1OOFA

Complex of drosophila odorant binding protein lush with ethanol
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
124
structure length
124
Chain Sequence
b'MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords odorant binding protein LUSH
publication title Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 46
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1oofA00
5EL2A 2L2CA 3D78A 4OZDA 1LS8A 1C3YA 3CYZA 3N7HA 2QEHA 3DYEA 3VB1A 1P28A 3CZ2A 1GM0A 3L47A 4INWA 3DZTA 1C3ZA 3S0DA 1OOGA 3BFBA 3R1OA 3R1PA 4F7FA 1T14A 4JD9A 4INXA 3PJIA 1QWVA 1TWOA 1OOFA 4PT1A 3R1VA 3DXLA 3CZ1A 3L4AA 3FE9A 3BFAA 3B6XA 3BJHA 3DY9A 2P71A 3CZ0A 3CABA 3V2LA 3S0FA 2PQLA 3S0BA 2GTEA 2ERBA 1OOIX 3L4LA 3S0AA 3D74A 3B88A 3D73A 3FE6A 1DQEA 2WCJA 3S0EA 3D75A 2QDIA 3BFHA 2P70A 3CDNA 3QMEA 2KPHA 3R72A 3B87A 2FJYA 3FE8A 3NGVA 2WCKA 3B86A 3NHIA 3RZSA 2QEBA 3K1EA 3Q8IA 3B7AA 3NHTA 3OGNA 2WC6A 2JPOA 3S0GA 2WCMA 2WC5A 2WCLA 2QEOA 3D77A 1TUJA 5DICA 2QEVA 1ORGA 1XFRA 2WCHA 4FQTA 2H8VA 1OOHA 3D76A 1OW4A
chains in the Genus database with same CATH superfamily
2EC6B 1QV1A 2L2CA 2BAPA 4MRXA 4YGBB 1Y1AA 3HCMA 1MQ1A 2KFGA 3EVUA 1G33A 2KI4C 4MSPA 3O4XA 1LS8A 1NX3A 4MEWA 1C3YA 1EXRA 2LHIA 2LMVA 2PVBA 2QEHA 3CYZA 3MSEB 3SG6A 1UHHA 1KFUL 4JWQA 3WHTB 1KSOA 3BUWB 2ZRTA 1AVSA 4PE4A 1GM0A 4MVFA 2BL0B 1LA3A 3CWGA 1K93D 1YVHA 2OTGC 5AERA 1CMFA 1JBAA 1EH2A 1XFUO 2M29A 1Q80A 1RFJA 2OTGB 2JC2A 1K96A 1OOGA 1U5IA 2LVKA 1IGVA 2NCOA 4GNKB 4YGEB 2MRDA 5HLOA 3VGOA 5D3OA 1MUXA 5ER4X 2LLSA 4ETOA 1YX8A 1ODBA 4FTGA 2BCBA 4F0ZB 1J1EA 1NX0A 1WRKA 1WLZA 1PULA 1TCOB 2PYQA 3H4SE 1AUIB 1QX5B 1MF8B 1IKUA 3DD4A 1OOFA 4NDBA 4I5KA 2JNFA 3DXLA 1YVLA 1Y1UA 1IG5A 2KFHA 2OS8C 4TNCA 2WCEA 1GQMA 1V1FA 2GV5A 2MJWB 1H8BA 2YGUA 4M2OA 1KSMA 1S36A 2NZ0A 2OS8B 5F6TA 3OB2B 3AKBA 2NCPA 3V2LA 1JF0A 1QLSA 2L5YA 2M8UA 2GTEA 1QJTA 1EL4A 2K8MB 1QX2A 3D0YB 4A4CA 1DQEA 1FI5A 1SCMB 3VRRA 3EK7A 1M46A 1NSHA 2G9BA 1CFCA 1J55A 3I5HB 1UHJA 2EGDA 1YURA 3BFHA 1SPYA 2PALA 1CM1A 4PCWA 2I2RE 3UNWA 2E30A 2JXLA 2JTZA 3A8RA 1SBJA 2D8NA 2FJYA 2V53A 5K89A 1A03A 3I5IC 1CDPA 1DGUA 3EG5B 3KO0A 4MBEA 5DKRA 4CFRA 1DMOA 4YI9A 1M39A 2H61C 3NHIA 4ORBB 5CSNA 3O2PA 4IJ7A 5HLVA 4BY5A 2LVVA 4MZLA 4PDZA 1AJ5A 1LINA 5HL1A 1SL7A 4QJ5B 1NCZA 3OHMB 4C0JA 2FOTA 2I7AA 1RK9A 1JC2A 1J7RA 2K60A 3I5FC 1F4OA 1QVIZ 1J7OA 2WC6A 5I2LA 5BPJA 4OKHA 4WQ2A 2LMUA 4ZCUA 3I5FB 3S0GA 1SNLA 4XJKA 2QEOA 1TUJA 2KOTA 3OX6A 1F4QA 1SK6D 5DICA 2QEVA 1K2HA 4MZKA 1N2DA 4GGNA 5KU1A 2JXCA 4FQTA 4GAOA 1JF2A 1GGZA 3KHEA 5HKYA 1SMGA 1OOHA 1QV0A 2WOSA 2OPOA 3D76A 1JSAA 1KQVA 2F8PA 5EL2A 1AP4A 1QX7A 2M1KB 2F33A 4JPZB 4N5XA 1V1GA 3LK1A 1RROA 1FW4A 1N65A 4OZDA 5HKZA 1X02A 1CM4A 2L4HA 2L2EA 4OCIA 2JPTA 1BMOA 2LE9B 3N7HA 1H4BA 3DYEA 1TOPA 3PM8A 1B8RA 1DF0B 1K8UA 3CZ2A 4AOMA 5D69A 4GUKA 2M0RA 1F55A 1PSBA 1B4CA 1ZACA 2MLEC 1Z4HA 3NSKA 2JT3A 1UHKA 1C3ZA 1D1OA 2LM5A 3BUMB 3EVVA 3UO9A 3S0DA 4Q04A 2M9GA 1J7QA 3O78A 4BY4A 2EHBA 4KYNA 1S26D 3BFBA 3R1OA 1BR4B 1YR5A 2M3WA 1UUSA 2IS9A 2BKHB 4HREE 1OMDA 1QIVA 2BKIB 2LC5A 3PLFB 4PHMA 1J1DA 3GK4X 1NYAA 2JTTA 4D1EA 1XFWO 4PHNA 4M2PA 2E6WA 2PRUA 3DF0A 3PJIA 4USLA 3K21A 1K9PA 4PT1A 1Y0VH 2BL0C 2AAOA 1IIOA 1EG4A 1U5IB 3LLEA 5G08A 3BJHA 2B1UA 3DY9A 1K9UA 1PK0D 3CZ0A 3EK4A 2JNXA 4NQGA 1RECA 3DVKA 3KPXA 1LXFC 2VRGA 4CFQA 1LKJA 2LNKA 1HT9A 2KLEA 4I5NB 2KLDA 1OOIX 2Q91A 3L4LA 4N1FA 2MBXA 1SR6B 3FE6A 4A4BA 3SIAA 2WCJA 4AQIA 4GGFC 4DIRA 1YUSA 1G8IA 3E3RA 1HQVA 2BECA 2HF5A 2WCBA 3BUOB 3TDIA 1Y6WA 1DC1A 1FPWA 3S0EA 3D75A 2QDIA 2P70A 4XYNA 3DVJA 3LCPC 1PVAA 4HSZA 5I94A 1IH0A 1OZOA 3NSIA 2LLTA 2LP2A 4NDDA 1GGWA 1IJ5A 1ZMZA 1CTRA 1GJYA 2L98A 2LV7A 4R1EA 1JWDA 1WLMA 1TUZA 2F3ZA 1PALA 4M2QA 4DS7A 3B86A 5KTYA 3TDZA 3FS7A 3SG5A 3RZSA 1DJXA 1SCMC 2LCPA 2NLNA 3JTDB 3I5HC 3O4YA 1UURA 4PE1A 2CT9A 3Q8IA 1XFXO 4L9MA 1BLQA 5IBWA 1BJFA 2HQWA 3GK1A 2P6BB 1A4PA 3NHTA 1FF1A 1A75B 2KQ6A 5I8NA 2JWWA 3M0WA 1CDLA 1S3PA 1S5GY 1MWNA 2JPOA 3TZ1A 4PE0A 1MHOA 1RWYA 1B1GA 1K90D 1SW8A 2WCLA 5FI6A 3HX4A 1L2OC 2KAYA 1XFVO 3FWCA 3I5GC 3C1VA 4JQ0D 1B7TY 3PALA 4HRHA 3JVTB 1IQ5A 2CCMA 2KAVA 1EJ3A 1SSEB 1AK8A 1L2OB 1NIWA 3BUNB 3BXKA 3BYAA 3I5GB 1W7JB 4MRYA 3IVTA 2BBNA 4XJKB 2F3YA 4NDCA 2KBMA 5CSJA 4MN0A 2QACA 2WNDA 4N1GA 3D78A 4JKTA 5DKNA 5I2QA 2M97A 4PHJA 1M63B 4P2YB 2GGMA 3CGAA 1CB1A 2BE6A 4CIDA 3VRPA 1CKKA 2K7OA 3D0YA 2KYFA 1OE9B 1UHNA 1P28A 1OZSA 2KNEA 1XK4C 2WCFA 1MR8A 2ZFDA 2CBLA 1PVBA 4DRWA 3L47A 1NPQA 4INWA 2JT0A 2HPSA 3CZTX 4ORCB 4YGCB 1YRUB 2MHHA 5AXIA 4I5LB 1DT7B 2JQ6A 1IQ3A 1JFKA 1QLKA 5AANA 3IQQA 2LVIA 1QTXA 1S1EA 3D10A 3PATA 3R1PA 4C0KA 4QJ3B 1TCFA 5HKWA 1KK7Y 2QPTA 2K61A 1CLBA 2KYCA 1F54A 3AAJA 2MA2A 4JD9A 2BE4A 2LP3A 1S6CA 5CSIA 2M49B 1FBVA 2PSRA 3EKJA 4CLNA 2BNXA 1TNWA 3SG2A 1ALVA 5AFPA 1SCVA 2KGBC 2JRFA 2H61A 2Y5IA 3FE9A 3BFAA 3B6XA 1C7WA 1ZFSA 4WQ3A 2ZN9A 4MZJA 1B8CA 1F70A 2ISDA 3VROA 1K9KA 3CABA 3SG4A 3DVEA 3S0BA 1BR1B 3DF0B 3FIAA 2ERBA 3VRQA 1XYDA 4P5OE 3QRXA 1B8LA 1A2XA 3FWBA 1UWOA 1BT6A 3S0AA 3D74A 2A4JA 3B88A 3D73A 1SY9A 1EG3A 4ORAB 2G2BA 4OR9B 3AKAA 1TNXA 2M7LA 2ZKMX 3SS3A 3PM2A 2MLFC 2KI6C 3BQ3A 1KWOB 3EK8A 2KFFA 2GGZA 4MLWA 4DUQA 1N0YA 2LUXA 3CDNA 3EKHA 3OB1B 5TNCA 1MXEA 3A4UB 3PFVA 1WDCB 3BOWA 5FI7A 3B87A 3SG7A 1DGVA 2L51A 2K2FA 1ALWA 2CNPA 3NGVA 4ICBA 2Y4QA 5KSZA 2WCKA 2Y1NA 3SS4A 3SG3A 4FQOA 3GOFA 4GFTA 1SR6C 1DF0A 1JUOA 1YRTB 2I18A 2RGIA 3CR2A 3CLNA 1DJHA 4YGAA 1XA5A 1XFYO 1IJ6A 2MAZA 3TS5B 1QASA 1OQPA 3K1EA 1KQMC 1S5GZ 3O6BA 5B8IB 1NP8A 1SRAA 2AMIA 2L0PA 1RJVA 1KQMB 4C0LA 1IWQA 2O60A 5I2OA 3OGNA 5DKQA 1B7TZ 2KI4B 1E8AA 3VRNA 4OVNF 4E68A 1TNQA 2Q4UA 3ICBA 4PALA 1DJYA 3D77A 5HYDA 3TDUA 2I94A 2KGRA 1ORGA 3EVRA 4I5JA 1L7ZA 1CDMA 1OOJA 2WCHA 2NXQA 4PHKA 2F2OA 2KI6D 2LANA 3WNXB 5JJGA 2H8VA 5GQQC 3JTDC 1VRKA 1CFDA 2KAXA 3CR4X 2M1UA 2SASA 3RM1A 3PSRA 1CDNA 1ZUZA 1K94A 2SCPA 1QIWA 2K2AA 2LHLA 1BOCA 1DEKA 1NCYA 3OX5A 2WORA 4ZCVA 1C7VA 1WY9A 1TIZA 1UHIA 1CFFA 2K7CA 1AHRA 3VB1A 1WRLA 1KK8C 3SS5A 4YGDB 3NXAA 1OSAA 2WC8A 3JVTC 4PE7A 2K7BA 2ZNEA 3DZTA 3SJSA 1KK8B 2ZRSA 1TTXA 2LLUA 1KK7Z 1C07A 4GGFA 2ZN8A 4IL1A 2K0JA 1R2UA 1TRFA 2H2KA 2K7DA 4HRGA 3TUYC 1CLMA 1J7PA 1LVCD 1DJZA 1ZOTB 3NSOA 1TNPA 5FYXA 3LL8B 1QATA 3TUYB 4F7FA 1SL8A 2M7NA 1DJIA 1T14A 3WHUB 1AJ4A 1PRWA 2JULA 1DJGA 1NX1A 2FCEA 4INXA 4QJ4B 2JOJA 2L5XB 5FI2A 1QWVA 1TWOA 1CLLA 1BF5A 1YUTA 2F2PA 1XFZO 2KHNA 1NX2A 3R1VA 1RTP1 1NWDA 3CZ1A 3L4AA 1KFXS 2ZNDA 4CPVA 4YBHB 1TN4A 3ZNIA 1M45A 1OMRA 1NCXA 1QXPA 3IF7A 2P71A 1BODA 1FI6A 1G4YR 1B9AA 1A75A 1SYMA 2JU0A 2PQLA 2LAPA 1A29A 1W7IB 4YI8A 1W9ZA 3S0FA 5CSFA 3PN7C 4UPGA 3I5IB 4GBAA 5ER5A 2BBMA 2LVJA 1CMGA 1OMVA 3OBVA 1UP5A 3DVMA 2O5GA 3PN7B 2JT8A 1DTLA 1XVJA 2PASA 2R2IA 5AEQA 1DVIA 2HETA 3WXAA 1DJWA 1KFUS 1R6PA 3BUXB 1LA0A 4OV2A 1JFJA 3F45A 5J3XA 3IQOA 3ZWHA 2PMYA 1QS7A 2FCDA 3QMEA 4DCKA 2KPHA 3NSLA 4YRUA 3R72A 3CTNA 1YX7A 1IRJA 3FE8A 1NUBA 3KEVA 1F71A 3LK0A 3CS1A 5D7FA 2HQ8A 2L50A 1Y1XA 2L4IA 1WRZA 2KBIA 2KDHA 1BU3A 2JZIA 2QEBA 1F8HA 2CXJA 5CPVA 1SL9A 1XK4A 3BOWB 4U8DA 1Z2CB 2DOQA 1KWOC 2CTNA 3SIBA 1M31A 2FJUB 2AUCA 3B7AA 1SKTA 2COLB 1WDCC 1PSRA 3CR5X 1S6JA 3RLZA 1YTZC 4GPLB 1CNPA 2Y1MA 2WCMA 4WRIA 1DELA 4AQJA 2WC5A 5PALA 1YUUA 2TN4A 1MXLC 1BG1A 1KFXL 1QVIY 2KQYA 1S6IA 2BCXA 1K95A 5JOLA 1CFPA 1XFRA 1XO5A 3KF9A 3GK2A 3OP0A 2EC6C 2KSPA 3AAKA 2LUCA 2LMTA 3TS5C 1KCYA 1B47A 1OW4A 2BCAA
chains in the Genus database with same CATH topology
5EL2A 2L2CA 3D78A 4OZDA 1LS8A 1C3YA 3CYZA 3N7HA 2QEHA 3DYEA 3VB1A 1P28A 3CZ2A 1GM0A 3L47A 4INWA 3DZTA 1C3ZA 3S0DA 1OOGA 3BFBA 3R1OA 3R1PA 4F7FA 1T14A 4JD9A 4INXA 3PJIA 1QWVA 1TWOA 1OOFA 4PT1A 3R1VA 3DXLA 3CZ1A 3L4AA 3FE9A 3BFAA 3B6XA 3BJHA 3DY9A 2P71A 3CZ0A 3CABA 3V2LA 3S0FA 2PQLA 3S0BA 2GTEA 2ERBA 1OOIX 3L4LA 3S0AA 3D74A 3B88A 3D73A 3FE6A 1DQEA 2WCJA 3S0EA 3D75A 2QDIA 3BFHA 2P70A 3CDNA 3QMEA 2KPHA 3R72A 3B87A 2FJYA 3FE8A 3NGVA 2WCKA 3B86A 3NHIA 3RZSA 2QEBA 3K1EA 3Q8IA 3B7AA 3NHTA 3OGNA 2WC6A 2JPOA 3S0GA 2WCMA 2WC5A 2WCLA 2QEOA 3D77A 1TUJA 5DICA 2QEVA 1ORGA 1XFRA 2WCHA 4FQTA 2H8VA 1OOHA 3D76A 1OW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EL2 A;  2L2C A;  3D78 A;  4OZD A;  1LS8 A;  1C3Y A;  3CYZ A;  3N7H A;  2QEH A;  3DYE A;  3VB1 A;  1P28 A;  3CZ2 A;  1GM0 A;  3L47 A;  4INW A;  3DZT A;  1C3Z A;  3S0D A;  1OOG A;  3BFB A;  3R1O A;  3R1P A;  4F7F A;  1T14 A;  4JD9 A;  4INX A;  3PJI A;  1QWV A;  1TWO A;  1OOF A;  4PT1 A;  3R1V A;  3DXL A;  3CZ1 A;  3L4A A;  3FE9 A;  3BFA A;  3B6X A;  3BJH A;  3DY9 A;  2P71 A;  3CZ0 A;  3CAB A;  3V2L A;  3S0F A;  2PQL A;  3S0B A;  2GTE A;  2ERB A;  1OOI X;  3L4L A;  3S0A A;  3D74 A;  3B88 A;  3D73 A;  3FE6 A;  1DQE A;  2WCJ A;  3S0E A;  3D75 A;  2QDI A;  3BFH A;  2P70 A;  3CDN A;  3QME A;  2KPH A;  3R72 A;  3B87 A;  2FJY A;  3FE8 A;  3NGV A;  2WCK A;  3B86 A;  3NHI A;  3RZS A;  2QEB A;  3K1E A;  3Q8I A;  3B7A A;  3NHT A;  3OGN A;  2WC6 A;  2JPO A;  3S0G A;  2WCM A;  2WC5 A;  2WCL A;  2QEO A;  3D77 A;  1TUJ A;  5DIC A;  2QEV A;  1ORG A;  1XFR A;  2WCH A;  4FQT A;  2H8V A;  1OOH A;  3D76 A;  1OW4 A; 
#chains in the Genus database with same CATH topology
 2EC6 B;  1QV1 A;  2L2C A;  2BAP A;  4MRX A;  4YGB B;  1Y1A A;  3HCM A;  1MQ1 A;  2KFG A;  3EVU A;  1G33 A;  2KI4 C;  4MSP A;  3O4X A;  1LS8 A;  1NX3 A;  4MEW A;  1C3Y A;  1EXR A;  2LHI A;  2LMV A;  2PVB A;  2QEH A;  3CYZ A;  3MSE B;  3SG6 A;  1UHH A;  1KFU L;  4JWQ A;  3WHT B;  1KSO A;  3BUW B;  2ZRT A;  1AVS A;  4PE4 A;  1GM0 A;  4MVF A;  2BL0 B;  1LA3 A;  3CWG A;  1K93 D;  1YVH A;  2OTG C;  5AER A;  1CMF A;  1JBA A;  1EH2 A;  1XFU O;  2M29 A;  1Q80 A;  1RFJ A;  2OTG B;  2JC2 A;  1K96 A;  1OOG A;  1U5I A;  2LVK A;  1IGV A;  2NCO A;  4GNK B;  4YGE B;  2MRD A;  5HLO A;  3VGO A;  5D3O A;  1MUX A;  5ER4 X;  2LLS A;  4ETO A;  1YX8 A;  1ODB A;  4FTG A;  2BCB A;  4F0Z B;  1J1E A;  1NX0 A;  1WRK A;  1WLZ A;  1PUL A;  1TCO B;  2PYQ A;  3H4S E;  1AUI B;  1QX5 B;  1MF8 B;  1IKU A;  3DD4 A;  1OOF A;  4NDB A;  4I5K A;  2JNF A;  3DXL A;  1YVL A;  1Y1U A;  1IG5 A;  2KFH A;  2OS8 C;  4TNC A;  2WCE A;  1GQM A;  1V1F A;  2GV5 A;  2MJW B;  1H8B A;  2YGU A;  4M2O A;  1KSM A;  1S36 A;  2NZ0 A;  2OS8 B;  5F6T A;  3OB2 B;  3AKB A;  2NCP A;  3V2L A;  1JF0 A;  1QLS A;  2L5Y A;  2M8U A;  2GTE A;  1QJT A;  1EL4 A;  2K8M B;  1QX2 A;  3D0Y B;  4A4C A;  1DQE A;  1FI5 A;  1SCM B;  3VRR A;  3EK7 A;  1M46 A;  1NSH A;  2G9B A;  1CFC A;  1J55 A;  3I5H B;  1UHJ A;  2EGD A;  1YUR A;  3BFH A;  1SPY A;  2PAL A;  1CM1 A;  4PCW A;  2I2R E;  3UNW A;  2E30 A;  2JXL A;  2JTZ A;  3A8R A;  1SBJ A;  2D8N A;  2FJY A;  2V53 A;  5K89 A;  1A03 A;  3I5I C;  1CDP A;  1DGU A;  3EG5 B;  3KO0 A;  4MBE A;  5DKR A;  4CFR A;  1DMO A;  4YI9 A;  1M39 A;  2H61 C;  3NHI A;  4ORB B;  5CSN A;  3O2P A;  4IJ7 A;  5HLV A;  4BY5 A;  2LVV A;  4MZL A;  4PDZ A;  1AJ5 A;  1LIN A;  5HL1 A;  1SL7 A;  4QJ5 B;  1NCZ A;  3OHM B;  4C0J A;  2FOT A;  2I7A A;  1RK9 A;  1JC2 A;  1J7R A;  2K60 A;  3I5F C;  1F4O A;  1QVI Z;  1J7O A;  2WC6 A;  5I2L A;  5BPJ A;  4OKH A;  4WQ2 A;  2LMU A;  4ZCU A;  3I5F B;  3S0G A;  1SNL A;  4XJK A;  2QEO A;  1TUJ A;  2KOT A;  3OX6 A;  1F4Q A;  1SK6 D;  5DIC A;  2QEV A;  1K2H A;  4MZK A;  1N2D A;  4GGN A;  5KU1 A;  2JXC A;  4FQT A;  4GAO A;  1JF2 A;  1GGZ A;  3KHE A;  5HKY A;  1SMG A;  1OOH A;  1QV0 A;  2WOS A;  2OPO A;  3D76 A;  1JSA A;  1KQV A;  2F8P A;  5EL2 A;  1AP4 A;  1QX7 A;  2M1K B;  2F33 A;  4JPZ B;  4N5X A;  1V1G A;  3LK1 A;  1RRO A;  1FW4 A;  1N65 A;  4OZD A;  5HKZ A;  1X02 A;  1CM4 A;  2L4H A;  2L2E A;  4OCI A;  2JPT A;  1BMO A;  2LE9 B;  3N7H A;  1H4B A;  3DYE A;  1TOP A;  3PM8 A;  1B8R A;  1DF0 B;  1K8U A;  3CZ2 A;  4AOM A;  5D69 A;  4GUK A;  2M0R A;  1F55 A;  1PSB A;  1B4C A;  1ZAC A;  2MLE C;  1Z4H A;  3NSK A;  2JT3 A;  1UHK A;  1C3Z A;  1D1O A;  2LM5 A;  3BUM B;  3EVV A;  3UO9 A;  3S0D A;  4Q04 A;  2M9G A;  1J7Q A;  3O78 A;  4BY4 A;  2EHB A;  4KYN A;  1S26 D;  3BFB A;  3R1O A;  1BR4 B;  1YR5 A;  2M3W A;  1UUS A;  2IS9 A;  2BKH B;  4HRE E;  1OMD A;  1QIV A;  2BKI B;  2LC5 A;  3PLF B;  4PHM A;  1J1D A;  3GK4 X;  1NYA A;  2JTT A;  4D1E A;  1XFW O;  4PHN A;  4M2P A;  2E6W A;  2PRU A;  3DF0 A;  3PJI A;  4USL A;  3K21 A;  1K9P A;  4PT1 A;  1Y0V H;  2BL0 C;  2AAO A;  1IIO A;  1EG4 A;  1U5I B;  3LLE A;  5G08 A;  3BJH A;  2B1U A;  3DY9 A;  1K9U A;  1PK0 D;  3CZ0 A;  3EK4 A;  2JNX A;  4NQG A;  1REC A;  3DVK A;  3KPX A;  1LXF C;  2VRG A;  4CFQ A;  1LKJ A;  2LNK A;  1HT9 A;  2KLE A;  4I5N B;  2KLD A;  1OOI X;  2Q91 A;  3L4L A;  4N1F A;  2MBX A;  1SR6 B;  3FE6 A;  4A4B A;  3SIA A;  2WCJ A;  4AQI A;  4GGF C;  4DIR A;  1YUS A;  1G8I A;  3E3R A;  1HQV A;  2BEC A;  2HF5 A;  2WCB A;  3BUO B;  3TDI A;  1Y6W A;  1DC1 A;  1FPW A;  3S0E A;  3D75 A;  2QDI A;  2P70 A;  4XYN A;  3DVJ A;  3LCP C;  1PVA A;  4HSZ A;  5I94 A;  1IH0 A;  1OZO A;  3NSI A;  2LLT A;  2LP2 A;  4NDD A;  1GGW A;  1IJ5 A;  1ZMZ A;  1CTR A;  1GJY A;  2L98 A;  2LV7 A;  4R1E A;  1JWD A;  1WLM A;  1TUZ A;  2F3Z A;  1PAL A;  4M2Q A;  4DS7 A;  3B86 A;  5KTY A;  3TDZ A;  3FS7 A;  3SG5 A;  3RZS A;  1DJX A;  1SCM C;  2LCP A;  2NLN A;  3JTD B;  3I5H C;  3O4Y A;  1UUR A;  4PE1 A;  2CT9 A;  3Q8I A;  1XFX O;  4L9M A;  1BLQ A;  5IBW A;  1BJF A;  2HQW A;  3GK1 A;  2P6B B;  1A4P A;  3NHT A;  1FF1 A;  1A75 B;  2KQ6 A;  5I8N A;  2JWW A;  3M0W A;  1CDL A;  1S3P A;  1S5G Y;  1MWN A;  2JPO A;  3TZ1 A;  4PE0 A;  1MHO A;  1RWY A;  1B1G A;  1K90 D;  1SW8 A;  2WCL A;  5FI6 A;  3HX4 A;  1L2O C;  2KAY A;  1XFV O;  3FWC A;  3I5G C;  3C1V A;  4JQ0 D;  1B7T Y;  3PAL A;  4HRH A;  3JVT B;  1IQ5 A;  2CCM A;  2KAV A;  1EJ3 A;  1SSE B;  1AK8 A;  1L2O B;  1NIW A;  3BUN B;  3BXK A;  3BYA A;  3I5G B;  1W7J B;  4MRY A;  3IVT A;  2BBN A;  4XJK B;  2F3Y A;  4NDC A;  2KBM A;  5CSJ A;  4MN0 A;  2QAC A;  2WND A;  4N1G A;  3D78 A;  4JKT A;  5DKN A;  5I2Q A;  2M97 A;  4PHJ A;  1M63 B;  4P2Y B;  2GGM A;  3CGA A;  1CB1 A;  2BE6 A;  4CID A;  3VRP A;  1CKK A;  2K7O A;  3D0Y A;  2KYF A;  1OE9 B;  1UHN A;  1P28 A;  1OZS A;  2KNE A;  1XK4 C;  2WCF A;  1MR8 A;  2ZFD A;  2CBL A;  1PVB A;  4DRW A;  3L47 A;  1NPQ A;  4INW A;  2JT0 A;  2HPS A;  3CZT X;  4ORC B;  4YGC B;  1YRU B;  2MHH A;  5AXI A;  4I5L B;  1DT7 B;  2JQ6 A;  1IQ3 A;  1JFK A;  1QLK A;  5AAN A;  3IQQ A;  2LVI A;  1QTX A;  1S1E A;  3D10 A;  3PAT A;  3R1P A;  4C0K A;  4QJ3 B;  1TCF A;  5HKW A;  1KK7 Y;  2QPT A;  2K61 A;  1CLB A;  2KYC A;  1F54 A;  3AAJ A;  2MA2 A;  4JD9 A;  2BE4 A;  2LP3 A;  1S6C A;  5CSI A;  2M49 B;  1FBV A;  2PSR A;  3EKJ A;  4CLN A;  2BNX A;  1TNW A;  3SG2 A;  1ALV A;  5AFP A;  1SCV A;  2KGB C;  2JRF A;  2H61 A;  2Y5I A;  3FE9 A;  3BFA A;  3B6X A;  1C7W A;  1ZFS A;  4WQ3 A;  2ZN9 A;  4MZJ A;  1B8C A;  1F70 A;  2ISD A;  3VRO A;  1K9K A;  3CAB A;  3SG4 A;  3DVE A;  3S0B A;  1BR1 B;  3DF0 B;  3FIA A;  2ERB A;  3VRQ A;  1XYD A;  4P5O E;  3QRX A;  1B8L A;  1A2X A;  3FWB A;  1UWO A;  1BT6 A;  3S0A A;  3D74 A;  2A4J A;  3B88 A;  3D73 A;  1SY9 A;  1EG3 A;  4ORA B;  2G2B A;  4OR9 B;  3AKA A;  1TNX A;  2M7L A;  2ZKM X;  3SS3 A;  3PM2 A;  2MLF C;  2KI6 C;  3BQ3 A;  1KWO B;  3EK8 A;  2KFF A;  2GGZ A;  4MLW A;  4DUQ A;  1N0Y A;  2LUX A;  3CDN A;  3EKH A;  3OB1 B;  5TNC A;  1MXE A;  3A4U B;  3PFV A;  1WDC B;  3BOW A;  5FI7 A;  3B87 A;  3SG7 A;  1DGV A;  2L51 A;  2K2F A;  1ALW A;  2CNP A;  3NGV A;  4ICB A;  2Y4Q A;  5KSZ A;  2WCK A;  2Y1N A;  3SS4 A;  3SG3 A;  4FQO A;  3GOF A;  4GFT A;  1SR6 C;  1DF0 A;  1JUO A;  1YRT B;  2I18 A;  2RGI A;  3CR2 A;  3CLN A;  1DJH A;  4YGA A;  1XA5 A;  1XFY O;  1IJ6 A;  2MAZ A;  3TS5 B;  1QAS A;  1OQP A;  3K1E A;  1KQM C;  1S5G Z;  3O6B A;  5B8I B;  1NP8 A;  1SRA A;  2AMI A;  2L0P A;  1RJV A;  1KQM B;  4C0L A;  1IWQ A;  2O60 A;  5I2O A;  3OGN A;  5DKQ A;  1B7T Z;  2KI4 B;  1E8A A;  3VRN A;  4OVN F;  4E68 A;  1TNQ A;  2Q4U A;  3ICB A;  4PAL A;  1DJY A;  3D77 A;  5HYD A;  3TDU A;  2I94 A;  2KGR A;  1ORG A;  3EVR A;  4I5J A;  1L7Z A;  1CDM A;  1OOJ A;  2WCH A;  2NXQ A;  4PHK A;  2F2O A;  2KI6 D;  2LAN A;  3WNX B;  5JJG A;  2H8V A;  5GQQ C;  3JTD C;  1VRK A;  1CFD A;  2KAX A;  3CR4 X;  2M1U A;  2SAS A;  3RM1 A;  3PSR A;  1CDN A;  1ZUZ A;  1K94 A;  2SCP A;  1QIW A;  2K2A A;  2LHL A;  1BOC A;  1DEK A;  1NCY A;  3OX5 A;  2WOR A;  4ZCV A;  1C7V A;  1WY9 A;  1TIZ A;  1UHI A;  1CFF A;  2K7C A;  1AHR A;  3VB1 A;  1WRL A;  1KK8 C;  3SS5 A;  4YGD B;  3NXA A;  1OSA A;  2WC8 A;  3JVT C;  4PE7 A;  2K7B A;  2ZNE A;  3DZT A;  3SJS A;  1KK8 B;  2ZRS A;  1TTX A;  2LLU A;  1KK7 Z;  1C07 A;  4GGF A;  2ZN8 A;  4IL1 A;  2K0J A;  1R2U A;  1TRF A;  2H2K A;  2K7D A;  4HRG A;  3TUY C;  1CLM A;  1J7P A;  1LVC D;  1DJZ A;  1ZOT B;  3NSO A;  1TNP A;  5FYX A;  3LL8 B;  1QAT A;  3TUY B;  4F7F A;  1SL8 A;  2M7N A;  1DJI A;  1T14 A;  3WHU B;  1AJ4 A;  1PRW A;  2JUL A;  1DJG A;  1NX1 A;  2FCE A;  4INX A;  4QJ4 B;  2JOJ A;  2L5X B;  5FI2 A;  1QWV A;  1TWO A;  1CLL A;  1BF5 A;  1YUT A;  2F2P A;  1XFZ O;  2KHN A;  1NX2 A;  3R1V A;  1RTP 1;  1NWD A;  3CZ1 A;  3L4A A;  1KFX S;  2ZND A;  4CPV A;  4YBH B;  1TN4 A;  3ZNI A;  1M45 A;  1OMR A;  1NCX A;  1QXP A;  3IF7 A;  2P71 A;  1BOD A;  1FI6 A;  1G4Y R;  1B9A A;  1A75 A;  1SYM A;  2JU0 A;  2PQL A;  2LAP A;  1A29 A;  1W7I B;  4YI8 A;  1W9Z A;  3S0F A;  5CSF A;  3PN7 C;  4UPG A;  3I5I B;  4GBA A;  5ER5 A;  2BBM A;  2LVJ A;  1CMG A;  1OMV A;  3OBV A;  1UP5 A;  3DVM A;  2O5G A;  3PN7 B;  2JT8 A;  1DTL A;  1XVJ A;  2PAS A;  2R2I A;  5AEQ A;  1DVI A;  2HET A;  3WXA A;  1DJW A;  1KFU S;  1R6P A;  3BUX B;  1LA0 A;  4OV2 A;  1JFJ A;  3F45 A;  5J3X A;  3IQO A;  3ZWH A;  2PMY A;  1QS7 A;  2FCD A;  3QME A;  4DCK A;  2KPH A;  3NSL A;  4YRU A;  3R72 A;  3CTN A;  1YX7 A;  1IRJ A;  3FE8 A;  1NUB A;  3KEV A;  1F71 A;  3LK0 A;  3CS1 A;  5D7F A;  2HQ8 A;  2L50 A;  1Y1X A;  2L4I A;  1WRZ A;  2KBI A;  2KDH A;  1BU3 A;  2JZI A;  2QEB A;  1F8H A;  2CXJ A;  5CPV A;  1SL9 A;  1XK4 A;  3BOW B;  4U8D A;  1Z2C B;  2DOQ A;  1KWO C;  2CTN A;  3SIB A;  1M31 A;  2FJU B;  2AUC A;  3B7A A;  1SKT A;  2COL B;  1WDC C;  1PSR A;  3CR5 X;  1S6J A;  3RLZ A;  1YTZ C;  4GPL B;  1CNP A;  2Y1M A;  2WCM A;  4WRI A;  1DEL A;  4AQJ A;  2WC5 A;  5PAL A;  1YUU A;  2TN4 A;  1MXL C;  1BG1 A;  1KFX L;  1QVI Y;  2KQY A;  1S6I A;  2BCX A;  1K95 A;  5JOL A;  1CFP A;  1XFR A;  1XO5 A;  3KF9 A;  3GK2 A;  3OP0 A;  2EC6 C;  2KSP A;  3AAK A;  2LUC A;  2LMT A;  3TS5 C;  1KCY A;  1B47 A;  1OW4 A;  2BCA A; 
#chains in the Genus database with same CATH homology
 5EL2 A;  2L2C A;  3D78 A;  4OZD A;  1LS8 A;  1C3Y A;  3CYZ A;  3N7H A;  2QEH A;  3DYE A;  3VB1 A;  1P28 A;  3CZ2 A;  1GM0 A;  3L47 A;  4INW A;  3DZT A;  1C3Z A;  3S0D A;  1OOG A;  3BFB A;  3R1O A;  3R1P A;  4F7F A;  1T14 A;  4JD9 A;  4INX A;  3PJI A;  1QWV A;  1TWO A;  1OOF A;  4PT1 A;  3R1V A;  3DXL A;  3CZ1 A;  3L4A A;  3FE9 A;  3BFA A;  3B6X A;  3BJH A;  3DY9 A;  2P71 A;  3CZ0 A;  3CAB A;  3V2L A;  3S0F A;  2PQL A;  3S0B A;  2GTE A;  2ERB A;  1OOI X;  3L4L A;  3S0A A;  3D74 A;  3B88 A;  3D73 A;  3FE6 A;  1DQE A;  2WCJ A;  3S0E A;  3D75 A;  2QDI A;  3BFH A;  2P70 A;  3CDN A;  3QME A;  2KPH A;  3R72 A;  3B87 A;  2FJY A;  3FE8 A;  3NGV A;  2WCK A;  3B86 A;  3NHI A;  3RZS A;  2QEB A;  3K1E A;  3Q8I A;  3B7A A;  3NHT A;  3OGN A;  2WC6 A;  2JPO A;  3S0G A;  2WCM A;  2WC5 A;  2WCL A;  2QEO A;  3D77 A;  1TUJ A;  5DIC A;  2QEV A;  1ORG A;  1XFR A;  2WCH A;  4FQT A;  2H8V A;  1OOH A;  3D76 A;  1OW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...