3KHEA

Crystal structure of the calcium-loaded calmodulin-like domain of the cdpk, 541.m00134 from toxoplasma gondii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
184
Chain Sequence
HALTGALGNMKKFQSSQKLAQAAMLFMGSKLTTLEETKELTQIFRQLDNNGDGQLDRKELIEGYRKLMQVSDLDSSQIEAEVDHILQSVDFDRNGYIEYSEFVTVCMDKQLLLSRERLLAAFQQFDSDGSGKITNEELGRLFGVTEVDDETWHQVLQECDKNNDGEVDFEEFVEMMQKICDVKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin-like domain protein kinase isoform 3
publication title Structures of parasitic CDPK domains point to a common mechanism of activation.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 75
structure length 184
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3kheA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3kheA02
2KDHA 1A75A 2JXCA 4UPGA 2BL0C 1BT6A 1J1DA 1XVJA 1A03A 1IQ3A 2KOTA 4TNCA 5ER5A 1MWNA 4YGBB 1J1EA 1XFYO 1DGVA 2LUCA 3M0WA 1LXFC 2LNKA 1AK8A 1M46A 1KWOC 2HETA 1BU3A 1WLMA 1Y1UA 3AKAA 1Y1XA 1FPWA 1QASA 3I5FB 1EG4A 1S5GZ 1FW4A 1DF0A 1QIWA 5CSJA 1UHKA 1SKTA 1EH2A 2CCMA 4JQ0D 5JJGA 5AXIA 5IBWA 2LP3A 1QIVA 2BBMA 1BR1B 1KK7Y 1F70A 2K7CA 2G9BA 1NWDA 1S5GY 3OX5A 2KI6D 3VGOA 1TCFA 1A29A 1A4PA 1W7IB 3BXKA 4GNKB 3DD4A 4NDCA 2BCBA 1N65A 4CFQA 1YX8A 4A4BA 1MXLC 2M49B 3GK2A 4QJ5B 3D0YB 2LLSA 1L2OB 4AQIA 2PMYA 1YURA 2KHNA 3EVUA 2Q91A 1K8UA 2MLEC 1K9UA 2A4JA 2F2PA 3CS1A 1SR6B 1Y6WA 1JF0A 5DKQA 2NLNA 4PE0A 1JFJA 2JRFA 3DVKA 2O5GA 3LLEA 2RGIA 2JC2A 5JOLA 3IQOA 1SL8A 1IG5A 1N0YA 2L50A 3I5GB 4DIRA 4MZKA 4N1FA 2JT8A 1YRTB 1H8BA 1AJ4A 2HPSA 4DUQA 2M9GA 1PALA 2WCEA 4ORBB 4C0LA 1L7ZA 1NP8A 2IS9A 1RJVA 2KBMA 1ZMZA 1GQMA 3BUXB 4PHKA 4OR9B 2OS8B 1ZOTB 4NQGA 3GK1A 2K61A 1RWYA 2SCPA 3CLNA 1F54A 5HLVA 2I94A 3SG3A 4FQOA 1OZSA 2ZFDA 3EVVA 5AERA 1NX0A 1ZUZA 2WORA 1IQ5A 3AAJA 1M39A 2KQ6A 2M1UA 1TRFA 4PHJA 2LHIA 5AFPA 3I5FC 3DVEA 5I2QA 3A4UB 2M3WA 1J7OA 2JU0A 4AQJA 1DGUA 1TTXA 2B1UA 2D8NA 2F2OA 1KFUL 1NX2A 3SG2A 4PCWA 1XFVO 5CSFA 4QJ3B 2JTZA 3C1VA 4FTGA 2LVKA 1SYMA 4OCIA 4E68A 1CFDA 2LHLA 2DOQA 1RROA 3AAKA 4DCKA 1F4QA 4P2YB 4BY5A 1Y1AA 1KCYA 4WRIA 1KQMB 1GGWA 2ZRSA 4CLNA 1S26D 1B1GA 2LMUA 4HREE 1QXPA 1F55A 4YBHB 1L2OC 1PULA 2K7DA 2I7AA 2LANA 1X02A 1S6IA 3CWGA 5F6TA 3PSRA 1SW8A 2PRUA 4XYNA 1SR6C 1U5IA 2GV5A 4Q04A 1DTLA 4I5KA 1B7TZ 3DF0B 2G2BA 4MVFA 1YX7A 1XFXO 2FCEA 2MHHA 2WC8A 5BPJA 2BKIB 2BKHB 1K95A 4WQ3A 3EK4A 1CFPA 1IKUA 1J7QA 4CIDA 3I5GC 3KF9A 5KSZA 1NCZA 2LLTA 3EKJA 1C7WA 3BUOB 5ER4X 3E3RA 3BOWB 2M97A 4I5LB 4YRUA 1S6CA 2O60A 3CR2A 3KEVA 2LVVA 3VROA 4ZCUA 1SCMB 3D10A 4NDBA 2OS8C 1AJ5A 2EGDA 4PE4A 3A8RA 3JTDC 1DVIA 4N5XA 1JBAA 5CPVA 3SG6A 3GOFA 2LUXA 5AEQA 4AOMA 4PE7A 3EK8A 1BODA 2K0JA 1KFXL 1NX3A 1A75B 4JPZB 2R2IA 1DJWA 1NX1A 2JWWA 2Y1NA 1OMRA 1M63B 1BF5A 1EXRA 4I5NB 2MJWB 3CR5X 2WCFA 4ORAB 2JXLA 4GGFC 2L51A 1H4BA 2VRGA 1V1FA 1XFZO 3FIAA 2KGRA 3EVRA 3NXAA 2F33A 3SIBA 5CSNA 1XA5A 1QVIZ 4A4CA 1D1OA 2AAOA 5DKRA 1OMVA 4C0KA 5KTYA 2F3YA 2MLFC 1ODBA 3O2PA 1MQ1A 1LKJA 5I2OA 2HQ8A 1K94A 2FOTA 1KQMC 1B9AA 3IF7A 3KPXA 1WRZA 1LVCD 1JUOA 1LINA 1RK9A 1K9PA 2K2AA 4MN0A 2NCOA 1CDNA 2COLB 1CMGA 1WRKA 4HSZA 3D0YA 2L4HA 1YUUA 1NSHA 2WOSA 4XJKB 2KBIA 4PHNA 2M7NA 1SK6D 2WCBA 1DMOA 1AVSA 2PVBA 2JQ6A 2EHBA 4QJ4B 2OPOA 1PSBA 1JWDA 2H61C 4JWQA 1FF1A 1Y0VH 1YVHA 2QPTA 3DVJA 1JF2A 1C7VA 1J7RA 1UURA 4OV2A 1DJXA 1MUXA 1SMGA 2JZIA 1WDCB 4ETOA 3SJSA 2LMTA 2MBXA 3NSIA 2K7OA 5D69A 1G4YR 1LA3A 4M2OA 4WQ2A 1GGZA 3JTDB 1SCMC 1RFJA 3CR4X 4D1EA 4YGDB 1OZOA 1R6PA 1HT9A 1TN4A 4DS7A 1CFCA 3VRQA 2ISDA 3K21A 2JTTA 1XK4C 1DJIA 1XFWO 2KAVA 4I5JA 1F4OA 2FJUB 1FI5A 2L5XB 2NCPA 2HF5A 4USLA 3WNXB 1CDLA 1G8IA 4MBEA 5AANA 2MRDA 3BUMB 5G08A 3FS7A 1IJ5A 1IWQA 2JOJA 1QX7A 5J3XA 1QTXA 5KU1A 1EL4A 1BR4B 1A2XA 3PATA 4NDDA 4GUKA 2KFFA 1PVAA 1G33A 1OQPA 1TIZA 2JT0A 1B47A 1QV0A 1RECA 2LLUA 3QRXA 3WXAA 3SG5A 5B8IB 1IGVA 1J7PA 3DVMA 3LK0A 4GGNA 1Q80A 2KYFA 1ALWA 1BMOA 2Y1MA 2K8MB 1TCOB 1TNQA 3RLZA 1SRAA 2ZN9A 2PALA 3TS5B 4ORCB 3TDUA 1JFKA 1PVBA 4HRHA 1EJ3A 4R1EA 1K90D 1CLBA 5PALA 4PHMA 3VRNA 1DJZA 2MA2A 5HKYA 4F0ZB 1B8RA 3MSEB 2CNPA 1AHRA 1TNXA 1QX5B 3OHMB 1FI6A 1QS7A 1K96A 2AUCA 3DF0A 1K93D 3I5IC 5HKWA 2F3ZA 1NPQA 2K7BA 3I5HB 1B7TY 4PDZA 1MF8B 4YI8A 1WDCC 3CGAA 4CPVA 1QATA 5I8NA 2KGBC 2JPTA 2CXJA 3BOWA 3ZNIA 2M0RA 3TZ1A 2MAZA 2KYCA 2LMVA 1NCYA 2L98A 1GJYA 1CM4A 3VRPA 1NYAA 1XO5A 1CMFA 1KFXS 2BCXA 2LAPA 1SY9A 3ZWHA 1QV1A 1UHIA 2K2FA 1MHOA 5HLOA 2M29A 3TDIA 1XK4A 2JNXA 4U8DA 1OSAA 3CTNA 3PN7C 3JVTB 1TNPA 1SL7A 2M8UA 2GGZA 3EKHA 1QLSA 2JULA 1CLMA 1KSMA 1NUBA 2LV7A 4M2PA 1YUTA 1YUSA 1W7JB 3TDZA 1AUIB 3BYAA 4GBAA 1CDMA 3SIAA 1DF0B 1CFFA 1MXEA 2V53A 1CM1A 1N2DA 1CLLA 2KAYA 3KO0A 1KK7Z 1F8HA 2LE9B 2SASA 3FWBA 1WRLA 1PK0D 1E8AA 2LC5A 2CT9A 2BBNA 1V1GA 4PALA 1KQVA 2EC6C 3NSOA 1UWOA 3KHEA 3BUWB 2E30A 2LVIA 1K9KA 2Q4UA 1QVIY 1M31A 2KI6C 4MRYA 3TS5C 5D7FA 3SG7A 1XYDA 1NIWA 2GGMA 3CZTX 1UP5A 1YR5A 1JC2A 1OOJA 4XJKA 1DJYA 2LP2A 1C07A 1KSOA 3LCPC 2HQWA 1CKKA 1J55A 2F8PA 4GAOA 1IH0A 4CFRA 2NXQA 3HCMA 2BE4A 3TUYB 2KAXA 1WY9A 3I5IB 1DJHA 1CNPA 3OB1B 1BG1A 4ZCVA 2OTGB 3I5HC 1BLQA 1YRUB 2BE6A 1ZFSA 5TNCA 2ZNEA 2KI4B 1NCXA 1EG3A 1KK8B 1SCVA 3RM1A 3ICBA 1QX2A 1XFUO 1SNLA 1CDPA 3FWCA 3O6BA 4YGEB 1UHNA 3EK7A 3LK1A 2ZNDA 1TOPA 4MEWA 3BUNB 3SG4A 1K2HA 4MZLA 5DKNA 4M2QA 3PN7B 4GPLB 5GQQC 2PSRA 1KFUS 1S1EA 1F71A 1ALVA 2PASA 2WNDA 2BL0B 3OP0A 2KFHA 3JVTC 4C0JA 3BQ3A 3PFVA 3WHTB 2L2EA 2NZ0A 1SPYA 1RTP1 2ZKMX 1AP4A 1IJ6A 4YGCB 4MLWA 1R2UA 1QJTA 4GGFA 1M45A 3F45A 1KWOB 3NSLA 1ZACA 4MZJA 2JNFA 2JT3A 1B8CA 1QLKA 3PM8A 1S36A 5K89A 1VRKA 2EC6B 1UUSA 4OKHA 1SL9A 3NSKA 2ZN8A 2KNEA 2BECA 2H2KA 1HQVA 2E6WA 2KFGA 3PLFB 4DRWA 1WLZA 3GK4X 1TNWA 1IRJA 2CBLA 1YTZC 2ZRTA 3AKBA 1DJGA 2P6BB 2KQYA 4ICBA 1BOCA 3H4SE 2CTNA 2L0PA 1UHHA 3IQQA 4P5OE 4HRGA 2TN4A 3TUYC 5I2LA 2H61A 1JSAA 4YGAA 4MSPA 3LL8B 1B8LA 4MRXA 1DT7B 1CB1A 1U5IB 2L4IA 3O78A 4OVNF 5CSIA 2OTGC 4GFTA 2M7LA 4BY4A 4YI9A 1B4CA 3WHUB 2Y5IA 1PSRA 1YVLA 1LA0A 2BCAA 2KI4C 1KK8C 1FBVA 3OX6A 4IL1A 4PE1A 4L9MA 1OE9B 2M1KB 3O4YA 3HX4A 1UHJA 2I18A 4N1GA 5HKZA 3VRRA 3OB2B 1OMDA 2FCDA 1BJFA 2QACA 1S3PA 2LCPA 1PRWA 2AMIA 2Y4QA 5FYXA 1S6JA 1MR8A 2KSPA 2I2RE 2LVJA 3PALA 1SBJA 5HYDA 2LM5A 1CTRA
chains in the Genus database with same CATH superfamily
2KDHA 1C3YA 1A75A 2JXCA 4UPGA 2BL0C 1BT6A 1J1DA 1XVJA 3Q8IA 1A03A 3CYZA 2KOTA 4TNCA 5ER5A 1MWNA 4YGBB 1J1EA 1XFYO 5FI2A 1DGVA 2LUCA 3M0WA 1LXFC 3B7AA 2LNKA 1AK8A 1M46A 1KWOC 2HETA 1BU3A 1WLMA 1Y1UA 2WC5A 3AKAA 1Y1XA 1FPWA 1QASA 2BAPA 3I5FB 2L5YA 1EG4A 1S5GZ 1FW4A 1DF0A 1QIWA 5CSJA 1UHKA 1SKTA 1EH2A 2CCMA 4JQ0D 5JJGA 5EL2A 5AXIA 5IBWA 2LP3A 1QIVA 2BBMA 1BR1B 2P71A 1KK7Y 1F70A 2K7CA 2G9BA 1NWDA 1S5GY 3OX5A 4OZDA 2KI6D 3VGOA 1TCFA 1A29A 1A4PA 1W7IB 3BXKA 4GNKB 3DD4A 4NDCA 2BCBA 1N65A 4CFQA 1YX8A 4A4BA 1MXLC 2M49B 3EG5B 3GK2A 3D0YB 2LLSA 4QJ5B 1L2OB 4AQIA 2PMYA 1YURA 2KHNA 3EVUA 2Q91A 1K8UA 2MLEC 1K9UA 2A4JA 2F2PA 3CS1A 1SR6B 1Y6WA 1JF0A 5DKQA 2NLNA 4PE0A 1JFJA 1LS8A 2JRFA 1W9ZA 3DVKA 2O5GA 3LLEA 2RGIA 2JC2A 3V2LA 3S0EA 5JOLA 3IQOA 1SL8A 1IG5A 1N0YA 2L50A 3I5GB 4DIRA 4MZKA 4N1FA 2JT8A 1YRTB 1H8BA 1AJ4A 2HPSA 4DUQA 2M9GA 3DXLA 1PALA 2WCEA 4ORBB 4C0LA 1L7ZA 1NP8A 2IS9A 1RJVA 2KBMA 1ZMZA 1GQMA 3BUXB 3NHTA 4OR9B 4PHKA 2JPOA 2OS8B 1ZOTB 4NQGA 3GK1A 2K61A 1RWYA 2SCPA 3CLNA 1XFRA 1F54A 5HLVA 2I94A 3SG3A 4FQOA 1OZSA 2ZFDA 3EVVA 5AERA 1NX0A 1ZUZA 2WORA 1IQ5A 3AAJA 1M39A 2KQ6A 2M1UA 1TRFA 4PHJA 2LHIA 5AFPA 3I5FC 3DVEA 5I2QA 3A4UB 2M3WA 1J7OA 2JU0A 4AQJA 1DGUA 1TTXA 2B1UA 2D8NA 2F2OA 1KFUL 1NX2A 3SG2A 2L2CA 4PCWA 1XFVO 5CSFA 4QJ3B 2JTZA 3C1VA 4FTGA 2LVKA 1SYMA 3FE9A 4OCIA 4E68A 3FE8A 1CFDA 2LHLA 3PJIA 2DOQA 1RROA 1SSEB 3AAKA 4DCKA 1F4QA 4P2YB 4BY5A 1Y1AA 1KCYA 4WRIA 1DQEA 1KQMB 1GGWA 2ZRSA 4CLNA 1S26D 1B1GA 2LMUA 4HREE 1QXPA 1F55A 1IIOA 3K1EA 4YBHB 1L2OC 1PULA 2K7DA 2I7AA 3PM2A 2LANA 1X02A 1S6IA 3CWGA 5F6TA 3PSRA 2GTEA 3UNWA 1SW8A 2PRUA 4XYNA 1SR6C 1U5IA 2GV5A 4Q04A 1DTLA 4PT1A 4I5KA 1B7TZ 3S0BA 3DF0B 2G2BA 4MVFA 1YX7A 1XFXO 2FCEA 2MHHA 3D77A 2WC8A 3OGNA 5BPJA 2BKIB 2BKHB 1K95A 4WQ3A 3EK4A 1CFPA 1IKUA 3VB1A 3R1VA 4CIDA 3I5GC 3KF9A 5KSZA 1NCZA 1J7QA 2LLTA 3EKJA 1C7WA 1OOGA 3BUOB 5ER4X 4JD9A 3E3RA 3BOWB 2M97A 4I5LB 4YRUA 1S6CA 2O60A 3CR2A 3KEVA 2LVVA 3BFBA 3VROA 4ZCUA 1DELA 1SCMB 3D10A 4NDBA 2OS8C 1AJ5A 2EGDA 4PE4A 3A8RA 3JTDC 1DVIA 4N5XA 1JBAA 5CPVA 3SG6A 3GOFA 2LUXA 5AEQA 3S0DA 4AOMA 4PE7A 3EK8A 1BODA 2K0JA 5I94A 1KFXL 2H8VA 1NX3A 1A75B 3R1PA 2R2IA 4JPZB 1DJWA 1NX1A 2JWWA 2Y1NA 1OMRA 1M63B 1BF5A 1EXRA 4I5NB 2MJWB 3CR5X 3O4XA 2WCFA 4ORAB 2JXLA 3SS5A 4GGFC 1P28A 2L51A 1H4BA 2VRGA 1V1FA 2QEVA 1XFZO 3FIAA 2KGRA 3EVRA 4JKTA 3D78A 2KLDA 3NXAA 2F33A 3SIBA 5CSNA 1XA5A 3BJHA 1QVIZ 4A4CA 1D1OA 2AAOA 5DKRA 1OMVA 4C0KA 5KTYA 2F3YA 2MLFC 1ODBA 3O2PA 1MQ1A 1LKJA 5I2OA 2HQ8A 1K94A 2FOTA 1KQMC 1B9AA 3IF7A 3KPXA 1WRZA 1LVCD 1JUOA 1LINA 1RK9A 1K9PA 2K2AA 4MN0A 2NCOA 1CDNA 2COLB 1CMGA 1WRKA 4HSZA 4FQTA 3D0YA 1ORGA 2L4HA 1YUUA 1NSHA 2QEBA 2WOSA 4XJKB 2KBIA 4PHNA 3S0FA 2M7NA 2KPHA 5FI6A 1SK6D 2KLEA 2WCHA 1QWVA 3CZ0A 2WCBA 1DMOA 1AVSA 3BFAA 2PVBA 2JQ6A 3IVTA 2EHBA 4QJ4B 2OPOA 1PSBA 3B88A 1JWDA 2H61C 4JWQA 1FF1A 1Y0VH 1YVHA 2QPTA 1TUJA 3DVJA 1OOIX 1JF2A 1C7VA 1J7RA 1UURA 4OV2A 1DJXA 1MUXA 5FI7A 1SMGA 2JZIA 1WDCB 4ETOA 3CZ2A 3SJSA 2LMTA 2MBXA 3NSIA 3RZSA 2K7OA 5D69A 1G4YR 1LA3A 4M2OA 4WQ2A 1GGZA 1IQ3A 3JTDB 1SCMC 1RFJA 3CR4X 4D1EA 4YGDB 1OZOA 1R6PA 1HT9A 1TN4A 4DS7A 1CFCA 3VRQA 1C3ZA 2ISDA 3K21A 2JTTA 1OOFA 1XK4C 3DY9A 1DJIA 1XFWO 1OOHA 2KAVA 3DYEA 4I5JA 1F4OA 2FJUB 1FI5A 2L5XB 2NCPA 2HF5A 4USLA 3WNXB 1CDLA 1G8IA 4MBEA 5AANA 2MRDA 3BUMB 5G08A 3FS7A 1IJ5A 1IWQA 2JOJA 1QX7A 5J3XA 4INXA 1QTXA 5KU1A 1EL4A 1BR4B 1A2XA 3PATA 4NDDA 4GUKA 2KFFA 4INWA 1PVAA 1G33A 1OQPA 1TIZA 2JT0A 4IJ7A 1B47A 1QV0A 1RECA 2LLUA 3QRXA 3WXAA 3SG5A 5B8IB 1IGVA 1J7PA 3DVMA 3LK0A 4GGNA 1Q80A 2KYFA 1ALWA 1BMOA 2Y1MA 2K8MB 1TCOB 1TNQA 3RLZA 1SRAA 2ZN9A 2PALA 3TS5B 4ORCB 3TDUA 1JFKA 1PVBA 4HRHA 1EJ3A 4R1EA 1K90D 1CLBA 3B86A 5PALA 4PHMA 3VRNA 1DJZA 2MA2A 5HKYA 2WCKA 4F0ZB 1B8RA 3MSEB 2CNPA 1AHRA 3D74A 1TNXA 1QX5B 3OHMB 1FI6A 1QS7A 1K96A 2AUCA 3BFHA 3DF0A 1K93D 3I5IC 5HKWA 2F3ZA 1NPQA 2K7BA 3I5HB 1B7TY 4PDZA 1MF8B 4YI8A 1WDCC 2FJYA 3CGAA 3UO9A 4CPVA 1QATA 5DICA 5I8NA 2KGBC 2JPTA 2CXJA 3BOWA 3ZNIA 2M0RA 3TZ1A 3D76A 2MAZA 2KYCA 2LMVA 1NCYA 3L4LA 2L98A 1GJYA 1CM4A 3VRPA 1NYAA 1XO5A 1CMFA 1KFXS 2BCXA 2QEHA 3CZ1A 2LAPA 3FE6A 1SY9A 3ZWHA 1GM0A 1QV1A 1UHIA 2K2FA 1MHOA 5HLOA 2M29A 3TDIA 1XK4A 2JNXA 4U8DA 1OSAA 3CTNA 3N7HA 3PN7C 3NGVA 3JVTB 1T14A 1TNPA 1SL7A 2M8UA 2GGZA 3CDNA 1QLSA 3CABA 3EKHA 2JULA 1CLMA 1KSMA 1NUBA 2LV7A 4M2PA 1YUTA 1YUSA 1W7JB 3TDZA 1AUIB 2QEOA 3BYAA 4GBAA 1CDMA 3SIAA 4KYNA 1DF0B 1CFFA 1MXEA 2V53A 1CM1A 1N2DA 1CLLA 2KAYA 2K60A 3KO0A 1KK7Z 1F8HA 2LE9B 2WCMA 2SASA 3FWBA 1WRLA 1PK0D 1E8AA 2LC5A 3L4AA 2CT9A 2BBNA 3S0GA 1V1GA 4PALA 1KQVA 2EC6C 3NSOA 2ERBA 1UWOA 3KHEA 3BUWB 2E30A 2LVIA 1K9KA 2Q4UA 1QVIY 1M31A 2KI6C 4MRYA 3B87A 5D7FA 3SG7A 3TS5C 1XYDA 1NIWA 2GGMA 3CZTX 1UP5A 1YR5A 1JC2A 1OOJA 2QDIA 1DJYA 2LP2A 4XJKA 1C07A 1KSOA 3LCPC 2HQWA 1CKKA 1J55A 2F8PA 4GAOA 1IH0A 4CFRA 3SS4A 2NXQA 3HCMA 2BE4A 3TUYB 1TWOA 2KAXA 2WC6A 1WY9A 3I5IB 1DJHA 1CNPA 3OB1B 1BG1A 4ZCVA 2OTGB 3I5HC 1BLQA 1YRUB 2BE6A 1ZFSA 3QMEA 2ZNEA 2KI4B 5TNCA 2PYQA 3S0AA 1NCXA 1EG3A 1KK8B 1SCVA 3RM1A 3ICBA 1QX2A 1XFUO 1SNLA 1CDPA 3FWCA 2BNXA 3O6BA 4YGEB 1UHNA 3EK7A 3LK1A 2ZNDA 1TOPA 4MEWA 3BUNB 3SG4A 1K2HA 4MZLA 1TUZA 5DKNA 4M2QA 3PN7B 4GPLB 5GQQC 2PSRA 3B6XA 1KFUS 1S1EA 1F71A 1ALVA 2PASA 2WNDA 2BL0B 3OP0A 2KFHA 3JVTC 4C0JA 3BQ3A 3PFVA 3WHTB 2L2EA 2NZ0A 2WCLA 1SPYA 1RTP1 2ZKMX 1AP4A 1IJ6A 4YGCB 4MLWA 1R2UA 3D75A 1QJTA 4GGFA 1M45A 3F45A 1KWOB 3NSLA 1ZACA 4MZJA 2JNFA 2JT3A 1B8CA 1QLKA 3PM8A 1S36A 5K89A 1VRKA 2EC6B 1UUSA 4OKHA 1SL9A 1Z4HA 3NSKA 2ZN8A 2KNEA 3DZTA 1DEKA 3SS3A 2BECA 2YGUA 2H2KA 1HQVA 2E6WA 2KFGA 2PQLA 1DC1A 1Z2CB 3PLFB 1WLZA 4DRWA 3GK4X 1TNWA 1IRJA 1YTZC 2CBLA 2ZRTA 3AKBA 3R72A 1DJGA 2P6BB 2KQYA 3OBVA 4ICBA 1BOCA 3H4SE 2CTNA 2P70A 2L0PA 1UHHA 3IQQA 3R1OA 4P5OE 4HRGA 2TN4A 3TUYC 5I2LA 2H61A 1JSAA 4YGAA 4F7FA 4MSPA 3LL8B 2WCJA 1B8LA 4MRXA 1DT7B 1CB1A 1U5IB 2L4IA 3O78A 4OVNF 5CSIA 2OTGC 4GFTA 2M7LA 4BY4A 5HL1A 3D73A 4YI9A 1B4CA 3WHUB 2Y5IA 1PSRA 1YVLA 1LA0A 2BCAA 2KI4C 1KK8C 1FBVA 3OX6A 4IL1A 4PE1A 4L9MA 1OE9B 2M1KB 3NHIA 3HX4A 1UHJA 2I18A 3O4YA 4N1GA 5HKZA 3VRRA 3OB2B 1OMDA 2FCDA 1BJFA 2QACA 1S3PA 2LCPA 1PRWA 2AMIA 2Y4QA 5FYXA 1S6JA 5D3OA 1OW4A 1MR8A 2KSPA 2I2RE 2LVJA 3PALA 1SBJA 5HYDA 2LM5A 3L47A 1CTRA
chains in the Genus database with same CATH topology
2KDHA 1A75A 2JXCA 4UPGA 2BL0C 1BT6A 1J1DA 1XVJA 1A03A 1IQ3A 2KOTA 4TNCA 5ER5A 1MWNA 4YGBB 1J1EA 1XFYO 1DGVA 2LUCA 3M0WA 1LXFC 2LNKA 1AK8A 1M46A 1KWOC 2HETA 1BU3A 1WLMA 1Y1UA 3AKAA 1Y1XA 1FPWA 1QASA 3I5FB 1EG4A 1S5GZ 1FW4A 1DF0A 1QIWA 5CSJA 1UHKA 1SKTA 1EH2A 2CCMA 4JQ0D 5JJGA 5AXIA 5IBWA 2LP3A 1QIVA 2BBMA 1BR1B 1KK7Y 1F70A 2K7CA 2G9BA 1NWDA 1S5GY 3OX5A 2KI6D 3VGOA 1TCFA 1A29A 1A4PA 1W7IB 3BXKA 4GNKB 3DD4A 4NDCA 2BCBA 1N65A 4CFQA 1YX8A 4A4BA 1MXLC 2M49B 3GK2A 4QJ5B 3D0YB 2LLSA 1L2OB 4AQIA 2PMYA 1YURA 2KHNA 3EVUA 2Q91A 1K8UA 2MLEC 1K9UA 2A4JA 2F2PA 3CS1A 1SR6B 1Y6WA 1JF0A 5DKQA 2NLNA 4PE0A 1JFJA 2JRFA 3DVKA 2O5GA 3LLEA 2RGIA 2JC2A 5JOLA 3IQOA 1SL8A 1IG5A 1N0YA 2L50A 3I5GB 4DIRA 4MZKA 4N1FA 2JT8A 1YRTB 1H8BA 1AJ4A 2HPSA 4DUQA 2M9GA 1PALA 2WCEA 4ORBB 4C0LA 1L7ZA 1NP8A 2IS9A 1RJVA 2KBMA 1ZMZA 1GQMA 3BUXB 4PHKA 4OR9B 2OS8B 1ZOTB 4NQGA 3GK1A 2K61A 1RWYA 2SCPA 3CLNA 1F54A 5HLVA 2I94A 3SG3A 4FQOA 1OZSA 2ZFDA 3EVVA 5AERA 1NX0A 1ZUZA 2WORA 1IQ5A 3AAJA 1M39A 2KQ6A 2M1UA 1TRFA 4PHJA 2LHIA 5AFPA 3I5FC 3DVEA 5I2QA 3A4UB 2M3WA 1J7OA 2JU0A 4AQJA 1DGUA 1TTXA 2B1UA 2D8NA 2F2OA 1KFUL 1NX2A 3SG2A 4PCWA 1XFVO 5CSFA 4QJ3B 2JTZA 3C1VA 4FTGA 2LVKA 1SYMA 4OCIA 4E68A 1CFDA 2LHLA 2DOQA 1RROA 3AAKA 4DCKA 1F4QA 4P2YB 4BY5A 1Y1AA 1KCYA 4WRIA 1KQMB 1GGWA 2ZRSA 4CLNA 1S26D 1B1GA 2LMUA 4HREE 1QXPA 1F55A 4YBHB 1L2OC 1PULA 2K7DA 2I7AA 2LANA 1X02A 1S6IA 3CWGA 5F6TA 3PSRA 1SW8A 2PRUA 4XYNA 1SR6C 1U5IA 2GV5A 4Q04A 1DTLA 4I5KA 1B7TZ 3DF0B 2G2BA 4MVFA 1YX7A 1XFXO 2FCEA 2MHHA 2WC8A 5BPJA 2BKIB 2BKHB 1K95A 4WQ3A 3EK4A 1CFPA 1IKUA 1J7QA 4CIDA 3I5GC 3KF9A 5KSZA 1NCZA 2LLTA 3EKJA 1C7WA 3BUOB 5ER4X 3E3RA 3BOWB 2M97A 4I5LB 4YRUA 1S6CA 2O60A 3CR2A 3KEVA 2LVVA 3VROA 4ZCUA 1SCMB 3D10A 4NDBA 2OS8C 1AJ5A 2EGDA 4PE4A 3A8RA 3JTDC 1DVIA 4N5XA 1JBAA 5CPVA 3SG6A 3GOFA 2LUXA 5AEQA 4AOMA 4PE7A 3EK8A 1BODA 2K0JA 1KFXL 1NX3A 1A75B 4JPZB 2R2IA 1DJWA 1NX1A 2JWWA 2Y1NA 1OMRA 1M63B 1BF5A 1EXRA 4I5NB 2MJWB 3CR5X 2WCFA 4ORAB 2JXLA 4GGFC 2L51A 1H4BA 2VRGA 1V1FA 1XFZO 3FIAA 2KGRA 3EVRA 3NXAA 2F33A 3SIBA 5CSNA 1XA5A 1QVIZ 4A4CA 1D1OA 2AAOA 5DKRA 1OMVA 4C0KA 5KTYA 2F3YA 2MLFC 1ODBA 3O2PA 1MQ1A 1LKJA 5I2OA 2HQ8A 1K94A 2FOTA 1KQMC 1B9AA 3IF7A 3KPXA 1WRZA 1LVCD 1JUOA 1LINA 1RK9A 1K9PA 2K2AA 4MN0A 2NCOA 1CDNA 2COLB 1CMGA 1WRKA 4HSZA 3D0YA 2L4HA 1YUUA 1NSHA 2WOSA 4XJKB 2KBIA 4PHNA 2M7NA 1SK6D 2WCBA 1DMOA 1AVSA 2PVBA 2JQ6A 2EHBA 4QJ4B 2OPOA 1PSBA 1JWDA 2H61C 4JWQA 1FF1A 1Y0VH 1YVHA 2QPTA 3DVJA 1JF2A 1C7VA 1J7RA 1UURA 4OV2A 1DJXA 1MUXA 1SMGA 2JZIA 1WDCB 4ETOA 3SJSA 2LMTA 2MBXA 3NSIA 2K7OA 5D69A 1G4YR 1LA3A 4M2OA 4WQ2A 1GGZA 3JTDB 1SCMC 1RFJA 3CR4X 4D1EA 4YGDB 1OZOA 1R6PA 1HT9A 1TN4A 4DS7A 1CFCA 3VRQA 2ISDA 3K21A 2JTTA 1XK4C 1DJIA 1XFWO 2KAVA 4I5JA 1F4OA 2FJUB 1FI5A 2L5XB 2NCPA 2HF5A 4USLA 3WNXB 1CDLA 1G8IA 4MBEA 5AANA 2MRDA 3BUMB 5G08A 3FS7A 1IJ5A 1IWQA 2JOJA 1QX7A 5J3XA 1QTXA 5KU1A 1EL4A 1BR4B 1A2XA 3PATA 4NDDA 4GUKA 2KFFA 1PVAA 1G33A 1OQPA 1TIZA 2JT0A 1B47A 1QV0A 1RECA 2LLUA 3QRXA 3WXAA 3SG5A 5B8IB 1IGVA 1J7PA 3DVMA 3LK0A 4GGNA 1Q80A 2KYFA 1ALWA 1BMOA 2Y1MA 2K8MB 1TCOB 1TNQA 3RLZA 1SRAA 2ZN9A 2PALA 3TS5B 4ORCB 3TDUA 1JFKA 1PVBA 4HRHA 1EJ3A 4R1EA 1K90D 1CLBA 5PALA 4PHMA 3VRNA 1DJZA 2MA2A 5HKYA 4F0ZB 1B8RA 3MSEB 2CNPA 1AHRA 1TNXA 1QX5B 3OHMB 1FI6A 1QS7A 1K96A 2AUCA 3DF0A 1K93D 3I5IC 5HKWA 2F3ZA 1NPQA 2K7BA 3I5HB 1B7TY 4PDZA 1MF8B 4YI8A 1WDCC 3CGAA 4CPVA 1QATA 5I8NA 2KGBC 2JPTA 2CXJA 3BOWA 3ZNIA 2M0RA 3TZ1A 2MAZA 2KYCA 2LMVA 1NCYA 2L98A 1GJYA 1CM4A 3VRPA 1NYAA 1XO5A 1CMFA 1KFXS 2BCXA 2LAPA 1SY9A 3ZWHA 1QV1A 1UHIA 2K2FA 1MHOA 5HLOA 2M29A 3TDIA 1XK4A 2JNXA 4U8DA 1OSAA 3CTNA 3PN7C 3JVTB 1TNPA 1SL7A 2M8UA 2GGZA 3EKHA 1QLSA 2JULA 1CLMA 1KSMA 1NUBA 2LV7A 4M2PA 1YUTA 1YUSA 1W7JB 3TDZA 1AUIB 3BYAA 4GBAA 1CDMA 3SIAA 1DF0B 1CFFA 1MXEA 2V53A 1CM1A 1N2DA 1CLLA 2KAYA 3KO0A 1KK7Z 1F8HA 2LE9B 2SASA 3FWBA 1WRLA 1PK0D 1E8AA 2LC5A 2CT9A 2BBNA 1V1GA 4PALA 1KQVA 2EC6C 3NSOA 1UWOA 3KHEA 3BUWB 2E30A 2LVIA 1K9KA 2Q4UA 1QVIY 1M31A 2KI6C 4MRYA 3TS5C 5D7FA 3SG7A 1XYDA 1NIWA 2GGMA 3CZTX 1UP5A 1YR5A 1JC2A 1OOJA 4XJKA 1DJYA 2LP2A 1C07A 1KSOA 3LCPC 2HQWA 1CKKA 1J55A 2F8PA 4GAOA 1IH0A 4CFRA 2NXQA 3HCMA 2BE4A 3TUYB 2KAXA 1WY9A 3I5IB 1DJHA 1CNPA 3OB1B 1BG1A 4ZCVA 2OTGB 3I5HC 1BLQA 1YRUB 2BE6A 1ZFSA 5TNCA 2ZNEA 2KI4B 1NCXA 1EG3A 1KK8B 1SCVA 3RM1A 3ICBA 1QX2A 1XFUO 1SNLA 1CDPA 3FWCA 3O6BA 4YGEB 1UHNA 3EK7A 3LK1A 2ZNDA 1TOPA 4MEWA 3BUNB 3SG4A 1K2HA 4MZLA 5DKNA 4M2QA 3PN7B 4GPLB 5GQQC 2PSRA 1KFUS 1S1EA 1F71A 1ALVA 2PASA 2WNDA 2BL0B 3OP0A 2KFHA 3JVTC 4C0JA 3BQ3A 3PFVA 3WHTB 2L2EA 2NZ0A 1SPYA 1RTP1 2ZKMX 1AP4A 1IJ6A 4YGCB 4MLWA 1R2UA 1QJTA 4GGFA 1M45A 3F45A 1KWOB 3NSLA 1ZACA 4MZJA 2JNFA 2JT3A 1B8CA 1QLKA 3PM8A 1S36A 5K89A 1VRKA 2EC6B 1UUSA 4OKHA 1SL9A 3NSKA 2ZN8A 2KNEA 2BECA 2H2KA 1HQVA 2E6WA 2KFGA 3PLFB 4DRWA 1WLZA 3GK4X 1TNWA 1IRJA 2CBLA 1YTZC 2ZRTA 3AKBA 1DJGA 2P6BB 2KQYA 4ICBA 1BOCA 3H4SE 2CTNA 2L0PA 1UHHA 3IQQA 4P5OE 4HRGA 2TN4A 3TUYC 5I2LA 2H61A 1JSAA 4YGAA 4MSPA 3LL8B 1B8LA 4MRXA 1DT7B 1CB1A 1U5IB 2L4IA 3O78A 4OVNF 5CSIA 2OTGC 4GFTA 2M7LA 4BY4A 4YI9A 1B4CA 3WHUB 2Y5IA 1PSRA 1YVLA 1LA0A 2BCAA 2KI4C 1KK8C 1FBVA 3OX6A 4IL1A 4PE1A 4L9MA 1OE9B 2M1KB 3O4YA 3HX4A 1UHJA 2I18A 4N1GA 5HKZA 3VRRA 3OB2B 1OMDA 2FCDA 1BJFA 2QACA 1S3PA 2LCPA 1PRWA 2AMIA 2Y4QA 5FYXA 1S6JA 1MR8A 2KSPA 2I2RE 2LVJA 3PALA 1SBJA 5HYDA 2LM5A 1CTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDH A;  1A75 A;  2JXC A;  4UPG A;  2BL0 C;  1BT6 A;  1J1D A;  1XVJ A;  1A03 A;  1IQ3 A;  2KOT A;  4TNC A;  5ER5 A;  1MWN A;  4YGB B;  1J1E A;  1XFY O;  1DGV A;  2LUC A;  3M0W A;  1LXF C;  2LNK A;  1AK8 A;  1M46 A;  1KWO C;  2HET A;  1BU3 A;  1WLM A;  1Y1U A;  3AKA A;  1Y1X A;  1FPW A;  1QAS A;  3I5F B;  1EG4 A;  1S5G Z;  1FW4 A;  1DF0 A;  1QIW A;  5CSJ A;  1UHK A;  1SKT A;  1EH2 A;  2CCM A;  4JQ0 D;  5JJG A;  5AXI A;  5IBW A;  2LP3 A;  1QIV A;  2BBM A;  1BR1 B;  1KK7 Y;  1F70 A;  2K7C A;  2G9B A;  1NWD A;  1S5G Y;  3OX5 A;  2KI6 D;  3VGO A;  1TCF A;  1A29 A;  1A4P A;  1W7I B;  3BXK A;  4GNK B;  3DD4 A;  4NDC A;  2BCB A;  1N65 A;  4CFQ A;  1YX8 A;  4A4B A;  1MXL C;  2M49 B;  3GK2 A;  4QJ5 B;  3D0Y B;  2LLS A;  1L2O B;  4AQI A;  2PMY A;  1YUR A;  2KHN A;  3EVU A;  2Q91 A;  1K8U A;  2MLE C;  1K9U A;  2A4J A;  2F2P A;  3CS1 A;  1SR6 B;  1Y6W A;  1JF0 A;  5DKQ A;  2NLN A;  4PE0 A;  1JFJ A;  2JRF A;  3DVK A;  2O5G A;  3LLE A;  2RGI A;  2JC2 A;  5JOL A;  3IQO A;  1SL8 A;  1IG5 A;  1N0Y A;  2L50 A;  3I5G B;  4DIR A;  4MZK A;  4N1F A;  2JT8 A;  1YRT B;  1H8B A;  1AJ4 A;  2HPS A;  4DUQ A;  2M9G A;  1PAL A;  2WCE A;  4ORB B;  4C0L A;  1L7Z A;  1NP8 A;  2IS9 A;  1RJV A;  2KBM A;  1ZMZ A;  1GQM A;  3BUX B;  4PHK A;  4OR9 B;  2OS8 B;  1ZOT B;  4NQG A;  3GK1 A;  2K61 A;  1RWY A;  2SCP A;  3CLN A;  1F54 A;  5HLV A;  2I94 A;  3SG3 A;  4FQO A;  1OZS A;  2ZFD A;  3EVV A;  5AER A;  1NX0 A;  1ZUZ A;  2WOR A;  1IQ5 A;  3AAJ A;  1M39 A;  2KQ6 A;  2M1U A;  1TRF A;  4PHJ A;  2LHI A;  5AFP A;  3I5F C;  3DVE A;  5I2Q A;  3A4U B;  2M3W A;  1J7O A;  2JU0 A;  4AQJ A;  1DGU A;  1TTX A;  2B1U A;  2D8N A;  2F2O A;  1KFU L;  1NX2 A;  3SG2 A;  4PCW A;  1XFV O;  5CSF A;  4QJ3 B;  2JTZ A;  3C1V A;  4FTG A;  2LVK A;  1SYM A;  4OCI A;  4E68 A;  1CFD A;  2LHL A;  2DOQ A;  1RRO A;  3AAK A;  4DCK A;  1F4Q A;  4P2Y B;  4BY5 A;  1Y1A A;  1KCY A;  4WRI A;  1KQM B;  1GGW A;  2ZRS A;  4CLN A;  1S26 D;  1B1G A;  2LMU A;  4HRE E;  1QXP A;  1F55 A;  4YBH B;  1L2O C;  1PUL A;  2K7D A;  2I7A A;  2LAN A;  1X02 A;  1S6I A;  3CWG A;  5F6T A;  3PSR A;  1SW8 A;  2PRU A;  4XYN A;  1SR6 C;  1U5I A;  2GV5 A;  4Q04 A;  1DTL A;  4I5K A;  1B7T Z;  3DF0 B;  2G2B A;  4MVF A;  1YX7 A;  1XFX O;  2FCE A;  2MHH A;  2WC8 A;  5BPJ A;  2BKI B;  2BKH B;  1K95 A;  4WQ3 A;  3EK4 A;  1CFP A;  1IKU A;  1J7Q A;  4CID A;  3I5G C;  3KF9 A;  5KSZ A;  1NCZ A;  2LLT A;  3EKJ A;  1C7W A;  3BUO B;  5ER4 X;  3E3R A;  3BOW B;  2M97 A;  4I5L B;  4YRU A;  1S6C A;  2O60 A;  3CR2 A;  3KEV A;  2LVV A;  3VRO A;  4ZCU A;  1SCM B;  3D10 A;  4NDB A;  2OS8 C;  1AJ5 A;  2EGD A;  4PE4 A;  3A8R A;  3JTD C;  1DVI A;  4N5X A;  1JBA A;  5CPV A;  3SG6 A;  3GOF A;  2LUX A;  5AEQ A;  4AOM A;  4PE7 A;  3EK8 A;  1BOD A;  2K0J A;  1KFX L;  1NX3 A;  1A75 B;  4JPZ B;  2R2I A;  1DJW A;  1NX1 A;  2JWW A;  2Y1N A;  1OMR A;  1M63 B;  1BF5 A;  1EXR A;  4I5N B;  2MJW B;  3CR5 X;  2WCF A;  4ORA B;  2JXL A;  4GGF C;  2L51 A;  1H4B A;  2VRG A;  1V1F A;  1XFZ O;  3FIA A;  2KGR A;  3EVR A;  3NXA A;  2F33 A;  3SIB A;  5CSN A;  1XA5 A;  1QVI Z;  4A4C A;  1D1O A;  2AAO A;  5DKR A;  1OMV A;  4C0K A;  5KTY A;  2F3Y A;  2MLF C;  1ODB A;  3O2P A;  1MQ1 A;  1LKJ A;  5I2O A;  2HQ8 A;  1K94 A;  2FOT A;  1KQM C;  1B9A A;  3IF7 A;  3KPX A;  1WRZ A;  1LVC D;  1JUO A;  1LIN A;  1RK9 A;  1K9P A;  2K2A A;  4MN0 A;  2NCO A;  1CDN A;  2COL B;  1CMG A;  1WRK A;  4HSZ A;  3D0Y A;  2L4H A;  1YUU A;  1NSH A;  2WOS A;  4XJK B;  2KBI A;  4PHN A;  2M7N A;  1SK6 D;  2WCB A;  1DMO A;  1AVS A;  2PVB A;  2JQ6 A;  2EHB A;  4QJ4 B;  2OPO A;  1PSB A;  1JWD A;  2H61 C;  4JWQ A;  1FF1 A;  1Y0V H;  1YVH A;  2QPT A;  3DVJ A;  1JF2 A;  1C7V A;  1J7R A;  1UUR A;  4OV2 A;  1DJX A;  1MUX A;  1SMG A;  2JZI A;  1WDC B;  4ETO A;  3SJS A;  2LMT A;  2MBX A;  3NSI A;  2K7O A;  5D69 A;  1G4Y R;  1LA3 A;  4M2O A;  4WQ2 A;  1GGZ A;  3JTD B;  1SCM C;  1RFJ A;  3CR4 X;  4D1E A;  4YGD B;  1OZO A;  1R6P A;  1HT9 A;  1TN4 A;  4DS7 A;  1CFC A;  3VRQ A;  2ISD A;  3K21 A;  2JTT A;  1XK4 C;  1DJI A;  1XFW O;  2KAV A;  4I5J A;  1F4O A;  2FJU B;  1FI5 A;  2L5X B;  2NCP A;  2HF5 A;  4USL A;  3WNX B;  1CDL A;  1G8I A;  4MBE A;  5AAN A;  2MRD A;  3BUM B;  5G08 A;  3FS7 A;  1IJ5 A;  1IWQ A;  2JOJ A;  1QX7 A;  5J3X A;  1QTX A;  5KU1 A;  1EL4 A;  1BR4 B;  1A2X A;  3PAT A;  4NDD A;  4GUK A;  2KFF A;  1PVA A;  1G33 A;  1OQP A;  1TIZ A;  2JT0 A;  1B47 A;  1QV0 A;  1REC A;  2LLU A;  3QRX A;  3WXA A;  3SG5 A;  5B8I B;  1IGV A;  1J7P A;  3DVM A;  3LK0 A;  4GGN A;  1Q80 A;  2KYF A;  1ALW A;  1BMO A;  2Y1M A;  2K8M B;  1TCO B;  1TNQ A;  3RLZ A;  1SRA A;  2ZN9 A;  2PAL A;  3TS5 B;  4ORC B;  3TDU A;  1JFK A;  1PVB A;  4HRH A;  1EJ3 A;  4R1E A;  1K90 D;  1CLB A;  5PAL A;  4PHM A;  3VRN A;  1DJZ A;  2MA2 A;  5HKY A;  4F0Z B;  1B8R A;  3MSE B;  2CNP A;  1AHR A;  1TNX A;  1QX5 B;  3OHM B;  1FI6 A;  1QS7 A;  1K96 A;  2AUC A;  3DF0 A;  1K93 D;  3I5I C;  5HKW A;  2F3Z A;  1NPQ A;  2K7B A;  3I5H B;  1B7T Y;  4PDZ A;  1MF8 B;  4YI8 A;  1WDC C;  3CGA A;  4CPV A;  1QAT A;  5I8N A;  2KGB C;  2JPT A;  2CXJ A;  3BOW A;  3ZNI A;  2M0R A;  3TZ1 A;  2MAZ A;  2KYC A;  2LMV A;  1NCY A;  2L98 A;  1GJY A;  1CM4 A;  3VRP A;  1NYA A;  1XO5 A;  1CMF A;  1KFX S;  2BCX A;  2LAP A;  1SY9 A;  3ZWH A;  1QV1 A;  1UHI A;  2K2F A;  1MHO A;  5HLO A;  2M29 A;  3TDI A;  1XK4 A;  2JNX A;  4U8D A;  1OSA A;  3CTN A;  3PN7 C;  3JVT B;  1TNP A;  1SL7 A;  2M8U A;  2GGZ A;  3EKH A;  1QLS A;  2JUL A;  1CLM A;  1KSM A;  1NUB A;  2LV7 A;  4M2P A;  1YUT A;  1YUS A;  1W7J B;  3TDZ A;  1AUI B;  3BYA A;  4GBA A;  1CDM A;  3SIA A;  1DF0 B;  1CFF A;  1MXE A;  2V53 A;  1CM1 A;  1N2D A;  1CLL A;  2KAY A;  3KO0 A;  1KK7 Z;  1F8H A;  2LE9 B;  2SAS A;  3FWB A;  1WRL A;  1PK0 D;  1E8A A;  2LC5 A;  2CT9 A;  2BBN A;  1V1G A;  4PAL A;  1KQV A;  2EC6 C;  3NSO A;  1UWO A;  3KHE A;  3BUW B;  2E30 A;  2LVI A;  1K9K A;  2Q4U A;  1QVI Y;  1M31 A;  2KI6 C;  4MRY A;  3TS5 C;  5D7F A;  3SG7 A;  1XYD A;  1NIW A;  2GGM A;  3CZT X;  1UP5 A;  1YR5 A;  1JC2 A;  1OOJ A;  4XJK A;  1DJY A;  2LP2 A;  1C07 A;  1KSO A;  3LCP C;  2HQW A;  1CKK A;  1J55 A;  2F8P A;  4GAO A;  1IH0 A;  4CFR A;  2NXQ A;  3HCM A;  2BE4 A;  3TUY B;  2KAX A;  1WY9 A;  3I5I B;  1DJH A;  1CNP A;  3OB1 B;  1BG1 A;  4ZCV A;  2OTG B;  3I5H C;  1BLQ A;  1YRU B;  2BE6 A;  1ZFS A;  5TNC A;  2ZNE A;  2KI4 B;  1NCX A;  1EG3 A;  1KK8 B;  1SCV A;  3RM1 A;  3ICB A;  1QX2 A;  1XFU O;  1SNL A;  1CDP A;  3FWC A;  3O6B A;  4YGE B;  1UHN A;  3EK7 A;  3LK1 A;  2ZND A;  1TOP A;  4MEW A;  3BUN B;  3SG4 A;  1K2H A;  4MZL A;  5DKN A;  4M2Q A;  3PN7 B;  4GPL B;  5GQQ C;  2PSR A;  1KFU S;  1S1E A;  1F71 A;  1ALV A;  2PAS A;  2WND A;  2BL0 B;  3OP0 A;  2KFH A;  3JVT C;  4C0J A;  3BQ3 A;  3PFV A;  3WHT B;  2L2E A;  2NZ0 A;  1SPY A;  1RTP 1;  2ZKM X;  1AP4 A;  1IJ6 A;  4YGC B;  4MLW A;  1R2U A;  1QJT A;  4GGF A;  1M45 A;  3F45 A;  1KWO B;  3NSL A;  1ZAC A;  4MZJ A;  2JNF A;  2JT3 A;  1B8C A;  1QLK A;  3PM8 A;  1S36 A;  5K89 A;  1VRK A;  2EC6 B;  1UUS A;  4OKH A;  1SL9 A;  3NSK A;  2ZN8 A;  2KNE A;  2BEC A;  2H2K A;  1HQV A;  2E6W A;  2KFG A;  3PLF B;  4DRW A;  1WLZ A;  3GK4 X;  1TNW A;  1IRJ A;  2CBL A;  1YTZ C;  2ZRT A;  3AKB A;  1DJG A;  2P6B B;  2KQY A;  4ICB A;  1BOC A;  3H4S E;  2CTN A;  2L0P A;  1UHH A;  3IQQ A;  4P5O E;  4HRG A;  2TN4 A;  3TUY C;  5I2L A;  2H61 A;  1JSA A;  4YGA A;  4MSP A;  3LL8 B;  1B8L A;  4MRX A;  1DT7 B;  1CB1 A;  1U5I B;  2L4I A;  3O78 A;  4OVN F;  5CSI A;  2OTG C;  4GFT A;  2M7L A;  4BY4 A;  4YI9 A;  1B4C A;  3WHU B;  2Y5I A;  1PSR A;  1YVL A;  1LA0 A;  2BCA A;  2KI4 C;  1KK8 C;  1FBV A;  3OX6 A;  4IL1 A;  4PE1 A;  4L9M A;  1OE9 B;  2M1K B;  3O4Y A;  3HX4 A;  1UHJ A;  2I18 A;  4N1G A;  5HKZ A;  3VRR A;  3OB2 B;  1OMD A;  2FCD A;  1BJF A;  2QAC A;  1S3P A;  2LCP A;  1PRW A;  2AMI A;  2Y4Q A;  5FYX A;  1S6J A;  1MR8 A;  2KSP A;  2I2R E;  2LVJ A;  3PAL A;  1SBJ A;  5HYD A;  2LM5 A;  1CTR A; 
#chains in the Genus database with same CATH topology
 2KDH A;  1C3Y A;  1A75 A;  2JXC A;  4UPG A;  2BL0 C;  1BT6 A;  1J1D A;  1XVJ A;  3Q8I A;  1A03 A;  3CYZ A;  2KOT A;  4TNC A;  5ER5 A;  1MWN A;  4YGB B;  1J1E A;  1XFY O;  5FI2 A;  1DGV A;  2LUC A;  3M0W A;  1LXF C;  3B7A A;  2LNK A;  1AK8 A;  1M46 A;  1KWO C;  2HET A;  1BU3 A;  1WLM A;  1Y1U A;  2WC5 A;  3AKA A;  1Y1X A;  1FPW A;  1QAS A;  2BAP A;  3I5F B;  2L5Y A;  1EG4 A;  1S5G Z;  1FW4 A;  1DF0 A;  1QIW A;  5CSJ A;  1UHK A;  1SKT A;  1EH2 A;  2CCM A;  4JQ0 D;  5JJG A;  5EL2 A;  5AXI A;  5IBW A;  2LP3 A;  1QIV A;  2BBM A;  1BR1 B;  2P71 A;  1KK7 Y;  1F70 A;  2K7C A;  2G9B A;  1NWD A;  1S5G Y;  3OX5 A;  4OZD A;  2KI6 D;  3VGO A;  1TCF A;  1A29 A;  1A4P A;  1W7I B;  3BXK A;  4GNK B;  3DD4 A;  4NDC A;  2BCB A;  1N65 A;  4CFQ A;  1YX8 A;  4A4B A;  1MXL C;  2M49 B;  3EG5 B;  3GK2 A;  3D0Y B;  2LLS A;  4QJ5 B;  1L2O B;  4AQI A;  2PMY A;  1YUR A;  2KHN A;  3EVU A;  2Q91 A;  1K8U A;  2MLE C;  1K9U A;  2A4J A;  2F2P A;  3CS1 A;  1SR6 B;  1Y6W A;  1JF0 A;  5DKQ A;  2NLN A;  4PE0 A;  1JFJ A;  1LS8 A;  2JRF A;  1W9Z A;  3DVK A;  2O5G A;  3LLE A;  2RGI A;  2JC2 A;  3V2L A;  3S0E A;  5JOL A;  3IQO A;  1SL8 A;  1IG5 A;  1N0Y A;  2L50 A;  3I5G B;  4DIR A;  4MZK A;  4N1F A;  2JT8 A;  1YRT B;  1H8B A;  1AJ4 A;  2HPS A;  4DUQ A;  2M9G A;  3DXL A;  1PAL A;  2WCE A;  4ORB B;  4C0L A;  1L7Z A;  1NP8 A;  2IS9 A;  1RJV A;  2KBM A;  1ZMZ A;  1GQM A;  3BUX B;  3NHT A;  4OR9 B;  4PHK A;  2JPO A;  2OS8 B;  1ZOT B;  4NQG A;  3GK1 A;  2K61 A;  1RWY A;  2SCP A;  3CLN A;  1XFR A;  1F54 A;  5HLV A;  2I94 A;  3SG3 A;  4FQO A;  1OZS A;  2ZFD A;  3EVV A;  5AER A;  1NX0 A;  1ZUZ A;  2WOR A;  1IQ5 A;  3AAJ A;  1M39 A;  2KQ6 A;  2M1U A;  1TRF A;  4PHJ A;  2LHI A;  5AFP A;  3I5F C;  3DVE A;  5I2Q A;  3A4U B;  2M3W A;  1J7O A;  2JU0 A;  4AQJ A;  1DGU A;  1TTX A;  2B1U A;  2D8N A;  2F2O A;  1KFU L;  1NX2 A;  3SG2 A;  2L2C A;  4PCW A;  1XFV O;  5CSF A;  4QJ3 B;  2JTZ A;  3C1V A;  4FTG A;  2LVK A;  1SYM A;  3FE9 A;  4OCI A;  4E68 A;  3FE8 A;  1CFD A;  2LHL A;  3PJI A;  2DOQ A;  1RRO A;  1SSE B;  3AAK A;  4DCK A;  1F4Q A;  4P2Y B;  4BY5 A;  1Y1A A;  1KCY A;  4WRI A;  1DQE A;  1KQM B;  1GGW A;  2ZRS A;  4CLN A;  1S26 D;  1B1G A;  2LMU A;  4HRE E;  1QXP A;  1F55 A;  1IIO A;  3K1E A;  4YBH B;  1L2O C;  1PUL A;  2K7D A;  2I7A A;  3PM2 A;  2LAN A;  1X02 A;  1S6I A;  3CWG A;  5F6T A;  3PSR A;  2GTE A;  3UNW A;  1SW8 A;  2PRU A;  4XYN A;  1SR6 C;  1U5I A;  2GV5 A;  4Q04 A;  1DTL A;  4PT1 A;  4I5K A;  1B7T Z;  3S0B A;  3DF0 B;  2G2B A;  4MVF A;  1YX7 A;  1XFX O;  2FCE A;  2MHH A;  3D77 A;  2WC8 A;  3OGN A;  5BPJ A;  2BKI B;  2BKH B;  1K95 A;  4WQ3 A;  3EK4 A;  1CFP A;  1IKU A;  3VB1 A;  3R1V A;  4CID A;  3I5G C;  3KF9 A;  5KSZ A;  1NCZ A;  1J7Q A;  2LLT A;  3EKJ A;  1C7W A;  1OOG A;  3BUO B;  5ER4 X;  4JD9 A;  3E3R A;  3BOW B;  2M97 A;  4I5L B;  4YRU A;  1S6C A;  2O60 A;  3CR2 A;  3KEV A;  2LVV A;  3BFB A;  3VRO A;  4ZCU A;  1DEL A;  1SCM B;  3D10 A;  4NDB A;  2OS8 C;  1AJ5 A;  2EGD A;  4PE4 A;  3A8R A;  3JTD C;  1DVI A;  4N5X A;  1JBA A;  5CPV A;  3SG6 A;  3GOF A;  2LUX A;  5AEQ A;  3S0D A;  4AOM A;  4PE7 A;  3EK8 A;  1BOD A;  2K0J A;  5I94 A;  1KFX L;  2H8V A;  1NX3 A;  1A75 B;  3R1P A;  2R2I A;  4JPZ B;  1DJW A;  1NX1 A;  2JWW A;  2Y1N A;  1OMR A;  1M63 B;  1BF5 A;  1EXR A;  4I5N B;  2MJW B;  3CR5 X;  3O4X A;  2WCF A;  4ORA B;  2JXL A;  3SS5 A;  4GGF C;  1P28 A;  2L51 A;  1H4B A;  2VRG A;  1V1F A;  2QEV A;  1XFZ O;  3FIA A;  2KGR A;  3EVR A;  4JKT A;  3D78 A;  2KLD A;  3NXA A;  2F33 A;  3SIB A;  5CSN A;  1XA5 A;  3BJH A;  1QVI Z;  4A4C A;  1D1O A;  2AAO A;  5DKR A;  1OMV A;  4C0K A;  5KTY A;  2F3Y A;  2MLF C;  1ODB A;  3O2P A;  1MQ1 A;  1LKJ A;  5I2O A;  2HQ8 A;  1K94 A;  2FOT A;  1KQM C;  1B9A A;  3IF7 A;  3KPX A;  1WRZ A;  1LVC D;  1JUO A;  1LIN A;  1RK9 A;  1K9P A;  2K2A A;  4MN0 A;  2NCO A;  1CDN A;  2COL B;  1CMG A;  1WRK A;  4HSZ A;  4FQT A;  3D0Y A;  1ORG A;  2L4H A;  1YUU A;  1NSH A;  2QEB A;  2WOS A;  4XJK B;  2KBI A;  4PHN A;  3S0F A;  2M7N A;  2KPH A;  5FI6 A;  1SK6 D;  2KLE A;  2WCH A;  1QWV A;  3CZ0 A;  2WCB A;  1DMO A;  1AVS A;  3BFA A;  2PVB A;  2JQ6 A;  3IVT A;  2EHB A;  4QJ4 B;  2OPO A;  1PSB A;  3B88 A;  1JWD A;  2H61 C;  4JWQ A;  1FF1 A;  1Y0V H;  1YVH A;  2QPT A;  1TUJ A;  3DVJ A;  1OOI X;  1JF2 A;  1C7V A;  1J7R A;  1UUR A;  4OV2 A;  1DJX A;  1MUX A;  5FI7 A;  1SMG A;  2JZI A;  1WDC B;  4ETO A;  3CZ2 A;  3SJS A;  2LMT A;  2MBX A;  3NSI A;  3RZS A;  2K7O A;  5D69 A;  1G4Y R;  1LA3 A;  4M2O A;  4WQ2 A;  1GGZ A;  1IQ3 A;  3JTD B;  1SCM C;  1RFJ A;  3CR4 X;  4D1E A;  4YGD B;  1OZO A;  1R6P A;  1HT9 A;  1TN4 A;  4DS7 A;  1CFC A;  3VRQ A;  1C3Z A;  2ISD A;  3K21 A;  2JTT A;  1OOF A;  1XK4 C;  3DY9 A;  1DJI A;  1XFW O;  1OOH A;  2KAV A;  3DYE A;  4I5J A;  1F4O A;  2FJU B;  1FI5 A;  2L5X B;  2NCP A;  2HF5 A;  4USL A;  3WNX B;  1CDL A;  1G8I A;  4MBE A;  5AAN A;  2MRD A;  3BUM B;  5G08 A;  3FS7 A;  1IJ5 A;  1IWQ A;  2JOJ A;  1QX7 A;  5J3X A;  4INX A;  1QTX A;  5KU1 A;  1EL4 A;  1BR4 B;  1A2X A;  3PAT A;  4NDD A;  4GUK A;  2KFF A;  4INW A;  1PVA A;  1G33 A;  1OQP A;  1TIZ A;  2JT0 A;  4IJ7 A;  1B47 A;  1QV0 A;  1REC A;  2LLU A;  3QRX A;  3WXA A;  3SG5 A;  5B8I B;  1IGV A;  1J7P A;  3DVM A;  3LK0 A;  4GGN A;  1Q80 A;  2KYF A;  1ALW A;  1BMO A;  2Y1M A;  2K8M B;  1TCO B;  1TNQ A;  3RLZ A;  1SRA A;  2ZN9 A;  2PAL A;  3TS5 B;  4ORC B;  3TDU A;  1JFK A;  1PVB A;  4HRH A;  1EJ3 A;  4R1E A;  1K90 D;  1CLB A;  3B86 A;  5PAL A;  4PHM A;  3VRN A;  1DJZ A;  2MA2 A;  5HKY A;  2WCK A;  4F0Z B;  1B8R A;  3MSE B;  2CNP A;  1AHR A;  3D74 A;  1TNX A;  1QX5 B;  3OHM B;  1FI6 A;  1QS7 A;  1K96 A;  2AUC A;  3BFH A;  3DF0 A;  1K93 D;  3I5I C;  5HKW A;  2F3Z A;  1NPQ A;  2K7B A;  3I5H B;  1B7T Y;  4PDZ A;  1MF8 B;  4YI8 A;  1WDC C;  2FJY A;  3CGA A;  3UO9 A;  4CPV A;  1QAT A;  5DIC A;  5I8N A;  2KGB C;  2JPT A;  2CXJ A;  3BOW A;  3ZNI A;  2M0R A;  3TZ1 A;  3D76 A;  2MAZ A;  2KYC A;  2LMV A;  1NCY A;  3L4L A;  2L98 A;  1GJY A;  1CM4 A;  3VRP A;  1NYA A;  1XO5 A;  1CMF A;  1KFX S;  2BCX A;  2QEH A;  3CZ1 A;  2LAP A;  3FE6 A;  1SY9 A;  3ZWH A;  1GM0 A;  1QV1 A;  1UHI A;  2K2F A;  1MHO A;  5HLO A;  2M29 A;  3TDI A;  1XK4 A;  2JNX A;  4U8D A;  1OSA A;  3CTN A;  3N7H A;  3PN7 C;  3NGV A;  3JVT B;  1T14 A;  1TNP A;  1SL7 A;  2M8U A;  2GGZ A;  3CDN A;  1QLS A;  3CAB A;  3EKH A;  2JUL A;  1CLM A;  1KSM A;  1NUB A;  2LV7 A;  4M2P A;  1YUT A;  1YUS A;  1W7J B;  3TDZ A;  1AUI B;  2QEO A;  3BYA A;  4GBA A;  1CDM A;  3SIA A;  4KYN A;  1DF0 B;  1CFF A;  1MXE A;  2V53 A;  1CM1 A;  1N2D A;  1CLL A;  2KAY A;  2K60 A;  3KO0 A;  1KK7 Z;  1F8H A;  2LE9 B;  2WCM A;  2SAS A;  3FWB A;  1WRL A;  1PK0 D;  1E8A A;  2LC5 A;  3L4A A;  2CT9 A;  2BBN A;  3S0G A;  1V1G A;  4PAL A;  1KQV A;  2EC6 C;  3NSO A;  2ERB A;  1UWO A;  3KHE A;  3BUW B;  2E30 A;  2LVI A;  1K9K A;  2Q4U A;  1QVI Y;  1M31 A;  2KI6 C;  4MRY A;  3B87 A;  5D7F A;  3SG7 A;  3TS5 C;  1XYD A;  1NIW A;  2GGM A;  3CZT X;  1UP5 A;  1YR5 A;  1JC2 A;  1OOJ A;  2QDI A;  1DJY A;  2LP2 A;  4XJK A;  1C07 A;  1KSO A;  3LCP C;  2HQW A;  1CKK A;  1J55 A;  2F8P A;  4GAO A;  1IH0 A;  4CFR A;  3SS4 A;  2NXQ A;  3HCM A;  2BE4 A;  3TUY B;  1TWO A;  2KAX A;  2WC6 A;  1WY9 A;  3I5I B;  1DJH A;  1CNP A;  3OB1 B;  1BG1 A;  4ZCV A;  2OTG B;  3I5H C;  1BLQ A;  1YRU B;  2BE6 A;  1ZFS A;  3QME A;  2ZNE A;  2KI4 B;  5TNC A;  2PYQ A;  3S0A A;  1NCX A;  1EG3 A;  1KK8 B;  1SCV A;  3RM1 A;  3ICB A;  1QX2 A;  1XFU O;  1SNL A;  1CDP A;  3FWC A;  2BNX A;  3O6B A;  4YGE B;  1UHN A;  3EK7 A;  3LK1 A;  2ZND A;  1TOP A;  4MEW A;  3BUN B;  3SG4 A;  1K2H A;  4MZL A;  1TUZ A;  5DKN A;  4M2Q A;  3PN7 B;  4GPL B;  5GQQ C;  2PSR A;  3B6X A;  1KFU S;  1S1E A;  1F71 A;  1ALV A;  2PAS A;  2WND A;  2BL0 B;  3OP0 A;  2KFH A;  3JVT C;  4C0J A;  3BQ3 A;  3PFV A;  3WHT B;  2L2E A;  2NZ0 A;  2WCL A;  1SPY A;  1RTP 1;  2ZKM X;  1AP4 A;  1IJ6 A;  4YGC B;  4MLW A;  1R2U A;  3D75 A;  1QJT A;  4GGF A;  1M45 A;  3F45 A;  1KWO B;  3NSL A;  1ZAC A;  4MZJ A;  2JNF A;  2JT3 A;  1B8C A;  1QLK A;  3PM8 A;  1S36 A;  5K89 A;  1VRK A;  2EC6 B;  1UUS A;  4OKH A;  1SL9 A;  1Z4H A;  3NSK A;  2ZN8 A;  2KNE A;  3DZT A;  1DEK A;  3SS3 A;  2BEC A;  2YGU A;  2H2K A;  1HQV A;  2E6W A;  2KFG A;  2PQL A;  1DC1 A;  1Z2C B;  3PLF B;  1WLZ A;  4DRW A;  3GK4 X;  1TNW A;  1IRJ A;  1YTZ C;  2CBL A;  2ZRT A;  3AKB A;  3R72 A;  1DJG A;  2P6B B;  2KQY A;  3OBV A;  4ICB A;  1BOC A;  3H4S E;  2CTN A;  2P70 A;  2L0P A;  1UHH A;  3IQQ A;  3R1O A;  4P5O E;  4HRG A;  2TN4 A;  3TUY C;  5I2L A;  2H61 A;  1JSA A;  4YGA A;  4F7F A;  4MSP A;  3LL8 B;  2WCJ A;  1B8L A;  4MRX A;  1DT7 B;  1CB1 A;  1U5I B;  2L4I A;  3O78 A;  4OVN F;  5CSI A;  2OTG C;  4GFT A;  2M7L A;  4BY4 A;  5HL1 A;  3D73 A;  4YI9 A;  1B4C A;  3WHU B;  2Y5I A;  1PSR A;  1YVL A;  1LA0 A;  2BCA A;  2KI4 C;  1KK8 C;  1FBV A;  3OX6 A;  4IL1 A;  4PE1 A;  4L9M A;  1OE9 B;  2M1K B;  3NHI A;  3HX4 A;  1UHJ A;  2I18 A;  3O4Y A;  4N1G A;  5HKZ A;  3VRR A;  3OB2 B;  1OMD A;  2FCD A;  1BJF A;  2QAC A;  1S3P A;  2LCP A;  1PRW A;  2AMI A;  2Y4Q A;  5FYX A;  1S6J A;  5D3O A;  1OW4 A;  1MR8 A;  2KSP A;  2I2R E;  2LVJ A;  3PAL A;  1SBJ A;  5HYD A;  2LM5 A;  3L47 A;  1CTR A; 
#chains in the Genus database with same CATH homology
 2KDH A;  1A75 A;  2JXC A;  4UPG A;  2BL0 C;  1BT6 A;  1J1D A;  1XVJ A;  1A03 A;  1IQ3 A;  2KOT A;  4TNC A;  5ER5 A;  1MWN A;  4YGB B;  1J1E A;  1XFY O;  1DGV A;  2LUC A;  3M0W A;  1LXF C;  2LNK A;  1AK8 A;  1M46 A;  1KWO C;  2HET A;  1BU3 A;  1WLM A;  1Y1U A;  3AKA A;  1Y1X A;  1FPW A;  1QAS A;  3I5F B;  1EG4 A;  1S5G Z;  1FW4 A;  1DF0 A;  1QIW A;  5CSJ A;  1UHK A;  1SKT A;  1EH2 A;  2CCM A;  4JQ0 D;  5JJG A;  5AXI A;  5IBW A;  2LP3 A;  1QIV A;  2BBM A;  1BR1 B;  1KK7 Y;  1F70 A;  2K7C A;  2G9B A;  1NWD A;  1S5G Y;  3OX5 A;  2KI6 D;  3VGO A;  1TCF A;  1A29 A;  1A4P A;  1W7I B;  3BXK A;  4GNK B;  3DD4 A;  4NDC A;  2BCB A;  1N65 A;  4CFQ A;  1YX8 A;  4A4B A;  1MXL C;  2M49 B;  3GK2 A;  4QJ5 B;  3D0Y B;  2LLS A;  1L2O B;  4AQI A;  2PMY A;  1YUR A;  2KHN A;  3EVU A;  2Q91 A;  1K8U A;  2MLE C;  1K9U A;  2A4J A;  2F2P A;  3CS1 A;  1SR6 B;  1Y6W A;  1JF0 A;  5DKQ A;  2NLN A;  4PE0 A;  1JFJ A;  2JRF A;  3DVK A;  2O5G A;  3LLE A;  2RGI A;  2JC2 A;  5JOL A;  3IQO A;  1SL8 A;  1IG5 A;  1N0Y A;  2L50 A;  3I5G B;  4DIR A;  4MZK A;  4N1F A;  2JT8 A;  1YRT B;  1H8B A;  1AJ4 A;  2HPS A;  4DUQ A;  2M9G A;  1PAL A;  2WCE A;  4ORB B;  4C0L A;  1L7Z A;  1NP8 A;  2IS9 A;  1RJV A;  2KBM A;  1ZMZ A;  1GQM A;  3BUX B;  4PHK A;  4OR9 B;  2OS8 B;  1ZOT B;  4NQG A;  3GK1 A;  2K61 A;  1RWY A;  2SCP A;  3CLN A;  1F54 A;  5HLV A;  2I94 A;  3SG3 A;  4FQO A;  1OZS A;  2ZFD A;  3EVV A;  5AER A;  1NX0 A;  1ZUZ A;  2WOR A;  1IQ5 A;  3AAJ A;  1M39 A;  2KQ6 A;  2M1U A;  1TRF A;  4PHJ A;  2LHI A;  5AFP A;  3I5F C;  3DVE A;  5I2Q A;  3A4U B;  2M3W A;  1J7O A;  2JU0 A;  4AQJ A;  1DGU A;  1TTX A;  2B1U A;  2D8N A;  2F2O A;  1KFU L;  1NX2 A;  3SG2 A;  4PCW A;  1XFV O;  5CSF A;  4QJ3 B;  2JTZ A;  3C1V A;  4FTG A;  2LVK A;  1SYM A;  4OCI A;  4E68 A;  1CFD A;  2LHL A;  2DOQ A;  1RRO A;  3AAK A;  4DCK A;  1F4Q A;  4P2Y B;  4BY5 A;  1Y1A A;  1KCY A;  4WRI A;  1KQM B;  1GGW A;  2ZRS A;  4CLN A;  1S26 D;  1B1G A;  2LMU A;  4HRE E;  1QXP A;  1F55 A;  4YBH B;  1L2O C;  1PUL A;  2K7D A;  2I7A A;  2LAN A;  1X02 A;  1S6I A;  3CWG A;  5F6T A;  3PSR A;  1SW8 A;  2PRU A;  4XYN A;  1SR6 C;  1U5I A;  2GV5 A;  4Q04 A;  1DTL A;  4I5K A;  1B7T Z;  3DF0 B;  2G2B A;  4MVF A;  1YX7 A;  1XFX O;  2FCE A;  2MHH A;  2WC8 A;  5BPJ A;  2BKI B;  2BKH B;  1K95 A;  4WQ3 A;  3EK4 A;  1CFP A;  1IKU A;  1J7Q A;  4CID A;  3I5G C;  3KF9 A;  5KSZ A;  1NCZ A;  2LLT A;  3EKJ A;  1C7W A;  3BUO B;  5ER4 X;  3E3R A;  3BOW B;  2M97 A;  4I5L B;  4YRU A;  1S6C A;  2O60 A;  3CR2 A;  3KEV A;  2LVV A;  3VRO A;  4ZCU A;  1SCM B;  3D10 A;  4NDB A;  2OS8 C;  1AJ5 A;  2EGD A;  4PE4 A;  3A8R A;  3JTD C;  1DVI A;  4N5X A;  1JBA A;  5CPV A;  3SG6 A;  3GOF A;  2LUX A;  5AEQ A;  4AOM A;  4PE7 A;  3EK8 A;  1BOD A;  2K0J A;  1KFX L;  1NX3 A;  1A75 B;  4JPZ B;  2R2I A;  1DJW A;  1NX1 A;  2JWW A;  2Y1N A;  1OMR A;  1M63 B;  1BF5 A;  1EXR A;  4I5N B;  2MJW B;  3CR5 X;  2WCF A;  4ORA B;  2JXL A;  4GGF C;  2L51 A;  1H4B A;  2VRG A;  1V1F A;  1XFZ O;  3FIA A;  2KGR A;  3EVR A;  3NXA A;  2F33 A;  3SIB A;  5CSN A;  1XA5 A;  1QVI Z;  4A4C A;  1D1O A;  2AAO A;  5DKR A;  1OMV A;  4C0K A;  5KTY A;  2F3Y A;  2MLF C;  1ODB A;  3O2P A;  1MQ1 A;  1LKJ A;  5I2O A;  2HQ8 A;  1K94 A;  2FOT A;  1KQM C;  1B9A A;  3IF7 A;  3KPX A;  1WRZ A;  1LVC D;  1JUO A;  1LIN A;  1RK9 A;  1K9P A;  2K2A A;  4MN0 A;  2NCO A;  1CDN A;  2COL B;  1CMG A;  1WRK A;  4HSZ A;  3D0Y A;  2L4H A;  1YUU A;  1NSH A;  2WOS A;  4XJK B;  2KBI A;  4PHN A;  2M7N A;  1SK6 D;  2WCB A;  1DMO A;  1AVS A;  2PVB A;  2JQ6 A;  2EHB A;  4QJ4 B;  2OPO A;  1PSB A;  1JWD A;  2H61 C;  4JWQ A;  1FF1 A;  1Y0V H;  1YVH A;  2QPT A;  3DVJ A;  1JF2 A;  1C7V A;  1J7R A;  1UUR A;  4OV2 A;  1DJX A;  1MUX A;  1SMG A;  2JZI A;  1WDC B;  4ETO A;  3SJS A;  2LMT A;  2MBX A;  3NSI A;  2K7O A;  5D69 A;  1G4Y R;  1LA3 A;  4M2O A;  4WQ2 A;  1GGZ A;  3JTD B;  1SCM C;  1RFJ A;  3CR4 X;  4D1E A;  4YGD B;  1OZO A;  1R6P A;  1HT9 A;  1TN4 A;  4DS7 A;  1CFC A;  3VRQ A;  2ISD A;  3K21 A;  2JTT A;  1XK4 C;  1DJI A;  1XFW O;  2KAV A;  4I5J A;  1F4O A;  2FJU B;  1FI5 A;  2L5X B;  2NCP A;  2HF5 A;  4USL A;  3WNX B;  1CDL A;  1G8I A;  4MBE A;  5AAN A;  2MRD A;  3BUM B;  5G08 A;  3FS7 A;  1IJ5 A;  1IWQ A;  2JOJ A;  1QX7 A;  5J3X A;  1QTX A;  5KU1 A;  1EL4 A;  1BR4 B;  1A2X A;  3PAT A;  4NDD A;  4GUK A;  2KFF A;  1PVA A;  1G33 A;  1OQP A;  1TIZ A;  2JT0 A;  1B47 A;  1QV0 A;  1REC A;  2LLU A;  3QRX A;  3WXA A;  3SG5 A;  5B8I B;  1IGV A;  1J7P A;  3DVM A;  3LK0 A;  4GGN A;  1Q80 A;  2KYF A;  1ALW A;  1BMO A;  2Y1M A;  2K8M B;  1TCO B;  1TNQ A;  3RLZ A;  1SRA A;  2ZN9 A;  2PAL A;  3TS5 B;  4ORC B;  3TDU A;  1JFK A;  1PVB A;  4HRH A;  1EJ3 A;  4R1E A;  1K90 D;  1CLB A;  5PAL A;  4PHM A;  3VRN A;  1DJZ A;  2MA2 A;  5HKY A;  4F0Z B;  1B8R A;  3MSE B;  2CNP A;  1AHR A;  1TNX A;  1QX5 B;  3OHM B;  1FI6 A;  1QS7 A;  1K96 A;  2AUC A;  3DF0 A;  1K93 D;  3I5I C;  5HKW A;  2F3Z A;  1NPQ A;  2K7B A;  3I5H B;  1B7T Y;  4PDZ A;  1MF8 B;  4YI8 A;  1WDC C;  3CGA A;  4CPV A;  1QAT A;  5I8N A;  2KGB C;  2JPT A;  2CXJ A;  3BOW A;  3ZNI A;  2M0R A;  3TZ1 A;  2MAZ A;  2KYC A;  2LMV A;  1NCY A;  2L98 A;  1GJY A;  1CM4 A;  3VRP A;  1NYA A;  1XO5 A;  1CMF A;  1KFX S;  2BCX A;  2LAP A;  1SY9 A;  3ZWH A;  1QV1 A;  1UHI A;  2K2F A;  1MHO A;  5HLO A;  2M29 A;  3TDI A;  1XK4 A;  2JNX A;  4U8D A;  1OSA A;  3CTN A;  3PN7 C;  3JVT B;  1TNP A;  1SL7 A;  2M8U A;  2GGZ A;  3EKH A;  1QLS A;  2JUL A;  1CLM A;  1KSM A;  1NUB A;  2LV7 A;  4M2P A;  1YUT A;  1YUS A;  1W7J B;  3TDZ A;  1AUI B;  3BYA A;  4GBA A;  1CDM A;  3SIA A;  1DF0 B;  1CFF A;  1MXE A;  2V53 A;  1CM1 A;  1N2D A;  1CLL A;  2KAY A;  3KO0 A;  1KK7 Z;  1F8H A;  2LE9 B;  2SAS A;  3FWB A;  1WRL A;  1PK0 D;  1E8A A;  2LC5 A;  2CT9 A;  2BBN A;  1V1G A;  4PAL A;  1KQV A;  2EC6 C;  3NSO A;  1UWO A;  3KHE A;  3BUW B;  2E30 A;  2LVI A;  1K9K A;  2Q4U A;  1QVI Y;  1M31 A;  2KI6 C;  4MRY A;  3TS5 C;  5D7F A;  3SG7 A;  1XYD A;  1NIW A;  2GGM A;  3CZT X;  1UP5 A;  1YR5 A;  1JC2 A;  1OOJ A;  4XJK A;  1DJY A;  2LP2 A;  1C07 A;  1KSO A;  3LCP C;  2HQW A;  1CKK A;  1J55 A;  2F8P A;  4GAO A;  1IH0 A;  4CFR A;  2NXQ A;  3HCM A;  2BE4 A;  3TUY B;  2KAX A;  1WY9 A;  3I5I B;  1DJH A;  1CNP A;  3OB1 B;  1BG1 A;  4ZCV A;  2OTG B;  3I5H C;  1BLQ A;  1YRU B;  2BE6 A;  1ZFS A;  5TNC A;  2ZNE A;  2KI4 B;  1NCX A;  1EG3 A;  1KK8 B;  1SCV A;  3RM1 A;  3ICB A;  1QX2 A;  1XFU O;  1SNL A;  1CDP A;  3FWC A;  3O6B A;  4YGE B;  1UHN A;  3EK7 A;  3LK1 A;  2ZND A;  1TOP A;  4MEW A;  3BUN B;  3SG4 A;  1K2H A;  4MZL A;  5DKN A;  4M2Q A;  3PN7 B;  4GPL B;  5GQQ C;  2PSR A;  1KFU S;  1S1E A;  1F71 A;  1ALV A;  2PAS A;  2WND A;  2BL0 B;  3OP0 A;  2KFH A;  3JVT C;  4C0J A;  3BQ3 A;  3PFV A;  3WHT B;  2L2E A;  2NZ0 A;  1SPY A;  1RTP 1;  2ZKM X;  1AP4 A;  1IJ6 A;  4YGC B;  4MLW A;  1R2U A;  1QJT A;  4GGF A;  1M45 A;  3F45 A;  1KWO B;  3NSL A;  1ZAC A;  4MZJ A;  2JNF A;  2JT3 A;  1B8C A;  1QLK A;  3PM8 A;  1S36 A;  5K89 A;  1VRK A;  2EC6 B;  1UUS A;  4OKH A;  1SL9 A;  3NSK A;  2ZN8 A;  2KNE A;  2BEC A;  2H2K A;  1HQV A;  2E6W A;  2KFG A;  3PLF B;  4DRW A;  1WLZ A;  3GK4 X;  1TNW A;  1IRJ A;  2CBL A;  1YTZ C;  2ZRT A;  3AKB A;  1DJG A;  2P6B B;  2KQY A;  4ICB A;  1BOC A;  3H4S E;  2CTN A;  2L0P A;  1UHH A;  3IQQ A;  4P5O E;  4HRG A;  2TN4 A;  3TUY C;  5I2L A;  2H61 A;  1JSA A;  4YGA A;  4MSP A;  3LL8 B;  1B8L A;  4MRX A;  1DT7 B;  1CB1 A;  1U5I B;  2L4I A;  3O78 A;  4OVN F;  5CSI A;  2OTG C;  4GFT A;  2M7L A;  4BY4 A;  4YI9 A;  1B4C A;  3WHU B;  2Y5I A;  1PSR A;  1YVL A;  1LA0 A;  2BCA A;  2KI4 C;  1KK8 C;  1FBV A;  3OX6 A;  4IL1 A;  4PE1 A;  4L9M A;  1OE9 B;  2M1K B;  3O4Y A;  3HX4 A;  1UHJ A;  2I18 A;  4N1G A;  5HKZ A;  3VRR A;  3OB2 B;  1OMD A;  2FCD A;  1BJF A;  2QAC A;  1S3P A;  2LCP A;  1PRW A;  2AMI A;  2Y4Q A;  5FYX A;  1S6J A;  1MR8 A;  2KSP A;  2I2R E;  2LVJ A;  3PAL A;  1SBJ A;  5HYD A;  2LM5 A;  1CTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...