4YGCB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
64
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein ERGIC-53
total genus 21
structure length 64
sequence length 77
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygcB00
5HLOA 1AJ5A 1J7RA 1QASA 2BL0B 3LK0A 1S1EA 1BOCA 1TCFA 4OR9B 3DVJA 1CDMA 3C1VA 1CMFA 1QATA 4N1FA 2BECA 2ZRTA 1UHIA 3AKBA 3TS5C 2KNEA 1TOPA 2JULA 2L2EA 2BL0C 2L0PA 2CCMA 2Q4UA 5DKRA 4MEWA 3SG5A 1PALA 1WLMA 4GPLB 1UHHA 1TN4A 1JSAA 3JTDB 4GGFC 1ZUZA 5CSFA 1ZACA 1XVJA 3MSEB 2M29A 2FCDA 2H2KA 2MLFC 1JFJA 4MZLA 3BUWB 1SCMB 1SBJA 2K7DA 1IQ5A 2M1KB 1JWDA 1GQMA 1WDCB 3JVTB 1IG5A 1UURA 2M49B 1A75A 3KPXA 1F70A 1YTZC 3KO0A 1S26D 4C0JA 5AFPA 3EK7A 1KFUL 1CDNA 2LUCA 2OPOA 2A4JA 1ZMZA 2F33A 2I94A 2LMUA 2NXQA 2JQ6A 1SL9A 1AVSA 4I5NB 1DF0B 1CFPA 2JU0A 1TTXA 3IQQA 1K96A 1SPYA 2Y5IA 2PRUA 1OMRA 1YVLA 2LP3A 2BKHB 1B9AA 1V1FA 1S36A 5HKWA 4GGFA 4WQ2A 3VRQA 1OOJA 3LL8B 3WNXB 1MWNA 1YUTA 2AAOA 2K2FA 2R2IA 1OQPA 2L5XB 3FWBA 4AQIA 1L7ZA 1J7QA 1PSRA 4DUQA 1NCYA 5GQQC 2KAXA 2KGRA 4PALA 2LCPA 2M1UA 4YGAA 1A4PA 2BE4A 5CSNA 1CKKA 3SG2A 3BUMB 3PALA 1K93D 4YGDB 2K2AA 1NSHA 2B1UA 1XK4A 2PSRA 3OB1B 2KBMA 1TCOB 2KI6C 1QLKA 2PALA 1BG1A 1KK8B 2L98A 1J55A 2LMVA 2BCXA 3EKHA 4DS7A 5I2LA 4JPZB 1DGVA 2KSPA 4FTGA 4GGNA 3CGAA 4PHJA 5AANA 1RJVA 1SL7A 5KU1A 1B8LA 1QVIZ 1TNQA 2PASA 1G4YR 4A4CA 1JF2A 1RK9A 2KOTA 2OTGB 4IL1A 5AXIA 4DRWA 1GGZA 2BBNA 2LLSA 2MRDA 2JRFA 2K0JA 1QV0A 1TIZA 2KFHA 4PHKA 1L2OB 1BJFA 2FJUB 5HLVA 2KQYA 2K7CA 1DJHA 1DF0A 2D8NA 1SR6C 3DVKA 1GGWA 2Y1NA 2G9BA 1DTLA 2JPTA 2M7NA 1B1GA 2JZIA 4QJ4B 4NQGA 4CLNA 1NX2A 4CIDA 4NDDA 3O6BA 2JTTA 2LMTA 4MZKA 1DJYA 2Y4QA 1KWOC 2M0RA 2SASA 4C0LA 2LP2A 3ZWHA 1QVIY 1TNPA 2JWWA 3I5FB 4FQOA 1B4CA 2BCBA 3GK4X 4HREE 2K7OA 4PCWA 3KEVA 4F0ZB 1H4BA 1S6JA 2EHBA 1DVIA 2KI6D 4QJ3B 2M7LA 1NIWA 2MAZA 2KFFA 1BT6A 2HQWA 1AP4A 3I5FC 1K8UA 1KK8C 1IWQA 1CDLA 4ZCVA 3TDUA 3EK4A 2Y1MA 2OS8B 1WY9A 4YI9A 1BMOA 5G08A 1K9UA 1PVAA 2SCPA 1K2HA 2M8UA 2LM5A 2KGBC 3NSLA 2MBXA 2COLB 4N5XA 2PVBA 3SIBA 2HF5A 2ZN8A 1H8BA 4M2OA 1DJIA 4P5OE 1Y1UA 2JC2A 2NCPA 2V53A 1MXLC 2L51A 1YUUA 2LLUA 1K9PA 1DMOA 1EXRA 1SMGA 1J7PA 2KYCA 5TNCA 1CFFA 4OCIA 1GJYA 5DKNA 3NSKA 4ICBA 2WOSA 1CDPA 1CMGA 4I5JA 1E8AA 4BY4A 2JXLA 3BXKA 1U5IA 2AUCA 4ORBB 4HSZA 4YI8A 1QIVA 3ICBA 1NPQA 3DVEA 2P6BB 3OX6A 1G8IA 1F55A 4HRHA 1CNPA 1KQVA 4OKHA 4M2QA 1KK7Y 2LC5A 2MLEC 1F54A 2KAVA 1OZOA 2NCOA 1KSOA 3CWGA 3TUYB 2FCEA 3EKJA 1UHNA 5B8IB 1CFDA 1UUSA 1HQVA 5I2OA 2F2PA 1AUIB 2JOJA 2NZ0A 4PE4A 2F2OA 2JXCA 1F4QA 2CTNA 4JQ0D 1EH2A 1K9KA 1QX7A 4P2YB 1R6PA 2F3ZA 5JJGA 2MJWB 1A29A 1QV1A 1DGUA 4ORCB 1DJZA 2QACA 4MLWA 2KYFA 2H61A 1J7OA 2LANA 3DD4A 3D10A 1UHKA 1UHJA 1IQ3A 2H61C 4OV2A 4AQJA 1IJ6A 1A75B 1MHOA 1QXPA 2L50A 5I2QA 2DOQA 3I5GC 2CBLA 1OSAA 3CR4X 4DIRA 1FW4A 1NCZA 1X02A 2GV5A 3DVMA 5CPVA 1LA3A 1WLZA 1VRKA 1RROA 2VRGA 1TNWA 1PK0D 1Q80A 4XYNA 3EK8A 2E6WA 2EC6C 2MA2A 5JOLA 5PALA 1LVCD 5AEQA 1CLLA 4MRXA 4GFTA 1SCMC 3JVTC 4R1EA 4PE7A 1YUSA 2NLNA 1M39A 1XFUO 2RGIA 2K61A 4USLA 2MHHA 1CLBA 1EL4A 1NUBA 1AHRA 5D7FA 5KTYA 2HETA 1BLQA 1CM1A 1JFKA 1SR6B 3JTDC 4MBEA 3IF7A 1ZFSA 4GAOA 3E3RA 3DF0A 4MZJA 1XFXO 5HKYA 1EG4A 2KFGA 1MUXA 3QRXA 3VRRA 1KK7Z 1XFWO 2L4IA 2M9GA 1PRWA 1KSMA 1M31A 3WHUB 1WDCC 4GNKB 1B7TZ 2CNPA 2G2BA 1L2OC 5D69A 1J1DA 5HYDA 1W7IB 3EVUA 3EVRA 1OZSA 5KSZA 1NX0A 1MR8A 3BYAA 2LVVA 1KCYA 2TN4A 1QX5B 3NXAA 3CZTX 3PFVA 2ZFDA 3I5IC 1PVBA 1IKUA 1DJWA 3M0WA 4BY5A 1FI5A 4YRUA 1DJGA 4PHNA 2O60A 4DCKA 3TS5B 3OP0A 3KHEA 1XYDA 3K21A 4OVNF 2LV7A 3WXAA 3O78A 4XJKB 1CFCA 1CB1A 1S6CA 5DKQA 2KHNA 3D0YB 1YURA 1QLSA 4MVFA 4QJ5B 1NX3A 1U5IB 1MQ1A 3OB2B 2HQ8A 4TNCA 2LHLA 1JF0A 3F45A 3PN7C 1UP5A 1FBVA 5CSIA 2I2RE 2JT0A 2FOTA 1Y6WA 3AAKA 4C0KA 4WRIA 2BKIB 1W7JB 4YBHB 3I5HC 1BU3A 4GUKA 1MF8B 3WHTB 2KQ6A 1OE9B 5ER4X 3VROA 3FIAA 4JWQA 2PMYA 3SJSA 2CXJA 2ZKMX 4ORAB 3SG3A 1KQMC 2KI4C 3SG6A 5BPJA 1TRFA 3AKAA 4M2PA 4PDZA 4U8DA 1AJ4A 4CPVA 1C07A 1K95A 1LA0A 1TNXA 3CS1A 4AOMA 4E68A 1N65A 3PLFB 1K94A 3GOFA 1M46A 1SCVA 1NYAA 3RM1A 1LXFC 3I5IB 1FF1A 2KBIA 1F71A 1WRKA 1SK6D 1YX8A 1EJ3A 1BR4B 1IGVA 1XFZO 3D0YA 3LK1A 1CM4A 2LAPA 1IJ5A 1Y0VH 4XJKA 4YGCB 4MN0A 1QJTA 3VRNA 1YRTB 1OMDA 1UWOA 3CR2A 1D1OA 2M97A 3NSOA 1SNLA 2ZNDA 2WCFA 1XK4C 1FI6A 4L9MA 2ZN9A 4PE1A 2E30A 2LVKA 1AK8A 3PM8A 1C7VA 1SW8A 2AMIA 1Y1XA 2WCEA 2EC6B 4WQ3A 1G33A 2F8PA 1CTRA 2I18A 3BQ3A 2L4HA 1S3PA 2LVJA 1OMVA 2F3YA 5CSJA 4ETOA 3IQOA 1F8HA 1NX1A 1QIWA 1BR1B 1B47A 1SKTA 3I5GB 1PULA 1S5GZ 1S6IA 3TDZA 1J1EA 2LNKA 1RTP1 5IBWA 1IH0A 3RLZA 3TDIA 3GK1A 3LLEA 1RFJA 2LVIA 4D1EA 1N0YA 1QX2A 2JT8A 5HKZA 1YR5A 1YRUB 3VRPA 2WC8A 1BODA 3TZ1A 2JNXA 1SL8A 1KFXL 2I7AA 2QPTA 4N1GA 2IS9A 1IRJA 1M45A 3SG4A 1Y1AA 1S5GY 1M63B 4CFQA 3H4SE 1C7WA 1JC2A 2LE9B 3A8RA 1BF5A 3HX4A 4NDBA 4YGEB 1MXEA 1RWYA 2O5GA 3FWCA 2JNFA 3O2PA 2OTGC 5F6TA 1DT7B 3CLNA 2K7BA 1JUOA 1A2XA 1NP8A 1YVHA 2BCAA 4PHMA 4ZCUA 1LINA 2LHIA 1ALVA 4I5KA 3SIAA 1RECA 2M3WA 1B8RA 1ZOTB 1WRZA 3CR5X 2JTZA 1XFVO 3PATA 4HRGA 4PE0A 3ZNIA 5FYXA 2K8MB 2OS8C 1R2UA 2Q91A 4YGBB 3EVVA 4Q04A 4A4BA 2BE6A 1YX7A 2EGDA 1FPWA 1PSBA 1B7TY 1KWOB 3BUXB 4UPGA 1LKJA 3KF9A 3CTNA 3LCPC 3SG7A 5AERA 2WCBA 3AAJA 3BOWB 1NCXA 3BUNB 3I5HB 3BOWA 1ALWA 1HT9A 1NWDA 1ODBA 2KDHA 1KFXS 3HCMA 3NSIA 4GBAA 1KFUS 1SYMA 4MSPA 1EG3A 2BBMA 1V1GA 2WNDA 1A03A 1SRAA 3GK2A 1XA5A 2LUXA 2WORA 3PSRA 2ZNEA 2CT9A 2HPSA 2LLTA 1WRLA 2KAYA 1F4OA 2ISDA 3OHMB 2GGMA 1XFYO 1KQMB 2KI4B 2JT3A 3DF0B 5J3XA 5I8NA 2GGZA 1QS7A 3VGOA 5K89A 1N2DA 1K90D 1SY9A 4MRYA 3FS7A 1B8CA 4CFRA 3BUOB 3A4UB 3TUYC 1CLMA 5ER5A 3OX5A 1JBAA 4NDCA 1DJXA 2ZRSA 1XO5A 4I5LB 3O4YA 3PN7B 1QTXA
chains in the Genus database with same CATH superfamily
5HLOA 1AJ5A 1J7RA 2ERBA 1QASA 3S0GA 1OOIX 2BL0B 3LK0A 1S1EA 1BOCA 1TCFA 4OR9B 3DVJA 1CDMA 3C1VA 1CMFA 1QATA 4N1FA 2BECA 2ZRTA 1UHIA 3AKBA 3TS5C 2KNEA 2WC5A 1TOPA 2JULA 2P71A 2L2EA 2BL0C 2L0PA 2CCMA 2Q4UA 5DKRA 4MEWA 3SG5A 1PALA 1WLMA 4GPLB 1UHHA 3OBVA 1TN4A 1JSAA 3JTDB 4GGFC 1ZUZA 5CSFA 1ZACA 1XVJA 3MSEB 2M29A 2FCDA 4INWA 2H2KA 2MLFC 1JFJA 4MZLA 3BUWB 1SCMB 1SBJA 2K7DA 1IQ5A 2M1KB 1JWDA 1GQMA 1WDCB 3JVTB 1OOFA 1IG5A 1UURA 2M49B 1A75A 3D77A 3KPXA 1F70A 1YTZC 3KO0A 1S26D 4C0JA 5AFPA 3EK7A 1KFUL 3PJIA 2LUCA 2OPOA 2A4JA 1CDNA 1ZMZA 3B88A 2F33A 2I94A 2LMUA 2NXQA 2JQ6A 3BFBA 1SL9A 1AVSA 4I5NB 1DF0B 3BFAA 1CFPA 2JU0A 1TTXA 3IQQA 1K96A 1SPYA 2Y5IA 3D76A 2PRUA 4F7FA 1OMRA 1YVLA 2LP3A 2BKHB 1B9AA 1IIOA 1V1FA 1S36A 5HKWA 3NHTA 4GGFA 4WQ2A 3VRQA 1OOJA 1XFRA 3LL8B 3WNXB 1MWNA 1YUTA 2AAOA 2K2FA 2R2IA 1OQPA 2L5XB 3FWBA 4AQIA 1L7ZA 1J7QA 1PSRA 4DUQA 1NCYA 5GQQC 2KAXA 2KGRA 4PALA 2LCPA 2M1UA 4YGAA 1A4PA 2BE4A 5CSNA 1CKKA 3SG2A 3BUMB 3PALA 1K93D 4YGDB 2K2AA 1NSHA 2B1UA 1XK4A 2PSRA 3OB1B 2KBMA 1ORGA 1TCOB 2KI6C 3R1PA 1QLKA 1QWVA 2PALA 1BG1A 1KK8B 2L98A 1J55A 1OOGA 2LMVA 2BCXA 3EKHA 4DS7A 5I2LA 4JPZB 1DGVA 2KSPA 4FTGA 4GGNA 3CGAA 4PHJA 5FI2A 5AANA 1RJVA 1SL7A 5KU1A 1B8LA 1QVIZ 1TNQA 2PASA 1G4YR 4A4CA 1JF2A 3D74A 1RK9A 2KOTA 2OTGB 4IL1A 5AXIA 4DRWA 1GGZA 2BBNA 2LLSA 2WC6A 2PQLA 2MRDA 2JRFA 2K0JA 1QV0A 1TIZA 2KFHA 4PHKA 1Z2CB 1L2OB 1BJFA 2FJUB 5HLVA 2KQYA 2K7CA 1DJHA 1DF0A 2D8NA 1SR6C 3DVKA 1GGWA 3UNWA 2Y1NA 3R1VA 1DTLA 2G9BA 2JPTA 2M7NA 5FI7A 1B1GA 3PM2A 3B86A 2JZIA 2KLEA 4NQGA 4CLNA 4QJ4B 1NX2A 5DICA 4CIDA 2BNXA 4NDDA 2QEHA 3O6BA 2JTTA 2LMTA 4MZKA 1DJYA 2Y4QA 1KWOC 2M0RA 2SASA 4C0LA 2LP2A 3ZWHA 1QVIY 1TNPA 2JWWA 3I5FB 4FQOA 1B4CA 2BCBA 3GK4X 4HREE 2K7OA 4PCWA 3KEVA 4F0ZB 1H4BA 1S6JA 2EHBA 1DVIA 2KI6D 4QJ3B 2M7LA 1NIWA 2JPOA 2MAZA 1DEKA 2KFFA 1BT6A 2HQWA 1AP4A 3I5FC 1K8UA 1KK8C 3L4AA 1IWQA 1CDLA 3FE9A 4ZCVA 3TDUA 3EK4A 2Y1MA 2H8VA 2OS8B 1WY9A 4YI9A 3SS4A 1BMOA 5G08A 1K9UA 1PVAA 2QEVA 2SCPA 1K2HA 2M8UA 2LM5A 2KGBC 3V2LA 3NSLA 2MBXA 2COLB 4N5XA 2PVBA 5I94A 3SS3A 3NHIA 3SIBA 2HF5A 2ZN8A 1H8BA 4M2OA 1DJIA 4P5OE 1Y1UA 2JC2A 2NCPA 2V53A 1MXLC 2L51A 1YUUA 2LLUA 1K9PA 1DMOA 1EXRA 1SMGA 3CYZA 1J7PA 2KYCA 5TNCA 1CFFA 4OCIA 1GJYA 5DKNA 3NSKA 4ICBA 2WOSA 1CDPA 1CMGA 3DZTA 4I5JA 1E8AA 4BY4A 2JXLA 3BXKA 1U5IA 2AUCA 4ORBB 4HSZA 4YI8A 5HL1A 1QIVA 3ICBA 1NPQA 1P28A 3DVEA 2P6BB 3OX6A 4IJ7A 1G8IA 1F55A 4HRHA 1CNPA 2GTEA 1KQVA 4OKHA 4M2QA 3BFHA 3S0FA 1KK7Y 2LC5A 2MLEC 1F54A 2KAVA 1OZOA 3S0AA 2NCOA 1OW4A 1TUZA 1KSOA 3CWGA 3TUYB 3RZSA 1LS8A 2FCEA 3EKJA 1UHNA 5B8IB 1CFDA 1UUSA 1HQVA 5I2OA 2F2PA 1AUIB 2JOJA 2NZ0A 3DXLA 4PE4A 2F2OA 2JXCA 2CTNA 1F4QA 4JQ0D 1EH2A 1K9KA 1QX7A 4P2YB 1R6PA 2F3ZA 5JJGA 2MJWB 1A29A 1QV1A 1DGUA 4ORCB 1DJZA 2FJYA 2QACA 4MLWA 3D78A 2YGUA 2KYFA 2H61A 1J7OA 3CABA 2LANA 2PYQA 3D10A 3DD4A 1UHKA 1UHJA 2KLDA 1IQ3A 2H61C 4OV2A 4AQJA 1W9ZA 1IJ6A 1A75B 1MHOA 1QXPA 2L50A 2WCLA 5I2QA 2DOQA 3I5GC 2CBLA 1OSAA 2L2CA 3CR4X 3B6XA 4DIRA 1FW4A 1NCZA 1X02A 2GV5A 3DVMA 5CPVA 1LA3A 1WLZA 1VRKA 1RROA 2VRGA 1TNWA 1PK0D 1Q80A 4XYNA 3EK8A 2E6WA 3L4LA 2EC6C 3O4XA 2MA2A 3CDNA 5JOLA 5PALA 1LVCD 5AEQA 1CLLA 4MRXA 4GFTA 1SCMC 3JVTC 3L47A 4R1EA 4PE7A 1YUSA 2NLNA 1M39A 1XFUO 2RGIA 2K61A 3CZ0A 2MHHA 4USLA 1CLBA 1EL4A 1NUBA 1AHRA 5D7FA 5KTYA 2HETA 1BLQA 1CM1A 1JFKA 1SR6B 2QDIA 4JD9A 3JTDC 4MBEA 3IF7A 1ZFSA 4GAOA 3E3RA 3DF0A 3B87A 4MZJA 1XFXO 2WCKA 5HKYA 1EG4A 2KFGA 1MUXA 3QRXA 3R1OA 2WCMA 1KK7Z 4INXA 3VRRA 1XFWO 2L4IA 2M9GA 1GM0A 1PRWA 3R72A 1KSMA 1M31A 3WHUB 1WDCC 4GNKB 1B7TZ 2CNPA 2G2BA 1L2OC 5D69A 1J1DA 5HYDA 1W7IB 3EVUA 3EVRA 1C3YA 1OOHA 1OZSA 5KSZA 1NX0A 1MR8A 3BYAA 2LVVA 1KCYA 2TN4A 1QX5B 3NXAA 3CZTX 3PFVA 2ZFDA 3I5IC 2QEOA 3IVTA 1PVBA 1IKUA 1DJWA 3M0WA 4BY5A 1FI5A 4YRUA 1DJGA 4PHNA 2O60A 4DCKA 3TS5B 3OP0A 3SS5A 3KHEA 1XYDA 3K21A 4OVNF 2LV7A 3WXAA 3O78A 4XJKB 1CFCA 1CB1A 1S6CA 5DKQA 2KHNA 3D0YB 1YURA 1QLSA 4MVFA 4QJ5B 1NX3A 1U5IB 1MQ1A 3OB2B 2HQ8A 4TNCA 2LHLA 1JF0A 3F45A 3PN7C 1UP5A 1FBVA 5CSIA 2I2RE 3S0BA 3Q8IA 2JT0A 2FOTA 1Y6WA 3AAKA 3B7AA 4C0KA 4WRIA 2BKIB 1W7JB 4YBHB 3I5HC 1BU3A 4GUKA 1MF8B 2QEBA 3DYEA 3WHTB 2KQ6A 1OE9B 5ER4X 3VROA 3FIAA 4JWQA 2PMYA 3SJSA 2CXJA 3EG5B 2P70A 2ZKMX 4ORAB 3SG3A 1KQMC 2KI4C 3SG6A 5BPJA 1TRFA 3AKAA 4M2PA 4PDZA 4U8DA 1AJ4A 4CPVA 1C07A 1K95A 1LA0A 1TNXA 3CS1A 4AOMA 4E68A 1N65A 3PLFB 1K94A 3GOFA 1M46A 1SCVA 1NYAA 3RM1A 1LXFC 3I5IB 1FF1A 2KBIA 1F71A 1WRKA 3N7HA 1SK6D 1YX8A 1EJ3A 1BR4B 1IGVA 4OZDA 1XFZO 3D0YA 3LK1A 1CM4A 2LAPA 1IJ5A 1Y0VH 4XJKA 4YGCB 4MN0A 1QJTA 3D73A 1SSEB 3VRNA 1YRTB 1OMDA 1UWOA 3CR2A 1D1OA 2M97A 3NSOA 2KPHA 1SNLA 2ZNDA 2WCFA 1XK4C 1FI6A 4L9MA 4PT1A 2WCJA 2ZN9A 4PE1A 2E30A 2LVKA 1AK8A 3PM8A 1C7VA 1SW8A 2K60A 2AMIA 1Y1XA 2BAPA 1DQEA 2WCEA 2EC6B 4WQ3A 1G33A 2F8PA 1CTRA 2I18A 3BQ3A 2WCHA 2L4HA 1S3PA 2LVJA 1OMVA 2F3YA 5CSJA 4ETOA 3IQOA 1F8HA 1NX1A 1QIWA 1BR1B 1B47A 1SKTA 3I5GB 1PULA 1S5GZ 1S6IA 3CZ1A 1J1EA 2LNKA 1RTP1 3TDZA 5IBWA 1IH0A 4JKTA 3RLZA 3TDIA 3GK1A 3S0EA 3LLEA 1RFJA 1TWOA 2LVIA 4D1EA 1N0YA 3OGNA 1QX2A 2JT8A 5HKZA 1YR5A 1YRUB 3VRPA 2WC8A 1BODA 3TZ1A 2JNXA 3FE6A 4FQTA 1SL8A 3FE8A 1KFXL 1DELA 2I7AA 2QPTA 4N1GA 2IS9A 1TUJA 1IRJA 1M45A 3SG4A 1Y1AA 1S5GY 1M63B 3S0DA 4CFQA 5FI6A 3H4SE 1C7WA 1JC2A 2LE9B 3A8RA 1BF5A 1C3ZA 3BJHA 3HX4A 4NDBA 4YGEB 1MXEA 1RWYA 3D75A 2O5GA 3FWCA 5D3OA 2JNFA 3O2PA 2OTGC 5F6TA 1DT7B 3CLNA 2K7BA 1JUOA 1A2XA 1NP8A 3UO9A 1YVHA 2BCAA 4PHMA 4ZCUA 1LINA 2LHIA 1ALVA 4I5KA 3SIAA 1RECA 2M3WA 4KYNA 1B8RA 1ZOTB 1WRZA 3CR5X 2JTZA 1XFVO 3PATA 4HRGA 4PE0A 3ZNIA 5FYXA 2K8MB 2OS8C 1R2UA 2Q91A 3K1EA 4YGBB 3EVVA 1DC1A 4Q04A 4A4BA 2BE6A 1YX7A 2EGDA 1FPWA 1PSBA 1B7TY 1KWOB 5EL2A 3BUXB 4UPGA 1LKJA 3KF9A 3CTNA 3LCPC 3SG7A 5AERA 1T14A 1Z4HA 2WCBA 3AAJA 3BOWB 1NCXA 3BUNB 3I5HB 2L5YA 3VB1A 3BOWA 1ALWA 1HT9A 1NWDA 1ODBA 2KDHA 1KFXS 3HCMA 3NSIA 4GBAA 1KFUS 1SYMA 4MSPA 1EG3A 2BBMA 1V1GA 2WNDA 1A03A 1SRAA 3GK2A 1XA5A 3QMEA 2LUXA 2WORA 3PSRA 2ZNEA 2CT9A 2HPSA 2LLTA 1WRLA 2KAYA 1F4OA 2ISDA 3DY9A 3OHMB 2GGMA 1XFYO 1KQMB 2KI4B 2JT3A 3DF0B 5J3XA 5I8NA 2GGZA 1QS7A 3VGOA 5K89A 1N2DA 1K90D 1SY9A 4MRYA 3FS7A 1B8CA 4CFRA 3BUOB 3A4UB 3TUYC 1CLMA 5ER5A 3OX5A 1JBAA 4NDCA 1DJXA 2ZRSA 1XO5A 3NGVA 4I5LB 3O4YA 3PN7B 1QTXA 3CZ2A
chains in the Genus database with same CATH topology
5HLOA 1AJ5A 1J7RA 1QASA 2BL0B 3LK0A 1S1EA 1BOCA 1TCFA 4OR9B 3DVJA 1CDMA 3C1VA 1CMFA 1QATA 4N1FA 2BECA 2ZRTA 1UHIA 3AKBA 3TS5C 2KNEA 1TOPA 2JULA 2L2EA 2BL0C 2L0PA 2CCMA 2Q4UA 5DKRA 4MEWA 3SG5A 1PALA 1WLMA 4GPLB 1UHHA 1TN4A 1JSAA 3JTDB 4GGFC 1ZUZA 5CSFA 1ZACA 1XVJA 3MSEB 2M29A 2FCDA 2H2KA 2MLFC 1JFJA 4MZLA 3BUWB 1SCMB 1SBJA 2K7DA 1IQ5A 2M1KB 1JWDA 1GQMA 1WDCB 3JVTB 1IG5A 1UURA 2M49B 1A75A 3KPXA 1F70A 1YTZC 3KO0A 1S26D 4C0JA 5AFPA 3EK7A 1KFUL 1CDNA 2LUCA 2OPOA 2A4JA 1ZMZA 2F33A 2I94A 2LMUA 2NXQA 2JQ6A 1SL9A 1AVSA 4I5NB 1DF0B 1CFPA 2JU0A 1TTXA 3IQQA 1K96A 1SPYA 2Y5IA 2PRUA 1OMRA 1YVLA 2LP3A 2BKHB 1B9AA 1V1FA 1S36A 5HKWA 4GGFA 4WQ2A 3VRQA 1OOJA 3LL8B 3WNXB 1MWNA 1YUTA 2AAOA 2K2FA 2R2IA 1OQPA 2L5XB 3FWBA 4AQIA 1L7ZA 1J7QA 1PSRA 4DUQA 1NCYA 5GQQC 2KAXA 2KGRA 4PALA 2LCPA 2M1UA 4YGAA 1A4PA 2BE4A 5CSNA 1CKKA 3SG2A 3BUMB 3PALA 1K93D 4YGDB 2K2AA 1NSHA 2B1UA 1XK4A 2PSRA 3OB1B 2KBMA 1TCOB 2KI6C 1QLKA 2PALA 1BG1A 1KK8B 2L98A 1J55A 2LMVA 2BCXA 3EKHA 4DS7A 5I2LA 4JPZB 1DGVA 2KSPA 4FTGA 4GGNA 3CGAA 4PHJA 5AANA 1RJVA 1SL7A 5KU1A 1B8LA 1QVIZ 1TNQA 2PASA 1G4YR 4A4CA 1JF2A 1RK9A 2KOTA 2OTGB 4IL1A 5AXIA 4DRWA 1GGZA 2BBNA 2LLSA 2MRDA 2JRFA 2K0JA 1QV0A 1TIZA 2KFHA 4PHKA 1L2OB 1BJFA 2FJUB 5HLVA 2KQYA 2K7CA 1DJHA 1DF0A 2D8NA 1SR6C 3DVKA 1GGWA 2Y1NA 2G9BA 1DTLA 2JPTA 2M7NA 1B1GA 2JZIA 4QJ4B 4NQGA 4CLNA 1NX2A 4CIDA 4NDDA 3O6BA 2JTTA 2LMTA 4MZKA 1DJYA 2Y4QA 1KWOC 2M0RA 2SASA 4C0LA 2LP2A 3ZWHA 1QVIY 1TNPA 2JWWA 3I5FB 4FQOA 1B4CA 2BCBA 3GK4X 4HREE 2K7OA 4PCWA 3KEVA 4F0ZB 1H4BA 1S6JA 2EHBA 1DVIA 2KI6D 4QJ3B 2M7LA 1NIWA 2MAZA 2KFFA 1BT6A 2HQWA 1AP4A 3I5FC 1K8UA 1KK8C 1IWQA 1CDLA 4ZCVA 3TDUA 3EK4A 2Y1MA 2OS8B 1WY9A 4YI9A 1BMOA 5G08A 1K9UA 1PVAA 2SCPA 1K2HA 2M8UA 2LM5A 2KGBC 3NSLA 2MBXA 2COLB 4N5XA 2PVBA 3SIBA 2HF5A 2ZN8A 1H8BA 4M2OA 1DJIA 4P5OE 1Y1UA 2JC2A 2NCPA 2V53A 1MXLC 2L51A 1YUUA 2LLUA 1K9PA 1DMOA 1EXRA 1SMGA 1J7PA 2KYCA 5TNCA 1CFFA 4OCIA 1GJYA 5DKNA 3NSKA 4ICBA 2WOSA 1CDPA 1CMGA 4I5JA 1E8AA 4BY4A 2JXLA 3BXKA 1U5IA 2AUCA 4ORBB 4HSZA 4YI8A 1QIVA 3ICBA 1NPQA 3DVEA 2P6BB 3OX6A 1G8IA 1F55A 4HRHA 1CNPA 1KQVA 4OKHA 4M2QA 1KK7Y 2LC5A 2MLEC 1F54A 2KAVA 1OZOA 2NCOA 1KSOA 3CWGA 3TUYB 2FCEA 3EKJA 1UHNA 5B8IB 1CFDA 1UUSA 1HQVA 5I2OA 2F2PA 1AUIB 2JOJA 2NZ0A 4PE4A 2F2OA 2JXCA 1F4QA 2CTNA 4JQ0D 1EH2A 1K9KA 1QX7A 4P2YB 1R6PA 2F3ZA 5JJGA 2MJWB 1A29A 1QV1A 1DGUA 4ORCB 1DJZA 2QACA 4MLWA 2KYFA 2H61A 1J7OA 2LANA 3DD4A 3D10A 1UHKA 1UHJA 1IQ3A 2H61C 4OV2A 4AQJA 1IJ6A 1A75B 1MHOA 1QXPA 2L50A 5I2QA 2DOQA 3I5GC 2CBLA 1OSAA 3CR4X 4DIRA 1FW4A 1NCZA 1X02A 2GV5A 3DVMA 5CPVA 1LA3A 1WLZA 1VRKA 1RROA 2VRGA 1TNWA 1PK0D 1Q80A 4XYNA 3EK8A 2E6WA 2EC6C 2MA2A 5JOLA 5PALA 1LVCD 5AEQA 1CLLA 4MRXA 4GFTA 1SCMC 3JVTC 4R1EA 4PE7A 1YUSA 2NLNA 1M39A 1XFUO 2RGIA 2K61A 4USLA 2MHHA 1CLBA 1EL4A 1NUBA 1AHRA 5D7FA 5KTYA 2HETA 1BLQA 1CM1A 1JFKA 1SR6B 3JTDC 4MBEA 3IF7A 1ZFSA 4GAOA 3E3RA 3DF0A 4MZJA 1XFXO 5HKYA 1EG4A 2KFGA 1MUXA 3QRXA 3VRRA 1KK7Z 1XFWO 2L4IA 2M9GA 1PRWA 1KSMA 1M31A 3WHUB 1WDCC 4GNKB 1B7TZ 2CNPA 2G2BA 1L2OC 5D69A 1J1DA 5HYDA 1W7IB 3EVUA 3EVRA 1OZSA 5KSZA 1NX0A 1MR8A 3BYAA 2LVVA 1KCYA 2TN4A 1QX5B 3NXAA 3CZTX 3PFVA 2ZFDA 3I5IC 1PVBA 1IKUA 1DJWA 3M0WA 4BY5A 1FI5A 4YRUA 1DJGA 4PHNA 2O60A 4DCKA 3TS5B 3OP0A 3KHEA 1XYDA 3K21A 4OVNF 2LV7A 3WXAA 3O78A 4XJKB 1CFCA 1CB1A 1S6CA 5DKQA 2KHNA 3D0YB 1YURA 1QLSA 4MVFA 4QJ5B 1NX3A 1U5IB 1MQ1A 3OB2B 2HQ8A 4TNCA 2LHLA 1JF0A 3F45A 3PN7C 1UP5A 1FBVA 5CSIA 2I2RE 2JT0A 2FOTA 1Y6WA 3AAKA 4C0KA 4WRIA 2BKIB 1W7JB 4YBHB 3I5HC 1BU3A 4GUKA 1MF8B 3WHTB 2KQ6A 1OE9B 5ER4X 3VROA 3FIAA 4JWQA 2PMYA 3SJSA 2CXJA 2ZKMX 4ORAB 3SG3A 1KQMC 2KI4C 3SG6A 5BPJA 1TRFA 3AKAA 4M2PA 4PDZA 4U8DA 1AJ4A 4CPVA 1C07A 1K95A 1LA0A 1TNXA 3CS1A 4AOMA 4E68A 1N65A 3PLFB 1K94A 3GOFA 1M46A 1SCVA 1NYAA 3RM1A 1LXFC 3I5IB 1FF1A 2KBIA 1F71A 1WRKA 1SK6D 1YX8A 1EJ3A 1BR4B 1IGVA 1XFZO 3D0YA 3LK1A 1CM4A 2LAPA 1IJ5A 1Y0VH 4XJKA 4YGCB 4MN0A 1QJTA 3VRNA 1YRTB 1OMDA 1UWOA 3CR2A 1D1OA 2M97A 3NSOA 1SNLA 2ZNDA 2WCFA 1XK4C 1FI6A 4L9MA 2ZN9A 4PE1A 2E30A 2LVKA 1AK8A 3PM8A 1C7VA 1SW8A 2AMIA 1Y1XA 2WCEA 2EC6B 4WQ3A 1G33A 2F8PA 1CTRA 2I18A 3BQ3A 2L4HA 1S3PA 2LVJA 1OMVA 2F3YA 5CSJA 4ETOA 3IQOA 1F8HA 1NX1A 1QIWA 1BR1B 1B47A 1SKTA 3I5GB 1PULA 1S5GZ 1S6IA 3TDZA 1J1EA 2LNKA 1RTP1 5IBWA 1IH0A 3RLZA 3TDIA 3GK1A 3LLEA 1RFJA 2LVIA 4D1EA 1N0YA 1QX2A 2JT8A 5HKZA 1YR5A 1YRUB 3VRPA 2WC8A 1BODA 3TZ1A 2JNXA 1SL8A 1KFXL 2I7AA 2QPTA 4N1GA 2IS9A 1IRJA 1M45A 3SG4A 1Y1AA 1S5GY 1M63B 4CFQA 3H4SE 1C7WA 1JC2A 2LE9B 3A8RA 1BF5A 3HX4A 4NDBA 4YGEB 1MXEA 1RWYA 2O5GA 3FWCA 2JNFA 3O2PA 2OTGC 5F6TA 1DT7B 3CLNA 2K7BA 1JUOA 1A2XA 1NP8A 1YVHA 2BCAA 4PHMA 4ZCUA 1LINA 2LHIA 1ALVA 4I5KA 3SIAA 1RECA 2M3WA 1B8RA 1ZOTB 1WRZA 3CR5X 2JTZA 1XFVO 3PATA 4HRGA 4PE0A 3ZNIA 5FYXA 2K8MB 2OS8C 1R2UA 2Q91A 4YGBB 3EVVA 4Q04A 4A4BA 2BE6A 1YX7A 2EGDA 1FPWA 1PSBA 1B7TY 1KWOB 3BUXB 4UPGA 1LKJA 3KF9A 3CTNA 3LCPC 3SG7A 5AERA 2WCBA 3AAJA 3BOWB 1NCXA 3BUNB 3I5HB 3BOWA 1ALWA 1HT9A 1NWDA 1ODBA 2KDHA 1KFXS 3HCMA 3NSIA 4GBAA 1KFUS 1SYMA 4MSPA 1EG3A 2BBMA 1V1GA 2WNDA 1A03A 1SRAA 3GK2A 1XA5A 2LUXA 2WORA 3PSRA 2ZNEA 2CT9A 2HPSA 2LLTA 1WRLA 2KAYA 1F4OA 2ISDA 3OHMB 2GGMA 1XFYO 1KQMB 2KI4B 2JT3A 3DF0B 5J3XA 5I8NA 2GGZA 1QS7A 3VGOA 5K89A 1N2DA 1K90D 1SY9A 4MRYA 3FS7A 1B8CA 4CFRA 3BUOB 3A4UB 3TUYC 1CLMA 5ER5A 3OX5A 1JBAA 4NDCA 1DJXA 2ZRSA 1XO5A 4I5LB 3O4YA 3PN7B 1QTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLO A;  1AJ5 A;  1J7R A;  1QAS A;  2BL0 B;  3LK0 A;  1S1E A;  1BOC A;  1TCF A;  4OR9 B;  3DVJ A;  1CDM A;  3C1V A;  1CMF A;  1QAT A;  4N1F A;  2BEC A;  2ZRT A;  1UHI A;  3AKB A;  3TS5 C;  2KNE A;  1TOP A;  2JUL A;  2L2E A;  2BL0 C;  2L0P A;  2CCM A;  2Q4U A;  5DKR A;  4MEW A;  3SG5 A;  1PAL A;  1WLM A;  4GPL B;  1UHH A;  1TN4 A;  1JSA A;  3JTD B;  4GGF C;  1ZUZ A;  5CSF A;  1ZAC A;  1XVJ A;  3MSE B;  2M29 A;  2FCD A;  2H2K A;  2MLF C;  1JFJ A;  4MZL A;  3BUW B;  1SCM B;  1SBJ A;  2K7D A;  1IQ5 A;  2M1K B;  1JWD A;  1GQM A;  1WDC B;  3JVT B;  1IG5 A;  1UUR A;  2M49 B;  1A75 A;  3KPX A;  1F70 A;  1YTZ C;  3KO0 A;  1S26 D;  4C0J A;  5AFP A;  3EK7 A;  1KFU L;  1CDN A;  2LUC A;  2OPO A;  2A4J A;  1ZMZ A;  2F33 A;  2I94 A;  2LMU A;  2NXQ A;  2JQ6 A;  1SL9 A;  1AVS A;  4I5N B;  1DF0 B;  1CFP A;  2JU0 A;  1TTX A;  3IQQ A;  1K96 A;  1SPY A;  2Y5I A;  2PRU A;  1OMR A;  1YVL A;  2LP3 A;  2BKH B;  1B9A A;  1V1F A;  1S36 A;  5HKW A;  4GGF A;  4WQ2 A;  3VRQ A;  1OOJ A;  3LL8 B;  3WNX B;  1MWN A;  1YUT A;  2AAO A;  2K2F A;  2R2I A;  1OQP A;  2L5X B;  3FWB A;  4AQI A;  1L7Z A;  1J7Q A;  1PSR A;  4DUQ A;  1NCY A;  5GQQ C;  2KAX A;  2KGR A;  4PAL A;  2LCP A;  2M1U A;  4YGA A;  1A4P A;  2BE4 A;  5CSN A;  1CKK A;  3SG2 A;  3BUM B;  3PAL A;  1K93 D;  4YGD B;  2K2A A;  1NSH A;  2B1U A;  1XK4 A;  2PSR A;  3OB1 B;  2KBM A;  1TCO B;  2KI6 C;  1QLK A;  2PAL A;  1BG1 A;  1KK8 B;  2L98 A;  1J55 A;  2LMV A;  2BCX A;  3EKH A;  4DS7 A;  5I2L A;  4JPZ B;  1DGV A;  2KSP A;  4FTG A;  4GGN A;  3CGA A;  4PHJ A;  5AAN A;  1RJV A;  1SL7 A;  5KU1 A;  1B8L A;  1QVI Z;  1TNQ A;  2PAS A;  1G4Y R;  4A4C A;  1JF2 A;  1RK9 A;  2KOT A;  2OTG B;  4IL1 A;  5AXI A;  4DRW A;  1GGZ A;  2BBN A;  2LLS A;  2MRD A;  2JRF A;  2K0J A;  1QV0 A;  1TIZ A;  2KFH A;  4PHK A;  1L2O B;  1BJF A;  2FJU B;  5HLV A;  2KQY A;  2K7C A;  1DJH A;  1DF0 A;  2D8N A;  1SR6 C;  3DVK A;  1GGW A;  2Y1N A;  2G9B A;  1DTL A;  2JPT A;  2M7N A;  1B1G A;  2JZI A;  4QJ4 B;  4NQG A;  4CLN A;  1NX2 A;  4CID A;  4NDD A;  3O6B A;  2JTT A;  2LMT A;  4MZK A;  1DJY A;  2Y4Q A;  1KWO C;  2M0R A;  2SAS A;  4C0L A;  2LP2 A;  3ZWH A;  1QVI Y;  1TNP A;  2JWW A;  3I5F B;  4FQO A;  1B4C A;  2BCB A;  3GK4 X;  4HRE E;  2K7O A;  4PCW A;  3KEV A;  4F0Z B;  1H4B A;  1S6J A;  2EHB A;  1DVI A;  2KI6 D;  4QJ3 B;  2M7L A;  1NIW A;  2MAZ A;  2KFF A;  1BT6 A;  2HQW A;  1AP4 A;  3I5F C;  1K8U A;  1KK8 C;  1IWQ A;  1CDL A;  4ZCV A;  3TDU A;  3EK4 A;  2Y1M A;  2OS8 B;  1WY9 A;  4YI9 A;  1BMO A;  5G08 A;  1K9U A;  1PVA A;  2SCP A;  1K2H A;  2M8U A;  2LM5 A;  2KGB C;  3NSL A;  2MBX A;  2COL B;  4N5X A;  2PVB A;  3SIB A;  2HF5 A;  2ZN8 A;  1H8B A;  4M2O A;  1DJI A;  4P5O E;  1Y1U A;  2JC2 A;  2NCP A;  2V53 A;  1MXL C;  2L51 A;  1YUU A;  2LLU A;  1K9P A;  1DMO A;  1EXR A;  1SMG A;  1J7P A;  2KYC A;  5TNC A;  1CFF A;  4OCI A;  1GJY A;  5DKN A;  3NSK A;  4ICB A;  2WOS A;  1CDP A;  1CMG A;  4I5J A;  1E8A A;  4BY4 A;  2JXL A;  3BXK A;  1U5I A;  2AUC A;  4ORB B;  4HSZ A;  4YI8 A;  1QIV A;  3ICB A;  1NPQ A;  3DVE A;  2P6B B;  3OX6 A;  1G8I A;  1F55 A;  4HRH A;  1CNP A;  1KQV A;  4OKH A;  4M2Q A;  1KK7 Y;  2LC5 A;  2MLE C;  1F54 A;  2KAV A;  1OZO A;  2NCO A;  1KSO A;  3CWG A;  3TUY B;  2FCE A;  3EKJ A;  1UHN A;  5B8I B;  1CFD A;  1UUS A;  1HQV A;  5I2O A;  2F2P A;  1AUI B;  2JOJ A;  2NZ0 A;  4PE4 A;  2F2O A;  2JXC A;  1F4Q A;  2CTN A;  4JQ0 D;  1EH2 A;  1K9K A;  1QX7 A;  4P2Y B;  1R6P A;  2F3Z A;  5JJG A;  2MJW B;  1A29 A;  1QV1 A;  1DGU A;  4ORC B;  1DJZ A;  2QAC A;  4MLW A;  2KYF A;  2H61 A;  1J7O A;  2LAN A;  3DD4 A;  3D10 A;  1UHK A;  1UHJ A;  1IQ3 A;  2H61 C;  4OV2 A;  4AQJ A;  1IJ6 A;  1A75 B;  1MHO A;  1QXP A;  2L50 A;  5I2Q A;  2DOQ A;  3I5G C;  2CBL A;  1OSA A;  3CR4 X;  4DIR A;  1FW4 A;  1NCZ A;  1X02 A;  2GV5 A;  3DVM A;  5CPV A;  1LA3 A;  1WLZ A;  1VRK A;  1RRO A;  2VRG A;  1TNW A;  1PK0 D;  1Q80 A;  4XYN A;  3EK8 A;  2E6W A;  2EC6 C;  2MA2 A;  5JOL A;  5PAL A;  1LVC D;  5AEQ A;  1CLL A;  4MRX A;  4GFT A;  1SCM C;  3JVT C;  4R1E A;  4PE7 A;  1YUS A;  2NLN A;  1M39 A;  1XFU O;  2RGI A;  2K61 A;  4USL A;  2MHH A;  1CLB A;  1EL4 A;  1NUB A;  1AHR A;  5D7F A;  5KTY A;  2HET A;  1BLQ A;  1CM1 A;  1JFK A;  1SR6 B;  3JTD C;  4MBE A;  3IF7 A;  1ZFS A;  4GAO A;  3E3R A;  3DF0 A;  4MZJ A;  1XFX O;  5HKY A;  1EG4 A;  2KFG A;  1MUX A;  3QRX A;  3VRR A;  1KK7 Z;  1XFW O;  2L4I A;  2M9G A;  1PRW A;  1KSM A;  1M31 A;  3WHU B;  1WDC C;  4GNK B;  1B7T Z;  2CNP A;  2G2B A;  1L2O C;  5D69 A;  1J1D A;  5HYD A;  1W7I B;  3EVU A;  3EVR A;  1OZS A;  5KSZ A;  1NX0 A;  1MR8 A;  3BYA A;  2LVV A;  1KCY A;  2TN4 A;  1QX5 B;  3NXA A;  3CZT X;  3PFV A;  2ZFD A;  3I5I C;  1PVB A;  1IKU A;  1DJW A;  3M0W A;  4BY5 A;  1FI5 A;  4YRU A;  1DJG A;  4PHN A;  2O60 A;  4DCK A;  3TS5 B;  3OP0 A;  3KHE A;  1XYD A;  3K21 A;  4OVN F;  2LV7 A;  3WXA A;  3O78 A;  4XJK B;  1CFC A;  1CB1 A;  1S6C A;  5DKQ A;  2KHN A;  3D0Y B;  1YUR A;  1QLS A;  4MVF A;  4QJ5 B;  1NX3 A;  1U5I B;  1MQ1 A;  3OB2 B;  2HQ8 A;  4TNC A;  2LHL A;  1JF0 A;  3F45 A;  3PN7 C;  1UP5 A;  1FBV A;  5CSI A;  2I2R E;  2JT0 A;  2FOT A;  1Y6W A;  3AAK A;  4C0K A;  4WRI A;  2BKI B;  1W7J B;  4YBH B;  3I5H C;  1BU3 A;  4GUK A;  1MF8 B;  3WHT B;  2KQ6 A;  1OE9 B;  5ER4 X;  3VRO A;  3FIA A;  4JWQ A;  2PMY A;  3SJS A;  2CXJ A;  2ZKM X;  4ORA B;  3SG3 A;  1KQM C;  2KI4 C;  3SG6 A;  5BPJ A;  1TRF A;  3AKA A;  4M2P A;  4PDZ A;  4U8D A;  1AJ4 A;  4CPV A;  1C07 A;  1K95 A;  1LA0 A;  1TNX A;  3CS1 A;  4AOM A;  4E68 A;  1N65 A;  3PLF B;  1K94 A;  3GOF A;  1M46 A;  1SCV A;  1NYA A;  3RM1 A;  1LXF C;  3I5I B;  1FF1 A;  2KBI A;  1F71 A;  1WRK A;  1SK6 D;  1YX8 A;  1EJ3 A;  1BR4 B;  1IGV A;  1XFZ O;  3D0Y A;  3LK1 A;  1CM4 A;  2LAP A;  1IJ5 A;  1Y0V H;  4XJK A;  4YGC B;  4MN0 A;  1QJT A;  3VRN A;  1YRT B;  1OMD A;  1UWO A;  3CR2 A;  1D1O A;  2M97 A;  3NSO A;  1SNL A;  2ZND A;  2WCF A;  1XK4 C;  1FI6 A;  4L9M A;  2ZN9 A;  4PE1 A;  2E30 A;  2LVK A;  1AK8 A;  3PM8 A;  1C7V A;  1SW8 A;  2AMI A;  1Y1X A;  2WCE A;  2EC6 B;  4WQ3 A;  1G33 A;  2F8P A;  1CTR A;  2I18 A;  3BQ3 A;  2L4H A;  1S3P A;  2LVJ A;  1OMV A;  2F3Y A;  5CSJ A;  4ETO A;  3IQO A;  1F8H A;  1NX1 A;  1QIW A;  1BR1 B;  1B47 A;  1SKT A;  3I5G B;  1PUL A;  1S5G Z;  1S6I A;  3TDZ A;  1J1E A;  2LNK A;  1RTP 1;  5IBW A;  1IH0 A;  3RLZ A;  3TDI A;  3GK1 A;  3LLE A;  1RFJ A;  2LVI A;  4D1E A;  1N0Y A;  1QX2 A;  2JT8 A;  5HKZ A;  1YR5 A;  1YRU B;  3VRP A;  2WC8 A;  1BOD A;  3TZ1 A;  2JNX A;  1SL8 A;  1KFX L;  2I7A A;  2QPT A;  4N1G A;  2IS9 A;  1IRJ A;  1M45 A;  3SG4 A;  1Y1A A;  1S5G Y;  1M63 B;  4CFQ A;  3H4S E;  1C7W A;  1JC2 A;  2LE9 B;  3A8R A;  1BF5 A;  3HX4 A;  4NDB A;  4YGE B;  1MXE A;  1RWY A;  2O5G A;  3FWC A;  2JNF A;  3O2P A;  2OTG C;  5F6T A;  1DT7 B;  3CLN A;  2K7B A;  1JUO A;  1A2X A;  1NP8 A;  1YVH A;  2BCA A;  4PHM A;  4ZCU A;  1LIN A;  2LHI A;  1ALV A;  4I5K A;  3SIA A;  1REC A;  2M3W A;  1B8R A;  1ZOT B;  1WRZ A;  3CR5 X;  2JTZ A;  1XFV O;  3PAT A;  4HRG A;  4PE0 A;  3ZNI A;  5FYX A;  2K8M B;  2OS8 C;  1R2U A;  2Q91 A;  4YGB B;  3EVV A;  4Q04 A;  4A4B A;  2BE6 A;  1YX7 A;  2EGD A;  1FPW A;  1PSB A;  1B7T Y;  1KWO B;  3BUX B;  4UPG A;  1LKJ A;  3KF9 A;  3CTN A;  3LCP C;  3SG7 A;  5AER A;  2WCB A;  3AAJ A;  3BOW B;  1NCX A;  3BUN B;  3I5H B;  3BOW A;  1ALW A;  1HT9 A;  1NWD A;  1ODB A;  2KDH A;  1KFX S;  3HCM A;  3NSI A;  4GBA A;  1KFU S;  1SYM A;  4MSP A;  1EG3 A;  2BBM A;  1V1G A;  2WND A;  1A03 A;  1SRA A;  3GK2 A;  1XA5 A;  2LUX A;  2WOR A;  3PSR A;  2ZNE A;  2CT9 A;  2HPS A;  2LLT A;  1WRL A;  2KAY A;  1F4O A;  2ISD A;  3OHM B;  2GGM A;  1XFY O;  1KQM B;  2KI4 B;  2JT3 A;  3DF0 B;  5J3X A;  5I8N A;  2GGZ A;  1QS7 A;  3VGO A;  5K89 A;  1N2D A;  1K90 D;  1SY9 A;  4MRY A;  3FS7 A;  1B8C A;  4CFR A;  3BUO B;  3A4U B;  3TUY C;  1CLM A;  5ER5 A;  3OX5 A;  1JBA A;  4NDC A;  1DJX A;  2ZRS A;  1XO5 A;  4I5L B;  3O4Y A;  3PN7 B;  1QTX A; 
#chains in the Genus database with same CATH topology
 5HLO A;  1AJ5 A;  1J7R A;  2ERB A;  1QAS A;  3S0G A;  1OOI X;  2BL0 B;  3LK0 A;  1S1E A;  1BOC A;  1TCF A;  4OR9 B;  3DVJ A;  1CDM A;  3C1V A;  1CMF A;  1QAT A;  4N1F A;  2BEC A;  2ZRT A;  1UHI A;  3AKB A;  3TS5 C;  2KNE A;  2WC5 A;  1TOP A;  2JUL A;  2P71 A;  2L2E A;  2BL0 C;  2L0P A;  2CCM A;  2Q4U A;  5DKR A;  4MEW A;  3SG5 A;  1PAL A;  1WLM A;  4GPL B;  1UHH A;  3OBV A;  1TN4 A;  1JSA A;  3JTD B;  4GGF C;  1ZUZ A;  5CSF A;  1ZAC A;  1XVJ A;  3MSE B;  2M29 A;  2FCD A;  4INW A;  2H2K A;  2MLF C;  1JFJ A;  4MZL A;  3BUW B;  1SCM B;  1SBJ A;  2K7D A;  1IQ5 A;  2M1K B;  1JWD A;  1GQM A;  1WDC B;  3JVT B;  1OOF A;  1IG5 A;  1UUR A;  2M49 B;  1A75 A;  3D77 A;  3KPX A;  1F70 A;  1YTZ C;  3KO0 A;  1S26 D;  4C0J A;  5AFP A;  3EK7 A;  1KFU L;  3PJI A;  2LUC A;  2OPO A;  2A4J A;  1CDN A;  1ZMZ A;  3B88 A;  2F33 A;  2I94 A;  2LMU A;  2NXQ A;  2JQ6 A;  3BFB A;  1SL9 A;  1AVS A;  4I5N B;  1DF0 B;  3BFA A;  1CFP A;  2JU0 A;  1TTX A;  3IQQ A;  1K96 A;  1SPY A;  2Y5I A;  3D76 A;  2PRU A;  4F7F A;  1OMR A;  1YVL A;  2LP3 A;  2BKH B;  1B9A A;  1IIO A;  1V1F A;  1S36 A;  5HKW A;  3NHT A;  4GGF A;  4WQ2 A;  3VRQ A;  1OOJ A;  1XFR A;  3LL8 B;  3WNX B;  1MWN A;  1YUT A;  2AAO A;  2K2F A;  2R2I A;  1OQP A;  2L5X B;  3FWB A;  4AQI A;  1L7Z A;  1J7Q A;  1PSR A;  4DUQ A;  1NCY A;  5GQQ C;  2KAX A;  2KGR A;  4PAL A;  2LCP A;  2M1U A;  4YGA A;  1A4P A;  2BE4 A;  5CSN A;  1CKK A;  3SG2 A;  3BUM B;  3PAL A;  1K93 D;  4YGD B;  2K2A A;  1NSH A;  2B1U A;  1XK4 A;  2PSR A;  3OB1 B;  2KBM A;  1ORG A;  1TCO B;  2KI6 C;  3R1P A;  1QLK A;  1QWV A;  2PAL A;  1BG1 A;  1KK8 B;  2L98 A;  1J55 A;  1OOG A;  2LMV A;  2BCX A;  3EKH A;  4DS7 A;  5I2L A;  4JPZ B;  1DGV A;  2KSP A;  4FTG A;  4GGN A;  3CGA A;  4PHJ A;  5FI2 A;  5AAN A;  1RJV A;  1SL7 A;  5KU1 A;  1B8L A;  1QVI Z;  1TNQ A;  2PAS A;  1G4Y R;  4A4C A;  1JF2 A;  3D74 A;  1RK9 A;  2KOT A;  2OTG B;  4IL1 A;  5AXI A;  4DRW A;  1GGZ A;  2BBN A;  2LLS A;  2WC6 A;  2PQL A;  2MRD A;  2JRF A;  2K0J A;  1QV0 A;  1TIZ A;  2KFH A;  4PHK A;  1Z2C B;  1L2O B;  1BJF A;  2FJU B;  5HLV A;  2KQY A;  2K7C A;  1DJH A;  1DF0 A;  2D8N A;  1SR6 C;  3DVK A;  1GGW A;  3UNW A;  2Y1N A;  3R1V A;  1DTL A;  2G9B A;  2JPT A;  2M7N A;  5FI7 A;  1B1G A;  3PM2 A;  3B86 A;  2JZI A;  2KLE A;  4NQG A;  4CLN A;  4QJ4 B;  1NX2 A;  5DIC A;  4CID A;  2BNX A;  4NDD A;  2QEH A;  3O6B A;  2JTT A;  2LMT A;  4MZK A;  1DJY A;  2Y4Q A;  1KWO C;  2M0R A;  2SAS A;  4C0L A;  2LP2 A;  3ZWH A;  1QVI Y;  1TNP A;  2JWW A;  3I5F B;  4FQO A;  1B4C A;  2BCB A;  3GK4 X;  4HRE E;  2K7O A;  4PCW A;  3KEV A;  4F0Z B;  1H4B A;  1S6J A;  2EHB A;  1DVI A;  2KI6 D;  4QJ3 B;  2M7L A;  1NIW A;  2JPO A;  2MAZ A;  1DEK A;  2KFF A;  1BT6 A;  2HQW A;  1AP4 A;  3I5F C;  1K8U A;  1KK8 C;  3L4A A;  1IWQ A;  1CDL A;  3FE9 A;  4ZCV A;  3TDU A;  3EK4 A;  2Y1M A;  2H8V A;  2OS8 B;  1WY9 A;  4YI9 A;  3SS4 A;  1BMO A;  5G08 A;  1K9U A;  1PVA A;  2QEV A;  2SCP A;  1K2H A;  2M8U A;  2LM5 A;  2KGB C;  3V2L A;  3NSL A;  2MBX A;  2COL B;  4N5X A;  2PVB A;  5I94 A;  3SS3 A;  3NHI A;  3SIB A;  2HF5 A;  2ZN8 A;  1H8B A;  4M2O A;  1DJI A;  4P5O E;  1Y1U A;  2JC2 A;  2NCP A;  2V53 A;  1MXL C;  2L51 A;  1YUU A;  2LLU A;  1K9P A;  1DMO A;  1EXR A;  1SMG A;  3CYZ A;  1J7P A;  2KYC A;  5TNC A;  1CFF A;  4OCI A;  1GJY A;  5DKN A;  3NSK A;  4ICB A;  2WOS A;  1CDP A;  1CMG A;  3DZT A;  4I5J A;  1E8A A;  4BY4 A;  2JXL A;  3BXK A;  1U5I A;  2AUC A;  4ORB B;  4HSZ A;  4YI8 A;  5HL1 A;  1QIV A;  3ICB A;  1NPQ A;  1P28 A;  3DVE A;  2P6B B;  3OX6 A;  4IJ7 A;  1G8I A;  1F55 A;  4HRH A;  1CNP A;  2GTE A;  1KQV A;  4OKH A;  4M2Q A;  3BFH A;  3S0F A;  1KK7 Y;  2LC5 A;  2MLE C;  1F54 A;  2KAV A;  1OZO A;  3S0A A;  2NCO A;  1OW4 A;  1TUZ A;  1KSO A;  3CWG A;  3TUY B;  3RZS A;  1LS8 A;  2FCE A;  3EKJ A;  1UHN A;  5B8I B;  1CFD A;  1UUS A;  1HQV A;  5I2O A;  2F2P A;  1AUI B;  2JOJ A;  2NZ0 A;  3DXL A;  4PE4 A;  2F2O A;  2JXC A;  2CTN A;  1F4Q A;  4JQ0 D;  1EH2 A;  1K9K A;  1QX7 A;  4P2Y B;  1R6P A;  2F3Z A;  5JJG A;  2MJW B;  1A29 A;  1QV1 A;  1DGU A;  4ORC B;  1DJZ A;  2FJY A;  2QAC A;  4MLW A;  3D78 A;  2YGU A;  2KYF A;  2H61 A;  1J7O A;  3CAB A;  2LAN A;  2PYQ A;  3D10 A;  3DD4 A;  1UHK A;  1UHJ A;  2KLD A;  1IQ3 A;  2H61 C;  4OV2 A;  4AQJ A;  1W9Z A;  1IJ6 A;  1A75 B;  1MHO A;  1QXP A;  2L50 A;  2WCL A;  5I2Q A;  2DOQ A;  3I5G C;  2CBL A;  1OSA A;  2L2C A;  3CR4 X;  3B6X A;  4DIR A;  1FW4 A;  1NCZ A;  1X02 A;  2GV5 A;  3DVM A;  5CPV A;  1LA3 A;  1WLZ A;  1VRK A;  1RRO A;  2VRG A;  1TNW A;  1PK0 D;  1Q80 A;  4XYN A;  3EK8 A;  2E6W A;  3L4L A;  2EC6 C;  3O4X A;  2MA2 A;  3CDN A;  5JOL A;  5PAL A;  1LVC D;  5AEQ A;  1CLL A;  4MRX A;  4GFT A;  1SCM C;  3JVT C;  3L47 A;  4R1E A;  4PE7 A;  1YUS A;  2NLN A;  1M39 A;  1XFU O;  2RGI A;  2K61 A;  3CZ0 A;  2MHH A;  4USL A;  1CLB A;  1EL4 A;  1NUB A;  1AHR A;  5D7F A;  5KTY A;  2HET A;  1BLQ A;  1CM1 A;  1JFK A;  1SR6 B;  2QDI A;  4JD9 A;  3JTD C;  4MBE A;  3IF7 A;  1ZFS A;  4GAO A;  3E3R A;  3DF0 A;  3B87 A;  4MZJ A;  1XFX O;  2WCK A;  5HKY A;  1EG4 A;  2KFG A;  1MUX A;  3QRX A;  3R1O A;  2WCM A;  1KK7 Z;  4INX A;  3VRR A;  1XFW O;  2L4I A;  2M9G A;  1GM0 A;  1PRW A;  3R72 A;  1KSM A;  1M31 A;  3WHU B;  1WDC C;  4GNK B;  1B7T Z;  2CNP A;  2G2B A;  1L2O C;  5D69 A;  1J1D A;  5HYD A;  1W7I B;  3EVU A;  3EVR A;  1C3Y A;  1OOH A;  1OZS A;  5KSZ A;  1NX0 A;  1MR8 A;  3BYA A;  2LVV A;  1KCY A;  2TN4 A;  1QX5 B;  3NXA A;  3CZT X;  3PFV A;  2ZFD A;  3I5I C;  2QEO A;  3IVT A;  1PVB A;  1IKU A;  1DJW A;  3M0W A;  4BY5 A;  1FI5 A;  4YRU A;  1DJG A;  4PHN A;  2O60 A;  4DCK A;  3TS5 B;  3OP0 A;  3SS5 A;  3KHE A;  1XYD A;  3K21 A;  4OVN F;  2LV7 A;  3WXA A;  3O78 A;  4XJK B;  1CFC A;  1CB1 A;  1S6C A;  5DKQ A;  2KHN A;  3D0Y B;  1YUR A;  1QLS A;  4MVF A;  4QJ5 B;  1NX3 A;  1U5I B;  1MQ1 A;  3OB2 B;  2HQ8 A;  4TNC A;  2LHL A;  1JF0 A;  3F45 A;  3PN7 C;  1UP5 A;  1FBV A;  5CSI A;  2I2R E;  3S0B A;  3Q8I A;  2JT0 A;  2FOT A;  1Y6W A;  3AAK A;  3B7A A;  4C0K A;  4WRI A;  2BKI B;  1W7J B;  4YBH B;  3I5H C;  1BU3 A;  4GUK A;  1MF8 B;  2QEB A;  3DYE A;  3WHT B;  2KQ6 A;  1OE9 B;  5ER4 X;  3VRO A;  3FIA A;  4JWQ A;  2PMY A;  3SJS A;  2CXJ A;  3EG5 B;  2P70 A;  2ZKM X;  4ORA B;  3SG3 A;  1KQM C;  2KI4 C;  3SG6 A;  5BPJ A;  1TRF A;  3AKA A;  4M2P A;  4PDZ A;  4U8D A;  1AJ4 A;  4CPV A;  1C07 A;  1K95 A;  1LA0 A;  1TNX A;  3CS1 A;  4AOM A;  4E68 A;  1N65 A;  3PLF B;  1K94 A;  3GOF A;  1M46 A;  1SCV A;  1NYA A;  3RM1 A;  1LXF C;  3I5I B;  1FF1 A;  2KBI A;  1F71 A;  1WRK A;  3N7H A;  1SK6 D;  1YX8 A;  1EJ3 A;  1BR4 B;  1IGV A;  4OZD A;  1XFZ O;  3D0Y A;  3LK1 A;  1CM4 A;  2LAP A;  1IJ5 A;  1Y0V H;  4XJK A;  4YGC B;  4MN0 A;  1QJT A;  3D73 A;  1SSE B;  3VRN A;  1YRT B;  1OMD A;  1UWO A;  3CR2 A;  1D1O A;  2M97 A;  3NSO A;  2KPH A;  1SNL A;  2ZND A;  2WCF A;  1XK4 C;  1FI6 A;  4L9M A;  4PT1 A;  2WCJ A;  2ZN9 A;  4PE1 A;  2E30 A;  2LVK A;  1AK8 A;  3PM8 A;  1C7V A;  1SW8 A;  2K60 A;  2AMI A;  1Y1X A;  2BAP A;  1DQE A;  2WCE A;  2EC6 B;  4WQ3 A;  1G33 A;  2F8P A;  1CTR A;  2I18 A;  3BQ3 A;  2WCH A;  2L4H A;  1S3P A;  2LVJ A;  1OMV A;  2F3Y A;  5CSJ A;  4ETO A;  3IQO A;  1F8H A;  1NX1 A;  1QIW A;  1BR1 B;  1B47 A;  1SKT A;  3I5G B;  1PUL A;  1S5G Z;  1S6I A;  3CZ1 A;  1J1E A;  2LNK A;  1RTP 1;  3TDZ A;  5IBW A;  1IH0 A;  4JKT A;  3RLZ A;  3TDI A;  3GK1 A;  3S0E A;  3LLE A;  1RFJ A;  1TWO A;  2LVI A;  4D1E A;  1N0Y A;  3OGN A;  1QX2 A;  2JT8 A;  5HKZ A;  1YR5 A;  1YRU B;  3VRP A;  2WC8 A;  1BOD A;  3TZ1 A;  2JNX A;  3FE6 A;  4FQT A;  1SL8 A;  3FE8 A;  1KFX L;  1DEL A;  2I7A A;  2QPT A;  4N1G A;  2IS9 A;  1TUJ A;  1IRJ A;  1M45 A;  3SG4 A;  1Y1A A;  1S5G Y;  1M63 B;  3S0D A;  4CFQ A;  5FI6 A;  3H4S E;  1C7W A;  1JC2 A;  2LE9 B;  3A8R A;  1BF5 A;  1C3Z A;  3BJH A;  3HX4 A;  4NDB A;  4YGE B;  1MXE A;  1RWY A;  3D75 A;  2O5G A;  3FWC A;  5D3O A;  2JNF A;  3O2P A;  2OTG C;  5F6T A;  1DT7 B;  3CLN A;  2K7B A;  1JUO A;  1A2X A;  1NP8 A;  3UO9 A;  1YVH A;  2BCA A;  4PHM A;  4ZCU A;  1LIN A;  2LHI A;  1ALV A;  4I5K A;  3SIA A;  1REC A;  2M3W A;  4KYN A;  1B8R A;  1ZOT B;  1WRZ A;  3CR5 X;  2JTZ A;  1XFV O;  3PAT A;  4HRG A;  4PE0 A;  3ZNI A;  5FYX A;  2K8M B;  2OS8 C;  1R2U A;  2Q91 A;  3K1E A;  4YGB B;  3EVV A;  1DC1 A;  4Q04 A;  4A4B A;  2BE6 A;  1YX7 A;  2EGD A;  1FPW A;  1PSB A;  1B7T Y;  1KWO B;  5EL2 A;  3BUX B;  4UPG A;  1LKJ A;  3KF9 A;  3CTN A;  3LCP C;  3SG7 A;  5AER A;  1T14 A;  1Z4H A;  2WCB A;  3AAJ A;  3BOW B;  1NCX A;  3BUN B;  3I5H B;  2L5Y A;  3VB1 A;  3BOW A;  1ALW A;  1HT9 A;  1NWD A;  1ODB A;  2KDH A;  1KFX S;  3HCM A;  3NSI A;  4GBA A;  1KFU S;  1SYM A;  4MSP A;  1EG3 A;  2BBM A;  1V1G A;  2WND A;  1A03 A;  1SRA A;  3GK2 A;  1XA5 A;  3QME A;  2LUX A;  2WOR A;  3PSR A;  2ZNE A;  2CT9 A;  2HPS A;  2LLT A;  1WRL A;  2KAY A;  1F4O A;  2ISD A;  3DY9 A;  3OHM B;  2GGM A;  1XFY O;  1KQM B;  2KI4 B;  2JT3 A;  3DF0 B;  5J3X A;  5I8N A;  2GGZ A;  1QS7 A;  3VGO A;  5K89 A;  1N2D A;  1K90 D;  1SY9 A;  4MRY A;  3FS7 A;  1B8C A;  4CFR A;  3BUO B;  3A4U B;  3TUY C;  1CLM A;  5ER5 A;  3OX5 A;  1JBA A;  4NDC A;  1DJX A;  2ZRS A;  1XO5 A;  3NGV A;  4I5L B;  3O4Y A;  3PN7 B;  1QTX A;  3CZ2 A; 
#chains in the Genus database with same CATH homology
 5HLO A;  1AJ5 A;  1J7R A;  1QAS A;  2BL0 B;  3LK0 A;  1S1E A;  1BOC A;  1TCF A;  4OR9 B;  3DVJ A;  1CDM A;  3C1V A;  1CMF A;  1QAT A;  4N1F A;  2BEC A;  2ZRT A;  1UHI A;  3AKB A;  3TS5 C;  2KNE A;  1TOP A;  2JUL A;  2L2E A;  2BL0 C;  2L0P A;  2CCM A;  2Q4U A;  5DKR A;  4MEW A;  3SG5 A;  1PAL A;  1WLM A;  4GPL B;  1UHH A;  1TN4 A;  1JSA A;  3JTD B;  4GGF C;  1ZUZ A;  5CSF A;  1ZAC A;  1XVJ A;  3MSE B;  2M29 A;  2FCD A;  2H2K A;  2MLF C;  1JFJ A;  4MZL A;  3BUW B;  1SCM B;  1SBJ A;  2K7D A;  1IQ5 A;  2M1K B;  1JWD A;  1GQM A;  1WDC B;  3JVT B;  1IG5 A;  1UUR A;  2M49 B;  1A75 A;  3KPX A;  1F70 A;  1YTZ C;  3KO0 A;  1S26 D;  4C0J A;  5AFP A;  3EK7 A;  1KFU L;  1CDN A;  2LUC A;  2OPO A;  2A4J A;  1ZMZ A;  2F33 A;  2I94 A;  2LMU A;  2NXQ A;  2JQ6 A;  1SL9 A;  1AVS A;  4I5N B;  1DF0 B;  1CFP A;  2JU0 A;  1TTX A;  3IQQ A;  1K96 A;  1SPY A;  2Y5I A;  2PRU A;  1OMR A;  1YVL A;  2LP3 A;  2BKH B;  1B9A A;  1V1F A;  1S36 A;  5HKW A;  4GGF A;  4WQ2 A;  3VRQ A;  1OOJ A;  3LL8 B;  3WNX B;  1MWN A;  1YUT A;  2AAO A;  2K2F A;  2R2I A;  1OQP A;  2L5X B;  3FWB A;  4AQI A;  1L7Z A;  1J7Q A;  1PSR A;  4DUQ A;  1NCY A;  5GQQ C;  2KAX A;  2KGR A;  4PAL A;  2LCP A;  2M1U A;  4YGA A;  1A4P A;  2BE4 A;  5CSN A;  1CKK A;  3SG2 A;  3BUM B;  3PAL A;  1K93 D;  4YGD B;  2K2A A;  1NSH A;  2B1U A;  1XK4 A;  2PSR A;  3OB1 B;  2KBM A;  1TCO B;  2KI6 C;  1QLK A;  2PAL A;  1BG1 A;  1KK8 B;  2L98 A;  1J55 A;  2LMV A;  2BCX A;  3EKH A;  4DS7 A;  5I2L A;  4JPZ B;  1DGV A;  2KSP A;  4FTG A;  4GGN A;  3CGA A;  4PHJ A;  5AAN A;  1RJV A;  1SL7 A;  5KU1 A;  1B8L A;  1QVI Z;  1TNQ A;  2PAS A;  1G4Y R;  4A4C A;  1JF2 A;  1RK9 A;  2KOT A;  2OTG B;  4IL1 A;  5AXI A;  4DRW A;  1GGZ A;  2BBN A;  2LLS A;  2MRD A;  2JRF A;  2K0J A;  1QV0 A;  1TIZ A;  2KFH A;  4PHK A;  1L2O B;  1BJF A;  2FJU B;  5HLV A;  2KQY A;  2K7C A;  1DJH A;  1DF0 A;  2D8N A;  1SR6 C;  3DVK A;  1GGW A;  2Y1N A;  2G9B A;  1DTL A;  2JPT A;  2M7N A;  1B1G A;  2JZI A;  4QJ4 B;  4NQG A;  4CLN A;  1NX2 A;  4CID A;  4NDD A;  3O6B A;  2JTT A;  2LMT A;  4MZK A;  1DJY A;  2Y4Q A;  1KWO C;  2M0R A;  2SAS A;  4C0L A;  2LP2 A;  3ZWH A;  1QVI Y;  1TNP A;  2JWW A;  3I5F B;  4FQO A;  1B4C A;  2BCB A;  3GK4 X;  4HRE E;  2K7O A;  4PCW A;  3KEV A;  4F0Z B;  1H4B A;  1S6J A;  2EHB A;  1DVI A;  2KI6 D;  4QJ3 B;  2M7L A;  1NIW A;  2MAZ A;  2KFF A;  1BT6 A;  2HQW A;  1AP4 A;  3I5F C;  1K8U A;  1KK8 C;  1IWQ A;  1CDL A;  4ZCV A;  3TDU A;  3EK4 A;  2Y1M A;  2OS8 B;  1WY9 A;  4YI9 A;  1BMO A;  5G08 A;  1K9U A;  1PVA A;  2SCP A;  1K2H A;  2M8U A;  2LM5 A;  2KGB C;  3NSL A;  2MBX A;  2COL B;  4N5X A;  2PVB A;  3SIB A;  2HF5 A;  2ZN8 A;  1H8B A;  4M2O A;  1DJI A;  4P5O E;  1Y1U A;  2JC2 A;  2NCP A;  2V53 A;  1MXL C;  2L51 A;  1YUU A;  2LLU A;  1K9P A;  1DMO A;  1EXR A;  1SMG A;  1J7P A;  2KYC A;  5TNC A;  1CFF A;  4OCI A;  1GJY A;  5DKN A;  3NSK A;  4ICB A;  2WOS A;  1CDP A;  1CMG A;  4I5J A;  1E8A A;  4BY4 A;  2JXL A;  3BXK A;  1U5I A;  2AUC A;  4ORB B;  4HSZ A;  4YI8 A;  1QIV A;  3ICB A;  1NPQ A;  3DVE A;  2P6B B;  3OX6 A;  1G8I A;  1F55 A;  4HRH A;  1CNP A;  1KQV A;  4OKH A;  4M2Q A;  1KK7 Y;  2LC5 A;  2MLE C;  1F54 A;  2KAV A;  1OZO A;  2NCO A;  1KSO A;  3CWG A;  3TUY B;  2FCE A;  3EKJ A;  1UHN A;  5B8I B;  1CFD A;  1UUS A;  1HQV A;  5I2O A;  2F2P A;  1AUI B;  2JOJ A;  2NZ0 A;  4PE4 A;  2F2O A;  2JXC A;  1F4Q A;  2CTN A;  4JQ0 D;  1EH2 A;  1K9K A;  1QX7 A;  4P2Y B;  1R6P A;  2F3Z A;  5JJG A;  2MJW B;  1A29 A;  1QV1 A;  1DGU A;  4ORC B;  1DJZ A;  2QAC A;  4MLW A;  2KYF A;  2H61 A;  1J7O A;  2LAN A;  3DD4 A;  3D10 A;  1UHK A;  1UHJ A;  1IQ3 A;  2H61 C;  4OV2 A;  4AQJ A;  1IJ6 A;  1A75 B;  1MHO A;  1QXP A;  2L50 A;  5I2Q A;  2DOQ A;  3I5G C;  2CBL A;  1OSA A;  3CR4 X;  4DIR A;  1FW4 A;  1NCZ A;  1X02 A;  2GV5 A;  3DVM A;  5CPV A;  1LA3 A;  1WLZ A;  1VRK A;  1RRO A;  2VRG A;  1TNW A;  1PK0 D;  1Q80 A;  4XYN A;  3EK8 A;  2E6W A;  2EC6 C;  2MA2 A;  5JOL A;  5PAL A;  1LVC D;  5AEQ A;  1CLL A;  4MRX A;  4GFT A;  1SCM C;  3JVT C;  4R1E A;  4PE7 A;  1YUS A;  2NLN A;  1M39 A;  1XFU O;  2RGI A;  2K61 A;  4USL A;  2MHH A;  1CLB A;  1EL4 A;  1NUB A;  1AHR A;  5D7F A;  5KTY A;  2HET A;  1BLQ A;  1CM1 A;  1JFK A;  1SR6 B;  3JTD C;  4MBE A;  3IF7 A;  1ZFS A;  4GAO A;  3E3R A;  3DF0 A;  4MZJ A;  1XFX O;  5HKY A;  1EG4 A;  2KFG A;  1MUX A;  3QRX A;  3VRR A;  1KK7 Z;  1XFW O;  2L4I A;  2M9G A;  1PRW A;  1KSM A;  1M31 A;  3WHU B;  1WDC C;  4GNK B;  1B7T Z;  2CNP A;  2G2B A;  1L2O C;  5D69 A;  1J1D A;  5HYD A;  1W7I B;  3EVU A;  3EVR A;  1OZS A;  5KSZ A;  1NX0 A;  1MR8 A;  3BYA A;  2LVV A;  1KCY A;  2TN4 A;  1QX5 B;  3NXA A;  3CZT X;  3PFV A;  2ZFD A;  3I5I C;  1PVB A;  1IKU A;  1DJW A;  3M0W A;  4BY5 A;  1FI5 A;  4YRU A;  1DJG A;  4PHN A;  2O60 A;  4DCK A;  3TS5 B;  3OP0 A;  3KHE A;  1XYD A;  3K21 A;  4OVN F;  2LV7 A;  3WXA A;  3O78 A;  4XJK B;  1CFC A;  1CB1 A;  1S6C A;  5DKQ A;  2KHN A;  3D0Y B;  1YUR A;  1QLS A;  4MVF A;  4QJ5 B;  1NX3 A;  1U5I B;  1MQ1 A;  3OB2 B;  2HQ8 A;  4TNC A;  2LHL A;  1JF0 A;  3F45 A;  3PN7 C;  1UP5 A;  1FBV A;  5CSI A;  2I2R E;  2JT0 A;  2FOT A;  1Y6W A;  3AAK A;  4C0K A;  4WRI A;  2BKI B;  1W7J B;  4YBH B;  3I5H C;  1BU3 A;  4GUK A;  1MF8 B;  3WHT B;  2KQ6 A;  1OE9 B;  5ER4 X;  3VRO A;  3FIA A;  4JWQ A;  2PMY A;  3SJS A;  2CXJ A;  2ZKM X;  4ORA B;  3SG3 A;  1KQM C;  2KI4 C;  3SG6 A;  5BPJ A;  1TRF A;  3AKA A;  4M2P A;  4PDZ A;  4U8D A;  1AJ4 A;  4CPV A;  1C07 A;  1K95 A;  1LA0 A;  1TNX A;  3CS1 A;  4AOM A;  4E68 A;  1N65 A;  3PLF B;  1K94 A;  3GOF A;  1M46 A;  1SCV A;  1NYA A;  3RM1 A;  1LXF C;  3I5I B;  1FF1 A;  2KBI A;  1F71 A;  1WRK A;  1SK6 D;  1YX8 A;  1EJ3 A;  1BR4 B;  1IGV A;  1XFZ O;  3D0Y A;  3LK1 A;  1CM4 A;  2LAP A;  1IJ5 A;  1Y0V H;  4XJK A;  4YGC B;  4MN0 A;  1QJT A;  3VRN A;  1YRT B;  1OMD A;  1UWO A;  3CR2 A;  1D1O A;  2M97 A;  3NSO A;  1SNL A;  2ZND A;  2WCF A;  1XK4 C;  1FI6 A;  4L9M A;  2ZN9 A;  4PE1 A;  2E30 A;  2LVK A;  1AK8 A;  3PM8 A;  1C7V A;  1SW8 A;  2AMI A;  1Y1X A;  2WCE A;  2EC6 B;  4WQ3 A;  1G33 A;  2F8P A;  1CTR A;  2I18 A;  3BQ3 A;  2L4H A;  1S3P A;  2LVJ A;  1OMV A;  2F3Y A;  5CSJ A;  4ETO A;  3IQO A;  1F8H A;  1NX1 A;  1QIW A;  1BR1 B;  1B47 A;  1SKT A;  3I5G B;  1PUL A;  1S5G Z;  1S6I A;  3TDZ A;  1J1E A;  2LNK A;  1RTP 1;  5IBW A;  1IH0 A;  3RLZ A;  3TDI A;  3GK1 A;  3LLE A;  1RFJ A;  2LVI A;  4D1E A;  1N0Y A;  1QX2 A;  2JT8 A;  5HKZ A;  1YR5 A;  1YRU B;  3VRP A;  2WC8 A;  1BOD A;  3TZ1 A;  2JNX A;  1SL8 A;  1KFX L;  2I7A A;  2QPT A;  4N1G A;  2IS9 A;  1IRJ A;  1M45 A;  3SG4 A;  1Y1A A;  1S5G Y;  1M63 B;  4CFQ A;  3H4S E;  1C7W A;  1JC2 A;  2LE9 B;  3A8R A;  1BF5 A;  3HX4 A;  4NDB A;  4YGE B;  1MXE A;  1RWY A;  2O5G A;  3FWC A;  2JNF A;  3O2P A;  2OTG C;  5F6T A;  1DT7 B;  3CLN A;  2K7B A;  1JUO A;  1A2X A;  1NP8 A;  1YVH A;  2BCA A;  4PHM A;  4ZCU A;  1LIN A;  2LHI A;  1ALV A;  4I5K A;  3SIA A;  1REC A;  2M3W A;  1B8R A;  1ZOT B;  1WRZ A;  3CR5 X;  2JTZ A;  1XFV O;  3PAT A;  4HRG A;  4PE0 A;  3ZNI A;  5FYX A;  2K8M B;  2OS8 C;  1R2U A;  2Q91 A;  4YGB B;  3EVV A;  4Q04 A;  4A4B A;  2BE6 A;  1YX7 A;  2EGD A;  1FPW A;  1PSB A;  1B7T Y;  1KWO B;  3BUX B;  4UPG A;  1LKJ A;  3KF9 A;  3CTN A;  3LCP C;  3SG7 A;  5AER A;  2WCB A;  3AAJ A;  3BOW B;  1NCX A;  3BUN B;  3I5H B;  3BOW A;  1ALW A;  1HT9 A;  1NWD A;  1ODB A;  2KDH A;  1KFX S;  3HCM A;  3NSI A;  4GBA A;  1KFU S;  1SYM A;  4MSP A;  1EG3 A;  2BBM A;  1V1G A;  2WND A;  1A03 A;  1SRA A;  3GK2 A;  1XA5 A;  2LUX A;  2WOR A;  3PSR A;  2ZNE A;  2CT9 A;  2HPS A;  2LLT A;  1WRL A;  2KAY A;  1F4O A;  2ISD A;  3OHM B;  2GGM A;  1XFY O;  1KQM B;  2KI4 B;  2JT3 A;  3DF0 B;  5J3X A;  5I8N A;  2GGZ A;  1QS7 A;  3VGO A;  5K89 A;  1N2D A;  1K90 D;  1SY9 A;  4MRY A;  3FS7 A;  1B8C A;  4CFR A;  3BUO B;  3A4U B;  3TUY C;  1CLM A;  5ER5 A;  3OX5 A;  1JBA A;  4NDC A;  1DJX A;  2ZRS A;  1XO5 A;  4I5L B;  3O4Y A;  3PN7 B;  1QTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...