPY A;  1KCY A;  3BUX B;  4USL A;  1KFU S;  3PJI A;  1DJZ A;  1QWV A;  1ZUZ A;  5J3X A;  3I5G C;  1B7T Z;  3GK2 A;  1IQ3 A;  1JWD A;  2I18 A;  1U5I A;  1LS8 A;  1TNP A;  1B8L A;  2KI6 C;  2MLF C;  1TTX A;  1AJ4 A;  1Y1A A;  2O5G A;  5HKZ A;  3PM2 A;  1PK0 D;  1OZS A;  2KBM A;  4WRI A;  1EL4 A;  1DJH A;  3S0E A;  3UNW A;  4MZJ A;  1YX7 A;  3L4L A;  3OHM B;  2ZRT A;  1N0Y A;  3AKB A;  3WHU B;  2O60 A;  2SAS A;  1AK8 A;  1YUU A;  4IJ7 A;  2WCJ A;  4C0L A;  3R1P A;  1GM0 A;  2K2A A;  1F4Q A;  1KFX L;  2F3Y A;  2FJY A;  3NHI A;  1J7R A;  1KQM B;  2PAS A;  3L47 A;  4GUK A;  4IL1 A;  5K89 A;  1EG3 A;  1MWN A;  2EHB A;  3DVJ A;  3JVT B;  4PE7 A;  1VRK A;  1MUX A;  3LK0 A;  1CLB A;  2F3Z A;  3AAJ A;  3SS5 A;  1YRU B;  2E6W A;  2MHH A;  1XFY O;  5BPJ A;  2KFF A;  3VRR A;  2LV7 A;  3KHE A;  1TNW A;  2KFG A;  1B8C A;  2Y4Q A;  2Q4U A;  4YBH B;  1QIW A;  2KDH A;  3BFH A;  5DKQ A;  1TNX A;  1B9A A;  2PSR A;  1UWO A;  3D0Y A;  1CTR A;  4GPL B;  1R6P A;  2E30 A;  2R2I A;  1JUO A;  1F70 A;  1OW4 A;  1C3Z A;  4PHJ A;  3SIB A;  5I2Q A;  2LMU A;  1W9Z A;  1TUJ A;  2WCB A;  3R1V A;  3CDN A;  4ICB A;  1ZMZ A;  3A4U B;  2VRG A;  2ZRS A;  1ODB A;  3D10 A;  4ETO A;  2F2O A;  1CDP A;  3DF0 B;  1OMV A;  1SRA A;  1CLL A;  1S6I A;  1SL9 A;  1XO5 A;  1BMO A;  2HPS A;  2JT0 A;  2ERB A;  1DGV A;  4WQ2 A;  1TRF A;  3DVK A;  3IF7 A;  1QLS A;  4JKT A;  2QDI A;  1G33 A;  4YI8 A;  5FI7 A;  1SCV A;  1A29 A;  5I94 A;  1PAL A;  4PE1 A;  1KK7 Y;  1K8U A;  1QV1 A;  4HRG A;  1C3Y A;  1J1E A;  2KGB C;  2QEV A;  4MRY A;  5CSN A;  1RWY A;  2I7A A;  1F8H A;  1KQM C;  1M39 A;  1UHH A;  2COL B;  1A75 A;  2PAL A;  4MN0 A;  1A2X A;  2CNP A;  3JVT C;  4OV2 A;  4PHK A;  4XJK A;  2K61 A;  4TNC A;  5KTY A;  1Q80 A;  1AUI B;  4YGC B;  1FI5 A;  4PCW A;  3S0B A;  5KSZ A;  2WND A;  3ICB A;  3NXA A;  4DRW A;  1CNP A;  3I5H B;  4QJ5 B;  3BXK A;  1OZO A;  4PE0 A;  1QX7 A;  2B1U A;  3S0D A;  1CFD A;  3HCM A;  3O6B A;  4MZK A;  2BE6 A;  2BNX A;  4OZD A;  3SG7 A;  4CFR A;  4ORB B;  2LP3 A;  1X02 A;  3LCP C;  2L51 A;  5ER4 X;  3SG3 A;  1JFJ A;  2PQL A;  2LHI A;  5HL1 A;  1V1G A;  3RLZ A;  2LC5 A;  3IQQ A;  3FS7 A;  2BL0 C;  4N1G A;  1CDM A;  1YRT B;  2KQ6 A;  1WRZ A;  2JWW A;  1DF0 A;  2L2C A;  1OOJ A;  1MHO A;  2GGZ A;  2KAX A;  3BOW A;  3FIA A;  2JC2 A;  5HLO A;  1H8B A;  1DQE A;  1CFC A;  1DMO A;  1XFU O;  1WRK A;  3O2P A;  3D76 A;  5DIC A;  2L98 A;  2L2E A;  2LVV A;  1JFK A;  2MAZ A;  2K7O A;  1LVC D;  3UO9 A;  2BCB A;  2KOT A;  3CZ0 A;  2ZKM X;  3C1V A;  2K0J A;  5CPV A;  4YGA A;  4CPV A;  4NQG A;  1RTP 1;  1KK8 B;  4I5K A;  1F4O A;  2KFH A;  3CGA A;  2KGR A;  2WCF A;  2MA2 A;  2Y5I A;  3EK4 A;  1JBA A;  5CSJ A;  2K7D A;  1PVB A;  2M97 A;  3LL8 B;  4JQ0 D;  1BU3 A;  1LXF C;  4NDD A;  4P2Y B;  3DXL A;  3VRQ A;  1SNL A;  4GGN A;  4OKH A;  1KFX S;  3CZ2 A;  2LUX A;  4ORC B;  5AER A;  3NSI A;  1L2O B;  1AVS A;  1B8R A;  2KPH A;  1MQ1 A;  2WC6 A;  2JT3 A;  4MRX A;  3E3R A;  2A4J A;  3IQO A;  1R2U A;  1SCM B;  3WNX B;  4ZCV A;  1NCY A;  4YGE B;  2ZN9 A;  4L9M A;  3TDZ A;  4D1E A;  4GGF C;  5B8I B;  3RZS A;  3S0F A;  3D75 A;  3GK4 X;  3BUN B;  3PAT A;  3FE8 A;  1V1F A;  1QS7 A;  2D8N A;  3R72 A;  5PAL A;  1RFJ A;  1YVH A;  3GK1 A;  4NDC A;  1K96 A;  3EVR A;  3PN7 B;  2WCE A;  2Y1M A;  1CFP A;  1NUB A;  1PSR A;  1XFW O;  2KLE A;  3BJH A;  1BJF A;  2L50 A;  4JPZ B;  2LP2 A;  2LMV A;  2LNK A;  2LUC A;  3LLE A;  3PAL A;  4F7F A;  1KQV A;  2LVI A;  1CLM A;  4FQT A;  2M9G A;  1TIZ A;  1DJW A;  5HLV A;  3GOF A;  1JC2 A;  1EXR A;  1KK8 C;  1PSB A;  1CFF A;  2NCP A;  2P70 A;  2MBX A;  2BBM A;  2I2R E;  3PSR A;  2LMT A;  3I5I B;  1G4Y R;  4OCI A;  4R1E A;  1IKU A;  1QXP A;  4A4B A;  1KK7 Z;  2M7N A;  3DYE A;  1B4C A;  2CTN A;  1BOC A;  1J7Q A;  2QEO A;  1JSA A;  2LE9 B;  2M49 B;  1OMD A;  4PDZ A;  4BY5 A;  2K8M B;  2KBI A;  1S6C A;  2KSP A;  5I2L A;  3OBV A;  1L2O C;  1PRW A;  3O4X A;  3CR2 A;  1WDC B;  1TUZ A;  4F0Z B;  2OS8 B;  2FOT A;  3NSL A;  2LLT A;  2PRU A;  1GGZ A;  5D3O A;  1CDN A;  1AP4 A;  2M8U A;  3I5F B;  3CR5 X;  5AAN A;  2KI4 B;  1J7O A;  3B88 A;  5I8N A;  3S0G A;  2KHN A;  2HET A;  3BFA A;  2L0P A;  3O4Y A;  5KU1 A;  2HQ8 A;  2CBL A;  1TNQ A;  1Z4H A;  4N1F A;  1NYA A;  3DY9 A;  5FI2 A;  3ZNI A;  2LVJ A;  4BY4 A;  3PN7 C;  1QIV A;  1EH2 A;  4OVN F;  5F6T A;  1IWQ A;  2QEB A;  1QTX A;  1SBJ A;  2HQW A;  5AFP A;  1UHN A;  2KAV A;  1C7V A;  1Y1U A;  2LHL A;  5FI6 A;  2YGU A;  1RJV A;  1TCF A;  1K95 A;  2KI6 D;  3IVT A;  1M46 A;  2NLN A;  3JTD B;  3K1E A;  3CZT X;  2L4I A;  1SSE B;  4INW A;  5D7F A;  3VRP A;  4OR9 B;  2F33 A;  1N2D A;  1FI6 A;  2QPT A;  2IS9 A;  2TN4 A;  1DJI A;  3HX4 A;  1SMG A;  4M2O A;  2PVB A;  3I5I C;  3SG6 A;  5HKY A;  1W7J B;  5HYD A;  3EG5 B;  1TOP A;  1BR4 B;  1XK4 C;  1QJT A;  4M2P A;  3CLN A;  1U5I B;  4MZL A;  4PHN A;  2L4H A;  1UHJ A;  5EL2 A;  2WC8 A;  2PMY A;  2ZND A;  1CMF A;  1CKK A;  3OX6 A;  2F8P A;  3NSK A;  5CSI A;  2KYC A;  1QAT A;  1DT7 B;  2M1K B;  3A8R A;  3LK1 A;  4DCK A;  5I2O A;  2KNE A;  4YRU A;  2LLS A;  1B47 A;  1WDC C;  1YTZ C;  3CS1 A;  1IRJ A;  5IBW A;  1A4P A;  2JRF A;  2L5Y A;  2AUC A;  4UPG A;  3OB1 B;  1WY9 A;  4YGD B;  3FE6 A;  3I5F C;  1OSA A;  2FJU B;  2KI4 C;  2WCM A;  1S36 A;  5JOL A;  2HF5 A;  1FW4 A;  1SW8 A;  1XFX O;  1MXL C;  2BBN A;  3CZ1 A;  4XYN A;  1P28 A;  3D74 A;  4N5X A;  1YR5 A;  1PUL A;  4MBE A;  3TS5 B;  1CB1 A;  1ZFS A;  2OTG B;  2M1U A;  1ZOT B;  1S1E A;  3AAK A;  2JPT A;  1ORG A;  1T14 A;  1PVA A;  4YI9 A;  1YX8 A;  2LAN A;  3JTD C;  4M2Q A;  3OP0 A;  1BT6 A;  1NSH A;  3D0Y B;  2Y1N A;  3I5G B;  2L5X B;  2BCA A;  1F55 A;  1XK4 A;  3OB2 B;  3VRN A;  4E68 A;  1UHK A;  2H61 C;  3NSO A;  3ZWH A;  2KAY A;  3EVU A;  1LIN A;  4MLW A;  4C0J A;  5GQQ C;  1Y6W A;  3SS3 A;  4FQO A;  4PAL A;  3CTN A;  3I5H C;  1IJ6 A;  3FE9 A;  2LAP A;  1CM1 A;  2BAP A;  1MR8 A;  2BKI B;  1SL7 A;  1TCO B;  1SKT A;  3B87 A;  5ER5 A;  4YGB B;  3AKA A;  1NX1 A;  1NX3 A;  4ZCU A;  1IIO A;  1G8I A;  5G08 A;  3TZ1 A;  1BOD A;  3NHT A;  1K94 A;  1NIW A;  3QRX A;  1WRL A;  1DVI A;  4DUQ A;  1NX0 A;  1XVJ A;  2ZNE A;  5DKR A;  2CXJ A;  1A03 A;  1A75 B;  2GTE A;  3DF0 A;  1M63 B;  4MVF A;  2ZN8 A;  1IGV A;  4XJK B;  1NPQ A;  1DJY A;  5HKW A;  2EC6 B;  3BQ3 A;  2BCX A;  1UP5 A;  1HQV A;  4MEW A;  3SS4 A;  1UHI A;  2H8V A;  2QEH A;  3EK7 A;  2JOJ A;  2QAC A;  1IG5 A;  3M0W A;  3Q8I A;  4QJ4 B;  1FPW A;  1H4B A;  4DS7 A;  1LA3 A;  3K21 A;  1AJ5 A;  1J55 A;  1KSM A;  1NCZ A;  3PFV A;  2K60 A;  1EJ3 A;  2H61 A;  1S6J A;  1K2H A;  1DTL A;  4GFT A;  4GBA A;  2JT8 A;  2WCL A;  4AQI A;  1OE9 B;  4Q04 A;  3CR4 X;  1EG4 A;  1CMG A;  2F2P A;  3WHT B;  3DZT A;  2JXL A;  1K90 D;  1IH0 A;  1OOG A;  4A4C A;  2CCM A;  2M29 A;  2JTZ A;  1DF0 B;  3SG4 A;  1SR6 B;  1CDL A;  3BOW B;  4ORA B;  4HRH A;  4I5N B;  2FCE A;  1FF1 A;  2FCD A;  1XFZ O;  4I5J A;  5AEQ A;  3WXA A;  3BUM B;  2P6B B;  2V53 A;  1K93 D;  3RM1 A;  1TN4 A;  4P5O E;  3DD4 A;  1ZAC A;  2M0R A;  1HT9 A;  2G9B A;  1MXE A; 
#chains in the Genus database with same CATH homology
 4GGF A;  2JNF A;  1SCM C;  1C07 A;  1REC A;  1J7P A;  1S26 D;  1S5G Y;  1FBV A;  2GGM A;  1YUT A;  3PLF B;  2NCO A;  1C7W A;  1CM4 A;  4I5L B;  4CID A;  4CLN A;  2LM5 A;  1BR1 B;  1GJY A;  4DIR A;  1YUR A;  1KFU L;  1XFV O;  1UUS A;  1XYD A;  1DGU A;  2EC6 C;  2BEC A;  1D1O A;  1QAS A;  4WQ3 A;  1N65 A;  2JTT A;  2NZ0 A;  3EK8 A;  1SY9 A;  2EGD A;  1SL8 A;  2DOQ A;  1B7T Y;  5AXI A;  2LCP A;  1S3P A;  2BL0 B;  2K7B A;  4CFQ A;  1SYM A;  3VRO A;  1IJ5 A;  1K9K A;  2LVK A;  1SK6 D;  1BLQ A;  2M3W A;  2AAO A;  1BG1 A;  1SR6 C;  1Y1X A;  2MLE C;  2NXQ A;  4MSP A;  4C0K A;  3KF9 A;  1K9P A;  3SG5 A;  2OS8 C;  3DVE A;  2AMI A;  3F45 A;  2BE4 A;  1L7Z A;  3TDI A;  1J1D A;  3CWG A;  2JXC A;  5K89 A;  2JUL A;  1ALW A;  1IQ5 A;  1OMR A;  1XA5 A;  1JF0 A;  3DVM A;  2K2F A;  4PE4 A;  2OPO A;  5FYX A;  3TUY B;  2ISD A;  3SG2 A;  4AOM A;  3SJS A;  3O78 A;  4NDB A;  5DKN A;  2JZI A;  2K7C A;  2LLU A;  1NWD A;  1YUS A;  3MSE B;  1AHR A;  1RK9 A;  2Q91 A;  3BUO B;  5D69 A;  5CSF A;  2I94 A;  3OX5 A;  1QVI Z;  1YVL A;  1BF5 A;  4U8D A;  1KWO B;  1W7I B;  1MF8 B;  4GNK B;  1LA0 A;  1Y0V H;  2CT9 A;  3SIA A;  2JNX A;  5TNC A;  2MJW B;  1M45 A;  4HSZ A;  1GQM A;  2G2B A;  1ALV A;  1K9U A;  2SCP A;  1QV0 A;  3KPX A;  1M31 A;  2WOR A;  1DJG A;  2GV5 A;  4GAO A;  1NCX A;  4FTG A;  2JU0 A;  2H2K A;  1LKJ A;  4QJ3 B;  1QX5 B;  1UUR A;  2KQY A;  3VGO A;  1DJX A;  3EVV A;  1OQP A;  3KEV A;  2RGI A;  3BYA A;  1KSO A;  2JQ6 A;  5JJG A;  1WLZ A;  1RRO A;  4JWQ A;  3EKJ A;  1B1G A;  1QX2 A;  1F54 A;  2BKH B;  1E8A A;  1QVI Y;  1F71 A;  3TUY C;  1NX2 A;  1JF2 A;  1WLM A;  1S5G Z;  4HRE E;  3FWC A;  1GGW A;  1QLK A;  2WOS A;  4PHM A;  3BUW B;  3EKH A;  3FWB A;  2MRD A;  2ZFD A;  3TS5 C;  4AQJ A;  3TDU A;  2OTG C;  3KO0 A;  3PM8 A;  2M7L A;  3H4S E;  1NP8 A;  2KYF A;  1KWO C;  1SPY A;  1KCY A;  3BUX B;  4USL A;  1KFU S;  1DJZ A;  1ZUZ A;  5J3X A;  3I5G C;  1B7T Z;  3GK2 A;  1IQ3 A;  1JWD A;  2I18 A;  1U5I A;  1TNP A;  1B8L A;  2KI6 C;  2MLF C;  1TTX A;  1AJ4 A;  1Y1A A;  2O5G A;  5HKZ A;  1PK0 D;  1OZS A;  2KBM A;  4WRI A;  1EL4 A;  1DJH A;  4MZJ A;  1YX7 A;  3OHM B;  2ZRT A;  1N0Y A;  3AKB A;  3WHU B;  2O60 A;  2SAS A;  1AK8 A;  1YUU A;  4C0L A;  2K2A A;  1F4Q A;  1KFX L;  2F3Y A;  4GUK A;  1J7R A;  1KQM B;  2PAS A;  4IL1 A;  1EG3 A;  1MWN A;  2EHB A;  3DVJ A;  3JVT B;  4PE7 A;  1VRK A;  1MUX A;  3LK0 A;  1CLB A;  2F3Z A;  3AAJ A;  1YRU B;  2E6W A;  2MHH A;  1XFY O;  5BPJ A;  2KFF A;  3VRR A;  2LV7 A;  3KHE A;  1TNW A;  2KFG A;  1B8C A;  2Y4Q A;  2Q4U A;  4YBH B;  1QIW A;  2KDH A;  5DKQ A;  1TNX A;  1B9A A;  2PSR A;  1UWO A;  3D0Y A;  1CTR A;  4GPL B;  1R6P A;  2E30 A;  2R2I A;  1JUO A;  1F70 A;  4PHJ A;  3SIB A;  5I2Q A;  2LMU A;  2WCB A;  4ICB A;  1ZMZ A;  3A4U B;  2VRG A;  2ZRS A;  1ODB A;  3D10 A;  4ETO A;  2F2O A;  1CDP A;  3DF0 B;  1OMV A;  1SRA A;  1CLL A;  1S6I A;  1SL9 A;  1XO5 A;  1BMO A;  2HPS A;  2JT0 A;  1DGV A;  4WQ2 A;  1TRF A;  3DVK A;  3IF7 A;  1QLS A;  1G33 A;  4YI8 A;  1SCV A;  1A29 A;  1PAL A;  4PE1 A;  1KK7 Y;  1K8U A;  1QV1 A;  4HRG A;  1J1E A;  2KGB C;  4MRY A;  5CSN A;  1F8H A;  1RWY A;  2I7A A;  1KQM C;  1M39 A;  1UHH A;  2COL B;  1A75 A;  2PAL A;  4MN0 A;  1A2X A;  2CNP A;  3JVT C;  4OV2 A;  4PHK A;  4XJK A;  2K61 A;  4TNC A;  5KTY A;  1Q80 A;  1AUI B;  4YGC B;  1FI5 A;  4PCW A;  5KSZ A;  2WND A;  3ICB A;  3NXA A;  4DRW A;  1CNP A;  3I5H B;  4QJ5 B;  3BXK A;  1OZO A;  4PE0 A;  1QX7 A;  2B1U A;  1CFD A;  3HCM A;  3O6B A;  4MZK A;  2BE6 A;  3SG7 A;  4CFR A;  4ORB B;  2LP3 A;  1X02 A;  3LCP C;  2L51 A;  5ER4 X;  3SG3 A;  1JFJ A;  2LHI A;  1V1G A;  3RLZ A;  2LC5 A;  3IQQ A;  3FS7 A;  2BL0 C;  4N1G A;  1CDM A;  1YRT B;  2KQ6 A;  1WRZ A;  2JWW A;  1DF0 A;  1OOJ A;  1MHO A;  2GGZ A;  2KAX A;  3BOW A;  3FIA A;  2JC2 A;  5HLO A;  1H8B A;  1CFC A;  1DMO A;  1XFU O;  1WRK A;  3O2P A;  2L98 A;  2L2E A;  2LVV A;  1JFK A;  2MAZ A;  2K7O A;  1LVC D;  2BCB A;  2KOT A;  2ZKM X;  3C1V A;  2K0J A;  5CPV A;  4YGA A;  4CPV A;  4NQG A;  1RTP 1;  1KK8 B;  4I5K A;  1F4O A;  2KFH A;  3CGA A;  2KGR A;  2WCF A;  2MA2 A;  2Y5I A;  3EK4 A;  1JBA A;  5CSJ A;  2K7D A;  1PVB A;  2M97 A;  3LL8 B;  4JQ0 D;  1BU3 A;  1LXF C;  4NDD A;  4P2Y B;  3VRQ A;  1SNL A;  4GGN A;  4OKH A;  1KFX S;  2LUX A;  4ORC B;  5AER A;  3NSI A;  1L2O B;  1AVS A;  1B8R A;  1MQ1 A;  2JT3 A;  4MRX A;  3E3R A;  2A4J A;  3IQO A;  1R2U A;  1SCM B;  3WNX B;  4ZCV A;  1NCY A;  4YGE B;  2ZN9 A;  4L9M A;  3TDZ A;  4D1E A;  4GGF C;  5B8I B;  3GK4 X;  3BUN B;  3PAT A;  1V1F A;  1QS7 A;  2D8N A;  5PAL A;  1RFJ A;  1YVH A;  3GK1 A;  4NDC A;  1K96 A;  3EVR A;  3PN7 B;  2WCE A;  2Y1M A;  1CFP A;  1NUB A;  1PSR A;  1XFW O;  1BJF A;  2L50 A;  4JPZ B;  2LP2 A;  2LMV A;  2LNK A;  2LUC A;  3LLE A;  3PAL A;  1KQV A;  2LVI A;  1CLM A;  2M9G A;  1TIZ A;  1DJW A;  5HLV A;  3GOF A;  1JC2 A;  1EXR A;  1KK8 C;  1PSB A;  1CFF A;  2NCP A;  2MBX A;  2BBM A;  2I2R E;  3PSR A;  2LMT A;  3I5I B;  1G4Y R;  4OCI A;  4R1E A;  1IKU A;  1QXP A;  4A4B A;  1KK7 Z;  2M7N A;  1B4C A;  2CTN A;  1BOC A;  1J7Q A;  1JSA A;  2LE9 B;  2M49 B;  1OMD A;  4PDZ A;  4BY5 A;  2K8M B;  2KBI A;  1S6C A;  2KSP A;  5I2L A;  1L2O C;  1PRW A;  3CR2 A;  1WDC B;  4F0Z B;  2OS8 B;  2FOT A;  3NSL A;  2LLT A;  2PRU A;  1GGZ A;  1CDN A;  1AP4 A;  2M8U A;  3I5F B;  3CR5 X;  5AAN A;  2KI4 B;  1J7O A;  5I8N A;  2KHN A;  2HET A;  2L0P A;  3O4Y A;  5KU1 A;  2HQ8 A;  2CBL A;  1TNQ A;  4N1F A;  1NYA A;  3ZNI A;  2LVJ A;  4BY4 A;  3PN7 C;  1QIV A;  1EH2 A;  4OVN F;  5F6T A;  1IWQ A;  1QTX A;  1SBJ A;  2HQW A;  5AFP A;  1UHN A;  2KAV A;  1C7V A;  1Y1U A;  2LHL A;  1RJV A;  1TCF A;  1K95 A;  2KI6 D;  1M46 A;  2NLN A;  3JTD B;  5D7F A;  3CZT X;  2L4I A;  3VRP A;  4OR9 B;  2F33 A;  1N2D A;  1FI6 A;  2QPT A;  2IS9 A;  2TN4 A;  1DJI A;  3HX4 A;  1SMG A;  4M2O A;  2PVB A;  3I5I C;  3SG6 A;  5HKY A;  1W7J B;  5HYD A;  1TOP A;  1BR4 B;  1XK4 C;  1QJT A;  4M2P A;  3CLN A;  1U5I B;  4MZL A;  4PHN A;  2L4H A;  1UHJ A;  1CMF A;  2WC8 A;  2PMY A;  2ZND A;  1CKK A;  3OX6 A;  2F8P A;  3NSK A;  5CSI A;  2KYC A;  1QAT A;  1DT7 B;  2M1K B;  3A8R A;  3LK1 A;  4DCK A;  5I2O A;  2KNE A;  4YRU A;  2LLS A;  1B47 A;  1WDC C;  1YTZ C;  3CS1 A;  1IRJ A;  5IBW A;  1A4P A;  2JRF A;  4UPG A;  2AUC A;  3OB1 B;  1WY9 A;  4YGD B;  3I5F C;  1OSA A;  2FJU B;  2KI4 C;  1S36 A;  5JOL A;  2HF5 A;  1FW4 A;  1SW8 A;  1XFX O;  1MXL C;  2BBN A;  4XYN A;  4N5X A;  1YR5 A;  1PUL A;  4MBE A;  3TS5 B;  1CB1 A;  1ZFS A;  2OTG B;  2M1U A;  1ZOT B;  1S1E A;  3AAK A;  2JPT A;  1PVA A;  4YI9 A;  1YX8 A;  2LAN A;  3JTD C;  4M2Q A;  3OP0 A;  1BT6 A;  1NSH A;  3D0Y B;  2Y1N A;  3I5G B;  2L5X B;  2BCA A;  1F55 A;  1XK4 A;  3OB2 B;  3VRN A;  4E68 A;  1UHK A;  2H61 C;  3NSO A;  3ZWH A;  2KAY A;  3EVU A;  1LIN A;  4MLW A;  4C0J A;  5GQQ C;  1Y6W A;  4FQO A;  4PAL A;  3CTN A;  3I5H C;  1IJ6 A;  2LAP A;  1CM1 A;  1MR8 A;  2BKI B;  1SL7 A;  1TCO B;  1SKT A;  5ER5 A;  4YGB B;  3AKA A;  1NX1 A;  1NX3 A;  4ZCU A;  1G8I A;  5G08 A;  3TZ1 A;  1BOD A;  1K94 A;  1NIW A;  3QRX A;  1WRL A;  1DVI A;  4DUQ A;  1NX0 A;  1XVJ A;  2ZNE A;  5DKR A;  2CXJ A;  1A03 A;  1A75 B;  3DF0 A;  1M63 B;  4MVF A;  2ZN8 A;  1IGV A;  4XJK B;  1NPQ A;  1DJY A;  5HKW A;  2EC6 B;  3BQ3 A;  2BCX A;  1UP5 A;  1HQV A;  4MEW A;  1UHI A;  3EK7 A;  2JOJ A;  2QAC A;  1IG5 A;  3M0W A;  4QJ4 B;  1FPW A;  1H4B A;  4DS7 A;  1LA3 A;  3K21 A;  1AJ5 A;  1J55 A;  1KSM A;  1NCZ A;  3PFV A;  1EJ3 A;  2H61 A;  1S6J A;  1K2H A;  1DTL A;  4GFT A;  4GBA A;  2JT8 A;  4AQI A;  1CMG A;  1OE9 B;  4Q04 A;  3CR4 X;  1EG4 A;  2F2P A;  3WHT B;  2JXL A;  1K90 D;  1IH0 A;  4A4C A;  2CCM A;  2M29 A;  2JTZ A;  1DF0 B;  3SG4 A;  1SR6 B;  1CDL A;  3BOW B;  4ORA B;  4HRH A;  4I5N B;  2FCE A;  1FF1 A;  2FCD A;  1XFZ O;  4I5J A;  5AEQ A;  3WXA A;  3BUM B;  2P6B B;  2V53 A;  1K93 D;  3RM1 A;  1TN4 A;  4P5O E;  3DD4 A;  1ZAC A;  2M0R A;  1HT9 A;  2G9B A;  1MXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...