4YGCB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
64
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 64
sequence length 77
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygcB00
3NSKA 5JJGA 4JWQA 5CSJA 4DS7A 2KI4C 1UHKA 2H2KA 1TCFA 3H4SE 1K93D 2AUCA 1F8HA 4WRIA 3GOFA 1PVBA 3PALA 2B1UA 3PLFB 4GGNA 1CMFA 2KFFA 1NX0A 1QIWA 2M7LA 1S6IA 1EL4A 1N2DA 1B47A 3AKBA 1TRFA 5F6TA 4DCKA 4A4CA 2KAYA 3EVRA 1CFPA 1RFJA 4MZKA 1PSRA 4OV2A 1QASA 3TUYC 1B1GA 1NSHA 1F70A 2FJUB 4NQGA 3DVJA 3BQ3A 3VROA 4GGFC 3IQQA 2BECA 2KFHA 5IBWA 3WHTB 2Y1NA 2LHLA 2JRFA 4HRHA 1NP8A 5AFPA 1H8BA 5ER4X 5CPVA 1Q80A 1SKTA 1DVIA 1K95A 2KDHA 1CDLA 5CSIA 1CM4A 1LA3A 4YI8A 1TCOB 2BBMA 4GPLB 1S5GZ 3EVUA 1DJIA 5HKZA 3BUXB 3VRRA 1SNLA 4F0ZB 2L0PA 3MSEB 1C07A 4XJKB 2K7BA 1QX5B 1ODBA 1A03A 2LLTA 2AMIA 1DJWA 2KHNA 3F45A 4I5LB 3E3RA 2OS8C 2Y5IA 1H4BA 1CM1A 1SY9A 3SG4A 5I2LA 1SCMC 3DD4A 2PALA 5CSNA 1ZMZA 3PATA 2LV7A 1CDNA 4I5KA 3VRNA 3PSRA 4ORBB 1M63B 4ORCB 4PE0A 1NPQA 1QVIZ 3GK2A 2ZNEA 4DIRA 3DVEA 3TDIA 3SG5A 2I2RE 3CS1A 1RWYA 5HLVA 4QJ4B 2M8UA 2MJWB 1BF5A 1DF0A 1BR4B 1UWOA 2AAOA 2L2EA 1FBVA 4PHJA 2QACA 1NCZA 1B8RA 1SPYA 2F8PA 3LCPC 1OMRA 1RTP1 1TNQA 4YGAA 1IQ3A 1B4CA 3BUWB 1CNPA 4AQJA 2L50A 4NDCA 1PSBA 1QIVA 1QLSA 3O4YA 5HYDA 1YUUA 1DTLA 1K9PA 3BUMB 1GGWA 1MXEA 1YVHA 2JULA 5D69A 4OKHA 2HF5A 2GGZA 3KF9A 5DKNA 5I8NA 2BCXA 5GQQC 3BYAA 1CMGA 1F4OA 1TNPA 2L4HA 3BOWB 5B8IB 1IKUA 2LLSA 5DKQA 2ZN8A 3EK4A 1KFXL 3IF7A 4OVNF 4IL1A 2P6BB 2SCPA 2JU0A 2LANA 3HCMA 1EG4A 5HKYA 2HPSA 1F4QA 1SL8A 1DF0B 3PFVA 1SL7A 1SRAA 2LLUA 3I5GB 1KFUL 4DUQA 1DJYA 1F54A 3SJSA 1WLMA 4E68A 1K9KA 1UHJA 4CFQA 1GGZA 1XK4A 3EVVA 1S36A 3ICBA 2KQYA 1K96A 4NDDA 3O2PA 1CFFA 1SW8A 1XFYO 2FCDA 2ISDA 3SG3A 1YURA 2V53A 1L2OB 1ZUZA 4N1FA 5AEQA 1WY9A 1CDMA 1NX2A 3KEVA 1KK7Y 4GAOA 1SMGA 1JF0A 4BY5A 4U8DA 2OTGC 4FQOA 2LUXA 4N5XA 2CTNA 1SL9A 4GBAA 1S3PA 1U5IB 3OB2B 1Y6WA 1UHIA 2WCFA 1JF2A 1YX8A 2CT9A 2M1UA 4ZCVA 1IJ6A 3GK1A 4XJKA 1SYMA 1TIZA 2JT8A 3QRXA 1XFVO 3GK4X 4D1EA 1OZOA 3DF0B 3VGOA 2TN4A 2ZRSA 1B8LA 1K8UA 1NX3A 4MBEA 1DT7B 2FOTA 5ER5A 1K2HA 2M49B 5HLOA 1B7TZ 3RLZA 4DRWA 2JXCA 4MLWA 2K7CA 1IWQA 3EK7A 4N1GA 3FWCA 1NWDA 4PDZA 4YBHB 3SIAA 1AK8A 3TZ1A 2HQWA 2NZ0A 1R2UA 2OTGB 1YUTA 2JNXA 4MZLA 1C7WA 4PE4A 3D0YB 2KI4B 2JZIA 2LC5A 1RECA 1NYAA 2WCEA 1DGUA 1J55A 1CDPA 1GQMA 2LUCA 2JTTA 2KAVA 5AXIA 1YUSA 2BBNA 2I94A 3NSOA 4I5JA 4MEWA 1NX1A 3CLNA 1S6JA 1KSMA 2M97A 3A4UB 1QLKA 2F3YA 2KI6D 1D1OA 1Y0VH 4GUKA 1YVLA 1WDCC 4YGDB 1X02A 4A4BA 1M46A 1YTZC 3DVKA 2FCEA 1J1DA 3TUYB 2WOSA 3CWGA 2PVBA 1AVSA 1YRUB 2JPTA 3WNXB 4BY4A 2LMUA 2O60A 2KGRA 2CNPA 3HX4A 2NCOA 3SG6A 2EC6C 1Y1AA 2KI6C 1XO5A 4PE1A 1EH2A 1QJTA 4I5NB 1BR1B 1Y1XA 2JOJA 1JFKA 5PALA 1BJFA 1F71A 1CLLA 3BOWA 3OB1B 1BT6A 3SG2A 2KNEA 3M0WA 1DJZA 4CIDA 4MVFA 1KCYA 3CR4X 1MF8B 1XFZO 2GV5A 2HETA 4WQ3A 3LL8B 2VRGA 1JUOA 2OPOA 2L5XB 1WDCB 2O5GA 1B8CA 2MAZA 3FS7A 3LK1A 2F2OA 1VRKA 2G2BA 2BCBA 2RGIA 4UPGA 1HT9A 4PCWA 1HQVA 2K7DA 1FW4A 2OS8B 1CB1A 1FI6A 2Y1MA 1SCMB 1PK0D 2K7OA 1DJHA 2E30A 3AKAA 5D7FA 1CTRA 3BUNB 2JT0A 2KAXA 2MLFC 3JVTC 1K90D 1NCXA 4OCIA 3IQOA 2F2PA 3JTDC 1BU3A 1RK9A 2WCBA 2BKHB 1CFCA 4XYNA 5AANA 1UHNA 3A8RA 3TDUA 1FI5A 4M2QA 1EXRA 1LVCD 4C0LA 4MRXA 2H61C 1U5IA 1LXFC 1RROA 4PHKA 2EHBA 1MR8A 3NXAA 2F33A 2MA2A 1UUSA 3ZWHA 3EKHA 1FPWA 1MUXA 1BOCA 1S5GY 2KGBC 3I5HC 4Q04A 2KBMA 1UHHA 2LVKA 1J7RA 2D8NA 3RM1A 2F3ZA 4AOMA 3DF0A 2LE9B 3JVTB 1MQ1A 1QX2A 1UURA 4M2PA 3JTDB 3TS5C 2G9BA 4YGBB 1DJXA 3OX5A 1LINA 3SIBA 4ORAB 3I5FC 4ETOA 1A2XA 1YRTB 2K2FA 4HREE 2CBLA 1ZOTB 3D0YA 1N0YA 1QVIY 1CFDA 3BUOB 1G33A 5CSFA 4GNKB 4PHMA 2KBIA 4PE7A 1PRWA 2LHIA 2LVVA 1NUBA 1ALWA 3I5HB 1WRZA 1NIWA 1LA0A 1J7OA 1M45A 2EGDA 4ICBA 1IQ5A 3VRPA 3WXAA 3O6BA 1PALA 4PALA 1SR6C 2DOQA 1XA5A 1IRJA 5KSZA 1CKKA 4YGEB 2JT3A 2QPTA 3OP0A 1XYDA 3TS5B 2IS9A 1LKJA 1OSAA 3FWBA 2SASA 2JQ6A 1BMOA 1CLBA 1KWOC 2KYFA 4GGFA 4CLNA 1FF1A 2I7AA 5AERA 3I5FB 2KSPA 1J7QA 3AAKA 5HKWA 1BG1A 1BODA 3KO0A 1S26D 1W7IB 3EK8A 2BKIB 4YRUA 2M1KB 2L98A 5KTYA 1WLZA 2BE6A 2WORA 2Y4QA 2M7NA 1AUIB 2WC8A 2JWWA 3LK0A 2ZKMX 4NDBA 5FYXA 4CPVA 1SR6B 2JC2A 1IGVA 1Y1UA 2PSRA 2JNFA 1NCYA 2K2AA 1AP4A 1A75B 3KHEA 3OX6A 2NLNA 1SCVA 2LCPA 1XFXO 1QATA 1M31A 1JBAA 1AJ5A 1SK6D 2NXQA 4C0JA 2GGMA 4FTGA 1KWOB 5TNCA 1G4YR 1S6CA 1WRKA 1KQMC 1F55A 2MLEC 2MHHA 2JTZA 3OHMB 4HRGA 2KOTA 1KK8C 1N65A 2L51A 1MWNA 1CLMA 3LLEA 1AHRA 1E8AA 4OR9B 3C1VA 1YX7A 2I18A 4MZJA 1ALVA 4JPZB 2KFGA 2COLB 1K9UA 2JXLA 5DKRA 3ZNIA 1JWDA 1ZACA 3O78A 1J7PA 3DVMA 1TOPA 1KFXS 3PN7C 1C7VA 2CCMA 4MRYA 1BLQA 5JOLA 1TNWA 5J3XA 1OMDA 1TN4A 4AQIA 2BE4A 3FIAA 4WQ2A 1KQMB 1QTXA 1KFUS 1OZSA 1KQVA 1IJ5A 3KPXA 1MHOA 1YR5A 1A4PA 2R2IA 2E6WA 1KK7Z 4PHNA 4P5OE 1KK8B 2WNDA 1XFWO 3SG7A 1M39A 2LVIA 1V1GA 2EC6B 1QXPA 1JC2A 1B7TY 1IH0A 1S1EA 1KSOA 4TNCA 5I2OA 3K21A 1JFJA 3CR2A 2LMTA 1OOJA 1DJGA 3PM8A 4GFTA 3BXKA 5G08A 3WHUB 1RJVA 1AJ4A 2CXJA 2H61A 2KYCA 1B9AA 4USLA 1SBJA 3CR5X 1DMOA 2ZN9A 3PN7B 2ZFDA 1PVAA 1UP5A 2M29A 3I5GC 3EKJA 2NCPA 1QS7A 2LP2A 1V1FA 3AAJA 2LNKA 4L9MA 2ZRTA 1OE9B 1WRLA 1XVJA 2ZNDA 2LP3A 4HSZA 5K89A 3TDZA 2BCAA 3VRQA 2A4JA 3I5IC 2K8MB 1OMVA 1DGVA 1K94A 4R1EA 2MRDA 3CGAA 2PRUA 1EJ3A 1L2OC 2MBXA 1G8IA 2L4IA 1TNXA 1QV0A 2LAPA 1ZFSA 1MXLC 2BL0C 1L7ZA 2M3WA 2K0JA 1R6PA 4P2YB 4QJ3B 4M2OA 1JSAA 4QJ5B 3D10A 1XFUO 2M0RA 4ZCUA 5KU1A 1PULA 4YGCB 4CFRA 1QV1A 1OQPA 2M9GA 5I2QA 2LMVA 4C0KA 3NSIA 2Q91A 1IG5A 1J1EA 1A75A 4JQ0D 4YI9A 2PMYA 5BPJA 3I5IB 4MN0A 1A29A 1XK4C 2Q4UA 1W7JB 2LVJA 1EG3A 1TTXA 3CTNA 2BL0B 1QX7A 4MSPA 3NSLA 2K61A 3CZTX 2PASA 2HQ8A 2LM5A 1GJYA 2KQ6A
chains in the Genus database with same CATH superfamily
3NSKA 5JJGA 4JWQA 5CSJA 4DS7A 2KI4C 1UHKA 2H2KA 1TCFA 3H4SE 4OZDA 1K93D 2AUCA 2GTEA 1F8HA 4WRIA 3GOFA 1PVBA 3PALA 2B1UA 3FE9A 3PLFB 4GGNA 1CMFA 1XFRA 2KFFA 1NX0A 1QIWA 2M7LA 1S6IA 1EL4A 1N2DA 1B47A 2WCKA 3AKBA 1TRFA 5F6TA 4DCKA 1TWOA 4A4CA 2KAYA 1T14A 3EVRA 3B6XA 3BFHA 1CFPA 1RFJA 4MZKA 1PSRA 4OV2A 1QASA 3TUYC 1B1GA 1NSHA 1F70A 3D76A 2FJUB 4NQGA 3DVJA 3BQ3A 3VROA 4GGFC 1OOHA 2BECA 3IQQA 2KFHA 4INWA 5IBWA 3WHTB 2Y1NA 2PQLA 2LHLA 2JRFA 4HRHA 1NP8A 5AFPA 1H8BA 5ER4X 5CPVA 1Q80A 3L4LA 3IVTA 5EL2A 1SKTA 1DVIA 3NGVA 1K95A 3PM2A 2KDHA 2QEHA 3R1VA 1CDLA 1OOIX 5CSIA 1CM4A 2FJYA 1LA3A 4YI8A 1GM0A 1TCOB 2BBMA 4GPLB 1S5GZ 3EVUA 1DJIA 5HKZA 3BUXB 2WC6A 3VRRA 1SNLA 4F0ZB 2L0PA 3MSEB 1C07A 4XJKB 2K7BA 1QX5B 1ODBA 1A03A 2LLTA 2AMIA 1DJWA 2KHNA 2KLEA 3OBVA 3F45A 1IIOA 4I5LB 3E3RA 2OS8C 2Y5IA 5FI2A 1CM1A 1H4BA 1SY9A 3SG4A 5I2LA 1SCMC 3DD4A 3S0GA 2PALA 5CSNA 1ZMZA 3PATA 5D3OA 2LV7A 1CDNA 4I5KA 2WCMA 3CABA 3VRNA 3PSRA 4ORBB 1M63B 4ORCB 4PE0A 1NPQA 1QVIZ 3GK2A 2ZNEA 4DIRA 3DVEA 3TDIA 4FQTA 3SG5A 3CYZA 2I2RE 3CS1A 1RWYA 5HLVA 4QJ4B 1TUZA 2M8UA 2MJWB 1BF5A 1DF0A 1BR4B 1UWOA 2AAOA 1OOFA 2L2EA 1FBVA 4PHJA 4IJ7A 2QACA 1NCZA 1B8RA 1SPYA 1OOGA 2F8PA 3LCPC 3DZTA 1OMRA 1RTP1 1TNQA 4YGAA 1IQ3A 1B4CA 3BUWB 1CNPA 4AQJA 2L50A 4NDCA 1PSBA 1QIVA 1QLSA 3O4YA 5HYDA 1YUUA 1DTLA 1K9PA 1OW4A 3BUMB 1GGWA 1MXEA 3FE8A 1YVHA 2JULA 5D69A 4OKHA 2HF5A 2GGZA 2WCJA 3KF9A 5DKNA 1DELA 5I8NA 2BCXA 5GQQC 3BYAA 1CMGA 1F4OA 1TNPA 2L4HA 3BOWB 5B8IB 1IKUA 2LLSA 5DKQA 2ZN8A 3EK4A 1KFXL 3IF7A 4OVNF 4IL1A 1QWVA 2ERBA 2P6BB 2JU0A 2PYQA 2LANA 2SCPA 3HCMA 1EG4A 5HKYA 2HPSA 1F4QA 1SL8A 1DF0B 3PFVA 1SL7A 1SRAA 2LLUA 3I5GB 1KFUL 4DUQA 1DJYA 1F54A 3SJSA 1WLMA 4E68A 3SS5A 1K9KA 1UHJA 3B7AA 1GGZA 4CFQA 3L4AA 1XK4A 3EVVA 1S36A 3ICBA 2KQYA 1K96A 4NDDA 3O2PA 1CFFA 1SW8A 1XFYO 2FCDA 2ISDA 3SG3A 3S0FA 1YURA 2V53A 1L2OB 1ZUZA 4N1FA 5AEQA 3V2LA 1WY9A 1CDMA 1NX2A 3KEVA 1KK7Y 4GAOA 2KPHA 1SMGA 1JF0A 5DICA 4BY5A 4U8DA 3PJIA 2OTGC 4FQOA 2LUXA 4N5XA 2CTNA 1SL9A 4GBAA 1S3PA 1U5IB 3OB2B 1Y6WA 1UHIA 2WCFA 1JF2A 1YX8A 2CT9A 2M1UA 2QEVA 4ZCVA 1IJ6A 2H8VA 3GK1A 4XJKA 1SYMA 1TIZA 2JT8A 3QRXA 1XFVO 3GK4X 3R72A 4D1EA 1OZOA 3DF0B 3VGOA 2TN4A 2ZRSA 1B8LA 1K8UA 1NX3A 4MBEA 1DT7B 2FOTA 5ER5A 3VB1A 2QDIA 2M49B 3D74A 5HLOA 1K2HA 1B7TZ 3RLZA 4DRWA 2JXCA 4MLWA 2K7CA 1IWQA 3EK7A 4N1GA 3FWCA 1NWDA 4PDZA 4YBHB 3SIAA 2L5YA 3TZ1A 1AK8A 2HQWA 2NZ0A 1R2UA 2OTGB 1YUTA 2JNXA 4MZLA 1C7WA 4PE4A 2BAPA 3D0YB 2KI4B 2JZIA 2LC5A 1RECA 1NYAA 2WCEA 1DGUA 1J55A 3SS4A 1CDPA 1GQMA 2LUCA 3B88A 2JTTA 1DC1A 2KAVA 5AXIA 1YUSA 2BBNA 2I94A 3NSOA 4I5JA 4MEWA 1NX1A 3CLNA 1S6JA 1KSMA 2M97A 3A4UB 1QLKA 2F3YA 2KI6D 4PT1A 1D1OA 1Y0VH 4GUKA 1YVLA 1WDCC 4YGDB 1X02A 4A4BA 1M46A 1YTZC 3DVKA 2FCEA 1J1DA 3TUYB 3RZSA 2WOSA 3CWGA 2PVBA 1AVSA 1YRUB 2JPTA 3S0DA 3WNXB 4BY4A 2LMUA 2O60A 2KGRA 2CNPA 3HX4A 2NCOA 3SG6A 2EC6C 1Y1AA 2KI6C 1XO5A 4PE1A 1EH2A 1QJTA 1Z2CB 4I5NB 1BR1B 1Y1XA 2JOJA 1JFKA 5FI7A 5PALA 1BJFA 1F71A 1CLLA 3BOWA 3CDNA 3SS3A 3OB1B 1BT6A 5FI6A 3SG2A 2KNEA 3M0WA 3R1OA 1DJZA 4CIDA 4MVFA 1KCYA 3CR4X 1MF8B 1XFZO 2GV5A 2HETA 4WQ3A 3LL8B 2VRGA 1JUOA 2OPOA 2L5XB 1WDCB 2O5GA 4INXA 1B8CA 1DEKA 2MAZA 3FS7A 3LK1A 2WCLA 2F2OA 1VRKA 2G2BA 2BCBA 2RGIA 4UPGA 1HT9A 4PCWA 1HQVA 2K7DA 2QEBA 1FW4A 2OS8B 1CB1A 3D78A 1FI6A 2Y1MA 1SCMB 1PK0D 2K7OA 1DJHA 1DQEA 2E30A 3AKAA 1CTRA 3BUNB 2JT0A 2KAXA 2MLFC 5D7FA 3JVTC 3DYEA 1K90D 1NCXA 4OCIA 3IQOA 2F2PA 3JTDC 1BU3A 1RK9A 2WCBA 3D73A 2BKHB 1CFCA 4XYNA 2WC5A 5AANA 1UHNA 3A8RA 3TDUA 1FI5A 4M2QA 1EXRA 1LVCD 4C0LA 4MRXA 2H61C 2K60A 1U5IA 1LXFC 1RROA 4PHKA 2EHBA 1MR8A 3NXAA 2F33A 2MA2A 1UUSA 3ZWHA 3EKHA 1FPWA 1MUXA 1BOCA 1S5GY 2KGBC 3I5HC 4Q04A 2KBMA 1UHHA 2LVKA 1J7RA 2D8NA 3RM1A 2F3ZA 4AOMA 3DF0A 3NHTA 2LE9B 3JVTB 1MQ1A 3BFAA 3D75A 1QX2A 1UURA 4M2PA 3JTDB 3TS5C 2G9BA 4YGBB 1DJXA 3DY9A 3OX5A 1LINA 3SIBA 4ORAB 2WCHA 3I5FC 4ETOA 1A2XA 1YRTB 2K2FA 4HREE 2CBLA 1ZOTB 3D0YA 3UNWA 1N0YA 1QVIY 1Z4HA 1CFDA 3BUOB 1G33A 2L2CA 5CSFA 4GNKB 4PHMA 3K1EA 2KBIA 4PE7A 1LS8A 1PRWA 2LHIA 2LVVA 1NUBA 1ALWA 3I5HB 1WRZA 1NIWA 1LA0A 1J7OA 1M45A 2EGDA 4ICBA 1IQ5A 3VRPA 3WXAA 3O6BA 3EG5B 3S0EA 1C3YA 1PALA 4PALA 1SR6C 2DOQA 1XA5A 1IRJA 2KLDA 5KSZA 1CKKA 4YGEB 2JT3A 2QPTA 3OP0A 1XYDA 3TS5B 2IS9A 1LKJA 3N7HA 1OSAA 3FWBA 2SASA 2JQ6A 1BMOA 1CLBA 1KWOC 2KYFA 3FE6A 4GGFA 4CLNA 2I7AA 1FF1A 5AERA 3I5FB 2KSPA 1J7QA 3AAKA 5HKWA 1BG1A 3S0BA 1BODA 3KO0A 1S26D 1W7IB 3S0AA 3EK8A 2BKIB 4JKTA 4YRUA 2M1KB 2L98A 3L47A 5KTYA 1WLZA 3QMEA 2BE6A 2WORA 2Y4QA 2M7NA 1AUIB 2WC8A 2JWWA 3LK0A 2ZKMX 4NDBA 5FYXA 4CPVA 1SR6B 2JC2A 1IGVA 1Y1UA 2PSRA 4KYNA 2JNFA 3B86A 1NCYA 2K2AA 1AP4A 1A75B 3KHEA 3OX6A 2NLNA 1SCVA 2LCPA 1XFXO 1QATA 3Q8IA 1M31A 1JBAA 1AJ5A 1SK6D 2NXQA 4C0JA 3BJHA 2GGMA 4FTGA 1KWOB 1SSEB 3DXLA 5TNCA 1G4YR 1S6CA 1WRKA 1KQMC 1F55A 2MLEC 3UO9A 2MHHA 2JTZA 3OHMB 2P71A 4HRGA 2KOTA 3R1PA 1KK8C 1N65A 2L51A 1MWNA 1CLMA 3LLEA 1AHRA 1E8AA 4OR9B 3C1VA 1YX7A 2I18A 4MZJA 1ALVA 4JPZB 2KFGA 2COLB 3CZ1A 1TUJA 1K9UA 2JXLA 5DKRA 3ZNIA 1JWDA 1ZACA 3O78A 1J7PA 3DVMA 1TOPA 1KFXS 3PN7C 1C7VA 2CCMA 4MRYA 1BLQA 5JOLA 1TNWA 5J3XA 1OMDA 1P28A 1TN4A 4AQIA 2BE4A 3FIAA 4WQ2A 1KQMB 1QTXA 1KFUS 2JPOA 1OZSA 1KQVA 1IJ5A 3KPXA 1MHOA 1YR5A 1A4PA 2QEOA 2R2IA 2E6WA 1KK7Z 4PHNA 2P70A 4P5OE 1KK8B 2WNDA 1XFWO 3SG7A 1M39A 2LVIA 1V1GA 2EC6B 1ORGA 1QXPA 1JC2A 1B7TY 1IH0A 1S1EA 1KSOA 4TNCA 3CZ0A 5I2OA 3K21A 1JFJA 3CR2A 2LMTA 1OOJA 1DJGA 3PM8A 4GFTA 3BXKA 5G08A 3WHUB 1RJVA 1AJ4A 2CXJA 2H61A 2KYCA 1B9AA 4USLA 1SBJA 3CR5X 3D77A 1DMOA 2ZN9A 3PN7B 2ZFDA 1PVAA 1C3ZA 1UP5A 2M29A 3I5GC 3EKJA 2NCPA 1QS7A 2LP2A 1V1FA 4F7FA 3AAJA 2LNKA 4L9MA 2ZRTA 1OE9B 1WRLA 1XVJA 2ZNDA 2LP3A 4HSZA 5K89A 3TDZA 2BCAA 3O4XA 3VRQA 2A4JA 3I5IC 2K8MB 1OMVA 1DGVA 1K94A 4R1EA 2MRDA 3CGAA 2PRUA 1EJ3A 1L2OC 2MBXA 1G8IA 5HL1A 2L4IA 3NHIA 1TNXA 1W9ZA 1QV0A 2LAPA 1ZFSA 1MXLC 2BL0C 2YGUA 1L7ZA 2M3WA 4JD9A 2K0JA 1R6PA 3B87A 4P2YB 4M2OA 4QJ3B 4QJ5B 2BNXA 3D10A 1JSAA 1XFUO 2M0RA 4ZCUA 5KU1A 1PULA 4YGCB 4CFRA 1QV1A 1OQPA 2M9GA 5I2QA 2LMVA 4C0KA 3CZ2A 2Q91A 3NSIA 1IG5A 1J1EA 1A75A 4JQ0D 4YI9A 2PMYA 3OGNA 5BPJA 3I5IB 4MN0A 1A29A 1XK4C 2Q4UA 3BFBA 1W7JB 2LVJA 1EG3A 5I94A 1TTXA 3CTNA 2BL0B 1QX7A 4MSPA 3NSLA 2K61A 3CZTX 2PASA 2HQ8A 2LM5A 1GJYA 2KQ6A
chains in the Genus database with same CATH topology
3NSKA 5JJGA 4JWQA 5CSJA 4DS7A 2KI4C 1UHKA 2H2KA 1TCFA 3H4SE 1K93D 2AUCA 1F8HA 4WRIA 3GOFA 1PVBA 3PALA 2B1UA 3PLFB 4GGNA 1CMFA 2KFFA 1NX0A 1QIWA 2M7LA 1S6IA 1EL4A 1N2DA 1B47A 3AKBA 1TRFA 5F6TA 4DCKA 4A4CA 2KAYA 3EVRA 1CFPA 1RFJA 4MZKA 1PSRA 4OV2A 1QASA 3TUYC 1B1GA 1NSHA 1F70A 2FJUB 4NQGA 3DVJA 3BQ3A 3VROA 4GGFC 3IQQA 2BECA 2KFHA 5IBWA 3WHTB 2Y1NA 2LHLA 2JRFA 4HRHA 1NP8A 5AFPA 1H8BA 5ER4X 5CPVA 1Q80A 1SKTA 1DVIA 1K95A 2KDHA 1CDLA 5CSIA 1CM4A 1LA3A 4YI8A 1TCOB 2BBMA 4GPLB 1S5GZ 3EVUA 1DJIA 5HKZA 3BUXB 3VRRA 1SNLA 4F0ZB 2L0PA 3MSEB 1C07A 4XJKB 2K7BA 1QX5B 1ODBA 1A03A 2LLTA 2AMIA 1DJWA 2KHNA 3F45A 4I5LB 3E3RA 2OS8C 2Y5IA 1H4BA 1CM1A 1SY9A 3SG4A 5I2LA 1SCMC 3DD4A 2PALA 5CSNA 1ZMZA 3PATA 2LV7A 1CDNA 4I5KA 3VRNA 3PSRA 4ORBB 1M63B 4ORCB 4PE0A 1NPQA 1QVIZ 3GK2A 2ZNEA 4DIRA 3DVEA 3TDIA 3SG5A 2I2RE 3CS1A 1RWYA 5HLVA 4QJ4B 2M8UA 2MJWB 1BF5A 1DF0A 1BR4B 1UWOA 2AAOA 2L2EA 1FBVA 4PHJA 2QACA 1NCZA 1B8RA 1SPYA 2F8PA 3LCPC 1OMRA 1RTP1 1TNQA 4YGAA 1IQ3A 1B4CA 3BUWB 1CNPA 4AQJA 2L50A 4NDCA 1PSBA 1QIVA 1QLSA 3O4YA 5HYDA 1YUUA 1DTLA 1K9PA 3BUMB 1GGWA 1MXEA 1YVHA 2JULA 5D69A 4OKHA 2HF5A 2GGZA 3KF9A 5DKNA 5I8NA 2BCXA 5GQQC 3BYAA 1CMGA 1F4OA 1TNPA 2L4HA 3BOWB 5B8IB 1IKUA 2LLSA 5DKQA 2ZN8A 3EK4A 1KFXL 3IF7A 4OVNF 4IL1A 2P6BB 2SCPA 2JU0A 2LANA 3HCMA 1EG4A 5HKYA 2HPSA 1F4QA 1SL8A 1DF0B 3PFVA 1SL7A 1SRAA 2LLUA 3I5GB 1KFUL 4DUQA 1DJYA 1F54A 3SJSA 1WLMA 4E68A 1K9KA 1UHJA 4CFQA 1GGZA 1XK4A 3EVVA 1S36A 3ICBA 2KQYA 1K96A 4NDDA 3O2PA 1CFFA 1SW8A 1XFYO 2FCDA 2ISDA 3SG3A 1YURA 2V53A 1L2OB 1ZUZA 4N1FA 5AEQA 1WY9A 1CDMA 1NX2A 3KEVA 1KK7Y 4GAOA 1SMGA 1JF0A 4BY5A 4U8DA 2OTGC 4FQOA 2LUXA 4N5XA 2CTNA 1SL9A 4GBAA 1S3PA 1U5IB 3OB2B 1Y6WA 1UHIA 2WCFA 1JF2A 1YX8A 2CT9A 2M1UA 4ZCVA 1IJ6A 3GK1A 4XJKA 1SYMA 1TIZA 2JT8A 3QRXA 1XFVO 3GK4X 4D1EA 1OZOA 3DF0B 3VGOA 2TN4A 2ZRSA 1B8LA 1K8UA 1NX3A 4MBEA 1DT7B 2FOTA 5ER5A 1K2HA 2M49B 5HLOA 1B7TZ 3RLZA 4DRWA 2JXCA 4MLWA 2K7CA 1IWQA 3EK7A 4N1GA 3FWCA 1NWDA 4PDZA 4YBHB 3SIAA 1AK8A 3TZ1A 2HQWA 2NZ0A 1R2UA 2OTGB 1YUTA 2JNXA 4MZLA 1C7WA 4PE4A 3D0YB 2KI4B 2JZIA 2LC5A 1RECA 1NYAA 2WCEA 1DGUA 1J55A 1CDPA 1GQMA 2LUCA 2JTTA 2KAVA 5AXIA 1YUSA 2BBNA 2I94A 3NSOA 4I5JA 4MEWA 1NX1A 3CLNA 1S6JA 1KSMA 2M97A 3A4UB 1QLKA 2F3YA 2KI6D 1D1OA 1Y0VH 4GUKA 1YVLA 1WDCC 4YGDB 1X02A 4A4BA 1M46A 1YTZC 3DVKA 2FCEA 1J1DA 3TUYB 2WOSA 3CWGA 2PVBA 1AVSA 1YRUB 2JPTA 3WNXB 4BY4A 2LMUA 2O60A 2KGRA 2CNPA 3HX4A 2NCOA 3SG6A 2EC6C 1Y1AA 2KI6C 1XO5A 4PE1A 1EH2A 1QJTA 4I5NB 1BR1B 1Y1XA 2JOJA 1JFKA 5PALA 1BJFA 1F71A 1CLLA 3BOWA 3OB1B 1BT6A 3SG2A 2KNEA 3M0WA 1DJZA 4CIDA 4MVFA 1KCYA 3CR4X 1MF8B 1XFZO 2GV5A 2HETA 4WQ3A 3LL8B 2VRGA 1JUOA 2OPOA 2L5XB 1WDCB 2O5GA 1B8CA 2MAZA 3FS7A 3LK1A 2F2OA 1VRKA 2G2BA 2BCBA 2RGIA 4UPGA 1HT9A 4PCWA 1HQVA 2K7DA 1FW4A 2OS8B 1CB1A 1FI6A 2Y1MA 1SCMB 1PK0D 2K7OA 1DJHA 2E30A 3AKAA 5D7FA 1CTRA 3BUNB 2JT0A 2KAXA 2MLFC 3JVTC 1K90D 1NCXA 4OCIA 3IQOA 2F2PA 3JTDC 1BU3A 1RK9A 2WCBA 2BKHB 1CFCA 4XYNA 5AANA 1UHNA 3A8RA 3TDUA 1FI5A 4M2QA 1EXRA 1LVCD 4C0LA 4MRXA 2H61C 1U5IA 1LXFC 1RROA 4PHKA 2EHBA 1MR8A 3NXAA 2F33A 2MA2A 1UUSA 3ZWHA 3EKHA 1FPWA 1MUXA 1BOCA 1S5GY 2KGBC 3I5HC 4Q04A 2KBMA 1UHHA 2LVKA 1J7RA 2D8NA 3RM1A 2F3ZA 4AOMA 3DF0A 2LE9B 3JVTB 1MQ1A 1QX2A 1UURA 4M2PA 3JTDB 3TS5C 2G9BA 4YGBB 1DJXA 3OX5A 1LINA 3SIBA 4ORAB 3I5FC 4ETOA 1A2XA 1YRTB 2K2FA 4HREE 2CBLA 1ZOTB 3D0YA 1N0YA 1QVIY 1CFDA 3BUOB 1G33A 5CSFA 4GNKB 4PHMA 2KBIA 4PE7A 1PRWA 2LHIA 2LVVA 1NUBA 1ALWA 3I5HB 1WRZA 1NIWA 1LA0A 1J7OA 1M45A 2EGDA 4ICBA 1IQ5A 3VRPA 3WXAA 3O6BA 1PALA 4PALA 1SR6C 2DOQA 1XA5A 1IRJA 5KSZA 1CKKA 4YGEB 2JT3A 2QPTA 3OP0A 1XYDA 3TS5B 2IS9A 1LKJA 1OSAA 3FWBA 2SASA 2JQ6A 1BMOA 1CLBA 1KWOC 2KYFA 4GGFA 4CLNA 1FF1A 2I7AA 5AERA 3I5FB 2KSPA 1J7QA 3AAKA 5HKWA 1BG1A 1BODA 3KO0A 1S26D 1W7IB 3EK8A 2BKIB 4YRUA 2M1KB 2L98A 5KTYA 1WLZA 2BE6A 2WORA 2Y4QA 2M7NA 1AUIB 2WC8A 2JWWA 3LK0A 2ZKMX 4NDBA 5FYXA 4CPVA 1SR6B 2JC2A 1IGVA 1Y1UA 2PSRA 2JNFA 1NCYA 2K2AA 1AP4A 1A75B 3KHEA 3OX6A 2NLNA 1SCVA 2LCPA 1XFXO 1QATA 1M31A 1JBAA 1AJ5A 1SK6D 2NXQA 4C0JA 2GGMA 4FTGA 1KWOB 5TNCA 1G4YR 1S6CA 1WRKA 1KQMC 1F55A 2MLEC 2MHHA 2JTZA 3OHMB 4HRGA 2KOTA 1KK8C 1N65A 2L51A 1MWNA 1CLMA 3LLEA 1AHRA 1E8AA 4OR9B 3C1VA 1YX7A 2I18A 4MZJA 1ALVA 4JPZB 2KFGA 2COLB 1K9UA 2JXLA 5DKRA 3ZNIA 1JWDA 1ZACA 3O78A 1J7PA 3DVMA 1TOPA 1KFXS 3PN7C 1C7VA 2CCMA 4MRYA 1BLQA 5JOLA 1TNWA 5J3XA 1OMDA 1TN4A 4AQIA 2BE4A 3FIAA 4WQ2A 1KQMB 1QTXA 1KFUS 1OZSA 1KQVA 1IJ5A 3KPXA 1MHOA 1YR5A 1A4PA 2R2IA 2E6WA 1KK7Z 4PHNA 4P5OE 1KK8B 2WNDA 1XFWO 3SG7A 1M39A 2LVIA 1V1GA 2EC6B 1QXPA 1JC2A 1B7TY 1IH0A 1S1EA 1KSOA 4TNCA 5I2OA 3K21A 1JFJA 3CR2A 2LMTA 1OOJA 1DJGA 3PM8A 4GFTA 3BXKA 5G08A 3WHUB 1RJVA 1AJ4A 2CXJA 2H61A 2KYCA 1B9AA 4USLA 1SBJA 3CR5X 1DMOA 2ZN9A 3PN7B 2ZFDA 1PVAA 1UP5A 2M29A 3I5GC 3EKJA 2NCPA 1QS7A 2LP2A 1V1FA 3AAJA 2LNKA 4L9MA 2ZRTA 1OE9B 1WRLA 1XVJA 2ZNDA 2LP3A 4HSZA 5K89A 3TDZA 2BCAA 3VRQA 2A4JA 3I5IC 2K8MB 1OMVA 1DGVA 1K94A 4R1EA 2MRDA 3CGAA 2PRUA 1EJ3A 1L2OC 2MBXA 1G8IA 2L4IA 1TNXA 1QV0A 2LAPA 1ZFSA 1MXLC 2BL0C 1L7ZA 2M3WA 2K0JA 1R6PA 4P2YB 4QJ3B 4M2OA 1JSAA 4QJ5B 3D10A 1XFUO 2M0RA 4ZCUA 5KU1A 1PULA 4YGCB 4CFRA 1QV1A 1OQPA 2M9GA 5I2QA 2LMVA 4C0KA 3NSIA 2Q91A 1IG5A 1J1EA 1A75A 4JQ0D 4YI9A 2PMYA 5BPJA 3I5IB 4MN0A 1A29A 1XK4C 2Q4UA 1W7JB 2LVJA 1EG3A 1TTXA 3CTNA 2BL0B 1QX7A 4MSPA 3NSLA 2K61A 3CZTX 2PASA 2HQ8A 2LM5A 1GJYA 2KQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSK A;  5JJG A;  4JWQ A;  5CSJ A;  4DS7 A;  2KI4 C;  1UHK A;  2H2K A;  1TCF A;  3H4S E;  1K93 D;  2AUC A;  1F8H A;  4WRI A;  3GOF A;  1PVB A;  3PAL A;  2B1U A;  3PLF B;  4GGN A;  1CMF A;  2KFF A;  1NX0 A;  1QIW A;  2M7L A;  1S6I A;  1EL4 A;  1N2D A;  1B47 A;  3AKB A;  1TRF A;  5F6T A;  4DCK A;  4A4C A;  2KAY A;  3EVR A;  1CFP A;  1RFJ A;  4MZK A;  1PSR A;  4OV2 A;  1QAS A;  3TUY C;  1B1G A;  1NSH A;  1F70 A;  2FJU B;  4NQG A;  3DVJ A;  3BQ3 A;  3VRO A;  4GGF C;  3IQQ A;  2BEC A;  2KFH A;  5IBW A;  3WHT B;  2Y1N A;  2LHL A;  2JRF A;  4HRH A;  1NP8 A;  5AFP A;  1H8B A;  5ER4 X;  5CPV A;  1Q80 A;  1SKT A;  1DVI A;  1K95 A;  2KDH A;  1CDL A;  5CSI A;  1CM4 A;  1LA3 A;  4YI8 A;  1TCO B;  2BBM A;  4GPL B;  1S5G Z;  3EVU A;  1DJI A;  5HKZ A;  3BUX B;  3VRR A;  1SNL A;  4F0Z B;  2L0P A;  3MSE B;  1C07 A;  4XJK B;  2K7B A;  1QX5 B;  1ODB A;  1A03 A;  2LLT A;  2AMI A;  1DJW A;  2KHN A;  3F45 A;  4I5L B;  3E3R A;  2OS8 C;  2Y5I A;  1H4B A;  1CM1 A;  1SY9 A;  3SG4 A;  5I2L A;  1SCM C;  3DD4 A;  2PAL A;  5CSN A;  1ZMZ A;  3PAT A;  2LV7 A;  1CDN A;  4I5K A;  3VRN A;  3PSR A;  4ORB B;  1M63 B;  4ORC B;  4PE0 A;  1NPQ A;  1QVI Z;  3GK2 A;  2ZNE A;  4DIR A;  3DVE A;  3TDI A;  3SG5 A;  2I2R E;  3CS1 A;  1RWY A;  5HLV A;  4QJ4 B;  2M8U A;  2MJW B;  1BF5 A;  1DF0 A;  1BR4 B;  1UWO A;  2AAO A;  2L2E A;  1FBV A;  4PHJ A;  2QAC A;  1NCZ A;  1B8R A;  1SPY A;  2F8P A;  3LCP C;  1OMR A;  1RTP 1;  1TNQ A;  4YGA A;  1IQ3 A;  1B4C A;  3BUW B;  1CNP A;  4AQJ A;  2L50 A;  4NDC A;  1PSB A;  1QIV A;  1QLS A;  3O4Y A;  5HYD A;  1YUU A;  1DTL A;  1K9P A;  3BUM B;  1GGW A;  1MXE A;  1YVH A;  2JUL A;  5D69 A;  4OKH A;  2HF5 A;  2GGZ A;  3KF9 A;  5DKN A;  5I8N A;  2BCX A;  5GQQ C;  3BYA A;  1CMG A;  1F4O A;  1TNP A;  2L4H A;  3BOW B;  5B8I B;  1IKU A;  2LLS A;  5DKQ A;  2ZN8 A;  3EK4 A;  1KFX L;  3IF7 A;  4OVN F;  4IL1 A;  2P6B B;  2SCP A;  2JU0 A;  2LAN A;  3HCM A;  1EG4 A;  5HKY A;  2HPS A;  1F4Q A;  1SL8 A;  1DF0 B;  3PFV A;  1SL7 A;  1SRA A;  2LLU A;  3I5G B;  1KFU L;  4DUQ A;  1DJY A;  1F54 A;  3SJS A;  1WLM A;  4E68 A;  1K9K A;  1UHJ A;  4CFQ A;  1GGZ A;  1XK4 A;  3EVV A;  1S36 A;  3ICB A;  2KQY A;  1K96 A;  4NDD A;  3O2P A;  1CFF A;  1SW8 A;  1XFY O;  2FCD A;  2ISD A;  3SG3 A;  1YUR A;  2V53 A;  1L2O B;  1ZUZ A;  4N1F A;  5AEQ A;  1WY9 A;  1CDM A;  1NX2 A;  3KEV A;  1KK7 Y;  4GAO A;  1SMG A;  1JF0 A;  4BY5 A;  4U8D A;  2OTG C;  4FQO A;  2LUX A;  4N5X A;  2CTN A;  1SL9 A;  4GBA A;  1S3P A;  1U5I B;  3OB2 B;  1Y6W A;  1UHI A;  2WCF A;  1JF2 A;  1YX8 A;  2CT9 A;  2M1U A;  4ZCV A;  1IJ6 A;  3GK1 A;  4XJK A;  1SYM A;  1TIZ A;  2JT8 A;  3QRX A;  1XFV O;  3GK4 X;  4D1E A;  1OZO A;  3DF0 B;  3VGO A;  2TN4 A;  2ZRS A;  1B8L A;  1K8U A;  1NX3 A;  4MBE A;  1DT7 B;  2FOT A;  5ER5 A;  1K2H A;  2M49 B;  5HLO A;  1B7T Z;  3RLZ A;  4DRW A;  2JXC A;  4MLW A;  2K7C A;  1IWQ A;  3EK7 A;  4N1G A;  3FWC A;  1NWD A;  4PDZ A;  4YBH B;  3SIA A;  1AK8 A;  3TZ1 A;  2HQW A;  2NZ0 A;  1R2U A;  2OTG B;  1YUT A;  2JNX A;  4MZL A;  1C7W A;  4PE4 A;  3D0Y B;  2KI4 B;  2JZI A;  2LC5 A;  1REC A;  1NYA A;  2WCE A;  1DGU A;  1J55 A;  1CDP A;  1GQM A;  2LUC A;  2JTT A;  2KAV A;  5AXI A;  1YUS A;  2BBN A;  2I94 A;  3NSO A;  4I5J A;  4MEW A;  1NX1 A;  3CLN A;  1S6J A;  1KSM A;  2M97 A;  3A4U B;  1QLK A;  2F3Y A;  2KI6 D;  1D1O A;  1Y0V H;  4GUK A;  1YVL A;  1WDC C;  4YGD B;  1X02 A;  4A4B A;  1M46 A;  1YTZ C;  3DVK A;  2FCE A;  1J1D A;  3TUY B;  2WOS A;  3CWG A;  2PVB A;  1AVS A;  1YRU B;  2JPT A;  3WNX B;  4BY4 A;  2LMU A;  2O60 A;  2KGR A;  2CNP A;  3HX4 A;  2NCO A;  3SG6 A;  2EC6 C;  1Y1A A;  2KI6 C;  1XO5 A;  4PE1 A;  1EH2 A;  1QJT A;  4I5N B;  1BR1 B;  1Y1X A;  2JOJ A;  1JFK A;  5PAL A;  1BJF A;  1F71 A;  1CLL A;  3BOW A;  3OB1 B;  1BT6 A;  3SG2 A;  2KNE A;  3M0W A;  1DJZ A;  4CID A;  4MVF A;  1KCY A;  3CR4 X;  1MF8 B;  1XFZ O;  2GV5 A;  2HET A;  4WQ3 A;  3LL8 B;  2VRG A;  1JUO A;  2OPO A;  2L5X B;  1WDC B;  2O5G A;  1B8C A;  2MAZ A;  3FS7 A;  3LK1 A;  2F2O A;  1VRK A;  2G2B A;  2BCB A;  2RGI A;  4UPG A;  1HT9 A;  4PCW A;  1HQV A;  2K7D A;  1FW4 A;  2OS8 B;  1CB1 A;  1FI6 A;  2Y1M A;  1SCM B;  1PK0 D;  2K7O A;  1DJH A;  2E30 A;  3AKA A;  5D7F A;  1CTR A;  3BUN B;  2JT0 A;  2KAX A;  2MLF C;  3JVT C;  1K90 D;  1NCX A;  4OCI A;  3IQO A;  2F2P A;  3JTD C;  1BU3 A;  1RK9 A;  2WCB A;  2BKH B;  1CFC A;  4XYN A;  5AAN A;  1UHN A;  3A8R A;  3TDU A;  1FI5 A;  4M2Q A;  1EXR A;  1LVC D;  4C0L A;  4MRX A;  2H61 C;  1U5I A;  1LXF C;  1RRO A;  4PHK A;  2EHB A;  1MR8 A;  3NXA A;  2F33 A;  2MA2 A;  1UUS A;  3ZWH A;  3EKH A;  1FPW A;  1MUX A;  1BOC A;  1S5G Y;  2KGB C;  3I5H C;  4Q04 A;  2KBM A;  1UHH A;  2LVK A;  1J7R A;  2D8N A;  3RM1 A;  2F3Z A;  4AOM A;  3DF0 A;  2LE9 B;  3JVT B;  1MQ1 A;  1QX2 A;  1UUR A;  4M2P A;  3JTD B;  3TS5 C;  2G9B A;  4YGB B;  1DJX A;  3OX5 A;  1LIN A;  3SIB A;  4ORA B;  3I5F C;  4ETO A;  1A2X A;  1YRT B;  2K2F A;  4HRE E;  2CBL A;  1ZOT B;  3D0Y A;  1N0Y A;  1QVI Y;  1CFD A;  3BUO B;  1G33 A;  5CSF A;  4GNK B;  4PHM A;  2KBI A;  4PE7 A;  1PRW A;  2LHI A;  2LVV A;  1NUB A;  1ALW A;  3I5H B;  1WRZ A;  1NIW A;  1LA0 A;  1J7O A;  1M45 A;  2EGD A;  4ICB A;  1IQ5 A;  3VRP A;  3WXA A;  3O6B A;  1PAL A;  4PAL A;  1SR6 C;  2DOQ A;  1XA5 A;  1IRJ A;  5KSZ A;  1CKK A;  4YGE B;  2JT3 A;  2QPT A;  3OP0 A;  1XYD A;  3TS5 B;  2IS9 A;  1LKJ A;  1OSA A;  3FWB A;  2SAS A;  2JQ6 A;  1BMO A;  1CLB A;  1KWO C;  2KYF A;  4GGF A;  4CLN A;  1FF1 A;  2I7A A;  5AER A;  3I5F B;  2KSP A;  1J7Q A;  3AAK A;  5HKW A;  1BG1 A;  1BOD A;  3KO0 A;  1S26 D;  1W7I B;  3EK8 A;  2BKI B;  4YRU A;  2M1K B;  2L98 A;  5KTY A;  1WLZ A;  2BE6 A;  2WOR A;  2Y4Q A;  2M7N A;  1AUI B;  2WC8 A;  2JWW A;  3LK0 A;  2ZKM X;  4NDB A;  5FYX A;  4CPV A;  1SR6 B;  2JC2 A;  1IGV A;  1Y1U A;  2PSR A;  2JNF A;  1NCY A;  2K2A A;  1AP4 A;  1A75 B;  3KHE A;  3OX6 A;  2NLN A;  1SCV A;  2LCP A;  1XFX O;  1QAT A;  1M31 A;  1JBA A;  1AJ5 A;  1SK6 D;  2NXQ A;  4C0J A;  2GGM A;  4FTG A;  1KWO B;  5TNC A;  1G4Y R;  1S6C A;  1WRK A;  1KQM C;  1F55 A;  2MLE C;  2MHH A;  2JTZ A;  3OHM B;  4HRG A;  2KOT A;  1KK8 C;  1N65 A;  2L51 A;  1MWN A;  1CLM A;  3LLE A;  1AHR A;  1E8A A;  4OR9 B;  3C1V A;  1YX7 A;  2I18 A;  4MZJ A;  1ALV A;  4JPZ B;  2KFG A;  2COL B;  1K9U A;  2JXL A;  5DKR A;  3ZNI A;  1JWD A;  1ZAC A;  3O78 A;  1J7P A;  3DVM A;  1TOP A;  1KFX S;  3PN7 C;  1C7V A;  2CCM A;  4MRY A;  1BLQ A;  5JOL A;  1TNW A;  5J3X A;  1OMD A;  1TN4 A;  4AQI A;  2BE4 A;  3FIA A;  4WQ2 A;  1KQM B;  1QTX A;  1KFU S;  1OZS A;  1KQV A;  1IJ5 A;  3KPX A;  1MHO A;  1YR5 A;  1A4P A;  2R2I A;  2E6W A;  1KK7 Z;  4PHN A;  4P5O E;  1KK8 B;  2WND A;  1XFW O;  3SG7 A;  1M39 A;  2LVI A;  1V1G A;  2EC6 B;  1QXP A;  1JC2 A;  1B7T Y;  1IH0 A;  1S1E A;  1KSO A;  4TNC A;  5I2O A;  3K21 A;  1JFJ A;  3CR2 A;  2LMT A;  1OOJ A;  1DJG A;  3PM8 A;  4GFT A;  3BXK A;  5G08 A;  3WHU B;  1RJV A;  1AJ4 A;  2CXJ A;  2H61 A;  2KYC A;  1B9A A;  4USL A;  1SBJ A;  3CR5 X;  1DMO A;  2ZN9 A;  3PN7 B;  2ZFD A;  1PVA A;  1UP5 A;  2M29 A;  3I5G C;  3EKJ A;  2NCP A;  1QS7 A;  2LP2 A;  1V1F A;  3AAJ A;  2LNK A;  4L9M A;  2ZRT A;  1OE9 B;  1WRL A;  1XVJ A;  2ZND A;  2LP3 A;  4HSZ A;  5K89 A;  3TDZ A;  2BCA A;  3VRQ A;  2A4J A;  3I5I C;  2K8M B;  1OMV A;  1DGV A;  1K94 A;  4R1E A;  2MRD A;  3CGA A;  2PRU A;  1EJ3 A;  1L2O C;  2MBX A;  1G8I A;  2L4I A;  1TNX A;  1QV0 A;  2LAP A;  1ZFS A;  1MXL C;  2BL0 C;  1L7Z A;  2M3W A;  2K0J A;  1R6P A;  4P2Y B;  4QJ3 B;  4M2O A;  1JSA A;  4QJ5 B;  3D10 A;  1XFU O;  2M0R A;  4ZCU A;  5KU1 A;  1PUL A;  4YGC B;  4CFR A;  1QV1 A;  1OQP A;  2M9G A;  5I2Q A;  2LMV A;  4C0K A;  3NSI A;  2Q91 A;  1IG5 A;  1J1E A;  1A75 A;  4JQ0 D;  4YI9 A;  2PMY A;  5BPJ A;  3I5I B;  4MN0 A;  1A29 A;  1XK4 C;  2Q4U A;  1W7J B;  2LVJ A;  1EG3 A;  1TTX A;  3CTN A;  2BL0 B;  1QX7 A;  4MSP A;  3NSL A;  2K61 A;  3CZT X;  2PAS A;  2HQ8 A;  2LM5 A;  1GJY A;  2KQ6 A; 
#chains in the Genus database with same CATH topology
 3NSK A;  5JJG A;  4JWQ A;  5CSJ A;  4DS7 A;  2KI4 C;  1UHK A;  2H2K A;  1TCF A;  3H4S E;  4OZD A;  1K93 D;  2AUC A;  2GTE A;  1F8H A;  4WRI A;  3GOF A;  1PVB A;  3PAL A;  2B1U A;  3FE9 A;  3PLF B;  4GGN A;  1CMF A;  1XFR A;  2KFF A;  1NX0 A;  1QIW A;  2M7L A;  1S6I A;  1EL4 A;  1N2D A;  1B47 A;  2WCK A;  3AKB A;  1TRF A;  5F6T A;  4DCK A;  1TWO A;  4A4C A;  2KAY A;  1T14 A;  3EVR A;  3B6X A;  3BFH A;  1CFP A;  1RFJ A;  4MZK A;  1PSR A;  4OV2 A;  1QAS A;  3TUY C;  1B1G A;  1NSH A;  1F70 A;  3D76 A;  2FJU B;  4NQG A;  3DVJ A;  3BQ3 A;  3VRO A;  4GGF C;  1OOH A;  2BEC A;  3IQQ A;  2KFH A;  4INW A;  5IBW A;  3WHT B;  2Y1N A;  2PQL A;  2LHL A;  2JRF A;  4HRH A;  1NP8 A;  5AFP A;  1H8B A;  5ER4 X;  5CPV A;  1Q80 A;  3L4L A;  3IVT A;  5EL2 A;  1SKT A;  1DVI A;  3NGV A;  1K95 A;  3PM2 A;  2KDH A;  2QEH A;  3R1V A;  1CDL A;  1OOI X;  5CSI A;  1CM4 A;  2FJY A;  1LA3 A;  4YI8 A;  1GM0 A;  1TCO B;  2BBM A;  4GPL B;  1S5G Z;  3EVU A;  1DJI A;  5HKZ A;  3BUX B;  2WC6 A;  3VRR A;  1SNL A;  4F0Z B;  2L0P A;  3MSE B;  1C07 A;  4XJK B;  2K7B A;  1QX5 B;  1ODB A;  1A03 A;  2LLT A;  2AMI A;  1DJW A;  2KHN A;  2KLE A;  3OBV A;  3F45 A;  1IIO A;  4I5L B;  3E3R A;  2OS8 C;  2Y5I A;  5FI2 A;  1CM1 A;  1H4B A;  1SY9 A;  3SG4 A;  5I2L A;  1SCM C;  3DD4 A;  3S0G A;  2PAL A;  5CSN A;  1ZMZ A;  3PAT A;  5D3O A;  2LV7 A;  1CDN A;  4I5K A;  2WCM A;  3CAB A;  3VRN A;  3PSR A;  4ORB B;  1M63 B;  4ORC B;  4PE0 A;  1NPQ A;  1QVI Z;  3GK2 A;  2ZNE A;  4DIR A;  3DVE A;  3TDI A;  4FQT A;  3SG5 A;  3CYZ A;  2I2R E;  3CS1 A;  1RWY A;  5HLV A;  4QJ4 B;  1TUZ A;  2M8U A;  2MJW B;  1BF5 A;  1DF0 A;  1BR4 B;  1UWO A;  2AAO A;  1OOF A;  2L2E A;  1FBV A;  4PHJ A;  4IJ7 A;  2QAC A;  1NCZ A;  1B8R A;  1SPY A;  1OOG A;  2F8P A;  3LCP C;  3DZT A;  1OMR A;  1RTP 1;  1TNQ A;  4YGA A;  1IQ3 A;  1B4C A;  3BUW B;  1CNP A;  4AQJ A;  2L50 A;  4NDC A;  1PSB A;  1QIV A;  1QLS A;  3O4Y A;  5HYD A;  1YUU A;  1DTL A;  1K9P A;  1OW4 A;  3BUM B;  1GGW A;  1MXE A;  3FE8 A;  1YVH A;  2JUL A;  5D69 A;  4OKH A;  2HF5 A;  2GGZ A;  2WCJ A;  3KF9 A;  5DKN A;  1DEL A;  5I8N A;  2BCX A;  5GQQ C;  3BYA A;  1CMG A;  1F4O A;  1TNP A;  2L4H A;  3BOW B;  5B8I B;  1IKU A;  2LLS A;  5DKQ A;  2ZN8 A;  3EK4 A;  1KFX L;  3IF7 A;  4OVN F;  4IL1 A;  1QWV A;  2ERB A;  2P6B B;  2JU0 A;  2PYQ A;  2LAN A;  2SCP A;  3HCM A;  1EG4 A;  5HKY A;  2HPS A;  1F4Q A;  1SL8 A;  1DF0 B;  3PFV A;  1SL7 A;  1SRA A;  2LLU A;  3I5G B;  1KFU L;  4DUQ A;  1DJY A;  1F54 A;  3SJS A;  1WLM A;  4E68 A;  3SS5 A;  1K9K A;  1UHJ A;  3B7A A;  1GGZ A;  4CFQ A;  3L4A A;  1XK4 A;  3EVV A;  1S36 A;  3ICB A;  2KQY A;  1K96 A;  4NDD A;  3O2P A;  1CFF A;  1SW8 A;  1XFY O;  2FCD A;  2ISD A;  3SG3 A;  3S0F A;  1YUR A;  2V53 A;  1L2O B;  1ZUZ A;  4N1F A;  5AEQ A;  3V2L A;  1WY9 A;  1CDM A;  1NX2 A;  3KEV A;  1KK7 Y;  4GAO A;  2KPH A;  1SMG A;  1JF0 A;  5DIC A;  4BY5 A;  4U8D A;  3PJI A;  2OTG C;  4FQO A;  2LUX A;  4N5X A;  2CTN A;  1SL9 A;  4GBA A;  1S3P A;  1U5I B;  3OB2 B;  1Y6W A;  1UHI A;  2WCF A;  1JF2 A;  1YX8 A;  2CT9 A;  2M1U A;  2QEV A;  4ZCV A;  1IJ6 A;  2H8V A;  3GK1 A;  4XJK A;  1SYM A;  1TIZ A;  2JT8 A;  3QRX A;  1XFV O;  3GK4 X;  3R72 A;  4D1E A;  1OZO A;  3DF0 B;  3VGO A;  2TN4 A;  2ZRS A;  1B8L A;  1K8U A;  1NX3 A;  4MBE A;  1DT7 B;  2FOT A;  5ER5 A;  3VB1 A;  2QDI A;  2M49 B;  3D74 A;  5HLO A;  1K2H A;  1B7T Z;  3RLZ A;  4DRW A;  2JXC A;  4MLW A;  2K7C A;  1IWQ A;  3EK7 A;  4N1G A;  3FWC A;  1NWD A;  4PDZ A;  4YBH B;  3SIA A;  2L5Y A;  3TZ1 A;  1AK8 A;  2HQW A;  2NZ0 A;  1R2U A;  2OTG B;  1YUT A;  2JNX A;  4MZL A;  1C7W A;  4PE4 A;  2BAP A;  3D0Y B;  2KI4 B;  2JZI A;  2LC5 A;  1REC A;  1NYA A;  2WCE A;  1DGU A;  1J55 A;  3SS4 A;  1CDP A;  1GQM A;  2LUC A;  3B88 A;  2JTT A;  1DC1 A;  2KAV A;  5AXI A;  1YUS A;  2BBN A;  2I94 A;  3NSO A;  4I5J A;  4MEW A;  1NX1 A;  3CLN A;  1S6J A;  1KSM A;  2M97 A;  3A4U B;  1QLK A;  2F3Y A;  2KI6 D;  4PT1 A;  1D1O A;  1Y0V H;  4GUK A;  1YVL A;  1WDC C;  4YGD B;  1X02 A;  4A4B A;  1M46 A;  1YTZ C;  3DVK A;  2FCE A;  1J1D A;  3TUY B;  3RZS A;  2WOS A;  3CWG A;  2PVB A;  1AVS A;  1YRU B;  2JPT A;  3S0D A;  3WNX B;  4BY4 A;  2LMU A;  2O60 A;  2KGR A;  2CNP A;  3HX4 A;  2NCO A;  3SG6 A;  2EC6 C;  1Y1A A;  2KI6 C;  1XO5 A;  4PE1 A;  1EH2 A;  1QJT A;  1Z2C B;  4I5N B;  1BR1 B;  1Y1X A;  2JOJ A;  1JFK A;  5FI7 A;  5PAL A;  1BJF A;  1F71 A;  1CLL A;  3BOW A;  3CDN A;  3SS3 A;  3OB1 B;  1BT6 A;  5FI6 A;  3SG2 A;  2KNE A;  3M0W A;  3R1O A;  1DJZ A;  4CID A;  4MVF A;  1KCY A;  3CR4 X;  1MF8 B;  1XFZ O;  2GV5 A;  2HET A;  4WQ3 A;  3LL8 B;  2VRG A;  1JUO A;  2OPO A;  2L5X B;  1WDC B;  2O5G A;  4INX A;  1B8C A;  1DEK A;  2MAZ A;  3FS7 A;  3LK1 A;  2WCL A;  2F2O A;  1VRK A;  2G2B A;  2BCB A;  2RGI A;  4UPG A;  1HT9 A;  4PCW A;  1HQV A;  2K7D A;  2QEB A;  1FW4 A;  2OS8 B;  1CB1 A;  3D78 A;  1FI6 A;  2Y1M A;  1SCM B;  1PK0 D;  2K7O A;  1DJH A;  1DQE A;  2E30 A;  3AKA A;  1CTR A;  3BUN B;  2JT0 A;  2KAX A;  2MLF C;  5D7F A;  3JVT C;  3DYE A;  1K90 D;  1NCX A;  4OCI A;  3IQO A;  2F2P A;  3JTD C;  1BU3 A;  1RK9 A;  2WCB A;  3D73 A;  2BKH B;  1CFC A;  4XYN A;  2WC5 A;  5AAN A;  1UHN A;  3A8R A;  3TDU A;  1FI5 A;  4M2Q A;  1EXR A;  1LVC D;  4C0L A;  4MRX A;  2H61 C;  2K60 A;  1U5I A;  1LXF C;  1RRO A;  4PHK A;  2EHB A;  1MR8 A;  3NXA A;  2F33 A;  2MA2 A;  1UUS A;  3ZWH A;  3EKH A;  1FPW A;  1MUX A;  1BOC A;  1S5G Y;  2KGB C;  3I5H C;  4Q04 A;  2KBM A;  1UHH A;  2LVK A;  1J7R A;  2D8N A;  3RM1 A;  2F3Z A;  4AOM A;  3DF0 A;  3NHT A;  2LE9 B;  3JVT B;  1MQ1 A;  3BFA A;  3D75 A;  1QX2 A;  1UUR A;  4M2P A;  3JTD B;  3TS5 C;  2G9B A;  4YGB B;  1DJX A;  3DY9 A;  3OX5 A;  1LIN A;  3SIB A;  4ORA B;  2WCH A;  3I5F C;  4ETO A;  1A2X A;  1YRT B;  2K2F A;  4HRE E;  2CBL A;  1ZOT B;  3D0Y A;  3UNW A;  1N0Y A;  1QVI Y;  1Z4H A;  1CFD A;  3BUO B;  1G33 A;  2L2C A;  5CSF A;  4GNK B;  4PHM A;  3K1E A;  2KBI A;  4PE7 A;  1LS8 A;  1PRW A;  2LHI A;  2LVV A;  1NUB A;  1ALW A;  3I5H B;  1WRZ A;  1NIW A;  1LA0 A;  1J7O A;  1M45 A;  2EGD A;  4ICB A;  1IQ5 A;  3VRP A;  3WXA A;  3O6B A;  3EG5 B;  3S0E A;  1C3Y A;  1PAL A;  4PAL A;  1SR6 C;  2DOQ A;  1XA5 A;  1IRJ A;  2KLD A;  5KSZ A;  1CKK A;  4YGE B;  2JT3 A;  2QPT A;  3OP0 A;  1XYD A;  3TS5 B;  2IS9 A;  1LKJ A;  3N7H A;  1OSA A;  3FWB A;  2SAS A;  2JQ6 A;  1BMO A;  1CLB A;  1KWO C;  2KYF A;  3FE6 A;  4GGF A;  4CLN A;  2I7A A;  1FF1 A;  5AER A;  3I5F B;  2KSP A;  1J7Q A;  3AAK A;  5HKW A;  1BG1 A;  3S0B A;  1BOD A;  3KO0 A;  1S26 D;  1W7I B;  3S0A A;  3EK8 A;  2BKI B;  4JKT A;  4YRU A;  2M1K B;  2L98 A;  3L47 A;  5KTY A;  1WLZ A;  3QME A;  2BE6 A;  2WOR A;  2Y4Q A;  2M7N A;  1AUI B;  2WC8 A;  2JWW A;  3LK0 A;  2ZKM X;  4NDB A;  5FYX A;  4CPV A;  1SR6 B;  2JC2 A;  1IGV A;  1Y1U A;  2PSR A;  4KYN A;  2JNF A;  3B86 A;  1NCY A;  2K2A A;  1AP4 A;  1A75 B;  3KHE A;  3OX6 A;  2NLN A;  1SCV A;  2LCP A;  1XFX O;  1QAT A;  3Q8I A;  1M31 A;  1JBA A;  1AJ5 A;  1SK6 D;  2NXQ A;  4C0J A;  3BJH A;  2GGM A;  4FTG A;  1KWO B;  1SSE B;  3DXL A;  5TNC A;  1G4Y R;  1S6C A;  1WRK A;  1KQM C;  1F55 A;  2MLE C;  3UO9 A;  2MHH A;  2JTZ A;  3OHM B;  2P71 A;  4HRG A;  2KOT A;  3R1P A;  1KK8 C;  1N65 A;  2L51 A;  1MWN A;  1CLM A;  3LLE A;  1AHR A;  1E8A A;  4OR9 B;  3C1V A;  1YX7 A;  2I18 A;  4MZJ A;  1ALV A;  4JPZ B;  2KFG A;  2COL B;  3CZ1 A;  1TUJ A;  1K9U A;  2JXL A;  5DKR A;  3ZNI A;  1JWD A;  1ZAC A;  3O78 A;  1J7P A;  3DVM A;  1TOP A;  1KFX S;  3PN7 C;  1C7V A;  2CCM A;  4MRY A;  1BLQ A;  5JOL A;  1TNW A;  5J3X A;  1OMD A;  1P28 A;  1TN4 A;  4AQI A;  2BE4 A;  3FIA A;  4WQ2 A;  1KQM B;  1QTX A;  1KFU S;  2JPO A;  1OZS A;  1KQV A;  1IJ5 A;  3KPX A;  1MHO A;  1YR5 A;  1A4P A;  2QEO A;  2R2I A;  2E6W A;  1KK7 Z;  4PHN A;  2P70 A;  4P5O E;  1KK8 B;  2WND A;  1XFW O;  3SG7 A;  1M39 A;  2LVI A;  1V1G A;  2EC6 B;  1ORG A;  1QXP A;  1JC2 A;  1B7T Y;  1IH0 A;  1S1E A;  1KSO A;  4TNC A;  3CZ0 A;  5I2O A;  3K21 A;  1JFJ A;  3CR2 A;  2LMT A;  1OOJ A;  1DJG A;  3PM8 A;  4GFT A;  3BXK A;  5G08 A;  3WHU B;  1RJV A;  1AJ4 A;  2CXJ A;  2H61 A;  2KYC A;  1B9A A;  4USL A;  1SBJ A;  3CR5 X;  3D77 A;  1DMO A;  2ZN9 A;  3PN7 B;  2ZFD A;  1PVA A;  1C3Z A;  1UP5 A;  2M29 A;  3I5G C;  3EKJ A;  2NCP A;  1QS7 A;  2LP2 A;  1V1F A;  4F7F A;  3AAJ A;  2LNK A;  4L9M A;  2ZRT A;  1OE9 B;  1WRL A;  1XVJ A;  2ZND A;  2LP3 A;  4HSZ A;  5K89 A;  3TDZ A;  2BCA A;  3O4X A;  3VRQ A;  2A4J A;  3I5I C;  2K8M B;  1OMV A;  1DGV A;  1K94 A;  4R1E A;  2MRD A;  3CGA A;  2PRU A;  1EJ3 A;  1L2O C;  2MBX A;  1G8I A;  5HL1 A;  2L4I A;  3NHI A;  1TNX A;  1W9Z A;  1QV0 A;  2LAP A;  1ZFS A;  1MXL C;  2BL0 C;  2YGU A;  1L7Z A;  2M3W A;  4JD9 A;  2K0J A;  1R6P A;  3B87 A;  4P2Y B;  4M2O A;  4QJ3 B;  4QJ5 B;  2BNX A;  3D10 A;  1JSA A;  1XFU O;  2M0R A;  4ZCU A;  5KU1 A;  1PUL A;  4YGC B;  4CFR A;  1QV1 A;  1OQP A;  2M9G A;  5I2Q A;  2LMV A;  4C0K A;  3CZ2 A;  2Q91 A;  3NSI A;  1IG5 A;  1J1E A;  1A75 A;  4JQ0 D;  4YI9 A;  2PMY A;  3OGN A;  5BPJ A;  3I5I B;  4MN0 A;  1A29 A;  1XK4 C;  2Q4U A;  3BFB A;  1W7J B;  2LVJ A;  1EG3 A;  5I94 A;  1TTX A;  3CTN A;  2BL0 B;  1QX7 A;  4MSP A;  3NSL A;  2K61 A;  3CZT X;  2PAS A;  2HQ8 A;  2LM5 A;  1GJY A;  2KQ6 A; 
#chains in the Genus database with same CATH homology
 3NSK A;  5JJG A;  4JWQ A;  5CSJ A;  4DS7 A;  2KI4 C;  1UHK A;  2H2K A;  1TCF A;  3H4S E;  1K93 D;  2AUC A;  1F8H A;  4WRI A;  3GOF A;  1PVB A;  3PAL A;  2B1U A;  3PLF B;  4GGN A;  1CMF A;  2KFF A;  1NX0 A;  1QIW A;  2M7L A;  1S6I A;  1EL4 A;  1N2D A;  1B47 A;  3AKB A;  1TRF A;  5F6T A;  4DCK A;  4A4C A;  2KAY A;  3EVR A;  1CFP A;  1RFJ A;  4MZK A;  1PSR A;  4OV2 A;  1QAS A;  3TUY C;  1B1G A;  1NSH A;  1F70 A;  2FJU B;  4NQG A;  3DVJ A;  3BQ3 A;  3VRO A;  4GGF C;  3IQQ A;  2BEC A;  2KFH A;  5IBW A;  3WHT B;  2Y1N A;  2LHL A;  2JRF A;  4HRH A;  1NP8 A;  5AFP A;  1H8B A;  5ER4 X;  5CPV A;  1Q80 A;  1SKT A;  1DVI A;  1K95 A;  2KDH A;  1CDL A;  5CSI A;  1CM4 A;  1LA3 A;  4YI8 A;  1TCO B;  2BBM A;  4GPL B;  1S5G Z;  3EVU A;  1DJI A;  5HKZ A;  3BUX B;  3VRR A;  1SNL A;  4F0Z B;  2L0P A;  3MSE B;  1C07 A;  4XJK B;  2K7B A;  1QX5 B;  1ODB A;  1A03 A;  2LLT A;  2AMI A;  1DJW A;  2KHN A;  3F45 A;  4I5L B;  3E3R A;  2OS8 C;  2Y5I A;  1H4B A;  1CM1 A;  1SY9 A;  3SG4 A;  5I2L A;  1SCM C;  3DD4 A;  2PAL A;  5CSN A;  1ZMZ A;  3PAT A;  2LV7 A;  1CDN A;  4I5K A;  3VRN A;  3PSR A;  4ORB B;  1M63 B;  4ORC B;  4PE0 A;  1NPQ A;  1QVI Z;  3GK2 A;  2ZNE A;  4DIR A;  3DVE A;  3TDI A;  3SG5 A;  2I2R E;  3CS1 A;  1RWY A;  5HLV A;  4QJ4 B;  2M8U A;  2MJW B;  1BF5 A;  1DF0 A;  1BR4 B;  1UWO A;  2AAO A;  2L2E A;  1FBV A;  4PHJ A;  2QAC A;  1NCZ A;  1B8R A;  1SPY A;  2F8P A;  3LCP C;  1OMR A;  1RTP 1;  1TNQ A;  4YGA A;  1IQ3 A;  1B4C A;  3BUW B;  1CNP A;  4AQJ A;  2L50 A;  4NDC A;  1PSB A;  1QIV A;  1QLS A;  3O4Y A;  5HYD A;  1YUU A;  1DTL A;  1K9P A;  3BUM B;  1GGW A;  1MXE A;  1YVH A;  2JUL A;  5D69 A;  4OKH A;  2HF5 A;  2GGZ A;  3KF9 A;  5DKN A;  5I8N A;  2BCX A;  5GQQ C;  3BYA A;  1CMG A;  1F4O A;  1TNP A;  2L4H A;  3BOW B;  5B8I B;  1IKU A;  2LLS A;  5DKQ A;  2ZN8 A;  3EK4 A;  1KFX L;  3IF7 A;  4OVN F;  4IL1 A;  2P6B B;  2SCP A;  2JU0 A;  2LAN A;  3HCM A;  1EG4 A;  5HKY A;  2HPS A;  1F4Q A;  1SL8 A;  1DF0 B;  3PFV A;  1SL7 A;  1SRA A;  2LLU A;  3I5G B;  1KFU L;  4DUQ A;  1DJY A;  1F54 A;  3SJS A;  1WLM A;  4E68 A;  1K9K A;  1UHJ A;  4CFQ A;  1GGZ A;  1XK4 A;  3EVV A;  1S36 A;  3ICB A;  2KQY A;  1K96 A;  4NDD A;  3O2P A;  1CFF A;  1SW8 A;  1XFY O;  2FCD A;  2ISD A;  3SG3 A;  1YUR A;  2V53 A;  1L2O B;  1ZUZ A;  4N1F A;  5AEQ A;  1WY9 A;  1CDM A;  1NX2 A;  3KEV A;  1KK7 Y;  4GAO A;  1SMG A;  1JF0 A;  4BY5 A;  4U8D A;  2OTG C;  4FQO A;  2LUX A;  4N5X A;  2CTN A;  1SL9 A;  4GBA A;  1S3P A;  1U5I B;  3OB2 B;  1Y6W A;  1UHI A;  2WCF A;  1JF2 A;  1YX8 A;  2CT9 A;  2M1U A;  4ZCV A;  1IJ6 A;  3GK1 A;  4XJK A;  1SYM A;  1TIZ A;  2JT8 A;  3QRX A;  1XFV O;  3GK4 X;  4D1E A;  1OZO A;  3DF0 B;  3VGO A;  2TN4 A;  2ZRS A;  1B8L A;  1K8U A;  1NX3 A;  4MBE A;  1DT7 B;  2FOT A;  5ER5 A;  1K2H A;  2M49 B;  5HLO A;  1B7T Z;  3RLZ A;  4DRW A;  2JXC A;  4MLW A;  2K7C A;  1IWQ A;  3EK7 A;  4N1G A;  3FWC A;  1NWD A;  4PDZ A;  4YBH B;  3SIA A;  1AK8 A;  3TZ1 A;  2HQW A;  2NZ0 A;  1R2U A;  2OTG B;  1YUT A;  2JNX A;  4MZL A;  1C7W A;  4PE4 A;  3D0Y B;  2KI4 B;  2JZI A;  2LC5 A;  1REC A;  1NYA A;  2WCE A;  1DGU A;  1J55 A;  1CDP A;  1GQM A;  2LUC A;  2JTT A;  2KAV A;  5AXI A;  1YUS A;  2BBN A;  2I94 A;  3NSO A;  4I5J A;  4MEW A;  1NX1 A;  3CLN A;  1S6J A;  1KSM A;  2M97 A;  3A4U B;  1QLK A;  2F3Y A;  2KI6 D;  1D1O A;  1Y0V H;  4GUK A;  1YVL A;  1WDC C;  4YGD B;  1X02 A;  4A4B A;  1M46 A;  1YTZ C;  3DVK A;  2FCE A;  1J1D A;  3TUY B;  2WOS A;  3CWG A;  2PVB A;  1AVS A;  1YRU B;  2JPT A;  3WNX B;  4BY4 A;  2LMU A;  2O60 A;  2KGR A;  2CNP A;  3HX4 A;  2NCO A;  3SG6 A;  2EC6 C;  1Y1A A;  2KI6 C;  1XO5 A;  4PE1 A;  1EH2 A;  1QJT A;  4I5N B;  1BR1 B;  1Y1X A;  2JOJ A;  1JFK A;  5PAL A;  1BJF A;  1F71 A;  1CLL A;  3BOW A;  3OB1 B;  1BT6 A;  3SG2 A;  2KNE A;  3M0W A;  1DJZ A;  4CID A;  4MVF A;  1KCY A;  3CR4 X;  1MF8 B;  1XFZ O;  2GV5 A;  2HET A;  4WQ3 A;  3LL8 B;  2VRG A;  1JUO A;  2OPO A;  2L5X B;  1WDC B;  2O5G A;  1B8C A;  2MAZ A;  3FS7 A;  3LK1 A;  2F2O A;  1VRK A;  2G2B A;  2BCB A;  2RGI A;  4UPG A;  1HT9 A;  4PCW A;  1HQV A;  2K7D A;  1FW4 A;  2OS8 B;  1CB1 A;  1FI6 A;  2Y1M A;  1SCM B;  1PK0 D;  2K7O A;  1DJH A;  2E30 A;  3AKA A;  5D7F A;  1CTR A;  3BUN B;  2JT0 A;  2KAX A;  2MLF C;  3JVT C;  1K90 D;  1NCX A;  4OCI A;  3IQO A;  2F2P A;  3JTD C;  1BU3 A;  1RK9 A;  2WCB A;  2BKH B;  1CFC A;  4XYN A;  5AAN A;  1UHN A;  3A8R A;  3TDU A;  1FI5 A;  4M2Q A;  1EXR A;  1LVC D;  4C0L A;  4MRX A;  2H61 C;  1U5I A;  1LXF C;  1RRO A;  4PHK A;  2EHB A;  1MR8 A;  3NXA A;  2F33 A;  2MA2 A;  1UUS A;  3ZWH A;  3EKH A;  1FPW A;  1MUX A;  1BOC A;  1S5G Y;  2KGB C;  3I5H C;  4Q04 A;  2KBM A;  1UHH A;  2LVK A;  1J7R A;  2D8N A;  3RM1 A;  2F3Z A;  4AOM A;  3DF0 A;  2LE9 B;  3JVT B;  1MQ1 A;  1QX2 A;  1UUR A;  4M2P A;  3JTD B;  3TS5 C;  2G9B A;  4YGB B;  1DJX A;  3OX5 A;  1LIN A;  3SIB A;  4ORA B;  3I5F C;  4ETO A;  1A2X A;  1YRT B;  2K2F A;  4HRE E;  2CBL A;  1ZOT B;  3D0Y A;  1N0Y A;  1QVI Y;  1CFD A;  3BUO B;  1G33 A;  5CSF A;  4GNK B;  4PHM A;  2KBI A;  4PE7 A;  1PRW A;  2LHI A;  2LVV A;  1NUB A;  1ALW A;  3I5H B;  1WRZ A;  1NIW A;  1LA0 A;  1J7O A;  1M45 A;  2EGD A;  4ICB A;  1IQ5 A;  3VRP A;  3WXA A;  3O6B A;  1PAL A;  4PAL A;  1SR6 C;  2DOQ A;  1XA5 A;  1IRJ A;  5KSZ A;  1CKK A;  4YGE B;  2JT3 A;  2QPT A;  3OP0 A;  1XYD A;  3TS5 B;  2IS9 A;  1LKJ A;  1OSA A;  3FWB A;  2SAS A;  2JQ6 A;  1BMO A;  1CLB A;  1KWO C;  2KYF A;  4GGF A;  4CLN A;  1FF1 A;  2I7A A;  5AER A;  3I5F B;  2KSP A;  1J7Q A;  3AAK A;  5HKW A;  1BG1 A;  1BOD A;  3KO0 A;  1S26 D;  1W7I B;  3EK8 A;  2BKI B;  4YRU A;  2M1K B;  2L98 A;  5KTY A;  1WLZ A;  2BE6 A;  2WOR A;  2Y4Q A;  2M7N A;  1AUI B;  2WC8 A;  2JWW A;  3LK0 A;  2ZKM X;  4NDB A;  5FYX A;  4CPV A;  1SR6 B;  2JC2 A;  1IGV A;  1Y1U A;  2PSR A;  2JNF A;  1NCY A;  2K2A A;  1AP4 A;  1A75 B;  3KHE A;  3OX6 A;  2NLN A;  1SCV A;  2LCP A;  1XFX O;  1QAT A;  1M31 A;  1JBA A;  1AJ5 A;  1SK6 D;  2NXQ A;  4C0J A;  2GGM A;  4FTG A;  1KWO B;  5TNC A;  1G4Y R;  1S6C A;  1WRK A;  1KQM C;  1F55 A;  2MLE C;  2MHH A;  2JTZ A;  3OHM B;  4HRG A;  2KOT A;  1KK8 C;  1N65 A;  2L51 A;  1MWN A;  1CLM A;  3LLE A;  1AHR A;  1E8A A;  4OR9 B;  3C1V A;  1YX7 A;  2I18 A;  4MZJ A;  1ALV A;  4JPZ B;  2KFG A;  2COL B;  1K9U A;  2JXL A;  5DKR A;  3ZNI A;  1JWD A;  1ZAC A;  3O78 A;  1J7P A;  3DVM A;  1TOP A;  1KFX S;  3PN7 C;  1C7V A;  2CCM A;  4MRY A;  1BLQ A;  5JOL A;  1TNW A;  5J3X A;  1OMD A;  1TN4 A;  4AQI A;  2BE4 A;  3FIA A;  4WQ2 A;  1KQM B;  1QTX A;  1KFU S;  1OZS A;  1KQV A;  1IJ5 A;  3KPX A;  1MHO A;  1YR5 A;  1A4P A;  2R2I A;  2E6W A;  1KK7 Z;  4PHN A;  4P5O E;  1KK8 B;  2WND A;  1XFW O;  3SG7 A;  1M39 A;  2LVI A;  1V1G A;  2EC6 B;  1QXP A;  1JC2 A;  1B7T Y;  1IH0 A;  1S1E A;  1KSO A;  4TNC A;  5I2O A;  3K21 A;  1JFJ A;  3CR2 A;  2LMT A;  1OOJ A;  1DJG A;  3PM8 A;  4GFT A;  3BXK A;  5G08 A;  3WHU B;  1RJV A;  1AJ4 A;  2CXJ A;  2H61 A;  2KYC A;  1B9A A;  4USL A;  1SBJ A;  3CR5 X;  1DMO A;  2ZN9 A;  3PN7 B;  2ZFD A;  1PVA A;  1UP5 A;  2M29 A;  3I5G C;  3EKJ A;  2NCP A;  1QS7 A;  2LP2 A;  1V1F A;  3AAJ A;  2LNK A;  4L9M A;  2ZRT A;  1OE9 B;  1WRL A;  1XVJ A;  2ZND A;  2LP3 A;  4HSZ A;  5K89 A;  3TDZ A;  2BCA A;  3VRQ A;  2A4J A;  3I5I C;  2K8M B;  1OMV A;  1DGV A;  1K94 A;  4R1E A;  2MRD A;  3CGA A;  2PRU A;  1EJ3 A;  1L2O C;  2MBX A;  1G8I A;  2L4I A;  1TNX A;  1QV0 A;  2LAP A;  1ZFS A;  1MXL C;  2BL0 C;  1L7Z A;  2M3W A;  2K0J A;  1R6P A;  4P2Y B;  4QJ3 B;  4M2O A;  1JSA A;  4QJ5 B;  3D10 A;  1XFU O;  2M0R A;  4ZCU A;  5KU1 A;  1PUL A;  4YGC B;  4CFR A;  1QV1 A;  1OQP A;  2M9G A;  5I2Q A;  2LMV A;  4C0K A;  3NSI A;  2Q91 A;  1IG5 A;  1J1E A;  1A75 A;  4JQ0 D;  4YI9 A;  2PMY A;  5BPJ A;  3I5I B;  4MN0 A;  1A29 A;  1XK4 C;  2Q4U A;  1W7J B;  2LVJ A;  1EG3 A;  1TTX A;  3CTN A;  2BL0 B;  1QX7 A;  4MSP A;  3NSL A;  2K61 A;  3CZT X;  2PAS A;  2HQ8 A;  2LM5 A;  1GJY A;  2KQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...