4YGCB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
64
Chain Sequence
b'MSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 64
sequence length 77
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygcB00
2AUCA 3EK8A 1QX2A 1CFFA 2SASA 1MR8A 1OZOA 1QX5B 2M97A 4AQIA 4GUKA 1QIWA 2PSRA 1CMGA 2JT0A 2BCAA 3TDUA 1K93D 2JTZA 1PRWA 1FW4A 3VRPA 2JNFA 3CTNA 2LLUA 2AAOA 4DUQA 4GFTA 1QV0A 2GGMA 1IG5A 1QATA 2LUCA 2F8PA 1BG1A 2KAXA 1B7TY 1DVIA 5D69A 4I5LB 2KQ6A 4XYNA 2MBXA 4A4CA 1QXPA 1OMRA 1C7VA 1ZFSA 1B1GA 2HQ8A 2EC6B 2JOJA 4NQGA 4F0ZB 2PALA 1Y1AA 3CS1A 2L4HA 1KQMB 2M49B 4D1EA 2H61C 1IJ6A 3O2PA 2LCPA 2QACA 2FOTA 1CTRA 1KFXS 1CM4A 1PALA 4MSPA 1J7RA 4N1FA 1AJ5A 4XJKB 3OB2B 3TUYB 3EKJA 5ER5A 2G2BA 1CB1A 5HYDA 1G8IA 2M0RA 1NX2A 3I5GB 2QPTA 1CFCA 1LA0A 2KGBC 2M29A 1K2HA 2NXQA 1SR6B 2WCBA 1YURA 2NLNA 2BE4A 3O78A 1K96A 4YGDB 4U8DA 2I94A 1K95A 1AP4A 2KFHA 1YVHA 3LCPC 2F2OA 1ZMZA 5D7FA 1KWOB 1S3PA 4PE7A 1PULA 1DF0A 3DF0A 2BKHB 1JSAA 2GGZA 2K7DA 2BBMA 2WORA 4HRHA 4WQ2A 3PN7B 4QJ4B 4NDBA 2JULA 1AJ4A 1OMVA 2F3YA 1E8AA 1S6CA 2KYFA 1QLKA 4I5NB 1WDCB 2KOTA 1J1EA 3TS5C 5K89A 2MJWB 2LANA 3CZTX 1MXEA 1J7PA 1A75A 2KYCA 2BBNA 2EC6C 2L5XB 2WC8A 1N65A 1XK4A 3FWCA 1JF2A 4MLWA 4YGBB 1YVLA 1W7IB 2BCXA 4PE0A 5J3XA 1KQMC 3PALA 4ORBB 1YUSA 5KSZA 3TDIA 1OMDA 3KHEA 2LM5A 2PMYA 2A4JA 2LUXA 4M2OA 3K21A 1RWYA 2K7BA 4DS7A 1UHIA 2B1UA 2ZNDA 3DVJA 2LLSA 3QRXA 4YI8A 2JXCA 2L4IA 1JF0A 4GGNA 1KCYA 2BL0C 1YUTA 4PHNA 1SW8A 3SG6A 2R2IA 4MRXA 1CLBA 1SR6C 3BUOB 1S6IA 2LC5A 2ISDA 3I5IC 2Q4UA 3EVUA 3GK1A 1TOPA 1DJWA 1UURA 1ZOTB 1KFUL 2CXJA 2HF5A 1KK7Z 2MAZA 1OSAA 3ICBA 1S6JA 5CSJA 1EJ3A 3BOWA 5KTYA 3OHMB 1FBVA 1NX0A 4N1GA 1NP8A 1B8LA 4A4BA 1QVIY 2NZ0A 2KHNA 3CR5X 4HREE 4YGEB 5FYXA 5PALA 3ZWHA 1S5GY 3PN7C 2LHLA 2ZRSA 1X02A 1B4CA 3F45A 2LMVA 2OS8B 5HKYA 2JXLA 1IQ5A 2LE9B 5DKQA 4GGFA 1C07A 4MRYA 1R6PA 2LVKA 2JRFA 2O5GA 1SKTA 1G4YR 2HQWA 1BOCA 3SG4A 1ALVA 2H2KA 3AKAA 4MN0A 3SG5A 1G33A 2VRGA 1BMOA 2HETA 2F33A 1F55A 4WQ3A 1DF0B 1F71A 1SRAA 1N0YA 1OZSA 1SL8A 2ZRTA 1OQPA 2JU0A 3DVMA 2ZNEA 1NIWA 3M0WA 3JVTB 5AERA 4JQ0D 1F4QA 1IGVA 1S26D 3OX5A 2MLFC 5F6TA 2IS9A 1B9AA 1TTXA 2JT8A 1DGVA 3PLFB 3TS5B 1NCZA 1Y6WA 1SL9A 2KGRA 4ZCVA 1M39A 1U5IA 1BU3A 1LKJA 2ZN9A 1LINA 4C0JA 1GGWA 1DTLA 1M63B 1KSMA 2KBIA 4QJ5B 1DJHA 3GK4X 2I7AA 2HPSA 2LVVA 2L98A 2PASA 3PFVA 3CR4X 2WCFA 2F2PA 4HRGA 1IJ5A 1EG3A 5CSIA 5HKWA 2MHHA 3SG2A 1A2XA 1KK8B 2Y5IA 1RTP1 1VRKA 1YUUA 3KEVA 1QVIZ 4HSZA 1F8HA 3LK1A 3WHTB 2KBMA 1KFXL 1CLMA 1S5GZ 2BL0B 4MVFA 1FI5A 1B8RA 1IH0A 1TCFA 2FJUB 1GQMA 3D0YB 1SY9A 3I5IB 2OS8C 3WNXB 2LVJA 1R2UA 2JC2A 1FI6A 4OCIA 5HKZA 1LA3A 4JWQA 3AKBA 1SBJA 1YRTB 1NWDA 4Q04A 5I2QA 3HCMA 2COLB 1EH2A 1L2OC 3O4YA 4DCKA 1F54A 2EGDA 1ZUZA 2I2RE 2V53A 1B7TZ 3CWGA 4ORAB 1AK8A 1CMFA 1DT7B 1CDNA 4N5XA 2LHIA 3JVTC 4P5OE 5KU1A 4DRWA 1PVBA 1M46A 4CLNA 2M9GA 3KO0A 1CDLA 1Y1UA 1PSBA 2JTTA 2CBLA 1CDMA 3OP0A 2LVIA 1OE9B 1QS7A 1FPWA 1A4PA 1BR1B 1TCOB 1J1DA 1BR4B 3WHUB 3VRNA 1NYAA 2Q91A 1XK4C 2FCDA 2BE6A 2JWWA 1MF8B 1AVSA 5G08A 1PVAA 1WRZA 1XFWO 2M7LA 4IL1A 5JOLA 1KK8C 2KAVA 2JQ6A 2WNDA 3SG3A 1CKKA 5I8NA 3EVVA 2RGIA 4OV2A 2CNPA 5CSFA 1U5IB 3CR2A 4GBAA 1XFZO 1UHJA 2M8UA 2LNKA 1NX3A 1QASA 3BYAA 1D1OA 1XO5A 3I5FC 1V1FA 4OVNF 2KI6C 4XJKA 3WXAA 1TNQA 5IBWA 2I18A 3VGOA 4C0LA 4OR9B 2CTNA 1BODA 3MSEB 2KSPA 1TRFA 2KQYA 1H8BA 5I2LA 1CLLA 1QIVA 2PVBA 1QV1A 3DVKA 3H4SE 1DJXA 1YX8A 3SIBA 5GQQC 5TNCA 2O60A 1SCMB 3FIAA 1MXLC 2KNEA 3LL8B 3VRRA 1MUXA 1DJZA 2K7OA 2MA2A 2JNXA 1NX1A 4NDCA 4BY4A 3NSKA 2MRDA 2NCPA 1WY9A 3SIAA 1SK6D 3AAKA 3OB1B 2BECA 4GGFC 1UP5A 1JFJA 3D10A 1L2OB 1YR5A 1JBAA 4OKHA 3FS7A 1CFPA 4MBEA 1MHOA 4MEWA 4M2QA 1F4OA 1SPYA 2L51A 3DF0B 3BUWB 1IWQA 4L9MA 1IKUA 5AFPA 2D8NA 1MWNA 5CSNA 5B8IB 1DMOA 1OOJA 2CT9A 2JPTA 3E3RA 2CCMA 1A29A 4DIRA 1YX7A 3JTDB 1KSOA 1QLSA 2LV7A 1S36A 1XFVO 2BCBA 3CGAA 1B8CA 5CPVA 1J7OA 1W7JB 2Y1MA 1RK9A 1A75B 2KAYA 3CLNA 3EKHA 4MZJA 1K94A 1NCYA 4CPVA 4ICBA 2KI6D 1RJVA 2OTGB 1K9PA 2AMIA 5AANA 2OPOA 4R1EA 1BT6A 4PDZA 1C7WA 1PSRA 2WCEA 1EXRA 3FWBA 3PSRA 4CIDA 1J7QA 3LLEA 4CFQA 1GGZA 2K0JA 1KQVA 1K8UA 1ZACA 2SCPA 1A03A 2JZIA 2H61A 4FQOA 4YBHB 3VROA 4M2PA 1H4BA 1DJIA 1SCMC 5AEQA 1RFJA 2M3WA 1WLMA 3O6BA 3I5FB 4PHJA 5DKRA 1XFUO 3BXKA 2NCOA 4AQJA 2F3ZA 1ALWA 1JUOA 1K9KA 4ZCUA 3IQQA 1JFKA 3KF9A 4YGCB 2LLTA 1DJYA 1DJGA 1CDPA 3NSIA 1BJFA 2JT3A 2ZFDA 2M1UA 1LVCD 3GK2A 3TZ1A 2FCEA 1NPQA 3BOWB 1RECA 2LMUA 3NSOA 3SJSA 3HX4A 5AXIA 2P6BB 2G9BA 2L0PA 3BUXB 1HQVA 1HT9A 3AAJA 3TDZA 4C0KA 1IQ3A 1TNXA 3LK0A 3IQOA 1F70A 3I5HB 1CFDA 1V1GA 1DGUA 3JTDC 1Y0VH 2WOSA 4YI9A 1XFYO 4GNKB 5DKNA 3GOFA 1TIZA 5JJGA 1JWDA 4ORCB 3BUNB 4I5JA 4PE1A 1LXFC 2DOQA 1J55A 1NUBA 1KK7Y 4PCWA 4YRUA 2KI4B 1EL4A 2MLEC 1TN4A 3VRQA 1UHHA 1UHKA 5HLOA 4BY5A 3SG7A 3BUMB 2OTGC 5ER4X 3EK4A 2E6WA 2Y1NA 4QJ3B 2KDHA 4PE4A 4UPGA 1ODBA 4P2YB 3EVRA 1K9UA 1SMGA 4WRIA 2M1KB 3C1VA 1BLQA 5HLVA 4NDDA 4ETOA 4GPLB 3NSLA 1L7ZA 2K8MB 4MZLA 2ZN8A 1NSHA 1WLZA 4CFRA 4MZKA 4FTGA 2ZKMX 3BQ3A 1XYDA 1SNLA 2LAPA 2LMTA 1BF5A 2TN4A 1QX7A 1PK0D 1EG4A 1S1EA 1XA5A 3RLZA 5I2OA 1NCXA 2L50A 1JC2A 3KPXA 1MQ1A 3TUYC 2GV5A 1M31A 2K7CA 3D0YA 1FF1A 2K2AA 3EK7A 1SYMA 1CNPA 3I5GC 2LP2A 2EHBA 2KFGA 1KFUS 2E30A 4YGAA 3RM1A 1M45A 3A4UB 4USLA 3PM8A 1K90D 3I5HC 1QJTA 1UHNA 2Y4QA 2LP3A 1YTZC 1IRJA 1YRUB 2M7NA 1GJYA 1TNWA 1TNPA 1WRLA 1N2DA 3DD4A 3NXAA 3OX6A 1KWOC 1QTXA 1UUSA 3IF7A 3PATA 4JPZB 3ZNIA 2K2FA 2L2EA 2KFFA 2PRUA 1Y1XA 1Q80A 1WRKA 4GAOA 3A8RA 1UWOA 4PHMA 2KI4C 5BPJA 1AHRA 1AUIB 1B47A 1XVJA 4AOMA 2K61A 4E68A 1CM1A 1RROA 4I5KA 1SCVA 3DVEA 4PALA 4PHKA 1SL7A 4TNCA 2BKIB 1WDCC 1XFXO
chains in the Genus database with same CATH superfamily
2AUCA 3EK8A 1QX2A 1CFFA 2SASA 1MR8A 1OZOA 1QX5B 2KLDA 2M97A 4IJ7A 4GUKA 1QIWA 2PSRA 4AQIA 2JT0A 1CMGA 2BCAA 3TDUA 1K93D 1W9ZA 2JTZA 1PRWA 3R1VA 1FW4A 3VRPA 2JNFA 3CTNA 2LLUA 2AAOA 4DUQA 4GFTA 1QV0A 3PM2A 2H8VA 2GGMA 1IG5A 1QATA 2LUCA 2F8PA 1BG1A 2KAXA 1B7TY 1DVIA 1OW4A 5D69A 4I5LB 2KQ6A 4XYNA 5D3OA 2QEBA 2MBXA 2PYQA 4A4CA 1QXPA 1OMRA 1C7VA 1ZFSA 1B1GA 2HQ8A 2EC6B 2JOJA 4NQGA 4F0ZB 2PALA 1Y1AA 3CS1A 2L4HA 1KQMB 2M49B 4D1EA 3O4XA 2H61C 2YGUA 1IJ6A 3O2PA 2LCPA 2QACA 2FOTA 1CTRA 1KFXS 4INXA 1CM4A 1PALA 4MSPA 1J7RA 4N1FA 1OOIX 1AJ5A 4XJKB 3OB2B 3TUYB 3EKJA 5ER5A 2G2BA 1CB1A 5HYDA 1G8IA 2M0RA 1NX2A 3I5GB 2QPTA 1CFCA 1LA0A 2KGBC 2M29A 1K2HA 1DEKA 2NXQA 3OBVA 1SR6B 2WCBA 1YURA 2NLNA 2BE4A 4OZDA 3O78A 1K96A 3FE6A 4YGDB 4U8DA 2I94A 1K95A 1AP4A 2KFHA 1YVHA 3LCPC 2F2OA 1ZMZA 5D7FA 1KWOB 1S3PA 4PE7A 1PULA 1DF0A 3DF0A 2BKHB 1JSAA 2GGZA 2K7DA 2BBMA 2WORA 3L4AA 4HRHA 4WQ2A 3PN7B 3S0FA 4QJ4B 4NDBA 2JULA 1AJ4A 3DYEA 1OMVA 2F3YA 1E8AA 1S6CA 2KYFA 1QLKA 4I5NB 1WDCB 2KOTA 1J1EA 3TS5C 5K89A 2MJWB 2LANA 3CZTX 1MXEA 1J7PA 1A75A 2KYCA 2BBNA 2EC6C 2L5XB 2WC8A 1N65A 1XK4A 3FWCA 1JF2A 4MLWA 4YGBB 1YVLA 1W7IB 2BCXA 4PE0A 5J3XA 1KQMC 3PALA 4ORBB 1YUSA 5KSZA 1SSEB 1XFRA 3TDIA 1OMDA 3KHEA 5FI7A 2LM5A 2PMYA 3UO9A 2A4JA 2LUXA 4M2OA 3K21A 1RWYA 2K7BA 1DC1A 4DS7A 1UHIA 2B1UA 2ZNDA 3DVJA 2LLSA 3QRXA 4YI8A 2JXCA 5FI2A 2L4IA 5FI6A 3BFHA 1JF0A 4GGNA 1KCYA 2BL0C 1YUTA 4PHNA 1SW8A 3SG6A 2R2IA 4MRXA 2BAPA 2KPHA 1CLBA 1SR6C 3BUOB 1S6IA 2LC5A 2ISDA 3I5IC 2Q4UA 3EVUA 3GK1A 1TOPA 3VB1A 1DJWA 1UURA 1ZOTB 1KFUL 2CXJA 2HF5A 1KK7Z 1Z4HA 2MAZA 1OSAA 3ICBA 1S6JA 5CSJA 1EJ3A 3BOWA 5KTYA 3OHMB 1FBVA 1NX0A 4N1GA 1NP8A 1B8LA 4A4BA 1QVIY 2NZ0A 2KHNA 3CR5X 4HREE 4YGEB 5FYXA 5PALA 2QEHA 4FQTA 1S5GY 3PN7C 2LHLA 2ZRSA 1X02A 1B4CA 3F45A 2LMVA 2OS8B 5HKYA 2JXLA 1IQ5A 2LE9B 5DKQA 4GGFA 1C07A 4MRYA 1R6PA 3CABA 2LVKA 2JRFA 2O5GA 1SKTA 1G4YR 2HQWA 1BOCA 3SG4A 1ALVA 2H2KA 5HL1A 3AKAA 4MN0A 3SG5A 1ORGA 1G33A 2VRGA 1BMOA 2HETA 2F33A 1F55A 4WQ3A 1DF0B 1F71A 1SRAA 1N0YA 1OZSA 1SL8A 2ZRTA 1OQPA 2JU0A 3DVMA 2ZNEA 1NIWA 3M0WA 3JVTB 5AERA 3FE9A 4JQ0D 1F4QA 1IGVA 1S26D 3OX5A 2MLFC 5F6TA 2IS9A 1B9AA 1TTXA 2JT8A 1DGVA 3PLFB 3TS5B 1NCZA 1Y6WA 1SL9A 2KGRA 4ZCVA 1M39A 1U5IA 1BU3A 1LKJA 2ZN9A 1LINA 4C0JA 1GGWA 1DTLA 1M63B 1KSMA 2KBIA 3N7HA 4INWA 3S0DA 4QJ5B 5I94A 3CZ2A 1DJHA 3GK4X 2I7AA 2HPSA 2LVVA 2L98A 2PASA 3B88A 3PFVA 3CR4X 2WCFA 3DZTA 3SS5A 2F2PA 4HRGA 1IJ5A 1EG3A 5DICA 5CSIA 5HKWA 3D77A 2MHHA 3SG2A 1A2XA 1KK8B 1GM0A 2Y5IA 1RTP1 1VRKA 1YUUA 2PQLA 3KEVA 1IIOA 1QVIZ 4HSZA 1F8HA 3LK1A 3WHTB 2KBMA 1KFXL 1CLMA 1S5GZ 2BL0B 4MVFA 1FI5A 1B8RA 1IH0A 1TCFA 2GTEA 2FJUB 1GQMA 2QEOA 3D0YB 1SY9A 3OGNA 2BNXA 3RZSA 3I5IB 2OS8C 3WNXB 2LVJA 1R2UA 2JC2A 1FI6A 4OCIA 5HKZA 1LA3A 3D78A 4JWQA 1P28A 3AKBA 1SBJA 1OOGA 2ERBA 1YRTB 2QEVA 1NWDA 4Q04A 2FJYA 5I2QA 3HCMA 2COLB 1TUZA 1EH2A 1L2OC 3O4YA 4DCKA 1F54A 2EGDA 1ZUZA 2I2RE 2V53A 1B7TZ 2KLEA 3CWGA 4ORAB 1AK8A 1CMFA 1DT7B 1CDNA 3NGVA 4N5XA 2LHIA 3NXAA 3JVTC 4P5OE 5KU1A 4DRWA 1PVBA 1M46A 4CLNA 2M9GA 3SS4A 3KO0A 1CDLA 3B86A 1Y1UA 1PSBA 2JTTA 2CBLA 1CDMA 3OP0A 2LVIA 1OE9B 1QS7A 1FPWA 3R1PA 1A4PA 1BR1B 1TCOB 1J1DA 1BR4B 3WHUB 3VRNA 1NYAA 2Q91A 1XK4C 2FCDA 2BE6A 2L2CA 2JWWA 3UNWA 1MF8B 1AVSA 5G08A 3L4LA 1PVAA 1WRZA 1XFWO 2M7LA 4IL1A 5JOLA 1KK8C 2KAVA 1OOFA 2JQ6A 2WNDA 3SG3A 1CKKA 5I8NA 3EVVA 2RGIA 4OV2A 2CNPA 1DQEA 5CSFA 1U5IB 3CR2A 4GBAA 1XFZO 1UHJA 2M8UA 2LNKA 1NX3A 1QASA 3BYAA 1D1OA 1XO5A 3I5FC 1V1FA 4OVNF 2KI6C 4XJKA 3WXAA 1TNQA 5IBWA 2I18A 3VGOA 4C0LA 4OR9B 5EL2A 3D73A 2CTNA 1BODA 3MSEB 2KSPA 1TRFA 2KQYA 1H8BA 5I2LA 2WC6A 1CLLA 1QIVA 2PVBA 1QV1A 3DVKA 3H4SE 1DJXA 1YX8A 3SIBA 5GQQC 5TNCA 2O60A 1SCMB 3FIAA 1LS8A 1MXLC 2KNEA 3LL8B 3VRRA 1MUXA 1DJZA 2K7OA 2MA2A 2JNXA 1NX1A 4NDCA 4BY4A 3NSKA 2MRDA 2NCPA 1WY9A 3SIAA 1SK6D 3AAKA 3OB1B 2BECA 4GGFC 1UP5A 1JFJA 3D10A 1L2OB 1YR5A 1JBAA 4OKHA 3FS7A 3IVTA 4MBEA 1MHOA 4MEWA 3S0GA 1CFPA 3S0AA 4M2QA 1F4OA 1SPYA 2L51A 2P70A 2QDIA 3DF0B 3BUWB 1IWQA 4L9MA 1IKUA 5AFPA 2D8NA 1MWNA 5CSNA 3V2LA 5B8IB 1OOJA 2CT9A 1DMOA 2JPTA 3E3RA 2CCMA 2P71A 1A29A 4DIRA 1YX7A 2WCJA 3CDNA 3JTDB 1KSOA 1QLSA 3K1EA 3BJHA 2WCHA 2WCKA 3B7AA 2LV7A 1S36A 1XFVO 2BCBA 3CGAA 1B8CA 5CPVA 1J7OA 1W7JB 2Y1MA 1RK9A 1A75B 2KAYA 3CLNA 3EKHA 4MZJA 1K94A 1NCYA 4CPVA 4ICBA 2KI6D 1RJVA 1TWOA 2OTGB 1K9PA 2AMIA 2WCMA 3NHIA 5AANA 2OPOA 4R1EA 1BT6A 4PDZA 1C7WA 1PSRA 2WCEA 3FE8A 1EXRA 3FWBA 3PSRA 4CIDA 1J7QA 4KYNA 3LLEA 3NHTA 1GGZA 4CFQA 2K0JA 1KQVA 1K8UA 1ZACA 2WC5A 3S0BA 2SCPA 1A03A 2JZIA 2H61A 4FQOA 4YBHB 3VROA 4M2PA 1H4BA 1DJIA 1SCMC 3R72A 1RFJA 5AEQA 2M3WA 3BFAA 1WLMA 3O6BA 3I5FB 4PHJA 5DKRA 1XFUO 3BXKA 2NCOA 3SS3A 4AQJA 2F3ZA 2L5YA 1ALWA 3EG5B 1JUOA 1K9KA 4ZCUA 3IQQA 1JFKA 3BFBA 3KF9A 2WCLA 2LLTA 4YGCB 1DJYA 1DJGA 1CDPA 3NSIA 1BJFA 2JT3A 2ZFDA 2M1UA 1LVCD 3GK2A 3TZ1A 2FCEA 1NPQA 3BOWB 1RECA 1DELA 2LMUA 3NSOA 3SJSA 3HX4A 5AXIA 2P6BB 2G9BA 2L0PA 3BUXB 1HQVA 1HT9A 3AAJA 3TDZA 4C0KA 1IQ3A 1TNXA 3LK0A 3IQOA 1F70A 3I5HB 1CFDA 1V1GA 1DGUA 3JTDC 1Y0VH 2WOSA 4YI9A 1XFYO 4GNKB 5DKNA 3GOFA 1TIZA 5JJGA 4JD9A 4ORCB 1JWDA 3BUNB 3D74A 4I5JA 3DXLA 1LXFC 4PE1A 2DOQA 1J55A 2JPOA 1NUBA 1KK7Y 3D75A 4PCWA 4YRUA 2KI4B 1EL4A 2MLEC 1TN4A 3VRQA 1UHHA 1UHKA 5HLOA 4BY5A 3SG7A 3BUMB 2OTGC 5ER4X 3EK4A 2E6WA 2Y1NA 2K60A 4QJ3B 2KDHA 4PE4A 4UPGA 1ODBA 4P2YB 3EVRA 1K9UA 1SMGA 3Q8IA 2M1KB 4WRIA 3C1VA 3DY9A 3CYZA 1BLQA 1TUJA 5HLVA 4NDDA 4ETOA 4GPLB 3NSLA 1L7ZA 2K8MB 4MZLA 2ZN8A 1C3ZA 1NSHA 1WLZA 4CFRA 4MZKA 4FTGA 2ZKMX 3BQ3A 1XYDA 1SNLA 2LAPA 2LMTA 3R1OA 4F7FA 1BF5A 2TN4A 1QX7A 1PK0D 1EG4A 1S1EA 1XA5A 3PJIA 3RLZA 1C3YA 5I2OA 1NCXA 2L50A 1JC2A 1QWVA 3KPXA 1MQ1A 3L47A 3TUYC 3QMEA 3B87A 2GV5A 1M31A 2K7CA 3CZ1A 3D0YA 2K2AA 1FF1A 3EK7A 1SYMA 1CNPA 3I5GC 1T14A 2LP2A 2EHBA 2KFGA 1KFUS 2E30A 3ZWHA 3D76A 4YGAA 3RM1A 1M45A 3A4UB 4USLA 3PM8A 1K90D 3I5HC 1QJTA 1UHNA 2Y4QA 2LP3A 1YTZC 1IRJA 1YRUB 2M7NA 1GJYA 1TNWA 1OOHA 1TNPA 1N2DA 1WRLA 3CZ0A 3DD4A 1KWOC 1QTXA 1UUSA 3IF7A 3OX6A 3PATA 4JPZB 3ZNIA 3S0EA 2K2FA 2L2EA 2KFFA 2PRUA 1Y1XA 1Q80A 1WRKA 3B6XA 3A8RA 1UWOA 4GAOA 2KI4C 4PHMA 5BPJA 1AHRA 1AUIB 1B47A 4JKTA 4PT1A 1XVJA 4AOMA 2K61A 4E68A 1CM1A 1RROA 4I5KA 1SCVA 3DVEA 4PALA 1Z2CB 4PHKA 1SL7A 4TNCA 2BKIB 1WDCC 1XFXO
chains in the Genus database with same CATH topology
2AUCA 3EK8A 1QX2A 1CFFA 2SASA 1MR8A 1OZOA 1QX5B 2M97A 4AQIA 4GUKA 1QIWA 2PSRA 1CMGA 2JT0A 2BCAA 3TDUA 1K93D 2JTZA 1PRWA 1FW4A 3VRPA 2JNFA 3CTNA 2LLUA 2AAOA 4DUQA 4GFTA 1QV0A 2GGMA 1IG5A 1QATA 2LUCA 2F8PA 1BG1A 2KAXA 1B7TY 1DVIA 5D69A 4I5LB 2KQ6A 4XYNA 2MBXA 4A4CA 1QXPA 1OMRA 1C7VA 1ZFSA 1B1GA 2HQ8A 2EC6B 2JOJA 4NQGA 4F0ZB 2PALA 1Y1AA 3CS1A 2L4HA 1KQMB 2M49B 4D1EA 2H61C 1IJ6A 3O2PA 2LCPA 2QACA 2FOTA 1CTRA 1KFXS 1CM4A 1PALA 4MSPA 1J7RA 4N1FA 1AJ5A 4XJKB 3OB2B 3TUYB 3EKJA 5ER5A 2G2BA 1CB1A 5HYDA 1G8IA 2M0RA 1NX2A 3I5GB 2QPTA 1CFCA 1LA0A 2KGBC 2M29A 1K2HA 2NXQA 1SR6B 2WCBA 1YURA 2NLNA 2BE4A 3O78A 1K96A 4YGDB 4U8DA 2I94A 1K95A 1AP4A 2KFHA 1YVHA 3LCPC 2F2OA 1ZMZA 5D7FA 1KWOB 1S3PA 4PE7A 1PULA 1DF0A 3DF0A 2BKHB 1JSAA 2GGZA 2K7DA 2BBMA 2WORA 4HRHA 4WQ2A 3PN7B 4QJ4B 4NDBA 2JULA 1AJ4A 1OMVA 2F3YA 1E8AA 1S6CA 2KYFA 1QLKA 4I5NB 1WDCB 2KOTA 1J1EA 3TS5C 5K89A 2MJWB 2LANA 3CZTX 1MXEA 1J7PA 1A75A 2KYCA 2BBNA 2EC6C 2L5XB 2WC8A 1N65A 1XK4A 3FWCA 1JF2A 4MLWA 4YGBB 1YVLA 1W7IB 2BCXA 4PE0A 5J3XA 1KQMC 3PALA 4ORBB 1YUSA 5KSZA 3TDIA 1OMDA 3KHEA 2LM5A 2PMYA 2A4JA 2LUXA 4M2OA 3K21A 1RWYA 2K7BA 4DS7A 1UHIA 2B1UA 2ZNDA 3DVJA 2LLSA 3QRXA 4YI8A 2JXCA 2L4IA 1JF0A 4GGNA 1KCYA 2BL0C 1YUTA 4PHNA 1SW8A 3SG6A 2R2IA 4MRXA 1CLBA 1SR6C 3BUOB 1S6IA 2LC5A 2ISDA 3I5IC 2Q4UA 3EVUA 3GK1A 1TOPA 1DJWA 1UURA 1ZOTB 1KFUL 2CXJA 2HF5A 1KK7Z 2MAZA 1OSAA 3ICBA 1S6JA 5CSJA 1EJ3A 3BOWA 5KTYA 3OHMB 1FBVA 1NX0A 4N1GA 1NP8A 1B8LA 4A4BA 1QVIY 2NZ0A 2KHNA 3CR5X 4HREE 4YGEB 5FYXA 5PALA 3ZWHA 1S5GY 3PN7C 2LHLA 2ZRSA 1X02A 1B4CA 3F45A 2LMVA 2OS8B 5HKYA 2JXLA 1IQ5A 2LE9B 5DKQA 4GGFA 1C07A 4MRYA 1R6PA 2LVKA 2JRFA 2O5GA 1SKTA 1G4YR 2HQWA 1BOCA 3SG4A 1ALVA 2H2KA 3AKAA 4MN0A 3SG5A 1G33A 2VRGA 1BMOA 2HETA 2F33A 1F55A 4WQ3A 1DF0B 1F71A 1SRAA 1N0YA 1OZSA 1SL8A 2ZRTA 1OQPA 2JU0A 3DVMA 2ZNEA 1NIWA 3M0WA 3JVTB 5AERA 4JQ0D 1F4QA 1IGVA 1S26D 3OX5A 2MLFC 5F6TA 2IS9A 1B9AA 1TTXA 2JT8A 1DGVA 3PLFB 3TS5B 1NCZA 1Y6WA 1SL9A 2KGRA 4ZCVA 1M39A 1U5IA 1BU3A 1LKJA 2ZN9A 1LINA 4C0JA 1GGWA 1DTLA 1M63B 1KSMA 2KBIA 4QJ5B 1DJHA 3GK4X 2I7AA 2HPSA 2LVVA 2L98A 2PASA 3PFVA 3CR4X 2WCFA 2F2PA 4HRGA 1IJ5A 1EG3A 5CSIA 5HKWA 2MHHA 3SG2A 1A2XA 1KK8B 2Y5IA 1RTP1 1VRKA 1YUUA 3KEVA 1QVIZ 4HSZA 1F8HA 3LK1A 3WHTB 2KBMA 1KFXL 1CLMA 1S5GZ 2BL0B 4MVFA 1FI5A 1B8RA 1IH0A 1TCFA 2FJUB 1GQMA 3D0YB 1SY9A 3I5IB 2OS8C 3WNXB 2LVJA 1R2UA 2JC2A 1FI6A 4OCIA 5HKZA 1LA3A 4JWQA 3AKBA 1SBJA 1YRTB 1NWDA 4Q04A 5I2QA 3HCMA 2COLB 1EH2A 1L2OC 3O4YA 4DCKA 1F54A 2EGDA 1ZUZA 2I2RE 2V53A 1B7TZ 3CWGA 4ORAB 1AK8A 1CMFA 1DT7B 1CDNA 4N5XA 2LHIA 3JVTC 4P5OE 5KU1A 4DRWA 1PVBA 1M46A 4CLNA 2M9GA 3KO0A 1CDLA 1Y1UA 1PSBA 2JTTA 2CBLA 1CDMA 3OP0A 2LVIA 1OE9B 1QS7A 1FPWA 1A4PA 1BR1B 1TCOB 1J1DA 1BR4B 3WHUB 3VRNA 1NYAA 2Q91A 1XK4C 2FCDA 2BE6A 2JWWA 1MF8B 1AVSA 5G08A 1PVAA 1WRZA 1XFWO 2M7LA 4IL1A 5JOLA 1KK8C 2KAVA 2JQ6A 2WNDA 3SG3A 1CKKA 5I8NA 3EVVA 2RGIA 4OV2A 2CNPA 5CSFA 1U5IB 3CR2A 4GBAA 1XFZO 1UHJA 2M8UA 2LNKA 1NX3A 1QASA 3BYAA 1D1OA 1XO5A 3I5FC 1V1FA 4OVNF 2KI6C 4XJKA 3WXAA 1TNQA 5IBWA 2I18A 3VGOA 4C0LA 4OR9B 2CTNA 1BODA 3MSEB 2KSPA 1TRFA 2KQYA 1H8BA 5I2LA 1CLLA 1QIVA 2PVBA 1QV1A 3DVKA 3H4SE 1DJXA 1YX8A 3SIBA 5GQQC 5TNCA 2O60A 1SCMB 3FIAA 1MXLC 2KNEA 3LL8B 3VRRA 1MUXA 1DJZA 2K7OA 2MA2A 2JNXA 1NX1A 4NDCA 4BY4A 3NSKA 2MRDA 2NCPA 1WY9A 3SIAA 1SK6D 3AAKA 3OB1B 2BECA 4GGFC 1UP5A 1JFJA 3D10A 1L2OB 1YR5A 1JBAA 4OKHA 3FS7A 1CFPA 4MBEA 1MHOA 4MEWA 4M2QA 1F4OA 1SPYA 2L51A 3DF0B 3BUWB 1IWQA 4L9MA 1IKUA 5AFPA 2D8NA 1MWNA 5CSNA 5B8IB 1DMOA 1OOJA 2CT9A 2JPTA 3E3RA 2CCMA 1A29A 4DIRA 1YX7A 3JTDB 1KSOA 1QLSA 2LV7A 1S36A 1XFVO 2BCBA 3CGAA 1B8CA 5CPVA 1J7OA 1W7JB 2Y1MA 1RK9A 1A75B 2KAYA 3CLNA 3EKHA 4MZJA 1K94A 1NCYA 4CPVA 4ICBA 2KI6D 1RJVA 2OTGB 1K9PA 2AMIA 5AANA 2OPOA 4R1EA 1BT6A 4PDZA 1C7WA 1PSRA 2WCEA 1EXRA 3FWBA 3PSRA 4CIDA 1J7QA 3LLEA 4CFQA 1GGZA 2K0JA 1KQVA 1K8UA 1ZACA 2SCPA 1A03A 2JZIA 2H61A 4FQOA 4YBHB 3VROA 4M2PA 1H4BA 1DJIA 1SCMC 5AEQA 1RFJA 2M3WA 1WLMA 3O6BA 3I5FB 4PHJA 5DKRA 1XFUO 3BXKA 2NCOA 4AQJA 2F3ZA 1ALWA 1JUOA 1K9KA 4ZCUA 3IQQA 1JFKA 3KF9A 4YGCB 2LLTA 1DJYA 1DJGA 1CDPA 3NSIA 1BJFA 2JT3A 2ZFDA 2M1UA 1LVCD 3GK2A 3TZ1A 2FCEA 1NPQA 3BOWB 1RECA 2LMUA 3NSOA 3SJSA 3HX4A 5AXIA 2P6BB 2G9BA 2L0PA 3BUXB 1HQVA 1HT9A 3AAJA 3TDZA 4C0KA 1IQ3A 1TNXA 3LK0A 3IQOA 1F70A 3I5HB 1CFDA 1V1GA 1DGUA 3JTDC 1Y0VH 2WOSA 4YI9A 1XFYO 4GNKB 5DKNA 3GOFA 1TIZA 5JJGA 1JWDA 4ORCB 3BUNB 4I5JA 4PE1A 1LXFC 2DOQA 1J55A 1NUBA 1KK7Y 4PCWA 4YRUA 2KI4B 1EL4A 2MLEC 1TN4A 3VRQA 1UHHA 1UHKA 5HLOA 4BY5A 3SG7A 3BUMB 2OTGC 5ER4X 3EK4A 2E6WA 2Y1NA 4QJ3B 2KDHA 4PE4A 4UPGA 1ODBA 4P2YB 3EVRA 1K9UA 1SMGA 4WRIA 2M1KB 3C1VA 1BLQA 5HLVA 4NDDA 4ETOA 4GPLB 3NSLA 1L7ZA 2K8MB 4MZLA 2ZN8A 1NSHA 1WLZA 4CFRA 4MZKA 4FTGA 2ZKMX 3BQ3A 1XYDA 1SNLA 2LAPA 2LMTA 1BF5A 2TN4A 1QX7A 1PK0D 1EG4A 1S1EA 1XA5A 3RLZA 5I2OA 1NCXA 2L50A 1JC2A 3KPXA 1MQ1A 3TUYC 2GV5A 1M31A 2K7CA 3D0YA 1FF1A 2K2AA 3EK7A 1SYMA 1CNPA 3I5GC 2LP2A 2EHBA 2KFGA 1KFUS 2E30A 4YGAA 3RM1A 1M45A 3A4UB 4USLA 3PM8A 1K90D 3I5HC 1QJTA 1UHNA 2Y4QA 2LP3A 1YTZC 1IRJA 1YRUB 2M7NA 1GJYA 1TNWA 1TNPA 1WRLA 1N2DA 3DD4A 3NXAA 3OX6A 1KWOC 1QTXA 1UUSA 3IF7A 3PATA 4JPZB 3ZNIA 2K2FA 2L2EA 2KFFA 2PRUA 1Y1XA 1Q80A 1WRKA 4GAOA 3A8RA 1UWOA 4PHMA 2KI4C 5BPJA 1AHRA 1AUIB 1B47A 1XVJA 4AOMA 2K61A 4E68A 1CM1A 1RROA 4I5KA 1SCVA 3DVEA 4PALA 4PHKA 1SL7A 4TNCA 2BKIB 1WDCC 1XFXO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUC A;  3EK8 A;  1QX2 A;  1CFF A;  2SAS A;  1MR8 A;  1OZO A;  1QX5 B;  2M97 A;  4AQI A;  4GUK A;  1QIW A;  2PSR A;  1CMG A;  2JT0 A;  2BCA A;  3TDU A;  1K93 D;  2JTZ A;  1PRW A;  1FW4 A;  3VRP A;  2JNF A;  3CTN A;  2LLU A;  2AAO A;  4DUQ A;  4GFT A;  1QV0 A;  2GGM A;  1IG5 A;  1QAT A;  2LUC A;  2F8P A;  1BG1 A;  2KAX A;  1B7T Y;  1DVI A;  5D69 A;  4I5L B;  2KQ6 A;  4XYN A;  2MBX A;  4A4C A;  1QXP A;  1OMR A;  1C7V A;  1ZFS A;  1B1G A;  2HQ8 A;  2EC6 B;  2JOJ A;  4NQG A;  4F0Z B;  2PAL A;  1Y1A A;  3CS1 A;  2L4H A;  1KQM B;  2M49 B;  4D1E A;  2H61 C;  1IJ6 A;  3O2P A;  2LCP A;  2QAC A;  2FOT A;  1CTR A;  1KFX S;  1CM4 A;  1PAL A;  4MSP A;  1J7R A;  4N1F A;  1AJ5 A;  4XJK B;  3OB2 B;  3TUY B;  3EKJ A;  5ER5 A;  2G2B A;  1CB1 A;  5HYD A;  1G8I A;  2M0R A;  1NX2 A;  3I5G B;  2QPT A;  1CFC A;  1LA0 A;  2KGB C;  2M29 A;  1K2H A;  2NXQ A;  1SR6 B;  2WCB A;  1YUR A;  2NLN A;  2BE4 A;  3O78 A;  1K96 A;  4YGD B;  4U8D A;  2I94 A;  1K95 A;  1AP4 A;  2KFH A;  1YVH A;  3LCP C;  2F2O A;  1ZMZ A;  5D7F A;  1KWO B;  1S3P A;  4PE7 A;  1PUL A;  1DF0 A;  3DF0 A;  2BKH B;  1JSA A;  2GGZ A;  2K7D A;  2BBM A;  2WOR A;  4HRH A;  4WQ2 A;  3PN7 B;  4QJ4 B;  4NDB A;  2JUL A;  1AJ4 A;  1OMV A;  2F3Y A;  1E8A A;  1S6C A;  2KYF A;  1QLK A;  4I5N B;  1WDC B;  2KOT A;  1J1E A;  3TS5 C;  5K89 A;  2MJW B;  2LAN A;  3CZT X;  1MXE A;  1J7P A;  1A75 A;  2KYC A;  2BBN A;  2EC6 C;  2L5X B;  2WC8 A;  1N65 A;  1XK4 A;  3FWC A;  1JF2 A;  4MLW A;  4YGB B;  1YVL A;  1W7I B;  2BCX A;  4PE0 A;  5J3X A;  1KQM C;  3PAL A;  4ORB B;  1YUS A;  5KSZ A;  3TDI A;  1OMD A;  3KHE A;  2LM5 A;  2PMY A;  2A4J A;  2LUX A;  4M2O A;  3K21 A;  1RWY A;  2K7B A;  4DS7 A;  1UHI A;  2B1U A;  2ZND A;  3DVJ A;  2LLS A;  3QRX A;  4YI8 A;  2JXC A;  2L4I A;  1JF0 A;  4GGN A;  1KCY A;  2BL0 C;  1YUT A;  4PHN A;  1SW8 A;  3SG6 A;  2R2I A;  4MRX A;  1CLB A;  1SR6 C;  3BUO B;  1S6I A;  2LC5 A;  2ISD A;  3I5I C;  2Q4U A;  3EVU A;  3GK1 A;  1TOP A;  1DJW A;  1UUR A;  1ZOT B;  1KFU L;  2CXJ A;  2HF5 A;  1KK7 Z;  2MAZ A;  1OSA A;  3ICB A;  1S6J A;  5CSJ A;  1EJ3 A;  3BOW A;  5KTY A;  3OHM B;  1FBV A;  1NX0 A;  4N1G A;  1NP8 A;  1B8L A;  4A4B A;  1QVI Y;  2NZ0 A;  2KHN A;  3CR5 X;  4HRE E;  4YGE B;  5FYX A;  5PAL A;  3ZWH A;  1S5G Y;  3PN7 C;  2LHL A;  2ZRS A;  1X02 A;  1B4C A;  3F45 A;  2LMV A;  2OS8 B;  5HKY A;  2JXL A;  1IQ5 A;  2LE9 B;  5DKQ A;  4GGF A;  1C07 A;  4MRY A;  1R6P A;  2LVK A;  2JRF A;  2O5G A;  1SKT A;  1G4Y R;  2HQW A;  1BOC A;  3SG4 A;  1ALV A;  2H2K A;  3AKA A;  4MN0 A;  3SG5 A;  1G33 A;  2VRG A;  1BMO A;  2HET A;  2F33 A;  1F55 A;  4WQ3 A;  1DF0 B;  1F71 A;  1SRA A;  1N0Y A;  1OZS A;  1SL8 A;  2ZRT A;  1OQP A;  2JU0 A;  3DVM A;  2ZNE A;  1NIW A;  3M0W A;  3JVT B;  5AER A;  4JQ0 D;  1F4Q A;  1IGV A;  1S26 D;  3OX5 A;  2MLF C;  5F6T A;  2IS9 A;  1B9A A;  1TTX A;  2JT8 A;  1DGV A;  3PLF B;  3TS5 B;  1NCZ A;  1Y6W A;  1SL9 A;  2KGR A;  4ZCV A;  1M39 A;  1U5I A;  1BU3 A;  1LKJ A;  2ZN9 A;  1LIN A;  4C0J A;  1GGW A;  1DTL A;  1M63 B;  1KSM A;  2KBI A;  4QJ5 B;  1DJH A;  3GK4 X;  2I7A A;  2HPS A;  2LVV A;  2L98 A;  2PAS A;  3PFV A;  3CR4 X;  2WCF A;  2F2P A;  4HRG A;  1IJ5 A;  1EG3 A;  5CSI A;  5HKW A;  2MHH A;  3SG2 A;  1A2X A;  1KK8 B;  2Y5I A;  1RTP 1;  1VRK A;  1YUU A;  3KEV A;  1QVI Z;  4HSZ A;  1F8H A;  3LK1 A;  3WHT B;  2KBM A;  1KFX L;  1CLM A;  1S5G Z;  2BL0 B;  4MVF A;  1FI5 A;  1B8R A;  1IH0 A;  1TCF A;  2FJU B;  1GQM A;  3D0Y B;  1SY9 A;  3I5I B;  2OS8 C;  3WNX B;  2LVJ A;  1R2U A;  2JC2 A;  1FI6 A;  4OCI A;  5HKZ A;  1LA3 A;  4JWQ A;  3AKB A;  1SBJ A;  1YRT B;  1NWD A;  4Q04 A;  5I2Q A;  3HCM A;  2COL B;  1EH2 A;  1L2O C;  3O4Y A;  4DCK A;  1F54 A;  2EGD A;  1ZUZ A;  2I2R E;  2V53 A;  1B7T Z;  3CWG A;  4ORA B;  1AK8 A;  1CMF A;  1DT7 B;  1CDN A;  4N5X A;  2LHI A;  3JVT C;  4P5O E;  5KU1 A;  4DRW A;  1PVB A;  1M46 A;  4CLN A;  2M9G A;  3KO0 A;  1CDL A;  1Y1U A;  1PSB A;  2JTT A;  2CBL A;  1CDM A;  3OP0 A;  2LVI A;  1OE9 B;  1QS7 A;  1FPW A;  1A4P A;  1BR1 B;  1TCO B;  1J1D A;  1BR4 B;  3WHU B;  3VRN A;  1NYA A;  2Q91 A;  1XK4 C;  2FCD A;  2BE6 A;  2JWW A;  1MF8 B;  1AVS A;  5G08 A;  1PVA A;  1WRZ A;  1XFW O;  2M7L A;  4IL1 A;  5JOL A;  1KK8 C;  2KAV A;  2JQ6 A;  2WND A;  3SG3 A;  1CKK A;  5I8N A;  3EVV A;  2RGI A;  4OV2 A;  2CNP A;  5CSF A;  1U5I B;  3CR2 A;  4GBA A;  1XFZ O;  1UHJ A;  2M8U A;  2LNK A;  1NX3 A;  1QAS A;  3BYA A;  1D1O A;  1XO5 A;  3I5F C;  1V1F A;  4OVN F;  2KI6 C;  4XJK A;  3WXA A;  1TNQ A;  5IBW A;  2I18 A;  3VGO A;  4C0L A;  4OR9 B;  2CTN A;  1BOD A;  3MSE B;  2KSP A;  1TRF A;  2KQY A;  1H8B A;  5I2L A;  1CLL A;  1QIV A;  2PVB A;  1QV1 A;  3DVK A;  3H4S E;  1DJX A;  1YX8 A;  3SIB A;  5GQQ C;  5TNC A;  2O60 A;  1SCM B;  3FIA A;  1MXL C;  2KNE A;  3LL8 B;  3VRR A;  1MUX A;  1DJZ A;  2K7O A;  2MA2 A;  2JNX A;  1NX1 A;  4NDC A;  4BY4 A;  3NSK A;  2MRD A;  2NCP A;  1WY9 A;  3SIA A;  1SK6 D;  3AAK A;  3OB1 B;  2BEC A;  4GGF C;  1UP5 A;  1JFJ A;  3D10 A;  1L2O B;  1YR5 A;  1JBA A;  4OKH A;  3FS7 A;  1CFP A;  4MBE A;  1MHO A;  4MEW A;  4M2Q A;  1F4O A;  1SPY A;  2L51 A;  3DF0 B;  3BUW B;  1IWQ A;  4L9M A;  1IKU A;  5AFP A;  2D8N A;  1MWN A;  5CSN A;  5B8I B;  1DMO A;  1OOJ A;  2CT9 A;  2JPT A;  3E3R A;  2CCM A;  1A29 A;  4DIR A;  1YX7 A;  3JTD B;  1KSO A;  1QLS A;  2LV7 A;  1S36 A;  1XFV O;  2BCB A;  3CGA A;  1B8C A;  5CPV A;  1J7O A;  1W7J B;  2Y1M A;  1RK9 A;  1A75 B;  2KAY A;  3CLN A;  3EKH A;  4MZJ A;  1K94 A;  1NCY A;  4CPV A;  4ICB A;  2KI6 D;  1RJV A;  2OTG B;  1K9P A;  2AMI A;  5AAN A;  2OPO A;  4R1E A;  1BT6 A;  4PDZ A;  1C7W A;  1PSR A;  2WCE A;  1EXR A;  3FWB A;  3PSR A;  4CID A;  1J7Q A;  3LLE A;  4CFQ A;  1GGZ A;  2K0J A;  1KQV A;  1K8U A;  1ZAC A;  2SCP A;  1A03 A;  2JZI A;  2H61 A;  4FQO A;  4YBH B;  3VRO A;  4M2P A;  1H4B A;  1DJI A;  1SCM C;  5AEQ A;  1RFJ A;  2M3W A;  1WLM A;  3O6B A;  3I5F B;  4PHJ A;  5DKR A;  1XFU O;  3BXK A;  2NCO A;  4AQJ A;  2F3Z A;  1ALW A;  1JUO A;  1K9K A;  4ZCU A;  3IQQ A;  1JFK A;  3KF9 A;  4YGC B;  2LLT A;  1DJY A;  1DJG A;  1CDP A;  3NSI A;  1BJF A;  2JT3 A;  2ZFD A;  2M1U A;  1LVC D;  3GK2 A;  3TZ1 A;  2FCE A;  1NPQ A;  3BOW B;  1REC A;  2LMU A;  3NSO A;  3SJS A;  3HX4 A;  5AXI A;  2P6B B;  2G9B A;  2L0P A;  3BUX B;  1HQV A;  1HT9 A;  3AAJ A;  3TDZ A;  4C0K A;  1IQ3 A;  1TNX A;  3LK0 A;  3IQO A;  1F70 A;  3I5H B;  1CFD A;  1V1G A;  1DGU A;  3JTD C;  1Y0V H;  2WOS A;  4YI9 A;  1XFY O;  4GNK B;  5DKN A;  3GOF A;  1TIZ A;  5JJG A;  1JWD A;  4ORC B;  3BUN B;  4I5J A;  4PE1 A;  1LXF C;  2DOQ A;  1J55 A;  1NUB A;  1KK7 Y;  4PCW A;  4YRU A;  2KI4 B;  1EL4 A;  2MLE C;  1TN4 A;  3VRQ A;  1UHH A;  1UHK A;  5HLO A;  4BY5 A;  3SG7 A;  3BUM B;  2OTG C;  5ER4 X;  3EK4 A;  2E6W A;  2Y1N A;  4QJ3 B;  2KDH A;  4PE4 A;  4UPG A;  1ODB A;  4P2Y B;  3EVR A;  1K9U A;  1SMG A;  4WRI A;  2M1K B;  3C1V A;  1BLQ A;  5HLV A;  4NDD A;  4ETO A;  4GPL B;  3NSL A;  1L7Z A;  2K8M B;  4MZL A;  2ZN8 A;  1NSH A;  1WLZ A;  4CFR A;  4MZK A;  4FTG A;  2ZKM X;  3BQ3 A;  1XYD A;  1SNL A;  2LAP A;  2LMT A;  1BF5 A;  2TN4 A;  1QX7 A;  1PK0 D;  1EG4 A;  1S1E A;  1XA5 A;  3RLZ A;  5I2O A;  1NCX A;  2L50 A;  1JC2 A;  3KPX A;  1MQ1 A;  3TUY C;  2GV5 A;  1M31 A;  2K7C A;  3D0Y A;  1FF1 A;  2K2A A;  3EK7 A;  1SYM A;  1CNP A;  3I5G C;  2LP2 A;  2EHB A;  2KFG A;  1KFU S;  2E30 A;  4YGA A;  3RM1 A;  1M45 A;  3A4U B;  4USL A;  3PM8 A;  1K90 D;  3I5H C;  1QJT A;  1UHN A;  2Y4Q A;  2LP3 A;  1YTZ C;  1IRJ A;  1YRU B;  2M7N A;  1GJY A;  1TNW A;  1TNP A;  1WRL A;  1N2D A;  3DD4 A;  3NXA A;  3OX6 A;  1KWO C;  1QTX A;  1UUS A;  3IF7 A;  3PAT A;  4JPZ B;  3ZNI A;  2K2F A;  2L2E A;  2KFF A;  2PRU A;  1Y1X A;  1Q80 A;  1WRK A;  4GAO A;  3A8R A;  1UWO A;  4PHM A;  2KI4 C;  5BPJ A;  1AHR A;  1AUI B;  1B47 A;  1XVJ A;  4AOM A;  2K61 A;  4E68 A;  1CM1 A;  1RRO A;  4I5K A;  1SCV A;  3DVE A;  4PAL A;  4PHK A;  1SL7 A;  4TNC A;  2BKI B;  1WDC C;  1XFX O; 
#chains in the Genus database with same CATH topology
 2AUC A;  3EK8 A;  1QX2 A;  1CFF A;  2SAS A;  1MR8 A;  1OZO A;  1QX5 B;  2KLD A;  2M97 A;  4IJ7 A;  4GUK A;  1QIW A;  2PSR A;  4AQI A;  2JT0 A;  1CMG A;  2BCA A;  3TDU A;  1K93 D;  1W9Z A;  2JTZ A;  1PRW A;  3R1V A;  1FW4 A;  3VRP A;  2JNF A;  3CTN A;  2LLU A;  2AAO A;  4DUQ A;  4GFT A;  1QV0 A;  3PM2 A;  2H8V A;  2GGM A;  1IG5 A;  1QAT A;  2LUC A;  2F8P A;  1BG1 A;  2KAX A;  1B7T Y;  1DVI A;  1OW4 A;  5D69 A;  4I5L B;  2KQ6 A;  4XYN A;  5D3O A;  2QEB A;  2MBX A;  2PYQ A;  4A4C A;  1QXP A;  1OMR A;  1C7V A;  1ZFS A;  1B1G A;  2HQ8 A;  2EC6 B;  2JOJ A;  4NQG A;  4F0Z B;  2PAL A;  1Y1A A;  3CS1 A;  2L4H A;  1KQM B;  2M49 B;  4D1E A;  3O4X A;  2H61 C;  2YGU A;  1IJ6 A;  3O2P A;  2LCP A;  2QAC A;  2FOT A;  1CTR A;  1KFX S;  4INX A;  1CM4 A;  1PAL A;  4MSP A;  1J7R A;  4N1F A;  1OOI X;  1AJ5 A;  4XJK B;  3OB2 B;  3TUY B;  3EKJ A;  5ER5 A;  2G2B A;  1CB1 A;  5HYD A;  1G8I A;  2M0R A;  1NX2 A;  3I5G B;  2QPT A;  1CFC A;  1LA0 A;  2KGB C;  2M29 A;  1K2H A;  1DEK A;  2NXQ A;  3OBV A;  1SR6 B;  2WCB A;  1YUR A;  2NLN A;  2BE4 A;  4OZD A;  3O78 A;  1K96 A;  3FE6 A;  4YGD B;  4U8D A;  2I94 A;  1K95 A;  1AP4 A;  2KFH A;  1YVH A;  3LCP C;  2F2O A;  1ZMZ A;  5D7F A;  1KWO B;  1S3P A;  4PE7 A;  1PUL A;  1DF0 A;  3DF0 A;  2BKH B;  1JSA A;  2GGZ A;  2K7D A;  2BBM A;  2WOR A;  3L4A A;  4HRH A;  4WQ2 A;  3PN7 B;  3S0F A;  4QJ4 B;  4NDB A;  2JUL A;  1AJ4 A;  3DYE A;  1OMV A;  2F3Y A;  1E8A A;  1S6C A;  2KYF A;  1QLK A;  4I5N B;  1WDC B;  2KOT A;  1J1E A;  3TS5 C;  5K89 A;  2MJW B;  2LAN A;  3CZT X;  1MXE A;  1J7P A;  1A75 A;  2KYC A;  2BBN A;  2EC6 C;  2L5X B;  2WC8 A;  1N65 A;  1XK4 A;  3FWC A;  1JF2 A;  4MLW A;  4YGB B;  1YVL A;  1W7I B;  2BCX A;  4PE0 A;  5J3X A;  1KQM C;  3PAL A;  4ORB B;  1YUS A;  5KSZ A;  1SSE B;  1XFR A;  3TDI A;  1OMD A;  3KHE A;  5FI7 A;  2LM5 A;  2PMY A;  3UO9 A;  2A4J A;  2LUX A;  4M2O A;  3K21 A;  1RWY A;  2K7B A;  1DC1 A;  4DS7 A;  1UHI A;  2B1U A;  2ZND A;  3DVJ A;  2LLS A;  3QRX A;  4YI8 A;  2JXC A;  5FI2 A;  2L4I A;  5FI6 A;  3BFH A;  1JF0 A;  4GGN A;  1KCY A;  2BL0 C;  1YUT A;  4PHN A;  1SW8 A;  3SG6 A;  2R2I A;  4MRX A;  2BAP A;  2KPH A;  1CLB A;  1SR6 C;  3BUO B;  1S6I A;  2LC5 A;  2ISD A;  3I5I C;  2Q4U A;  3EVU A;  3GK1 A;  1TOP A;  3VB1 A;  1DJW A;  1UUR A;  1ZOT B;  1KFU L;  2CXJ A;  2HF5 A;  1KK7 Z;  1Z4H A;  2MAZ A;  1OSA A;  3ICB A;  1S6J A;  5CSJ A;  1EJ3 A;  3BOW A;  5KTY A;  3OHM B;  1FBV A;  1NX0 A;  4N1G A;  1NP8 A;  1B8L A;  4A4B A;  1QVI Y;  2NZ0 A;  2KHN A;  3CR5 X;  4HRE E;  4YGE B;  5FYX A;  5PAL A;  2QEH A;  4FQT A;  1S5G Y;  3PN7 C;  2LHL A;  2ZRS A;  1X02 A;  1B4C A;  3F45 A;  2LMV A;  2OS8 B;  5HKY A;  2JXL A;  1IQ5 A;  2LE9 B;  5DKQ A;  4GGF A;  1C07 A;  4MRY A;  1R6P A;  3CAB A;  2LVK A;  2JRF A;  2O5G A;  1SKT A;  1G4Y R;  2HQW A;  1BOC A;  3SG4 A;  1ALV A;  2H2K A;  5HL1 A;  3AKA A;  4MN0 A;  3SG5 A;  1ORG A;  1G33 A;  2VRG A;  1BMO A;  2HET A;  2F33 A;  1F55 A;  4WQ3 A;  1DF0 B;  1F71 A;  1SRA A;  1N0Y A;  1OZS A;  1SL8 A;  2ZRT A;  1OQP A;  2JU0 A;  3DVM A;  2ZNE A;  1NIW A;  3M0W A;  3JVT B;  5AER A;  3FE9 A;  4JQ0 D;  1F4Q A;  1IGV A;  1S26 D;  3OX5 A;  2MLF C;  5F6T A;  2IS9 A;  1B9A A;  1TTX A;  2JT8 A;  1DGV A;  3PLF B;  3TS5 B;  1NCZ A;  1Y6W A;  1SL9 A;  2KGR A;  4ZCV A;  1M39 A;  1U5I A;  1BU3 A;  1LKJ A;  2ZN9 A;  1LIN A;  4C0J A;  1GGW A;  1DTL A;  1M63 B;  1KSM A;  2KBI A;  3N7H A;  4INW A;  3S0D A;  4QJ5 B;  5I94 A;  3CZ2 A;  1DJH A;  3GK4 X;  2I7A A;  2HPS A;  2LVV A;  2L98 A;  2PAS A;  3B88 A;  3PFV A;  3CR4 X;  2WCF A;  3DZT A;  3SS5 A;  2F2P A;  4HRG A;  1IJ5 A;  1EG3 A;  5DIC A;  5CSI A;  5HKW A;  3D77 A;  2MHH A;  3SG2 A;  1A2X A;  1KK8 B;  1GM0 A;  2Y5I A;  1RTP 1;  1VRK A;  1YUU A;  2PQL A;  3KEV A;  1IIO A;  1QVI Z;  4HSZ A;  1F8H A;  3LK1 A;  3WHT B;  2KBM A;  1KFX L;  1CLM A;  1S5G Z;  2BL0 B;  4MVF A;  1FI5 A;  1B8R A;  1IH0 A;  1TCF A;  2GTE A;  2FJU B;  1GQM A;  2QEO A;  3D0Y B;  1SY9 A;  3OGN A;  2BNX A;  3RZS A;  3I5I B;  2OS8 C;  3WNX B;  2LVJ A;  1R2U A;  2JC2 A;  1FI6 A;  4OCI A;  5HKZ A;  1LA3 A;  3D78 A;  4JWQ A;  1P28 A;  3AKB A;  1SBJ A;  1OOG A;  2ERB A;  1YRT B;  2QEV A;  1NWD A;  4Q04 A;  2FJY A;  5I2Q A;  3HCM A;  2COL B;  1TUZ A;  1EH2 A;  1L2O C;  3O4Y A;  4DCK A;  1F54 A;  2EGD A;  1ZUZ A;  2I2R E;  2V53 A;  1B7T Z;  2KLE A;  3CWG A;  4ORA B;  1AK8 A;  1CMF A;  1DT7 B;  1CDN A;  3NGV A;  4N5X A;  2LHI A;  3NXA A;  3JVT C;  4P5O E;  5KU1 A;  4DRW A;  1PVB A;  1M46 A;  4CLN A;  2M9G A;  3SS4 A;  3KO0 A;  1CDL A;  3B86 A;  1Y1U A;  1PSB A;  2JTT A;  2CBL A;  1CDM A;  3OP0 A;  2LVI A;  1OE9 B;  1QS7 A;  1FPW A;  3R1P A;  1A4P A;  1BR1 B;  1TCO B;  1J1D A;  1BR4 B;  3WHU B;  3VRN A;  1NYA A;  2Q91 A;  1XK4 C;  2FCD A;  2BE6 A;  2L2C A;  2JWW A;  3UNW A;  1MF8 B;  1AVS A;  5G08 A;  3L4L A;  1PVA A;  1WRZ A;  1XFW O;  2M7L A;  4IL1 A;  5JOL A;  1KK8 C;  2KAV A;  1OOF A;  2JQ6 A;  2WND A;  3SG3 A;  1CKK A;  5I8N A;  3EVV A;  2RGI A;  4OV2 A;  2CNP A;  1DQE A;  5CSF A;  1U5I B;  3CR2 A;  4GBA A;  1XFZ O;  1UHJ A;  2M8U A;  2LNK A;  1NX3 A;  1QAS A;  3BYA A;  1D1O A;  1XO5 A;  3I5F C;  1V1F A;  4OVN F;  2KI6 C;  4XJK A;  3WXA A;  1TNQ A;  5IBW A;  2I18 A;  3VGO A;  4C0L A;  4OR9 B;  5EL2 A;  3D73 A;  2CTN A;  1BOD A;  3MSE B;  2KSP A;  1TRF A;  2KQY A;  1H8B A;  5I2L A;  2WC6 A;  1CLL A;  1QIV A;  2PVB A;  1QV1 A;  3DVK A;  3H4S E;  1DJX A;  1YX8 A;  3SIB A;  5GQQ C;  5TNC A;  2O60 A;  1SCM B;  3FIA A;  1LS8 A;  1MXL C;  2KNE A;  3LL8 B;  3VRR A;  1MUX A;  1DJZ A;  2K7O A;  2MA2 A;  2JNX A;  1NX1 A;  4NDC A;  4BY4 A;  3NSK A;  2MRD A;  2NCP A;  1WY9 A;  3SIA A;  1SK6 D;  3AAK A;  3OB1 B;  2BEC A;  4GGF C;  1UP5 A;  1JFJ A;  3D10 A;  1L2O B;  1YR5 A;  1JBA A;  4OKH A;  3FS7 A;  3IVT A;  4MBE A;  1MHO A;  4MEW A;  3S0G A;  1CFP A;  3S0A A;  4M2Q A;  1F4O A;  1SPY A;  2L51 A;  2P70 A;  2QDI A;  3DF0 B;  3BUW B;  1IWQ A;  4L9M A;  1IKU A;  5AFP A;  2D8N A;  1MWN A;  5CSN A;  3V2L A;  5B8I B;  1OOJ A;  2CT9 A;  1DMO A;  2JPT A;  3E3R A;  2CCM A;  2P71 A;  1A29 A;  4DIR A;  1YX7 A;  2WCJ A;  3CDN A;  3JTD B;  1KSO A;  1QLS A;  3K1E A;  3BJH A;  2WCH A;  2WCK A;  3B7A A;  2LV7 A;  1S36 A;  1XFV O;  2BCB A;  3CGA A;  1B8C A;  5CPV A;  1J7O A;  1W7J B;  2Y1M A;  1RK9 A;  1A75 B;  2KAY A;  3CLN A;  3EKH A;  4MZJ A;  1K94 A;  1NCY A;  4CPV A;  4ICB A;  2KI6 D;  1RJV A;  1TWO A;  2OTG B;  1K9P A;  2AMI A;  2WCM A;  3NHI A;  5AAN A;  2OPO A;  4R1E A;  1BT6 A;  4PDZ A;  1C7W A;  1PSR A;  2WCE A;  3FE8 A;  1EXR A;  3FWB A;  3PSR A;  4CID A;  1J7Q A;  4KYN A;  3LLE A;  3NHT A;  1GGZ A;  4CFQ A;  2K0J A;  1KQV A;  1K8U A;  1ZAC A;  2WC5 A;  3S0B A;  2SCP A;  1A03 A;  2JZI A;  2H61 A;  4FQO A;  4YBH B;  3VRO A;  4M2P A;  1H4B A;  1DJI A;  1SCM C;  3R72 A;  1RFJ A;  5AEQ A;  2M3W A;  3BFA A;  1WLM A;  3O6B A;  3I5F B;  4PHJ A;  5DKR A;  1XFU O;  3BXK A;  2NCO A;  3SS3 A;  4AQJ A;  2F3Z A;  2L5Y A;  1ALW A;  3EG5 B;  1JUO A;  1K9K A;  4ZCU A;  3IQQ A;  1JFK A;  3BFB A;  3KF9 A;  2WCL A;  2LLT A;  4YGC B;  1DJY A;  1DJG A;  1CDP A;  3NSI A;  1BJF A;  2JT3 A;  2ZFD A;  2M1U A;  1LVC D;  3GK2 A;  3TZ1 A;  2FCE A;  1NPQ A;  3BOW B;  1REC A;  1DEL A;  2LMU A;  3NSO A;  3SJS A;  3HX4 A;  5AXI A;  2P6B B;  2G9B A;  2L0P A;  3BUX B;  1HQV A;  1HT9 A;  3AAJ A;  3TDZ A;  4C0K A;  1IQ3 A;  1TNX A;  3LK0 A;  3IQO A;  1F70 A;  3I5H B;  1CFD A;  1V1G A;  1DGU A;  3JTD C;  1Y0V H;  2WOS A;  4YI9 A;  1XFY O;  4GNK B;  5DKN A;  3GOF A;  1TIZ A;  5JJG A;  4JD9 A;  4ORC B;  1JWD A;  3BUN B;  3D74 A;  4I5J A;  3DXL A;  1LXF C;  4PE1 A;  2DOQ A;  1J55 A;  2JPO A;  1NUB A;  1KK7 Y;  3D75 A;  4PCW A;  4YRU A;  2KI4 B;  1EL4 A;  2MLE C;  1TN4 A;  3VRQ A;  1UHH A;  1UHK A;  5HLO A;  4BY5 A;  3SG7 A;  3BUM B;  2OTG C;  5ER4 X;  3EK4 A;  2E6W A;  2Y1N A;  2K60 A;  4QJ3 B;  2KDH A;  4PE4 A;  4UPG A;  1ODB A;  4P2Y B;  3EVR A;  1K9U A;  1SMG A;  3Q8I A;  2M1K B;  4WRI A;  3C1V A;  3DY9 A;  3CYZ A;  1BLQ A;  1TUJ A;  5HLV A;  4NDD A;  4ETO A;  4GPL B;  3NSL A;  1L7Z A;  2K8M B;  4MZL A;  2ZN8 A;  1C3Z A;  1NSH A;  1WLZ A;  4CFR A;  4MZK A;  4FTG A;  2ZKM X;  3BQ3 A;  1XYD A;  1SNL A;  2LAP A;  2LMT A;  3R1O A;  4F7F A;  1BF5 A;  2TN4 A;  1QX7 A;  1PK0 D;  1EG4 A;  1S1E A;  1XA5 A;  3PJI A;  3RLZ A;  1C3Y A;  5I2O A;  1NCX A;  2L50 A;  1JC2 A;  1QWV A;  3KPX A;  1MQ1 A;  3L47 A;  3TUY C;  3QME A;  3B87 A;  2GV5 A;  1M31 A;  2K7C A;  3CZ1 A;  3D0Y A;  2K2A A;  1FF1 A;  3EK7 A;  1SYM A;  1CNP A;  3I5G C;  1T14 A;  2LP2 A;  2EHB A;  2KFG A;  1KFU S;  2E30 A;  3ZWH A;  3D76 A;  4YGA A;  3RM1 A;  1M45 A;  3A4U B;  4USL A;  3PM8 A;  1K90 D;  3I5H C;  1QJT A;  1UHN A;  2Y4Q A;  2LP3 A;  1YTZ C;  1IRJ A;  1YRU B;  2M7N A;  1GJY A;  1TNW A;  1OOH A;  1TNP A;  1N2D A;  1WRL A;  3CZ0 A;  3DD4 A;  1KWO C;  1QTX A;  1UUS A;  3IF7 A;  3OX6 A;  3PAT A;  4JPZ B;  3ZNI A;  3S0E A;  2K2F A;  2L2E A;  2KFF A;  2PRU A;  1Y1X A;  1Q80 A;  1WRK A;  3B6X A;  3A8R A;  1UWO A;  4GAO A;  2KI4 C;  4PHM A;  5BPJ A;  1AHR A;  1AUI B;  1B47 A;  4JKT A;  4PT1 A;  1XVJ A;  4AOM A;  2K61 A;  4E68 A;  1CM1 A;  1RRO A;  4I5K A;  1SCV A;  3DVE A;  4PAL A;  1Z2C B;  4PHK A;  1SL7 A;  4TNC A;  2BKI B;  1WDC C;  1XFX O; 
#chains in the Genus database with same CATH homology
 2AUC A;  3EK8 A;  1QX2 A;  1CFF A;  2SAS A;  1MR8 A;  1OZO A;  1QX5 B;  2M97 A;  4AQI A;  4GUK A;  1QIW A;  2PSR A;  1CMG A;  2JT0 A;  2BCA A;  3TDU A;  1K93 D;  2JTZ A;  1PRW A;  1FW4 A;  3VRP A;  2JNF A;  3CTN A;  2LLU A;  2AAO A;  4DUQ A;  4GFT A;  1QV0 A;  2GGM A;  1IG5 A;  1QAT A;  2LUC A;  2F8P A;  1BG1 A;  2KAX A;  1B7T Y;  1DVI A;  5D69 A;  4I5L B;  2KQ6 A;  4XYN A;  2MBX A;  4A4C A;  1QXP A;  1OMR A;  1C7V A;  1ZFS A;  1B1G A;  2HQ8 A;  2EC6 B;  2JOJ A;  4NQG A;  4F0Z B;  2PAL A;  1Y1A A;  3CS1 A;  2L4H A;  1KQM B;  2M49 B;  4D1E A;  2H61 C;  1IJ6 A;  3O2P A;  2LCP A;  2QAC A;  2FOT A;  1CTR A;  1KFX S;  1CM4 A;  1PAL A;  4MSP A;  1J7R A;  4N1F A;  1AJ5 A;  4XJK B;  3OB2 B;  3TUY B;  3EKJ A;  5ER5 A;  2G2B A;  1CB1 A;  5HYD A;  1G8I A;  2M0R A;  1NX2 A;  3I5G B;  2QPT A;  1CFC A;  1LA0 A;  2KGB C;  2M29 A;  1K2H A;  2NXQ A;  1SR6 B;  2WCB A;  1YUR A;  2NLN A;  2BE4 A;  3O78 A;  1K96 A;  4YGD B;  4U8D A;  2I94 A;  1K95 A;  1AP4 A;  2KFH A;  1YVH A;  3LCP C;  2F2O A;  1ZMZ A;  5D7F A;  1KWO B;  1S3P A;  4PE7 A;  1PUL A;  1DF0 A;  3DF0 A;  2BKH B;  1JSA A;  2GGZ A;  2K7D A;  2BBM A;  2WOR A;  4HRH A;  4WQ2 A;  3PN7 B;  4QJ4 B;  4NDB A;  2JUL A;  1AJ4 A;  1OMV A;  2F3Y A;  1E8A A;  1S6C A;  2KYF A;  1QLK A;  4I5N B;  1WDC B;  2KOT A;  1J1E A;  3TS5 C;  5K89 A;  2MJW B;  2LAN A;  3CZT X;  1MXE A;  1J7P A;  1A75 A;  2KYC A;  2BBN A;  2EC6 C;  2L5X B;  2WC8 A;  1N65 A;  1XK4 A;  3FWC A;  1JF2 A;  4MLW A;  4YGB B;  1YVL A;  1W7I B;  2BCX A;  4PE0 A;  5J3X A;  1KQM C;  3PAL A;  4ORB B;  1YUS A;  5KSZ A;  3TDI A;  1OMD A;  3KHE A;  2LM5 A;  2PMY A;  2A4J A;  2LUX A;  4M2O A;  3K21 A;  1RWY A;  2K7B A;  4DS7 A;  1UHI A;  2B1U A;  2ZND A;  3DVJ A;  2LLS A;  3QRX A;  4YI8 A;  2JXC A;  2L4I A;  1JF0 A;  4GGN A;  1KCY A;  2BL0 C;  1YUT A;  4PHN A;  1SW8 A;  3SG6 A;  2R2I A;  4MRX A;  1CLB A;  1SR6 C;  3BUO B;  1S6I A;  2LC5 A;  2ISD A;  3I5I C;  2Q4U A;  3EVU A;  3GK1 A;  1TOP A;  1DJW A;  1UUR A;  1ZOT B;  1KFU L;  2CXJ A;  2HF5 A;  1KK7 Z;  2MAZ A;  1OSA A;  3ICB A;  1S6J A;  5CSJ A;  1EJ3 A;  3BOW A;  5KTY A;  3OHM B;  1FBV A;  1NX0 A;  4N1G A;  1NP8 A;  1B8L A;  4A4B A;  1QVI Y;  2NZ0 A;  2KHN A;  3CR5 X;  4HRE E;  4YGE B;  5FYX A;  5PAL A;  3ZWH A;  1S5G Y;  3PN7 C;  2LHL A;  2ZRS A;  1X02 A;  1B4C A;  3F45 A;  2LMV A;  2OS8 B;  5HKY A;  2JXL A;  1IQ5 A;  2LE9 B;  5DKQ A;  4GGF A;  1C07 A;  4MRY A;  1R6P A;  2LVK A;  2JRF A;  2O5G A;  1SKT A;  1G4Y R;  2HQW A;  1BOC A;  3SG4 A;  1ALV A;  2H2K A;  3AKA A;  4MN0 A;  3SG5 A;  1G33 A;  2VRG A;  1BMO A;  2HET A;  2F33 A;  1F55 A;  4WQ3 A;  1DF0 B;  1F71 A;  1SRA A;  1N0Y A;  1OZS A;  1SL8 A;  2ZRT A;  1OQP A;  2JU0 A;  3DVM A;  2ZNE A;  1NIW A;  3M0W A;  3JVT B;  5AER A;  4JQ0 D;  1F4Q A;  1IGV A;  1S26 D;  3OX5 A;  2MLF C;  5F6T A;  2IS9 A;  1B9A A;  1TTX A;  2JT8 A;  1DGV A;  3PLF B;  3TS5 B;  1NCZ A;  1Y6W A;  1SL9 A;  2KGR A;  4ZCV A;  1M39 A;  1U5I A;  1BU3 A;  1LKJ A;  2ZN9 A;  1LIN A;  4C0J A;  1GGW A;  1DTL A;  1M63 B;  1KSM A;  2KBI A;  4QJ5 B;  1DJH A;  3GK4 X;  2I7A A;  2HPS A;  2LVV A;  2L98 A;  2PAS A;  3PFV A;  3CR4 X;  2WCF A;  2F2P A;  4HRG A;  1IJ5 A;  1EG3 A;  5CSI A;  5HKW A;  2MHH A;  3SG2 A;  1A2X A;  1KK8 B;  2Y5I A;  1RTP 1;  1VRK A;  1YUU A;  3KEV A;  1QVI Z;  4HSZ A;  1F8H A;  3LK1 A;  3WHT B;  2KBM A;  1KFX L;  1CLM A;  1S5G Z;  2BL0 B;  4MVF A;  1FI5 A;  1B8R A;  1IH0 A;  1TCF A;  2FJU B;  1GQM A;  3D0Y B;  1SY9 A;  3I5I B;  2OS8 C;  3WNX B;  2LVJ A;  1R2U A;  2JC2 A;  1FI6 A;  4OCI A;  5HKZ A;  1LA3 A;  4JWQ A;  3AKB A;  1SBJ A;  1YRT B;  1NWD A;  4Q04 A;  5I2Q A;  3HCM A;  2COL B;  1EH2 A;  1L2O C;  3O4Y A;  4DCK A;  1F54 A;  2EGD A;  1ZUZ A;  2I2R E;  2V53 A;  1B7T Z;  3CWG A;  4ORA B;  1AK8 A;  1CMF A;  1DT7 B;  1CDN A;  4N5X A;  2LHI A;  3JVT C;  4P5O E;  5KU1 A;  4DRW A;  1PVB A;  1M46 A;  4CLN A;  2M9G A;  3KO0 A;  1CDL A;  1Y1U A;  1PSB A;  2JTT A;  2CBL A;  1CDM A;  3OP0 A;  2LVI A;  1OE9 B;  1QS7 A;  1FPW A;  1A4P A;  1BR1 B;  1TCO B;  1J1D A;  1BR4 B;  3WHU B;  3VRN A;  1NYA A;  2Q91 A;  1XK4 C;  2FCD A;  2BE6 A;  2JWW A;  1MF8 B;  1AVS A;  5G08 A;  1PVA A;  1WRZ A;  1XFW O;  2M7L A;  4IL1 A;  5JOL A;  1KK8 C;  2KAV A;  2JQ6 A;  2WND A;  3SG3 A;  1CKK A;  5I8N A;  3EVV A;  2RGI A;  4OV2 A;  2CNP A;  5CSF A;  1U5I B;  3CR2 A;  4GBA A;  1XFZ O;  1UHJ A;  2M8U A;  2LNK A;  1NX3 A;  1QAS A;  3BYA A;  1D1O A;  1XO5 A;  3I5F C;  1V1F A;  4OVN F;  2KI6 C;  4XJK A;  3WXA A;  1TNQ A;  5IBW A;  2I18 A;  3VGO A;  4C0L A;  4OR9 B;  2CTN A;  1BOD A;  3MSE B;  2KSP A;  1TRF A;  2KQY A;  1H8B A;  5I2L A;  1CLL A;  1QIV A;  2PVB A;  1QV1 A;  3DVK A;  3H4S E;  1DJX A;  1YX8 A;  3SIB A;  5GQQ C;  5TNC A;  2O60 A;  1SCM B;  3FIA A;  1MXL C;  2KNE A;  3LL8 B;  3VRR A;  1MUX A;  1DJZ A;  2K7O A;  2MA2 A;  2JNX A;  1NX1 A;  4NDC A;  4BY4 A;  3NSK A;  2MRD A;  2NCP A;  1WY9 A;  3SIA A;  1SK6 D;  3AAK A;  3OB1 B;  2BEC A;  4GGF C;  1UP5 A;  1JFJ A;  3D10 A;  1L2O B;  1YR5 A;  1JBA A;  4OKH A;  3FS7 A;  1CFP A;  4MBE A;  1MHO A;  4MEW A;  4M2Q A;  1F4O A;  1SPY A;  2L51 A;  3DF0 B;  3BUW B;  1IWQ A;  4L9M A;  1IKU A;  5AFP A;  2D8N A;  1MWN A;  5CSN A;  5B8I B;  1DMO A;  1OOJ A;  2CT9 A;  2JPT A;  3E3R A;  2CCM A;  1A29 A;  4DIR A;  1YX7 A;  3JTD B;  1KSO A;  1QLS A;  2LV7 A;  1S36 A;  1XFV O;  2BCB A;  3CGA A;  1B8C A;  5CPV A;  1J7O A;  1W7J B;  2Y1M A;  1RK9 A;  1A75 B;  2KAY A;  3CLN A;  3EKH A;  4MZJ A;  1K94 A;  1NCY A;  4CPV A;  4ICB A;  2KI6 D;  1RJV A;  2OTG B;  1K9P A;  2AMI A;  5AAN A;  2OPO A;  4R1E A;  1BT6 A;  4PDZ A;  1C7W A;  1PSR A;  2WCE A;  1EXR A;  3FWB A;  3PSR A;  4CID A;  1J7Q A;  3LLE A;  4CFQ A;  1GGZ A;  2K0J A;  1KQV A;  1K8U A;  1ZAC A;  2SCP A;  1A03 A;  2JZI A;  2H61 A;  4FQO A;  4YBH B;  3VRO A;  4M2P A;  1H4B A;  1DJI A;  1SCM C;  5AEQ A;  1RFJ A;  2M3W A;  1WLM A;  3O6B A;  3I5F B;  4PHJ A;  5DKR A;  1XFU O;  3BXK A;  2NCO A;  4AQJ A;  2F3Z A;  1ALW A;  1JUO A;  1K9K A;  4ZCU A;  3IQQ A;  1JFK A;  3KF9 A;  4YGC B;  2LLT A;  1DJY A;  1DJG A;  1CDP A;  3NSI A;  1BJF A;  2JT3 A;  2ZFD A;  2M1U A;  1LVC D;  3GK2 A;  3TZ1 A;  2FCE A;  1NPQ A;  3BOW B;  1REC A;  2LMU A;  3NSO A;  3SJS A;  3HX4 A;  5AXI A;  2P6B B;  2G9B A;  2L0P A;  3BUX B;  1HQV A;  1HT9 A;  3AAJ A;  3TDZ A;  4C0K A;  1IQ3 A;  1TNX A;  3LK0 A;  3IQO A;  1F70 A;  3I5H B;  1CFD A;  1V1G A;  1DGU A;  3JTD C;  1Y0V H;  2WOS A;  4YI9 A;  1XFY O;  4GNK B;  5DKN A;  3GOF A;  1TIZ A;  5JJG A;  1JWD A;  4ORC B;  3BUN B;  4I5J A;  4PE1 A;  1LXF C;  2DOQ A;  1J55 A;  1NUB A;  1KK7 Y;  4PCW A;  4YRU A;  2KI4 B;  1EL4 A;  2MLE C;  1TN4 A;  3VRQ A;  1UHH A;  1UHK A;  5HLO A;  4BY5 A;  3SG7 A;  3BUM B;  2OTG C;  5ER4 X;  3EK4 A;  2E6W A;  2Y1N A;  4QJ3 B;  2KDH A;  4PE4 A;  4UPG A;  1ODB A;  4P2Y B;  3EVR A;  1K9U A;  1SMG A;  4WRI A;  2M1K B;  3C1V A;  1BLQ A;  5HLV A;  4NDD A;  4ETO A;  4GPL B;  3NSL A;  1L7Z A;  2K8M B;  4MZL A;  2ZN8 A;  1NSH A;  1WLZ A;  4CFR A;  4MZK A;  4FTG A;  2ZKM X;  3BQ3 A;  1XYD A;  1SNL A;  2LAP A;  2LMT A;  1BF5 A;  2TN4 A;  1QX7 A;  1PK0 D;  1EG4 A;  1S1E A;  1XA5 A;  3RLZ A;  5I2O A;  1NCX A;  2L50 A;  1JC2 A;  3KPX A;  1MQ1 A;  3TUY C;  2GV5 A;  1M31 A;  2K7C A;  3D0Y A;  1FF1 A;  2K2A A;  3EK7 A;  1SYM A;  1CNP A;  3I5G C;  2LP2 A;  2EHB A;  2KFG A;  1KFU S;  2E30 A;  4YGA A;  3RM1 A;  1M45 A;  3A4U B;  4USL A;  3PM8 A;  1K90 D;  3I5H C;  1QJT A;  1UHN A;  2Y4Q A;  2LP3 A;  1YTZ C;  1IRJ A;  1YRU B;  2M7N A;  1GJY A;  1TNW A;  1TNP A;  1WRL A;  1N2D A;  3DD4 A;  3NXA A;  3OX6 A;  1KWO C;  1QTX A;  1UUS A;  3IF7 A;  3PAT A;  4JPZ B;  3ZNI A;  2K2F A;  2L2E A;  2KFF A;  2PRU A;  1Y1X A;  1Q80 A;  1WRK A;  4GAO A;  3A8R A;  1UWO A;  4PHM A;  2KI4 C;  5BPJ A;  1AHR A;  1AUI B;  1B47 A;  1XVJ A;  4AOM A;  2K61 A;  4E68 A;  1CM1 A;  1RRO A;  4I5K A;  1SCV A;  3DVE A;  4PAL A;  4PHK A;  1SL7 A;  4TNC A;  2BKI B;  1WDC C;  1XFX O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...