4YGCB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
64
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 64
sequence length 77
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygcB00
4XJKB 5CPVA 1K96A 1NUBA 3C1VA 2HF5A 1IG5A 3KHEA 1NX0A 1B1GA 3OX6A 2Y1NA 2Y4QA 2DOQA 1ODBA 5DKQA 1A29A 1S1EA 1YTZC 1U5IA 2ZNDA 1BG1A 1A03A 5DKRA 1NYAA 5D69A 1TRFA 1TCOB 2ZFDA 3H4SE 4AQJA 1JC2A 1EH2A 1JFJA 2HQ8A 5PALA 4MEWA 3SG5A 2MHHA 4D1EA 2FCDA 4HRGA 3BUOB 2BL0B 2R2IA 2F2PA 2BCAA 4DRWA 1CDPA 2BE6A 2CBLA 5JOLA 3NSKA 2LAPA 1CB1A 2K7CA 3DVMA 1NCXA 3PN7C 4I5KA 4GFTA 4Q04A 1UHKA 2IS9A 1JWDA 2M1KB 1NX2A 1UURA 3OB2B 1ZMZA 2JXCA 1RFJA 3I5HB 4OV2A 1TNWA 1Y0VH 4GAOA 2KGBC 3D0YB 3HCMA 2LP2A 3TUYB 2PALA 2K8MB 2KFHA 1UUSA 1ZACA 1FI5A 1OZOA 1YVHA 2D8NA 2PSRA 2BKHB 3GK2A 5I2QA 2LVKA 2K7BA 2WNDA 1LA0A 3TZ1A 3OB1B 1KWOC 3A4UB 4I5LB 4L9MA 3HX4A 4YI8A 4WQ3A 1RTP1 2JWWA 4MZLA 3BUWB 1M46A 4YGEB 2LLSA 2CXJA 1XK4A 3RM1A 1MXLC 3MSEB 4ICBA 1B9AA 3DD4A 1QX2A 2I18A 4MN0A 2MBXA 2H2KA 1WRKA 1QASA 2CTNA 1DJZA 3CR4X 4GBAA 2BBNA 3ZNIA 1IKUA 2HPSA 5CSJA 2JPTA 3AAJA 2LHIA 2MLEC 2K7OA 3VRQA 1K9KA 1F55A 1WDCB 1A4PA 2JNFA 4JPZB 1B8LA 1XFXO 2ZRSA 1AUIB 1RK9A 3JTDC 3LL8B 3WNXB 3QRXA 1QIWA 2NLNA 2L4IA 2KAVA 4HREE 4C0KA 1SW8A 1HT9A 1YUSA 2CCMA 1UHHA 4P5OE 1Y1XA 3WXAA 1CLBA 1G33A 1K90D 1OSAA 1QJTA 5I2LA 5KU1A 1JFKA 3EK4A 1N2DA 4YGAA 4A4CA 1OQPA 2K61A 3LCPC 1SYMA 1JF0A 2I94A 1UHJA 1IRJA 1EG4A 1E8AA 3CTNA 2BKIB 4GNKB 5CSFA 1KK8C 3BOWB 2LMTA 1QX5B 3PSRA 3GK1A 4PE4A 3KEVA 1PRWA 1BOCA 3OHMB 1L7ZA 2M9GA 4N1GA 3E3RA 2KI4B 3PN7B 5HYDA 1F54A 4YBHB 1TNQA 2I2RE 2KBIA 1TTXA 5AXIA 1LKJA 1XVJA 3FS7A 4ORCB 2LE9B 4ZCVA 4MZKA 3RLZA 3SG3A 3CS1A 4YGBB 1DJHA 4JWQA 1JBAA 3VROA 4HRHA 2ZNEA 2F8PA 3ZWHA 2PASA 3GK4X 1MR8A 4MRYA 1DJXA 1S3PA 1G4YR 3CWGA 5F6TA 1SCVA 2VRGA 4NQGA 4MLWA 2LANA 1XK4C 4OVNF 1IJ6A 1XYDA 3PFVA 1DVIA 1N65A 1R6PA 2WORA 3AAKA 1OE9B 1KWOB 3FWCA 1LINA 4C0JA 3VGOA 3BUXB 1YURA 2L4HA 4MBEA 4DIRA 3NSIA 1B8RA 2JT3A 1B7TY 1CM1A 1XA5A 5I2OA 1B7TZ 1L2OC 3GOFA 3SIAA 3TDIA 3PALA 2LVVA 2NZ0A 3I5IC 1S6CA 1BLQA 1LXFC 2KFGA 1XFWO 4XJKA 4MSPA 2GGMA 3BXKA 2HETA 4PE7A 4N1FA 5CSIA 2M97A 2LUXA 2PRUA 3BUNB 1PSBA 3JTDB 1CFCA 1J7OA 1SPYA 1MWNA 4DCKA 3SG4A 1J1EA 1A75B 3BUMB 4QJ3B 2GV5A 4XYNA 2I7AA 1TIZA 1RWYA 5CSNA 2WCBA 2B1UA 2BCXA 2MA2A 1LVCD 2LUCA 1XFUO 5HLOA 2KQ6A 3I5GC 1F8HA 3SG6A 1KCYA 2JT0A 2KAYA 4I5JA 4BY4A 1SCMC 1DMOA 1NWDA 1NCYA 2MAZA 1EL4A 1IQ3A 1NP8A 2NXQA 4CLNA 1QIVA 1KK8B 3F45A 1FBVA 2AMIA 1MXEA 2EGDA 1BODA 1H4BA 1CMFA 5AANA 4OR9B 3WHUB 2KFFA 3BYAA 1QXPA 1ZOTB 2AUCA 5AERA 1SL8A 1M39A 3FIAA 2PMYA 1KK7Y 1QVIY 4F0ZB 5K89A 2KYFA 3D0YA 1GJYA 5DKNA 1SKTA 1KK7Z 1QVIZ 5IBWA 1PK0D 3IQQA 2KYCA 1AP4A 1UWOA 3SIBA 1KFUL 1XFYO 1IQ5A 3EVUA 3KO0A 2LVIA 4AQIA 2L2EA 1DJGA 1SMGA 2M0RA 4YI9A 3SG7A 1VRKA 1Y1UA 4PALA 4GPLB 2KDHA 2LLUA 1LA3A 3WHTB 2K2AA 2M29A 2JTZA 1TNXA 2JULA 5G08A 1FW4A 1XO5A 3TS5C 2KGRA 1B8CA 2F2OA 3AKAA 2JXLA 4YRUA 2QPTA 1K2HA 1F4OA 1K95A 1DF0B 5J3XA 2LC5A 1WY9A 1QS7A 1MQ1A 5HKWA 5BPJA 1SL7A 1AVSA 1IH0A 3EVRA 1B47A 2F3YA 1QX7A 1L2OB 2HQWA 1K94A 3I5FC 2OPOA 3LK1A 5ER4X 3I5IB 1DJYA 1FI6A 1ZFSA 1AHRA 4YGDB 1SL9A 1Y1AA 2COLB 3EK7A 1UHNA 4PE0A 4AOMA 1V1GA 1NPQA 4PHNA 2L50A 1ALVA 4OCIA 1B4CA 2BCBA 2MJWB 1WRLA 4NDDA 4MVFA 3IQOA 4I5NB 1QTXA 1J7RA 1RJVA 2ZN9A 1D1OA 1PSRA 4OKHA 4PCWA 2L0PA 4QJ5B 1DJWA 2H61A 2M7LA 2CNPA 3CR2A 3I5GB 4PHKA 2BBMA 4E68A 2Q4UA 1J55A 1CFPA 2BE4A 1SCMB 2WC8A 1KFXS 2E6WA 2QACA 1BT6A 3BOWA 4A4BA 2RGIA 1M63B 3JVTC 1BR4B 1OMDA 1NX1A 1WLMA 2NCPA 4ETOA 3LLEA 2JT8A 1MHOA 1OZSA 1TCFA 3DF0B 1K9PA 2CT9A 2F33A 1DJIA 1YRUB 1ZUZA 5AFPA 2KHNA 3CZTX 2AAOA 2JU0A 3KPXA 1TN4A 2ZRTA 2EHBA 3KF9A 4BY5A 2OS8C 1S5GY 1WRZA 2O5GA 2PVBA 1DT7B 2Q91A 1SBJA 4JQ0D 1OMRA 1PALA 1S5GZ 2KI6D 3DVKA 4NDCA 2LHLA 1K93D 1YUTA 1IJ5A 3PLFB 2G2BA 2Y5IA 4U8DA 1SNLA 4UPGA 5JJGA 1RROA 4P2YB 4YGCB 3TS5B 2MRDA 2L98A 1BJFA 4MRXA 1BU3A 2KBMA 1M45A 4M2PA 4CIDA 1W7JB 2K2FA 4M2QA 1C7VA 1K9UA 4ORBB 1U5IB 4FTGA 2LVJA 3PATA 1TNPA 2KOTA 2KAXA 1SR6C 3O2PA 4PDZA 1N0YA 3I5FB 2JOJA 2V53A 2WCFA 2KNEA 4CFRA 2A4JA 2G9BA 4C0LA 1AK8A 1CNPA 2LLTA 2L51A 1GQMA 4FQOA 3AKBA 3PM8A 4IL1A 1CFFA 3VRNA 1S26D 1A75A 1BR1B 1CKKA 3NXAA 2H61C 4M2OA 2O60A 4GGFA 2Y1MA 1SY9A 1QV0A 2FOTA 1QATA 1KFUS 1CFDA 5D7FA 4PE1A 1CMGA 1KQMC 4R1EA 1F71A 5HKYA 4TNCA 4WQ2A 1S36A 1EXRA 2KI4C 1OMVA 1DTLA 2LM5A 2LP3A 1J1DA 2E30A 1K8UA 1YRTB 2GGZA 3LK0A 4MZJA 2MLFC 4NDBA 1SK6D 1YVLA 5FYXA 3JVTB 1CDNA 1KSMA 2P6BB 2FJUB 2M7NA 4WRIA 2EC6C 2SASA 1J7PA 2LCPA 2FCEA 1DGVA 3IF7A 3TDUA 2OTGC 2JC2A 3K21A 3BQ3A 1F70A 3EVVA 1F4QA 2JQ6A 3DVJA 2OS8B 2BECA 4ORAB 3OX5A 3EKHA 3FWBA 1XFZO 3D10A 5TNCA 4PHMA 3O6BA 1JUOA 1AJ4A 3O78A 3CR5X 1S6JA 1QLSA 1UHIA 1GGZA 5B8IB 1W7IB 1KSOA 1DF0A 4N5XA 1ALWA 1Y6WA 4GGNA 4HSZA 3EK8A 5KTYA 1CDLA 2LV7A 3SJSA 1J7QA 5GQQC 1CM4A 3ICBA 1HQVA 2M49B 1WLZA 1SRAA 1UP5A 3CLNA 5KSZA 1JF2A 1SR6B 2SCPA 3NSOA 3O4YA 1YX8A 2K0JA 1JSAA 1XFVO 2BL0C 2ISDA 2WOSA 1A2XA 1IGVA 1EJ3A 2ZKMX 4USLA 2M8UA 4GGFC 1PVAA 1X02A 1BMOA 1C7WA 1Q80A 1CDMA 2M1UA 1CLLA 1MF8B 2KI6C 1TOPA 3NSLA 3I5HC 1CLMA 3M0WA 1CTRA 4DUQA 1GGWA 3TUYC 1NIWA 1KQVA 3VRPA 1H8BA 2LMUA 3TDZA 1QLKA 2JNXA 1KQMB 5HKZA 1G8IA 3SG2A 2KQYA 1YUUA 1M31A 1NCZA 3CGAA 1AJ5A 1NX3A 1S6IA 1FPWA 2JRFA 3OP0A 2NCOA 1OOJA 1MUXA 1FF1A 4GUKA 1YR5A 1YX7A 2K7DA 1EG3A 2LMVA 2WCEA 3DF0A 1BF5A 1RECA 5I8NA 4PHJA 2M3WA 1V1FA 2TN4A 3A8RA 2KSPA 2EC6B 3VRRA 2JTTA 3DVEA 5ER5A 2L5XB 1C07A 4CPVA 1DGUA 1NSHA 1R2UA 2JZIA 2OTGB 1QV1A 2ZN8A 1KFXL 4QJ4B 5HLVA 3EKJA 5AEQA 1IWQA 1PULA 2LNKA 4ZCUA 1WDCC 2F3ZA 1PVBA 4DS7A 4CFQA
chains in the Genus database with same CATH superfamily
4XJKB 3OGNA 5CPVA 1K96A 1NUBA 3C1VA 2HF5A 1IG5A 3KHEA 1NX0A 1B1GA 3OX6A 2Y1NA 2Y4QA 2DOQA 2K60A 1ODBA 5DKQA 1A29A 1S1EA 3R1OA 1YTZC 1U5IA 2ZNDA 1BG1A 1A03A 1Z4HA 5DKRA 1NYAA 5D69A 5HL1A 1TRFA 3PJIA 1TCOB 2ZFDA 3H4SE 4AQJA 1JC2A 1EH2A 1JFJA 2HQ8A 3B86A 5PALA 4MEWA 3SG5A 2MHHA 4D1EA 4FQTA 2FCDA 4HRGA 3BUOB 2BL0B 2R2IA 2F2PA 2BCAA 1DELA 1CDPA 4DRWA 2BE6A 2CBLA 5JOLA 1DQEA 3NSKA 2LAPA 1CB1A 2K7CA 3DVMA 1NCXA 5DICA 3PN7C 4I5KA 4GFTA 3D73A 4Q04A 3CABA 1UHKA 3OBVA 3N7HA 2IS9A 1JWDA 2M1KB 1NX2A 1UURA 3D77A 1ZMZA 2JXCA 1RFJA 3I5HB 2QEVA 3OB2B 4OV2A 1TNWA 1Y0VH 4GAOA 2KGBC 3D0YB 3HCMA 1LS8A 2LP2A 3TUYB 5EL2A 5FI6A 2PALA 2K8MB 2KFHA 1UUSA 1ZACA 1FI5A 1OZOA 1YVHA 2D8NA 2PSRA 2BKHB 4WQ2A 3GK2A 5I2QA 2LVKA 2K7BA 2WNDA 1IIOA 1LA0A 3TZ1A 3OB1B 1KWOC 3A4UB 2WC6A 4I5LB 4L9MA 3HX4A 4YI8A 2YGUA 4WQ3A 1RTP1 2JWWA 4MZLA 3BUWB 1M46A 4JD9A 4YGEB 2LLSA 2CXJA 1XK4A 3RM1A 3S0BA 1MXLC 3MSEB 4ICBA 3S0EA 1B9AA 3DD4A 1QX2A 2I18A 4MN0A 2MBXA 2H2KA 1WRKA 1QASA 2CTNA 1DJZA 3CR4X 4GBAA 2BBNA 3ZNIA 3VB1A 1IKUA 2HPSA 5CSJA 2JPTA 3AAJA 2LHIA 2MLEC 3FE9A 2K7OA 3VRQA 1K9KA 1F55A 1WDCB 1A4PA 2JNFA 4JPZB 1B8LA 1XFXO 2ZRSA 1AUIB 1RK9A 3JTDC 3LL8B 3WNXB 3DZTA 3FE8A 3QRXA 1QIWA 2NLNA 2L4IA 2KAVA 4HREE 3SS3A 3SS5A 1SW8A 4C0KA 1HT9A 1YUSA 1W9ZA 2CCMA 1UHHA 4P5OE 1Y1XA 3WXAA 1CLBA 3O4XA 1G33A 1K90D 1OSAA 1QJTA 5I2LA 5KU1A 1JFKA 2PQLA 1N2DA 2QEHA 3EK4A 1OQPA 2K61A 3LCPC 1SYMA 2WC5A 1JF0A 3CZ0A 2I94A 2JPOA 1UHJA 1IRJA 1EG4A 1E8AA 3CTNA 2BKIB 4GNKB 5CSFA 1KK8C 3BOWB 2LMTA 1QX5B 3PSRA 3GK1A 4PE4A 3KEVA 1PRWA 1BOCA 3OHMB 1L7ZA 1XFRA 2M9GA 4N1GA 3E3RA 2KI4B 3PN7B 5HYDA 1F54A 4YBHB 1TNQA 2I2RE 2KBIA 1TTXA 5AXIA 4PT1A 1LKJA 1XVJA 3FS7A 3DY9A 2LE9B 4ORCB 4ZCVA 4MZKA 3RLZA 3SG3A 3CS1A 4YGBB 1DJHA 4JWQA 1JBAA 3VROA 4HRHA 2ZNEA 2F8PA 3ZWHA 2PASA 2L2CA 3GK4X 1MR8A 4MRYA 1DJXA 1S3PA 1G4YR 3CWGA 5F6TA 1SCVA 2VRGA 4NQGA 4MLWA 5FI7A 3DYEA 2LANA 1OOFA 1XK4C 4OVNF 1IJ6A 1XYDA 3PFVA 1DVIA 1N65A 1R6PA 2WORA 3AAKA 1OE9B 1KWOB 3FWCA 1LINA 2ERBA 3BFAA 3VGOA 4C0JA 3BUXB 1YURA 2L4HA 4MBEA 4DIRA 3NSIA 1B8RA 2JT3A 1B7TY 3B87A 1CM1A 1XA5A 1GM0A 5I2OA 1B7TZ 1L2OC 2H8VA 3GOFA 3SIAA 3PALA 3TDIA 2LVVA 3D76A 2NZ0A 3I5IC 1S6CA 1BLQA 1LXFC 2KFGA 1XFWO 4XJKA 4MSPA 2GGMA 3B7AA 3BXKA 2HETA 4PE7A 4N1FA 5CSIA 2M97A 2LUXA 2FJYA 2PRUA 1PSBA 3BUNB 3JTDB 1CFCA 1J7OA 1SPYA 1MWNA 4DCKA 1DEKA 3SG4A 1J1EA 1A75B 2WCKA 3BUMB 4QJ3B 2GV5A 4XYNA 2I7AA 1TIZA 1RWYA 5CSNA 2WCBA 2B1UA 2BCXA 2MA2A 1LVCD 2LUCA 1XFUO 2KPHA 5HLOA 2KQ6A 3I5GC 1F8HA 3SG6A 1KCYA 1ORGA 2JT0A 2KAYA 4I5JA 4INWA 4BY4A 1SCMC 1DMOA 1NWDA 1NCYA 1OOGA 2MAZA 3UNWA 1EL4A 1IQ3A 1NP8A 2NXQA 4CLNA 1QIVA 1KK8B 3F45A 1FBVA 2AMIA 1MXEA 2EGDA 1BODA 1H4BA 1CMFA 5AANA 4OR9B 3WHUB 2KFFA 3BYAA 1QXPA 1ZOTB 2AUCA 5AERA 1SL8A 1M39A 3FIAA 2PMYA 1KK7Y 1QVIY 3CZ2A 4F0ZB 5K89A 1DC1A 2KYFA 4IJ7A 3D0YA 1GJYA 5DKNA 1SKTA 1KK7Z 1QVIZ 5IBWA 1PK0D 3IQQA 2KYCA 1AP4A 1UWOA 3SIBA 1KFUL 1XFYO 1IQ5A 3EVUA 3KO0A 2LVIA 4AQIA 2L2EA 1DJGA 1SMGA 2M0RA 4YI9A 3SG7A 1VRKA 3D75A 1Y1UA 4PALA 4GPLB 2KDHA 2LLUA 1LA3A 2WCJA 3WHTB 2K2AA 2M29A 2JTZA 1TNXA 2JULA 3S0AA 5G08A 1FW4A 1XO5A 3TS5C 2KGRA 1B8CA 3CZ1A 3B88A 2F2OA 3IVTA 3S0GA 3K1EA 3AKAA 2JXLA 4YRUA 2QPTA 1K2HA 1TUJA 1F4OA 1K95A 1DF0B 5J3XA 4YGAA 2LC5A 1WY9A 1QS7A 1MQ1A 5HKWA 5BPJA 1SL7A 1AVSA 1IH0A 3EVRA 1B47A 2F3YA 1QX7A 1L2OB 2HQWA 1K94A 3I5FC 2OPOA 3LK1A 5ER4X 4JKTA 3I5IB 1DJYA 1FI6A 1P28A 1ZFSA 1AHRA 4YGDB 1SL9A 1Y1AA 2COLB 3EK7A 1UHNA 4PE0A 4AOMA 1V1GA 1NPQA 4PHNA 2L50A 1ALVA 4OCIA 1B4CA 2BCBA 2MJWB 1WRLA 4NDDA 1Z2CB 4MVFA 3IQOA 4I5NB 1QTXA 1J7RA 1RJVA 2ZN9A 3UO9A 1D1OA 1PSRA 4OKHA 4PCWA 2KLDA 2L0PA 4QJ5B 1DJWA 2H61A 2PYQA 2M7LA 2CNPA 3CR2A 3I5GB 4PHKA 2BBMA 4E68A 2Q4UA 1J55A 1CFPA 2BE4A 1SCMB 2WC8A 1KFXS 2E6WA 2QACA 1BT6A 3BOWA 4A4BA 3R72A 4F7FA 3CDNA 1SSEB 3R1VA 2RGIA 1M63B 3JVTC 1BR4B 1OMDA 3R1PA 1NX1A 1WLMA 2NCPA 5D3OA 4ETOA 3LLEA 2JT8A 1MHOA 1OZSA 1TCFA 3DF0B 1K9PA 4KYNA 2CT9A 2F33A 1DJIA 3L4AA 1YRUB 1ZUZA 5AFPA 2KHNA 3CZTX 2AAOA 1QWVA 2JU0A 3KPXA 1C3YA 1TN4A 2ZRTA 2BNXA 2EHBA 3KF9A 4BY5A 2OS8C 1S5GY 1WRZA 2O5GA 2PVBA 1DT7B 2Q91A 1SBJA 4JQ0D 1OMRA 1PALA 1S5GZ 2KI6D 3DVKA 3FE6A 4NDCA 2LHLA 3QMEA 1K93D 1YUTA 1IJ5A 3D74A 3CYZA 3PLFB 2G2BA 2Y5IA 4U8DA 1SNLA 4UPGA 5JJGA 1RROA 4P2YB 1TWOA 4YGCB 3BFBA 3TS5B 2MRDA 2L98A 1BJFA 3L4LA 1BU3A 2KBMA 1M45A 4M2PA 4MRXA 4CIDA 1W7JB 2K2FA 4M2QA 1C7VA 1K9UA 4ORBB 1U5IB 4FTGA 5I94A 2LVJA 2WCMA 3PATA 1TNPA 1OW4A 2BAPA 2KOTA 4OZDA 2KAXA 1SR6C 3O2PA 4PDZA 1N0YA 3V2LA 3I5FB 2JOJA 2V53A 2WCFA 2KNEA 4CFRA 2A4JA 2G9BA 4C0LA 1AK8A 1CNPA 2LLTA 2L51A 1GQMA 1C3ZA 3DXLA 2L5YA 4FQOA 3AKBA 3PM8A 4IL1A 1CFFA 3VRNA 1S26D 2GTEA 1A75A 1BR1B 2QEOA 2QDIA 3NXAA 1CKKA 5FI2A 2H61C 4M2OA 2O60A 4GGFA 2Y1MA 1SY9A 1QV0A 2FOTA 1QATA 1KFUS 1CFDA 5D7FA 4PE1A 3PM2A 1CMGA 1KQMC 4R1EA 1F71A 5HKYA 4TNCA 3B6XA 1S36A 1EXRA 2KI4C 1OMVA 1DTLA 2LM5A 2LP3A 1J1DA 2E30A 1K8UA 1YRTB 2GGZA 3LK0A 4MZJA 2MLFC 4NDBA 1SK6D 1YVLA 5FYXA 2WCLA 3JVTB 1CDNA 1KSMA 2P6BB 2FJUB 2M7NA 4WRIA 2EC6C 2SASA 1J7PA 2LCPA 2FCEA 1OOHA 3S0DA 1DGVA 3IF7A 3TDUA 2OTGC 2JC2A 3K21A 3BQ3A 1F70A 3EVVA 1F4QA 2JQ6A 3DVJA 2OS8B 4A4CA 2BECA 4ORAB 3OX5A 3EKHA 3FWBA 1XFZO 3D10A 5TNCA 4PHMA 3NHTA 3O6BA 3RZSA 1JUOA 1AJ4A 3O78A 3CR5X 1S6JA 1QLSA 1UHIA 1GGZA 5B8IB 1W7IB 1KSOA 1DF0A 4N5XA 1ALWA 1Y6WA 4GGNA 1TUZA 4HSZA 3EK8A 5KTYA 1CDLA 2LV7A 3EG5B 3SJSA 1J7QA 5GQQC 2KLEA 1CM4A 3ICBA 1HQVA 2M49B 1WLZA 1SRAA 1UP5A 3CLNA 5KSZA 1JF2A 1SR6B 2SCPA 3NSOA 3O4YA 1YX8A 2K0JA 1JSAA 1XFVO 2BL0C 2ISDA 2WOSA 1A2XA 1IGVA 1EJ3A 2ZKMX 3BJHA 4USLA 3S0FA 2M8UA 3NGVA 1PVAA 4GGFC 2P70A 1X02A 1BMOA 1C7WA 1Q80A 1CDMA 2M1UA 3Q8IA 1CLLA 1MF8B 2KI6C 1TOPA 3NSLA 3D78A 3I5HC 1CLMA 3M0WA 1CTRA 3SS4A 4DUQA 1GGWA 3TUYC 1NIWA 1KQVA 1OOIX 3VRPA 1H8BA 2LMUA 4INXA 3TDZA 1QLKA 2JNXA 1KQMB 5HKZA 1G8IA 3SG2A 2KQYA 1YUUA 1M31A 1NCZA 3CGAA 1AJ5A 1NX3A 3NHIA 1S6IA 1FPWA 2JRFA 3OP0A 2NCOA 1OOJA 1MUXA 2P71A 1FF1A 4GUKA 1YR5A 3BFHA 1YX7A 2K7DA 2WCHA 1EG3A 1T14A 2LMVA 2WCEA 3DF0A 1BF5A 1RECA 5I8NA 4PHJA 2M3WA 1V1FA 2TN4A 3A8RA 2KSPA 2EC6B 3VRRA 2JTTA 3DVEA 5ER5A 2L5XB 1C07A 4CPVA 1DGUA 1NSHA 1R2UA 2JZIA 2OTGB 1QV1A 2ZN8A 1KFXL 4QJ4B 5HLVA 3EKJA 5AEQA 1IWQA 1PULA 2LNKA 4ZCUA 1WDCC 2F3ZA 2QEBA 3L47A 1PVBA 4DS7A 4CFQA
chains in the Genus database with same CATH topology
4XJKB 5CPVA 1K96A 1NUBA 3C1VA 2HF5A 1IG5A 3KHEA 1NX0A 1B1GA 3OX6A 2Y1NA 2Y4QA 2DOQA 1ODBA 5DKQA 1A29A 1S1EA 1YTZC 1U5IA 2ZNDA 1BG1A 1A03A 5DKRA 1NYAA 5D69A 1TRFA 1TCOB 2ZFDA 3H4SE 4AQJA 1JC2A 1EH2A 1JFJA 2HQ8A 5PALA 4MEWA 3SG5A 2MHHA 4D1EA 2FCDA 4HRGA 3BUOB 2BL0B 2R2IA 2F2PA 2BCAA 4DRWA 1CDPA 2BE6A 2CBLA 5JOLA 3NSKA 2LAPA 1CB1A 2K7CA 3DVMA 1NCXA 3PN7C 4I5KA 4GFTA 4Q04A 1UHKA 2IS9A 1JWDA 2M1KB 1NX2A 1UURA 3OB2B 1ZMZA 2JXCA 1RFJA 3I5HB 4OV2A 1TNWA 1Y0VH 4GAOA 2KGBC 3D0YB 3HCMA 2LP2A 3TUYB 2PALA 2K8MB 2KFHA 1UUSA 1ZACA 1FI5A 1OZOA 1YVHA 2D8NA 2PSRA 2BKHB 3GK2A 5I2QA 2LVKA 2K7BA 2WNDA 1LA0A 3TZ1A 3OB1B 1KWOC 3A4UB 4I5LB 4L9MA 3HX4A 4YI8A 4WQ3A 1RTP1 2JWWA 4MZLA 3BUWB 1M46A 4YGEB 2LLSA 2CXJA 1XK4A 3RM1A 1MXLC 3MSEB 4ICBA 1B9AA 3DD4A 1QX2A 2I18A 4MN0A 2MBXA 2H2KA 1WRKA 1QASA 2CTNA 1DJZA 3CR4X 4GBAA 2BBNA 3ZNIA 1IKUA 2HPSA 5CSJA 2JPTA 3AAJA 2LHIA 2MLEC 2K7OA 3VRQA 1K9KA 1F55A 1WDCB 1A4PA 2JNFA 4JPZB 1B8LA 1XFXO 2ZRSA 1AUIB 1RK9A 3JTDC 3LL8B 3WNXB 3QRXA 1QIWA 2NLNA 2L4IA 2KAVA 4HREE 4C0KA 1SW8A 1HT9A 1YUSA 2CCMA 1UHHA 4P5OE 1Y1XA 3WXAA 1CLBA 1G33A 1K90D 1OSAA 1QJTA 5I2LA 5KU1A 1JFKA 3EK4A 1N2DA 4YGAA 4A4CA 1OQPA 2K61A 3LCPC 1SYMA 1JF0A 2I94A 1UHJA 1IRJA 1EG4A 1E8AA 3CTNA 2BKIB 4GNKB 5CSFA 1KK8C 3BOWB 2LMTA 1QX5B 3PSRA 3GK1A 4PE4A 3KEVA 1PRWA 1BOCA 3OHMB 1L7ZA 2M9GA 4N1GA 3E3RA 2KI4B 3PN7B 5HYDA 1F54A 4YBHB 1TNQA 2I2RE 2KBIA 1TTXA 5AXIA 1LKJA 1XVJA 3FS7A 4ORCB 2LE9B 4ZCVA 4MZKA 3RLZA 3SG3A 3CS1A 4YGBB 1DJHA 4JWQA 1JBAA 3VROA 4HRHA 2ZNEA 2F8PA 3ZWHA 2PASA 3GK4X 1MR8A 4MRYA 1DJXA 1S3PA 1G4YR 3CWGA 5F6TA 1SCVA 2VRGA 4NQGA 4MLWA 2LANA 1XK4C 4OVNF 1IJ6A 1XYDA 3PFVA 1DVIA 1N65A 1R6PA 2WORA 3AAKA 1OE9B 1KWOB 3FWCA 1LINA 4C0JA 3VGOA 3BUXB 1YURA 2L4HA 4MBEA 4DIRA 3NSIA 1B8RA 2JT3A 1B7TY 1CM1A 1XA5A 5I2OA 1B7TZ 1L2OC 3GOFA 3SIAA 3TDIA 3PALA 2LVVA 2NZ0A 3I5IC 1S6CA 1BLQA 1LXFC 2KFGA 1XFWO 4XJKA 4MSPA 2GGMA 3BXKA 2HETA 4PE7A 4N1FA 5CSIA 2M97A 2LUXA 2PRUA 3BUNB 1PSBA 3JTDB 1CFCA 1J7OA 1SPYA 1MWNA 4DCKA 3SG4A 1J1EA 1A75B 3BUMB 4QJ3B 2GV5A 4XYNA 2I7AA 1TIZA 1RWYA 5CSNA 2WCBA 2B1UA 2BCXA 2MA2A 1LVCD 2LUCA 1XFUO 5HLOA 2KQ6A 3I5GC 1F8HA 3SG6A 1KCYA 2JT0A 2KAYA 4I5JA 4BY4A 1SCMC 1DMOA 1NWDA 1NCYA 2MAZA 1EL4A 1IQ3A 1NP8A 2NXQA 4CLNA 1QIVA 1KK8B 3F45A 1FBVA 2AMIA 1MXEA 2EGDA 1BODA 1H4BA 1CMFA 5AANA 4OR9B 3WHUB 2KFFA 3BYAA 1QXPA 1ZOTB 2AUCA 5AERA 1SL8A 1M39A 3FIAA 2PMYA 1KK7Y 1QVIY 4F0ZB 5K89A 2KYFA 3D0YA 1GJYA 5DKNA 1SKTA 1KK7Z 1QVIZ 5IBWA 1PK0D 3IQQA 2KYCA 1AP4A 1UWOA 3SIBA 1KFUL 1XFYO 1IQ5A 3EVUA 3KO0A 2LVIA 4AQIA 2L2EA 1DJGA 1SMGA 2M0RA 4YI9A 3SG7A 1VRKA 1Y1UA 4PALA 4GPLB 2KDHA 2LLUA 1LA3A 3WHTB 2K2AA 2M29A 2JTZA 1TNXA 2JULA 5G08A 1FW4A 1XO5A 3TS5C 2KGRA 1B8CA 2F2OA 3AKAA 2JXLA 4YRUA 2QPTA 1K2HA 1F4OA 1K95A 1DF0B 5J3XA 2LC5A 1WY9A 1QS7A 1MQ1A 5HKWA 5BPJA 1SL7A 1AVSA 1IH0A 3EVRA 1B47A 2F3YA 1QX7A 1L2OB 2HQWA 1K94A 3I5FC 2OPOA 3LK1A 5ER4X 3I5IB 1DJYA 1FI6A 1ZFSA 1AHRA 4YGDB 1SL9A 1Y1AA 2COLB 3EK7A 1UHNA 4PE0A 4AOMA 1V1GA 1NPQA 4PHNA 2L50A 1ALVA 4OCIA 1B4CA 2BCBA 2MJWB 1WRLA 4NDDA 4MVFA 3IQOA 4I5NB 1QTXA 1J7RA 1RJVA 2ZN9A 1D1OA 1PSRA 4OKHA 4PCWA 2L0PA 4QJ5B 1DJWA 2H61A 2M7LA 2CNPA 3CR2A 3I5GB 4PHKA 2BBMA 4E68A 2Q4UA 1J55A 1CFPA 2BE4A 1SCMB 2WC8A 1KFXS 2E6WA 2QACA 1BT6A 3BOWA 4A4BA 2RGIA 1M63B 3JVTC 1BR4B 1OMDA 1NX1A 1WLMA 2NCPA 4ETOA 3LLEA 2JT8A 1MHOA 1OZSA 1TCFA 3DF0B 1K9PA 2CT9A 2F33A 1DJIA 1YRUB 1ZUZA 5AFPA 2KHNA 3CZTX 2AAOA 2JU0A 3KPXA 1TN4A 2ZRTA 2EHBA 3KF9A 4BY5A 2OS8C 1S5GY 1WRZA 2O5GA 2PVBA 1DT7B 2Q91A 1SBJA 4JQ0D 1OMRA 1PALA 1S5GZ 2KI6D 3DVKA 4NDCA 2LHLA 1K93D 1YUTA 1IJ5A 3PLFB 2G2BA 2Y5IA 4U8DA 1SNLA 4UPGA 5JJGA 1RROA 4P2YB 4YGCB 3TS5B 2MRDA 2L98A 1BJFA 4MRXA 1BU3A 2KBMA 1M45A 4M2PA 4CIDA 1W7JB 2K2FA 4M2QA 1C7VA 1K9UA 4ORBB 1U5IB 4FTGA 2LVJA 3PATA 1TNPA 2KOTA 2KAXA 1SR6C 3O2PA 4PDZA 1N0YA 3I5FB 2JOJA 2V53A 2WCFA 2KNEA 4CFRA 2A4JA 2G9BA 4C0LA 1AK8A 1CNPA 2LLTA 2L51A 1GQMA 4FQOA 3AKBA 3PM8A 4IL1A 1CFFA 3VRNA 1S26D 1A75A 1BR1B 1CKKA 3NXAA 2H61C 4M2OA 2O60A 4GGFA 2Y1MA 1SY9A 1QV0A 2FOTA 1QATA 1KFUS 1CFDA 5D7FA 4PE1A 1CMGA 1KQMC 4R1EA 1F71A 5HKYA 4TNCA 4WQ2A 1S36A 1EXRA 2KI4C 1OMVA 1DTLA 2LM5A 2LP3A 1J1DA 2E30A 1K8UA 1YRTB 2GGZA 3LK0A 4MZJA 2MLFC 4NDBA 1SK6D 1YVLA 5FYXA 3JVTB 1CDNA 1KSMA 2P6BB 2FJUB 2M7NA 4WRIA 2EC6C 2SASA 1J7PA 2LCPA 2FCEA 1DGVA 3IF7A 3TDUA 2OTGC 2JC2A 3K21A 3BQ3A 1F70A 3EVVA 1F4QA 2JQ6A 3DVJA 2OS8B 2BECA 4ORAB 3OX5A 3EKHA 3FWBA 1XFZO 3D10A 5TNCA 4PHMA 3O6BA 1JUOA 1AJ4A 3O78A 3CR5X 1S6JA 1QLSA 1UHIA 1GGZA 5B8IB 1W7IB 1KSOA 1DF0A 4N5XA 1ALWA 1Y6WA 4GGNA 4HSZA 3EK8A 5KTYA 1CDLA 2LV7A 3SJSA 1J7QA 5GQQC 1CM4A 3ICBA 1HQVA 2M49B 1WLZA 1SRAA 1UP5A 3CLNA 5KSZA 1JF2A 1SR6B 2SCPA 3NSOA 3O4YA 1YX8A 2K0JA 1JSAA 1XFVO 2BL0C 2ISDA 2WOSA 1A2XA 1IGVA 1EJ3A 2ZKMX 4USLA 2M8UA 4GGFC 1PVAA 1X02A 1BMOA 1C7WA 1Q80A 1CDMA 2M1UA 1CLLA 1MF8B 2KI6C 1TOPA 3NSLA 3I5HC 1CLMA 3M0WA 1CTRA 4DUQA 1GGWA 3TUYC 1NIWA 1KQVA 3VRPA 1H8BA 2LMUA 3TDZA 1QLKA 2JNXA 1KQMB 5HKZA 1G8IA 3SG2A 2KQYA 1YUUA 1M31A 1NCZA 3CGAA 1AJ5A 1NX3A 1S6IA 1FPWA 2JRFA 3OP0A 2NCOA 1OOJA 1MUXA 1FF1A 4GUKA 1YR5A 1YX7A 2K7DA 1EG3A 2LMVA 2WCEA 3DF0A 1BF5A 1RECA 5I8NA 4PHJA 2M3WA 1V1FA 2TN4A 3A8RA 2KSPA 2EC6B 3VRRA 2JTTA 3DVEA 5ER5A 2L5XB 1C07A 4CPVA 1DGUA 1NSHA 1R2UA 2JZIA 2OTGB 1QV1A 2ZN8A 1KFXL 4QJ4B 5HLVA 3EKJA 5AEQA 1IWQA 1PULA 2LNKA 4ZCUA 1WDCC 2F3ZA 1PVBA 4DS7A 4CFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJK B;  5CPV A;  1K96 A;  1NUB A;  3C1V A;  2HF5 A;  1IG5 A;  3KHE A;  1NX0 A;  1B1G A;  3OX6 A;  2Y1N A;  2Y4Q A;  2DOQ A;  1ODB A;  5DKQ A;  1A29 A;  1S1E A;  1YTZ C;  1U5I A;  2ZND A;  1BG1 A;  1A03 A;  5DKR A;  1NYA A;  5D69 A;  1TRF A;  1TCO B;  2ZFD A;  3H4S E;  4AQJ A;  1JC2 A;  1EH2 A;  1JFJ A;  2HQ8 A;  5PAL A;  4MEW A;  3SG5 A;  2MHH A;  4D1E A;  2FCD A;  4HRG A;  3BUO B;  2BL0 B;  2R2I A;  2F2P A;  2BCA A;  4DRW A;  1CDP A;  2BE6 A;  2CBL A;  5JOL A;  3NSK A;  2LAP A;  1CB1 A;  2K7C A;  3DVM A;  1NCX A;  3PN7 C;  4I5K A;  4GFT A;  4Q04 A;  1UHK A;  2IS9 A;  1JWD A;  2M1K B;  1NX2 A;  1UUR A;  3OB2 B;  1ZMZ A;  2JXC A;  1RFJ A;  3I5H B;  4OV2 A;  1TNW A;  1Y0V H;  4GAO A;  2KGB C;  3D0Y B;  3HCM A;  2LP2 A;  3TUY B;  2PAL A;  2K8M B;  2KFH A;  1UUS A;  1ZAC A;  1FI5 A;  1OZO A;  1YVH A;  2D8N A;  2PSR A;  2BKH B;  3GK2 A;  5I2Q A;  2LVK A;  2K7B A;  2WND A;  1LA0 A;  3TZ1 A;  3OB1 B;  1KWO C;  3A4U B;  4I5L B;  4L9M A;  3HX4 A;  4YI8 A;  4WQ3 A;  1RTP 1;  2JWW A;  4MZL A;  3BUW B;  1M46 A;  4YGE B;  2LLS A;  2CXJ A;  1XK4 A;  3RM1 A;  1MXL C;  3MSE B;  4ICB A;  1B9A A;  3DD4 A;  1QX2 A;  2I18 A;  4MN0 A;  2MBX A;  2H2K A;  1WRK A;  1QAS A;  2CTN A;  1DJZ A;  3CR4 X;  4GBA A;  2BBN A;  3ZNI A;  1IKU A;  2HPS A;  5CSJ A;  2JPT A;  3AAJ A;  2LHI A;  2MLE C;  2K7O A;  3VRQ A;  1K9K A;  1F55 A;  1WDC B;  1A4P A;  2JNF A;  4JPZ B;  1B8L A;  1XFX O;  2ZRS A;  1AUI B;  1RK9 A;  3JTD C;  3LL8 B;  3WNX B;  3QRX A;  1QIW A;  2NLN A;  2L4I A;  2KAV A;  4HRE E;  4C0K A;  1SW8 A;  1HT9 A;  1YUS A;  2CCM A;  1UHH A;  4P5O E;  1Y1X A;  3WXA A;  1CLB A;  1G33 A;  1K90 D;  1OSA A;  1QJT A;  5I2L A;  5KU1 A;  1JFK A;  3EK4 A;  1N2D A;  4YGA A;  4A4C A;  1OQP A;  2K61 A;  3LCP C;  1SYM A;  1JF0 A;  2I94 A;  1UHJ A;  1IRJ A;  1EG4 A;  1E8A A;  3CTN A;  2BKI B;  4GNK B;  5CSF A;  1KK8 C;  3BOW B;  2LMT A;  1QX5 B;  3PSR A;  3GK1 A;  4PE4 A;  3KEV A;  1PRW A;  1BOC A;  3OHM B;  1L7Z A;  2M9G A;  4N1G A;  3E3R A;  2KI4 B;  3PN7 B;  5HYD A;  1F54 A;  4YBH B;  1TNQ A;  2I2R E;  2KBI A;  1TTX A;  5AXI A;  1LKJ A;  1XVJ A;  3FS7 A;  4ORC B;  2LE9 B;  4ZCV A;  4MZK A;  3RLZ A;  3SG3 A;  3CS1 A;  4YGB B;  1DJH A;  4JWQ A;  1JBA A;  3VRO A;  4HRH A;  2ZNE A;  2F8P A;  3ZWH A;  2PAS A;  3GK4 X;  1MR8 A;  4MRY A;  1DJX A;  1S3P A;  1G4Y R;  3CWG A;  5F6T A;  1SCV A;  2VRG A;  4NQG A;  4MLW A;  2LAN A;  1XK4 C;  4OVN F;  1IJ6 A;  1XYD A;  3PFV A;  1DVI A;  1N65 A;  1R6P A;  2WOR A;  3AAK A;  1OE9 B;  1KWO B;  3FWC A;  1LIN A;  4C0J A;  3VGO A;  3BUX B;  1YUR A;  2L4H A;  4MBE A;  4DIR A;  3NSI A;  1B8R A;  2JT3 A;  1B7T Y;  1CM1 A;  1XA5 A;  5I2O A;  1B7T Z;  1L2O C;  3GOF A;  3SIA A;  3TDI A;  3PAL A;  2LVV A;  2NZ0 A;  3I5I C;  1S6C A;  1BLQ A;  1LXF C;  2KFG A;  1XFW O;  4XJK A;  4MSP A;  2GGM A;  3BXK A;  2HET A;  4PE7 A;  4N1F A;  5CSI A;  2M97 A;  2LUX A;  2PRU A;  3BUN B;  1PSB A;  3JTD B;  1CFC A;  1J7O A;  1SPY A;  1MWN A;  4DCK A;  3SG4 A;  1J1E A;  1A75 B;  3BUM B;  4QJ3 B;  2GV5 A;  4XYN A;  2I7A A;  1TIZ A;  1RWY A;  5CSN A;  2WCB A;  2B1U A;  2BCX A;  2MA2 A;  1LVC D;  2LUC A;  1XFU O;  5HLO A;  2KQ6 A;  3I5G C;  1F8H A;  3SG6 A;  1KCY A;  2JT0 A;  2KAY A;  4I5J A;  4BY4 A;  1SCM C;  1DMO A;  1NWD A;  1NCY A;  2MAZ A;  1EL4 A;  1IQ3 A;  1NP8 A;  2NXQ A;  4CLN A;  1QIV A;  1KK8 B;  3F45 A;  1FBV A;  2AMI A;  1MXE A;  2EGD A;  1BOD A;  1H4B A;  1CMF A;  5AAN A;  4OR9 B;  3WHU B;  2KFF A;  3BYA A;  1QXP A;  1ZOT B;  2AUC A;  5AER A;  1SL8 A;  1M39 A;  3FIA A;  2PMY A;  1KK7 Y;  1QVI Y;  4F0Z B;  5K89 A;  2KYF A;  3D0Y A;  1GJY A;  5DKN A;  1SKT A;  1KK7 Z;  1QVI Z;  5IBW A;  1PK0 D;  3IQQ A;  2KYC A;  1AP4 A;  1UWO A;  3SIB A;  1KFU L;  1XFY O;  1IQ5 A;  3EVU A;  3KO0 A;  2LVI A;  4AQI A;  2L2E A;  1DJG A;  1SMG A;  2M0R A;  4YI9 A;  3SG7 A;  1VRK A;  1Y1U A;  4PAL A;  4GPL B;  2KDH A;  2LLU A;  1LA3 A;  3WHT B;  2K2A A;  2M29 A;  2JTZ A;  1TNX A;  2JUL A;  5G08 A;  1FW4 A;  1XO5 A;  3TS5 C;  2KGR A;  1B8C A;  2F2O A;  3AKA A;  2JXL A;  4YRU A;  2QPT A;  1K2H A;  1F4O A;  1K95 A;  1DF0 B;  5J3X A;  2LC5 A;  1WY9 A;  1QS7 A;  1MQ1 A;  5HKW A;  5BPJ A;  1SL7 A;  1AVS A;  1IH0 A;  3EVR A;  1B47 A;  2F3Y A;  1QX7 A;  1L2O B;  2HQW A;  1K94 A;  3I5F C;  2OPO A;  3LK1 A;  5ER4 X;  3I5I B;  1DJY A;  1FI6 A;  1ZFS A;  1AHR A;  4YGD B;  1SL9 A;  1Y1A A;  2COL B;  3EK7 A;  1UHN A;  4PE0 A;  4AOM A;  1V1G A;  1NPQ A;  4PHN A;  2L50 A;  1ALV A;  4OCI A;  1B4C A;  2BCB A;  2MJW B;  1WRL A;  4NDD A;  4MVF A;  3IQO A;  4I5N B;  1QTX A;  1J7R A;  1RJV A;  2ZN9 A;  1D1O A;  1PSR A;  4OKH A;  4PCW A;  2L0P A;  4QJ5 B;  1DJW A;  2H61 A;  2M7L A;  2CNP A;  3CR2 A;  3I5G B;  4PHK A;  2BBM A;  4E68 A;  2Q4U A;  1J55 A;  1CFP A;  2BE4 A;  1SCM B;  2WC8 A;  1KFX S;  2E6W A;  2QAC A;  1BT6 A;  3BOW A;  4A4B A;  2RGI A;  1M63 B;  3JVT C;  1BR4 B;  1OMD A;  1NX1 A;  1WLM A;  2NCP A;  4ETO A;  3LLE A;  2JT8 A;  1MHO A;  1OZS A;  1TCF A;  3DF0 B;  1K9P A;  2CT9 A;  2F33 A;  1DJI A;  1YRU B;  1ZUZ A;  5AFP A;  2KHN A;  3CZT X;  2AAO A;  2JU0 A;  3KPX A;  1TN4 A;  2ZRT A;  2EHB A;  3KF9 A;  4BY5 A;  2OS8 C;  1S5G Y;  1WRZ A;  2O5G A;  2PVB A;  1DT7 B;  2Q91 A;  1SBJ A;  4JQ0 D;  1OMR A;  1PAL A;  1S5G Z;  2KI6 D;  3DVK A;  4NDC A;  2LHL A;  1K93 D;  1YUT A;  1IJ5 A;  3PLF B;  2G2B A;  2Y5I A;  4U8D A;  1SNL A;  4UPG A;  5JJG A;  1RRO A;  4P2Y B;  4YGC B;  3TS5 B;  2MRD A;  2L98 A;  1BJF A;  4MRX A;  1BU3 A;  2KBM A;  1M45 A;  4M2P A;  4CID A;  1W7J B;  2K2F A;  4M2Q A;  1C7V A;  1K9U A;  4ORB B;  1U5I B;  4FTG A;  2LVJ A;  3PAT A;  1TNP A;  2KOT A;  2KAX A;  1SR6 C;  3O2P A;  4PDZ A;  1N0Y A;  3I5F B;  2JOJ A;  2V53 A;  2WCF A;  2KNE A;  4CFR A;  2A4J A;  2G9B A;  4C0L A;  1AK8 A;  1CNP A;  2LLT A;  2L51 A;  1GQM A;  4FQO A;  3AKB A;  3PM8 A;  4IL1 A;  1CFF A;  3VRN A;  1S26 D;  1A75 A;  1BR1 B;  1CKK A;  3NXA A;  2H61 C;  4M2O A;  2O60 A;  4GGF A;  2Y1M A;  1SY9 A;  1QV0 A;  2FOT A;  1QAT A;  1KFU S;  1CFD A;  5D7F A;  4PE1 A;  1CMG A;  1KQM C;  4R1E A;  1F71 A;  5HKY A;  4TNC A;  4WQ2 A;  1S36 A;  1EXR A;  2KI4 C;  1OMV A;  1DTL A;  2LM5 A;  2LP3 A;  1J1D A;  2E30 A;  1K8U A;  1YRT B;  2GGZ A;  3LK0 A;  4MZJ A;  2MLF C;  4NDB A;  1SK6 D;  1YVL A;  5FYX A;  3JVT B;  1CDN A;  1KSM A;  2P6B B;  2FJU B;  2M7N A;  4WRI A;  2EC6 C;  2SAS A;  1J7P A;  2LCP A;  2FCE A;  1DGV A;  3IF7 A;  3TDU A;  2OTG C;  2JC2 A;  3K21 A;  3BQ3 A;  1F70 A;  3EVV A;  1F4Q A;  2JQ6 A;  3DVJ A;  2OS8 B;  2BEC A;  4ORA B;  3OX5 A;  3EKH A;  3FWB A;  1XFZ O;  3D10 A;  5TNC A;  4PHM A;  3O6B A;  1JUO A;  1AJ4 A;  3O78 A;  3CR5 X;  1S6J A;  1QLS A;  1UHI A;  1GGZ A;  5B8I B;  1W7I B;  1KSO A;  1DF0 A;  4N5X A;  1ALW A;  1Y6W A;  4GGN A;  4HSZ A;  3EK8 A;  5KTY A;  1CDL A;  2LV7 A;  3SJS A;  1J7Q A;  5GQQ C;  1CM4 A;  3ICB A;  1HQV A;  2M49 B;  1WLZ A;  1SRA A;  1UP5 A;  3CLN A;  5KSZ A;  1JF2 A;  1SR6 B;  2SCP A;  3NSO A;  3O4Y A;  1YX8 A;  2K0J A;  1JSA A;  1XFV O;  2BL0 C;  2ISD A;  2WOS A;  1A2X A;  1IGV A;  1EJ3 A;  2ZKM X;  4USL A;  2M8U A;  4GGF C;  1PVA A;  1X02 A;  1BMO A;  1C7W A;  1Q80 A;  1CDM A;  2M1U A;  1CLL A;  1MF8 B;  2KI6 C;  1TOP A;  3NSL A;  3I5H C;  1CLM A;  3M0W A;  1CTR A;  4DUQ A;  1GGW A;  3TUY C;  1NIW A;  1KQV A;  3VRP A;  1H8B A;  2LMU A;  3TDZ A;  1QLK A;  2JNX A;  1KQM B;  5HKZ A;  1G8I A;  3SG2 A;  2KQY A;  1YUU A;  1M31 A;  1NCZ A;  3CGA A;  1AJ5 A;  1NX3 A;  1S6I A;  1FPW A;  2JRF A;  3OP0 A;  2NCO A;  1OOJ A;  1MUX A;  1FF1 A;  4GUK A;  1YR5 A;  1YX7 A;  2K7D A;  1EG3 A;  2LMV A;  2WCE A;  3DF0 A;  1BF5 A;  1REC A;  5I8N A;  4PHJ A;  2M3W A;  1V1F A;  2TN4 A;  3A8R A;  2KSP A;  2EC6 B;  3VRR A;  2JTT A;  3DVE A;  5ER5 A;  2L5X B;  1C07 A;  4CPV A;  1DGU A;  1NSH A;  1R2U A;  2JZI A;  2OTG B;  1QV1 A;  2ZN8 A;  1KFX L;  4QJ4 B;  5HLV A;  3EKJ A;  5AEQ A;  1IWQ A;  1PUL A;  2LNK A;  4ZCU A;  1WDC C;  2F3Z A;  1PVB A;  4DS7 A;  4CFQ A; 
#chains in the Genus database with same CATH topology
 4XJK B;  3OGN A;  5CPV A;  1K96 A;  1NUB A;  3C1V A;  2HF5 A;  1IG5 A;  3KHE A;  1NX0 A;  1B1G A;  3OX6 A;  2Y1N A;  2Y4Q A;  2DOQ A;  2K60 A;  1ODB A;  5DKQ A;  1A29 A;  1S1E A;  3R1O A;  1YTZ C;  1U5I A;  2ZND A;  1BG1 A;  1A03 A;  1Z4H A;  5DKR A;  1NYA A;  5D69 A;  5HL1 A;  1TRF A;  3PJI A;  1TCO B;  2ZFD A;  3H4S E;  4AQJ A;  1JC2 A;  1EH2 A;  1JFJ A;  2HQ8 A;  3B86 A;  5PAL A;  4MEW A;  3SG5 A;  2MHH A;  4D1E A;  4FQT A;  2FCD A;  4HRG A;  3BUO B;  2BL0 B;  2R2I A;  2F2P A;  2BCA A;  1DEL A;  1CDP A;  4DRW A;  2BE6 A;  2CBL A;  5JOL A;  1DQE A;  3NSK A;  2LAP A;  1CB1 A;  2K7C A;  3DVM A;  1NCX A;  5DIC A;  3PN7 C;  4I5K A;  4GFT A;  3D73 A;  4Q04 A;  3CAB A;  1UHK A;  3OBV A;  3N7H A;  2IS9 A;  1JWD A;  2M1K B;  1NX2 A;  1UUR A;  3D77 A;  1ZMZ A;  2JXC A;  1RFJ A;  3I5H B;  2QEV A;  3OB2 B;  4OV2 A;  1TNW A;  1Y0V H;  4GAO A;  2KGB C;  3D0Y B;  3HCM A;  1LS8 A;  2LP2 A;  3TUY B;  5EL2 A;  5FI6 A;  2PAL A;  2K8M B;  2KFH A;  1UUS A;  1ZAC A;  1FI5 A;  1OZO A;  1YVH A;  2D8N A;  2PSR A;  2BKH B;  4WQ2 A;  3GK2 A;  5I2Q A;  2LVK A;  2K7B A;  2WND A;  1IIO A;  1LA0 A;  3TZ1 A;  3OB1 B;  1KWO C;  3A4U B;  2WC6 A;  4I5L B;  4L9M A;  3HX4 A;  4YI8 A;  2YGU A;  4WQ3 A;  1RTP 1;  2JWW A;  4MZL A;  3BUW B;  1M46 A;  4JD9 A;  4YGE B;  2LLS A;  2CXJ A;  1XK4 A;  3RM1 A;  3S0B A;  1MXL C;  3MSE B;  4ICB A;  3S0E A;  1B9A A;  3DD4 A;  1QX2 A;  2I18 A;  4MN0 A;  2MBX A;  2H2K A;  1WRK A;  1QAS A;  2CTN A;  1DJZ A;  3CR4 X;  4GBA A;  2BBN A;  3ZNI A;  3VB1 A;  1IKU A;  2HPS A;  5CSJ A;  2JPT A;  3AAJ A;  2LHI A;  2MLE C;  3FE9 A;  2K7O A;  3VRQ A;  1K9K A;  1F55 A;  1WDC B;  1A4P A;  2JNF A;  4JPZ B;  1B8L A;  1XFX O;  2ZRS A;  1AUI B;  1RK9 A;  3JTD C;  3LL8 B;  3WNX B;  3DZT A;  3FE8 A;  3QRX A;  1QIW A;  2NLN A;  2L4I A;  2KAV A;  4HRE E;  3SS3 A;  3SS5 A;  1SW8 A;  4C0K A;  1HT9 A;  1YUS A;  1W9Z A;  2CCM A;  1UHH A;  4P5O E;  1Y1X A;  3WXA A;  1CLB A;  3O4X A;  1G33 A;  1K90 D;  1OSA A;  1QJT A;  5I2L A;  5KU1 A;  1JFK A;  2PQL A;  1N2D A;  2QEH A;  3EK4 A;  1OQP A;  2K61 A;  3LCP C;  1SYM A;  2WC5 A;  1JF0 A;  3CZ0 A;  2I94 A;  2JPO A;  1UHJ A;  1IRJ A;  1EG4 A;  1E8A A;  3CTN A;  2BKI B;  4GNK B;  5CSF A;  1KK8 C;  3BOW B;  2LMT A;  1QX5 B;  3PSR A;  3GK1 A;  4PE4 A;  3KEV A;  1PRW A;  1BOC A;  3OHM B;  1L7Z A;  1XFR A;  2M9G A;  4N1G A;  3E3R A;  2KI4 B;  3PN7 B;  5HYD A;  1F54 A;  4YBH B;  1TNQ A;  2I2R E;  2KBI A;  1TTX A;  5AXI A;  4PT1 A;  1LKJ A;  1XVJ A;  3FS7 A;  3DY9 A;  2LE9 B;  4ORC B;  4ZCV A;  4MZK A;  3RLZ A;  3SG3 A;  3CS1 A;  4YGB B;  1DJH A;  4JWQ A;  1JBA A;  3VRO A;  4HRH A;  2ZNE A;  2F8P A;  3ZWH A;  2PAS A;  2L2C A;  3GK4 X;  1MR8 A;  4MRY A;  1DJX A;  1S3P A;  1G4Y R;  3CWG A;  5F6T A;  1SCV A;  2VRG A;  4NQG A;  4MLW A;  5FI7 A;  3DYE A;  2LAN A;  1OOF A;  1XK4 C;  4OVN F;  1IJ6 A;  1XYD A;  3PFV A;  1DVI A;  1N65 A;  1R6P A;  2WOR A;  3AAK A;  1OE9 B;  1KWO B;  3FWC A;  1LIN A;  2ERB A;  3BFA A;  3VGO A;  4C0J A;  3BUX B;  1YUR A;  2L4H A;  4MBE A;  4DIR A;  3NSI A;  1B8R A;  2JT3 A;  1B7T Y;  3B87 A;  1CM1 A;  1XA5 A;  1GM0 A;  5I2O A;  1B7T Z;  1L2O C;  2H8V A;  3GOF A;  3SIA A;  3PAL A;  3TDI A;  2LVV A;  3D76 A;  2NZ0 A;  3I5I C;  1S6C A;  1BLQ A;  1LXF C;  2KFG A;  1XFW O;  4XJK A;  4MSP A;  2GGM A;  3B7A A;  3BXK A;  2HET A;  4PE7 A;  4N1F A;  5CSI A;  2M97 A;  2LUX A;  2FJY A;  2PRU A;  1PSB A;  3BUN B;  3JTD B;  1CFC A;  1J7O A;  1SPY A;  1MWN A;  4DCK A;  1DEK A;  3SG4 A;  1J1E A;  1A75 B;  2WCK A;  3BUM B;  4QJ3 B;  2GV5 A;  4XYN A;  2I7A A;  1TIZ A;  1RWY A;  5CSN A;  2WCB A;  2B1U A;  2BCX A;  2MA2 A;  1LVC D;  2LUC A;  1XFU O;  2KPH A;  5HLO A;  2KQ6 A;  3I5G C;  1F8H A;  3SG6 A;  1KCY A;  1ORG A;  2JT0 A;  2KAY A;  4I5J A;  4INW A;  4BY4 A;  1SCM C;  1DMO A;  1NWD A;  1NCY A;  1OOG A;  2MAZ A;  3UNW A;  1EL4 A;  1IQ3 A;  1NP8 A;  2NXQ A;  4CLN A;  1QIV A;  1KK8 B;  3F45 A;  1FBV A;  2AMI A;  1MXE A;  2EGD A;  1BOD A;  1H4B A;  1CMF A;  5AAN A;  4OR9 B;  3WHU B;  2KFF A;  3BYA A;  1QXP A;  1ZOT B;  2AUC A;  5AER A;  1SL8 A;  1M39 A;  3FIA A;  2PMY A;  1KK7 Y;  1QVI Y;  3CZ2 A;  4F0Z B;  5K89 A;  1DC1 A;  2KYF A;  4IJ7 A;  3D0Y A;  1GJY A;  5DKN A;  1SKT A;  1KK7 Z;  1QVI Z;  5IBW A;  1PK0 D;  3IQQ A;  2KYC A;  1AP4 A;  1UWO A;  3SIB A;  1KFU L;  1XFY O;  1IQ5 A;  3EVU A;  3KO0 A;  2LVI A;  4AQI A;  2L2E A;  1DJG A;  1SMG A;  2M0R A;  4YI9 A;  3SG7 A;  1VRK A;  3D75 A;  1Y1U A;  4PAL A;  4GPL B;  2KDH A;  2LLU A;  1LA3 A;  2WCJ A;  3WHT B;  2K2A A;  2M29 A;  2JTZ A;  1TNX A;  2JUL A;  3S0A A;  5G08 A;  1FW4 A;  1XO5 A;  3TS5 C;  2KGR A;  1B8C A;  3CZ1 A;  3B88 A;  2F2O A;  3IVT A;  3S0G A;  3K1E A;  3AKA A;  2JXL A;  4YRU A;  2QPT A;  1K2H A;  1TUJ A;  1F4O A;  1K95 A;  1DF0 B;  5J3X A;  4YGA A;  2LC5 A;  1WY9 A;  1QS7 A;  1MQ1 A;  5HKW A;  5BPJ A;  1SL7 A;  1AVS A;  1IH0 A;  3EVR A;  1B47 A;  2F3Y A;  1QX7 A;  1L2O B;  2HQW A;  1K94 A;  3I5F C;  2OPO A;  3LK1 A;  5ER4 X;  4JKT A;  3I5I B;  1DJY A;  1FI6 A;  1P28 A;  1ZFS A;  1AHR A;  4YGD B;  1SL9 A;  1Y1A A;  2COL B;  3EK7 A;  1UHN A;  4PE0 A;  4AOM A;  1V1G A;  1NPQ A;  4PHN A;  2L50 A;  1ALV A;  4OCI A;  1B4C A;  2BCB A;  2MJW B;  1WRL A;  4NDD A;  1Z2C B;  4MVF A;  3IQO A;  4I5N B;  1QTX A;  1J7R A;  1RJV A;  2ZN9 A;  3UO9 A;  1D1O A;  1PSR A;  4OKH A;  4PCW A;  2KLD A;  2L0P A;  4QJ5 B;  1DJW A;  2H61 A;  2PYQ A;  2M7L A;  2CNP A;  3CR2 A;  3I5G B;  4PHK A;  2BBM A;  4E68 A;  2Q4U A;  1J55 A;  1CFP A;  2BE4 A;  1SCM B;  2WC8 A;  1KFX S;  2E6W A;  2QAC A;  1BT6 A;  3BOW A;  4A4B A;  3R72 A;  4F7F A;  3CDN A;  1SSE B;  3R1V A;  2RGI A;  1M63 B;  3JVT C;  1BR4 B;  1OMD A;  3R1P A;  1NX1 A;  1WLM A;  2NCP A;  5D3O A;  4ETO A;  3LLE A;  2JT8 A;  1MHO A;  1OZS A;  1TCF A;  3DF0 B;  1K9P A;  4KYN A;  2CT9 A;  2F33 A;  1DJI A;  3L4A A;  1YRU B;  1ZUZ A;  5AFP A;  2KHN A;  3CZT X;  2AAO A;  1QWV A;  2JU0 A;  3KPX A;  1C3Y A;  1TN4 A;  2ZRT A;  2BNX A;  2EHB A;  3KF9 A;  4BY5 A;  2OS8 C;  1S5G Y;  1WRZ A;  2O5G A;  2PVB A;  1DT7 B;  2Q91 A;  1SBJ A;  4JQ0 D;  1OMR A;  1PAL A;  1S5G Z;  2KI6 D;  3DVK A;  3FE6 A;  4NDC A;  2LHL A;  3QME A;  1K93 D;  1YUT A;  1IJ5 A;  3D74 A;  3CYZ A;  3PLF B;  2G2B A;  2Y5I A;  4U8D A;  1SNL A;  4UPG A;  5JJG A;  1RRO A;  4P2Y B;  1TWO A;  4YGC B;  3BFB A;  3TS5 B;  2MRD A;  2L98 A;  1BJF A;  3L4L A;  1BU3 A;  2KBM A;  1M45 A;  4M2P A;  4MRX A;  4CID A;  1W7J B;  2K2F A;  4M2Q A;  1C7V A;  1K9U A;  4ORB B;  1U5I B;  4FTG A;  5I94 A;  2LVJ A;  2WCM A;  3PAT A;  1TNP A;  1OW4 A;  2BAP A;  2KOT A;  4OZD A;  2KAX A;  1SR6 C;  3O2P A;  4PDZ A;  1N0Y A;  3V2L A;  3I5F B;  2JOJ A;  2V53 A;  2WCF A;  2KNE A;  4CFR A;  2A4J A;  2G9B A;  4C0L A;  1AK8 A;  1CNP A;  2LLT A;  2L51 A;  1GQM A;  1C3Z A;  3DXL A;  2L5Y A;  4FQO A;  3AKB A;  3PM8 A;  4IL1 A;  1CFF A;  3VRN A;  1S26 D;  2GTE A;  1A75 A;  1BR1 B;  2QEO A;  2QDI A;  3NXA A;  1CKK A;  5FI2 A;  2H61 C;  4M2O A;  2O60 A;  4GGF A;  2Y1M A;  1SY9 A;  1QV0 A;  2FOT A;  1QAT A;  1KFU S;  1CFD A;  5D7F A;  4PE1 A;  3PM2 A;  1CMG A;  1KQM C;  4R1E A;  1F71 A;  5HKY A;  4TNC A;  3B6X A;  1S36 A;  1EXR A;  2KI4 C;  1OMV A;  1DTL A;  2LM5 A;  2LP3 A;  1J1D A;  2E30 A;  1K8U A;  1YRT B;  2GGZ A;  3LK0 A;  4MZJ A;  2MLF C;  4NDB A;  1SK6 D;  1YVL A;  5FYX A;  2WCL A;  3JVT B;  1CDN A;  1KSM A;  2P6B B;  2FJU B;  2M7N A;  4WRI A;  2EC6 C;  2SAS A;  1J7P A;  2LCP A;  2FCE A;  1OOH A;  3S0D A;  1DGV A;  3IF7 A;  3TDU A;  2OTG C;  2JC2 A;  3K21 A;  3BQ3 A;  1F70 A;  3EVV A;  1F4Q A;  2JQ6 A;  3DVJ A;  2OS8 B;  4A4C A;  2BEC A;  4ORA B;  3OX5 A;  3EKH A;  3FWB A;  1XFZ O;  3D10 A;  5TNC A;  4PHM A;  3NHT A;  3O6B A;  3RZS A;  1JUO A;  1AJ4 A;  3O78 A;  3CR5 X;  1S6J A;  1QLS A;  1UHI A;  1GGZ A;  5B8I B;  1W7I B;  1KSO A;  1DF0 A;  4N5X A;  1ALW A;  1Y6W A;  4GGN A;  1TUZ A;  4HSZ A;  3EK8 A;  5KTY A;  1CDL A;  2LV7 A;  3EG5 B;  3SJS A;  1J7Q A;  5GQQ C;  2KLE A;  1CM4 A;  3ICB A;  1HQV A;  2M49 B;  1WLZ A;  1SRA A;  1UP5 A;  3CLN A;  5KSZ A;  1JF2 A;  1SR6 B;  2SCP A;  3NSO A;  3O4Y A;  1YX8 A;  2K0J A;  1JSA A;  1XFV O;  2BL0 C;  2ISD A;  2WOS A;  1A2X A;  1IGV A;  1EJ3 A;  2ZKM X;  3BJH A;  4USL A;  3S0F A;  2M8U A;  3NGV A;  1PVA A;  4GGF C;  2P70 A;  1X02 A;  1BMO A;  1C7W A;  1Q80 A;  1CDM A;  2M1U A;  3Q8I A;  1CLL A;  1MF8 B;  2KI6 C;  1TOP A;  3NSL A;  3D78 A;  3I5H C;  1CLM A;  3M0W A;  1CTR A;  3SS4 A;  4DUQ A;  1GGW A;  3TUY C;  1NIW A;  1KQV A;  1OOI X;  3VRP A;  1H8B A;  2LMU A;  4INX A;  3TDZ A;  1QLK A;  2JNX A;  1KQM B;  5HKZ A;  1G8I A;  3SG2 A;  2KQY A;  1YUU A;  1M31 A;  1NCZ A;  3CGA A;  1AJ5 A;  1NX3 A;  3NHI A;  1S6I A;  1FPW A;  2JRF A;  3OP0 A;  2NCO A;  1OOJ A;  1MUX A;  2P71 A;  1FF1 A;  4GUK A;  1YR5 A;  3BFH A;  1YX7 A;  2K7D A;  2WCH A;  1EG3 A;  1T14 A;  2LMV A;  2WCE A;  3DF0 A;  1BF5 A;  1REC A;  5I8N A;  4PHJ A;  2M3W A;  1V1F A;  2TN4 A;  3A8R A;  2KSP A;  2EC6 B;  3VRR A;  2JTT A;  3DVE A;  5ER5 A;  2L5X B;  1C07 A;  4CPV A;  1DGU A;  1NSH A;  1R2U A;  2JZI A;  2OTG B;  1QV1 A;  2ZN8 A;  1KFX L;  4QJ4 B;  5HLV A;  3EKJ A;  5AEQ A;  1IWQ A;  1PUL A;  2LNK A;  4ZCU A;  1WDC C;  2F3Z A;  2QEB A;  3L47 A;  1PVB A;  4DS7 A;  4CFQ A; 
#chains in the Genus database with same CATH homology
 4XJK B;  5CPV A;  1K96 A;  1NUB A;  3C1V A;  2HF5 A;  1IG5 A;  3KHE A;  1NX0 A;  1B1G A;  3OX6 A;  2Y1N A;  2Y4Q A;  2DOQ A;  1ODB A;  5DKQ A;  1A29 A;  1S1E A;  1YTZ C;  1U5I A;  2ZND A;  1BG1 A;  1A03 A;  5DKR A;  1NYA A;  5D69 A;  1TRF A;  1TCO B;  2ZFD A;  3H4S E;  4AQJ A;  1JC2 A;  1EH2 A;  1JFJ A;  2HQ8 A;  5PAL A;  4MEW A;  3SG5 A;  2MHH A;  4D1E A;  2FCD A;  4HRG A;  3BUO B;  2BL0 B;  2R2I A;  2F2P A;  2BCA A;  4DRW A;  1CDP A;  2BE6 A;  2CBL A;  5JOL A;  3NSK A;  2LAP A;  1CB1 A;  2K7C A;  3DVM A;  1NCX A;  3PN7 C;  4I5K A;  4GFT A;  4Q04 A;  1UHK A;  2IS9 A;  1JWD A;  2M1K B;  1NX2 A;  1UUR A;  3OB2 B;  1ZMZ A;  2JXC A;  1RFJ A;  3I5H B;  4OV2 A;  1TNW A;  1Y0V H;  4GAO A;  2KGB C;  3D0Y B;  3HCM A;  2LP2 A;  3TUY B;  2PAL A;  2K8M B;  2KFH A;  1UUS A;  1ZAC A;  1FI5 A;  1OZO A;  1YVH A;  2D8N A;  2PSR A;  2BKH B;  3GK2 A;  5I2Q A;  2LVK A;  2K7B A;  2WND A;  1LA0 A;  3TZ1 A;  3OB1 B;  1KWO C;  3A4U B;  4I5L B;  4L9M A;  3HX4 A;  4YI8 A;  4WQ3 A;  1RTP 1;  2JWW A;  4MZL A;  3BUW B;  1M46 A;  4YGE B;  2LLS A;  2CXJ A;  1XK4 A;  3RM1 A;  1MXL C;  3MSE B;  4ICB A;  1B9A A;  3DD4 A;  1QX2 A;  2I18 A;  4MN0 A;  2MBX A;  2H2K A;  1WRK A;  1QAS A;  2CTN A;  1DJZ A;  3CR4 X;  4GBA A;  2BBN A;  3ZNI A;  1IKU A;  2HPS A;  5CSJ A;  2JPT A;  3AAJ A;  2LHI A;  2MLE C;  2K7O A;  3VRQ A;  1K9K A;  1F55 A;  1WDC B;  1A4P A;  2JNF A;  4JPZ B;  1B8L A;  1XFX O;  2ZRS A;  1AUI B;  1RK9 A;  3JTD C;  3LL8 B;  3WNX B;  3QRX A;  1QIW A;  2NLN A;  2L4I A;  2KAV A;  4HRE E;  4C0K A;  1SW8 A;  1HT9 A;  1YUS A;  2CCM A;  1UHH A;  4P5O E;  1Y1X A;  3WXA A;  1CLB A;  1G33 A;  1K90 D;  1OSA A;  1QJT A;  5I2L A;  5KU1 A;  1JFK A;  3EK4 A;  1N2D A;  4YGA A;  4A4C A;  1OQP A;  2K61 A;  3LCP C;  1SYM A;  1JF0 A;  2I94 A;  1UHJ A;  1IRJ A;  1EG4 A;  1E8A A;  3CTN A;  2BKI B;  4GNK B;  5CSF A;  1KK8 C;  3BOW B;  2LMT A;  1QX5 B;  3PSR A;  3GK1 A;  4PE4 A;  3KEV A;  1PRW A;  1BOC A;  3OHM B;  1L7Z A;  2M9G A;  4N1G A;  3E3R A;  2KI4 B;  3PN7 B;  5HYD A;  1F54 A;  4YBH B;  1TNQ A;  2I2R E;  2KBI A;  1TTX A;  5AXI A;  1LKJ A;  1XVJ A;  3FS7 A;  4ORC B;  2LE9 B;  4ZCV A;  4MZK A;  3RLZ A;  3SG3 A;  3CS1 A;  4YGB B;  1DJH A;  4JWQ A;  1JBA A;  3VRO A;  4HRH A;  2ZNE A;  2F8P A;  3ZWH A;  2PAS A;  3GK4 X;  1MR8 A;  4MRY A;  1DJX A;  1S3P A;  1G4Y R;  3CWG A;  5F6T A;  1SCV A;  2VRG A;  4NQG A;  4MLW A;  2LAN A;  1XK4 C;  4OVN F;  1IJ6 A;  1XYD A;  3PFV A;  1DVI A;  1N65 A;  1R6P A;  2WOR A;  3AAK A;  1OE9 B;  1KWO B;  3FWC A;  1LIN A;  4C0J A;  3VGO A;  3BUX B;  1YUR A;  2L4H A;  4MBE A;  4DIR A;  3NSI A;  1B8R A;  2JT3 A;  1B7T Y;  1CM1 A;  1XA5 A;  5I2O A;  1B7T Z;  1L2O C;  3GOF A;  3SIA A;  3TDI A;  3PAL A;  2LVV A;  2NZ0 A;  3I5I C;  1S6C A;  1BLQ A;  1LXF C;  2KFG A;  1XFW O;  4XJK A;  4MSP A;  2GGM A;  3BXK A;  2HET A;  4PE7 A;  4N1F A;  5CSI A;  2M97 A;  2LUX A;  2PRU A;  3BUN B;  1PSB A;  3JTD B;  1CFC A;  1J7O A;  1SPY A;  1MWN A;  4DCK A;  3SG4 A;  1J1E A;  1A75 B;  3BUM B;  4QJ3 B;  2GV5 A;  4XYN A;  2I7A A;  1TIZ A;  1RWY A;  5CSN A;  2WCB A;  2B1U A;  2BCX A;  2MA2 A;  1LVC D;  2LUC A;  1XFU O;  5HLO A;  2KQ6 A;  3I5G C;  1F8H A;  3SG6 A;  1KCY A;  2JT0 A;  2KAY A;  4I5J A;  4BY4 A;  1SCM C;  1DMO A;  1NWD A;  1NCY A;  2MAZ A;  1EL4 A;  1IQ3 A;  1NP8 A;  2NXQ A;  4CLN A;  1QIV A;  1KK8 B;  3F45 A;  1FBV A;  2AMI A;  1MXE A;  2EGD A;  1BOD A;  1H4B A;  1CMF A;  5AAN A;  4OR9 B;  3WHU B;  2KFF A;  3BYA A;  1QXP A;  1ZOT B;  2AUC A;  5AER A;  1SL8 A;  1M39 A;  3FIA A;  2PMY A;  1KK7 Y;  1QVI Y;  4F0Z B;  5K89 A;  2KYF A;  3D0Y A;  1GJY A;  5DKN A;  1SKT A;  1KK7 Z;  1QVI Z;  5IBW A;  1PK0 D;  3IQQ A;  2KYC A;  1AP4 A;  1UWO A;  3SIB A;  1KFU L;  1XFY O;  1IQ5 A;  3EVU A;  3KO0 A;  2LVI A;  4AQI A;  2L2E A;  1DJG A;  1SMG A;  2M0R A;  4YI9 A;  3SG7 A;  1VRK A;  1Y1U A;  4PAL A;  4GPL B;  2KDH A;  2LLU A;  1LA3 A;  3WHT B;  2K2A A;  2M29 A;  2JTZ A;  1TNX A;  2JUL A;  5G08 A;  1FW4 A;  1XO5 A;  3TS5 C;  2KGR A;  1B8C A;  2F2O A;  3AKA A;  2JXL A;  4YRU A;  2QPT A;  1K2H A;  1F4O A;  1K95 A;  1DF0 B;  5J3X A;  2LC5 A;  1WY9 A;  1QS7 A;  1MQ1 A;  5HKW A;  5BPJ A;  1SL7 A;  1AVS A;  1IH0 A;  3EVR A;  1B47 A;  2F3Y A;  1QX7 A;  1L2O B;  2HQW A;  1K94 A;  3I5F C;  2OPO A;  3LK1 A;  5ER4 X;  3I5I B;  1DJY A;  1FI6 A;  1ZFS A;  1AHR A;  4YGD B;  1SL9 A;  1Y1A A;  2COL B;  3EK7 A;  1UHN A;  4PE0 A;  4AOM A;  1V1G A;  1NPQ A;  4PHN A;  2L50 A;  1ALV A;  4OCI A;  1B4C A;  2BCB A;  2MJW B;  1WRL A;  4NDD A;  4MVF A;  3IQO A;  4I5N B;  1QTX A;  1J7R A;  1RJV A;  2ZN9 A;  1D1O A;  1PSR A;  4OKH A;  4PCW A;  2L0P A;  4QJ5 B;  1DJW A;  2H61 A;  2M7L A;  2CNP A;  3CR2 A;  3I5G B;  4PHK A;  2BBM A;  4E68 A;  2Q4U A;  1J55 A;  1CFP A;  2BE4 A;  1SCM B;  2WC8 A;  1KFX S;  2E6W A;  2QAC A;  1BT6 A;  3BOW A;  4A4B A;  2RGI A;  1M63 B;  3JVT C;  1BR4 B;  1OMD A;  1NX1 A;  1WLM A;  2NCP A;  4ETO A;  3LLE A;  2JT8 A;  1MHO A;  1OZS A;  1TCF A;  3DF0 B;  1K9P A;  2CT9 A;  2F33 A;  1DJI A;  1YRU B;  1ZUZ A;  5AFP A;  2KHN A;  3CZT X;  2AAO A;  2JU0 A;  3KPX A;  1TN4 A;  2ZRT A;  2EHB A;  3KF9 A;  4BY5 A;  2OS8 C;  1S5G Y;  1WRZ A;  2O5G A;  2PVB A;  1DT7 B;  2Q91 A;  1SBJ A;  4JQ0 D;  1OMR A;  1PAL A;  1S5G Z;  2KI6 D;  3DVK A;  4NDC A;  2LHL A;  1K93 D;  1YUT A;  1IJ5 A;  3PLF B;  2G2B A;  2Y5I A;  4U8D A;  1SNL A;  4UPG A;  5JJG A;  1RRO A;  4P2Y B;  4YGC B;  3TS5 B;  2MRD A;  2L98 A;  1BJF A;  4MRX A;  1BU3 A;  2KBM A;  1M45 A;  4M2P A;  4CID A;  1W7J B;  2K2F A;  4M2Q A;  1C7V A;  1K9U A;  4ORB B;  1U5I B;  4FTG A;  2LVJ A;  3PAT A;  1TNP A;  2KOT A;  2KAX A;  1SR6 C;  3O2P A;  4PDZ A;  1N0Y A;  3I5F B;  2JOJ A;  2V53 A;  2WCF A;  2KNE A;  4CFR A;  2A4J A;  2G9B A;  4C0L A;  1AK8 A;  1CNP A;  2LLT A;  2L51 A;  1GQM A;  4FQO A;  3AKB A;  3PM8 A;  4IL1 A;  1CFF A;  3VRN A;  1S26 D;  1A75 A;  1BR1 B;  1CKK A;  3NXA A;  2H61 C;  4M2O A;  2O60 A;  4GGF A;  2Y1M A;  1SY9 A;  1QV0 A;  2FOT A;  1QAT A;  1KFU S;  1CFD A;  5D7F A;  4PE1 A;  1CMG A;  1KQM C;  4R1E A;  1F71 A;  5HKY A;  4TNC A;  4WQ2 A;  1S36 A;  1EXR A;  2KI4 C;  1OMV A;  1DTL A;  2LM5 A;  2LP3 A;  1J1D A;  2E30 A;  1K8U A;  1YRT B;  2GGZ A;  3LK0 A;  4MZJ A;  2MLF C;  4NDB A;  1SK6 D;  1YVL A;  5FYX A;  3JVT B;  1CDN A;  1KSM A;  2P6B B;  2FJU B;  2M7N A;  4WRI A;  2EC6 C;  2SAS A;  1J7P A;  2LCP A;  2FCE A;  1DGV A;  3IF7 A;  3TDU A;  2OTG C;  2JC2 A;  3K21 A;  3BQ3 A;  1F70 A;  3EVV A;  1F4Q A;  2JQ6 A;  3DVJ A;  2OS8 B;  2BEC A;  4ORA B;  3OX5 A;  3EKH A;  3FWB A;  1XFZ O;  3D10 A;  5TNC A;  4PHM A;  3O6B A;  1JUO A;  1AJ4 A;  3O78 A;  3CR5 X;  1S6J A;  1QLS A;  1UHI A;  1GGZ A;  5B8I B;  1W7I B;  1KSO A;  1DF0 A;  4N5X A;  1ALW A;  1Y6W A;  4GGN A;  4HSZ A;  3EK8 A;  5KTY A;  1CDL A;  2LV7 A;  3SJS A;  1J7Q A;  5GQQ C;  1CM4 A;  3ICB A;  1HQV A;  2M49 B;  1WLZ A;  1SRA A;  1UP5 A;  3CLN A;  5KSZ A;  1JF2 A;  1SR6 B;  2SCP A;  3NSO A;  3O4Y A;  1YX8 A;  2K0J A;  1JSA A;  1XFV O;  2BL0 C;  2ISD A;  2WOS A;  1A2X A;  1IGV A;  1EJ3 A;  2ZKM X;  4USL A;  2M8U A;  4GGF C;  1PVA A;  1X02 A;  1BMO A;  1C7W A;  1Q80 A;  1CDM A;  2M1U A;  1CLL A;  1MF8 B;  2KI6 C;  1TOP A;  3NSL A;  3I5H C;  1CLM A;  3M0W A;  1CTR A;  4DUQ A;  1GGW A;  3TUY C;  1NIW A;  1KQV A;  3VRP A;  1H8B A;  2LMU A;  3TDZ A;  1QLK A;  2JNX A;  1KQM B;  5HKZ A;  1G8I A;  3SG2 A;  2KQY A;  1YUU A;  1M31 A;  1NCZ A;  3CGA A;  1AJ5 A;  1NX3 A;  1S6I A;  1FPW A;  2JRF A;  3OP0 A;  2NCO A;  1OOJ A;  1MUX A;  1FF1 A;  4GUK A;  1YR5 A;  1YX7 A;  2K7D A;  1EG3 A;  2LMV A;  2WCE A;  3DF0 A;  1BF5 A;  1REC A;  5I8N A;  4PHJ A;  2M3W A;  1V1F A;  2TN4 A;  3A8R A;  2KSP A;  2EC6 B;  3VRR A;  2JTT A;  3DVE A;  5ER5 A;  2L5X B;  1C07 A;  4CPV A;  1DGU A;  1NSH A;  1R2U A;  2JZI A;  2OTG B;  1QV1 A;  2ZN8 A;  1KFX L;  4QJ4 B;  5HLV A;  3EKJ A;  5AEQ A;  1IWQ A;  1PUL A;  2LNK A;  4ZCU A;  1WDC C;  2F3Z A;  1PVB A;  4DS7 A;  4CFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...