3S0FA

Apis mellifera obp14 native apo, crystal form 2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
total genus 46
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0fA00
4JD9A 3S0AA 2L2CA 3CYZA 3OGNA 2FJYA 3K1EA 4OZDA 3FE9A 2WCKA 4F7FA 3BFHA 4INWA 2ERBA 3R72A 3B86A 3BFBA 3DXLA 3NGVA 3L4AA 1OOIX 3D78A 3S0EA 2QEHA 1DQEA 2H8VA 4INXA 1C3ZA 3RZSA 3CZ2A 2QEVA 2QEBA 2P71A 3NHTA 2QEOA 2WCHA 3D77A 2WCJA 2P70A 2GTEA 2JPOA 3DY9A 2WC6A 3CZ1A 3V2LA 5DICA 3DYEA 3CZ0A 1OOHA 1QWVA 2WCLA 3FE6A 3B7AA 3R1PA 1XFRA 1TUJA 3N7HA 4FQTA 3D75A 3R1VA 3QMEA 3L4LA 3VB1A 1P28A 3S0GA 4PT1A 3L47A 2PQLA 2WCMA 3B6XA 1TWOA 3B87A 3D76A 1ORGA 3D73A 2QDIA 3FE8A 1LS8A 1OOFA 3D74A 1C3YA 1OOGA 3R1OA 3NHIA 3BJHA 3Q8IA 3S0BA 1GM0A 2WC5A 1T14A 5EL2A 3B88A 3CABA 3PJIA 3S0DA 3S0FA 3CDNA 3DZTA 3BFAA 1OW4A 2KPHA
chains in the Genus database with same CATH superfamily
5G08A 1NX0A 1KK7Z 5KSZA 1CMFA 3NSIA 2I18A 4ZCUA 2KAVA 3C1VA 1KFUS 1CDLA 2F33A 5PALA 1CNPA 1N2DA 4MN0A 4PCWA 3E3RA 2MAZA 3DVMA 3O2PA 1ALWA 1S5GY 2LP3A 5CPVA 2M1UA 2KYCA 4OZDA 3LK0A 3FE9A 3IQOA 5D7FA 3SS4A 2QACA 2JXCA 1WY9A 3O4XA 1XVJA 2GV5A 1CTRA 2JTTA 4U8DA 3SS3A 1SR6B 2M0RA 2LLUA 1F4QA 2ERBA 2F3ZA 4E68A 1GGZA 1WLMA 2Y1MA 3GK2A 2ZN8A 2BCXA 3EKHA 1SW8A 3PM2A 1IJ6A 1CLLA 2K7DA 3BUWB 1NSHA 1PSRA 1IG5A 1OSAA 1SR6C 2BE6A 1XO5A 3A4UB 1CDMA 1XFZO 2NXQA 2YGUA 1BR4B 4AOMA 1RECA 1J1DA 2BECA 3KHEA 5FI6A 4XJKA 1DQEA 1CB1A 1S36A 2JPTA 4JKTA 1WRZA 3OX6A 2SASA 3O78A 4AQJA 4DS7A 1B4CA 2WCFA 1C3ZA 3IF7A 4C0JA 2ZNDA 3BOWA 1TNWA 2DOQA 1QIWA 5JJGA 1NCYA 1DEKA 4PALA 1F55A 1HQVA 1KK7Y 2KI6C 1MF8B 2QEVA 3VRRA 3NHTA 1K93D 1KFXL 3AAKA 3D77A 2FOTA 2I94A 4YRUA 1IRJA 1CM4A 1AK8A 4JWQA 1CFPA 1QX5B 3VROA 1QLKA 4JQ0D 2WC6A 2L98A 1SBJA 1FI6A 1BT6A 2L50A 2LAPA 1AUIB 1QATA 3DYEA 1YRUB 1JF0A 5HYDA 1JSAA 3PSRA 1PVAA 2OPOA 2WCLA 1TNXA 3FE6A 2AMIA 3B7AA 3R1PA 1JWDA 1UP5A 1NX2A 1TUJA 1XFRA 2KDHA 2LHIA 4GUKA 1JBAA 2JT8A 1M45A 1EL4A 3R1VA 2BAPA 4JPZB 5I2LA 1IKUA 2ZN9A 1EXRA 3HCMA 2G2BA 2Q4UA 3UNWA 3M0WA 2LANA 2WNDA 1R2UA 1L2OB 3BQ3A 1UHIA 1CMGA 2VRGA 4GGNA 4KYNA 4PT1A 4GGFC 1Q80A 2Y5IA 1UHNA 3K21A 3PN7C 2WCMA 1BF5A 2CBLA 5CSIA 1L2OC 1KSMA 1XFUO 2F8PA 1K94A 1TWOA 3B87A 4HRHA 1ZACA 3DVEA 2PALA 1JUOA 2KYFA 2KHNA 1MR8A 1WRKA 1BG1A 1A75B 5D3OA 1YURA 1W7IB 1LS8A 2D8NA 3I5GB 4YI8A 1C3YA 1SK6D 2JNFA 4PE1A 1IGVA 1ODBA 2SCPA 2PVBA 2LHLA 3S0BA 2LUXA 1S6JA 1CFDA 1M63B 1T14A 2KI6D 3I5GC 3SJSA 2L5YA 3S0FA 4YBHB 3CDNA 1YTZC 3AKBA 1DMOA 1S6IA 3BFAA 1ZMZA 1SL9A 1IQ5A 1OW4A 1PALA 2F2PA 2K0JA 2L4IA 3FWCA 4MZKA 4NQGA 5CSNA 1MQ1A 1SSEB 3EK4A 3ICBA 3OX5A 4ORBB 2JRFA 4OR9B 1S1EA 1YVLA 2L2CA 2A4JA 2FJYA 2K2FA 4P2YB 3K1EA 1BR1B 2MA2A 1DT7B 2WOSA 1RFJA 2Y4QA 1XFXO 2O5GA 4NDCA 2LVVA 1J7OA 1PRWA 1X02A 1C7WA 4N1GA 1DJZA 1FBVA 1UHKA 5I94A 4F7FA 4INWA 4PHKA 3R72A 4GPLB 1QTXA 2V53A 4GNKB 3MSEB 3GK1A 2G9BA 3DXLA 1GGWA 1OOIX 1SL8A 4HREE 1RWYA 1E8AA 3DF0B 2OS8B 2LM5A 2WC8A 1NX3A 2IS9A 2LMUA 2O60A 4QJ5B 1W7JB 2MLFC 1MXLC 3CZTX 1AP4A 2KSPA 2JNXA 4I5KA 2OS8C 4YGEB 1J1EA 2E6WA 3SS5A 3RZSA 2FJUB 1M31A 2PMYA 1A4PA 4MZJA 1QS7A 2M8UA 1UURA 3VRNA 4YGDB 2P71A 4YGBB 2KOTA 3ZWHA 2LVIA 2JPOA 3BYAA 4PE4A 2M7LA 3TZ1A 1QVIY 3OHMB 1DJYA 3RM1A 1IWQA 1W9ZA 4WRIA 2HQ8A 1NIWA 3V2LA 2FCEA 1B7TY 3CZ0A 3EK8A 3TDZA 3HX4A 1QASA 3PM8A 2MRDA 4R1EA 1BU3A 3EVUA 3N7HA 3EK7A 4CFQA 2LV7A 1KFXS 2E30A 1XK4C 5D69A 1G4YR 5HL1A 2LC5A 1DC1A 2CXJA 2JXLA 2EGDA 2L2EA 2NZ0A 1YVHA 1OOJA 1PSBA 2KI4B 1QV1A 3CLNA 1FI5A 2JTZA 1B47A 1P28A 4GGFA 2BKHB 4HRGA 3S0GA 3EVVA 2Y1NA 4HSZA 3UO9A 4CFRA 2PQLA 1XYDA 3CR5X 4CLNA 2BL0B 3BXKA 1SRAA 3CR4X 2KI4C 4NDBA 4N5XA 1LKJA 1LINA 1TUZA 2K7OA 3D10A 5I2QA 2KQ6A 3D0YB 2MJWB 5I8NA 3SG6A 1QX7A 2JT0A 2OTGB 3D76A 1AHRA 3PFVA 2M9GA 2BL0C 2BCBA 2COLB 1IQ3A 1OZSA 5AXIA 2KNEA 1C7VA 1DJIA 4ORCB 2LVKA 2I2RE 4USLA 3TDUA 2GGZA 3D74A 3O4YA 4A4CA 1JC2A 2OTGC 1AVSA 3TDIA 1NCXA 4PE0A 2AUCA 2LE9B 2MHHA 4UPGA 3BJHA 1SL7A 2WCBA 1UUSA 3OBVA 1A75A 3FS7A 3Q8IA 1C07A 1TNQA 3PN7B 1SKTA 2ZRSA 1IIOA 1Z4HA 5EL2A 2L0PA 3PJIA 1DJHA 4M2PA 3I5HB 2AAOA 4FTGA 1CM1A 1F8HA 2KFGA 1YRTB 1SYMA 2CNPA 3WNXB 4OVNF 2L51A 3EKJA 4JD9A 1DF0B 1HT9A 1MUXA 1B9AA 3FIAA 4FQOA 1B8LA 2K8MB 3I5HC 2M29A 1GQMA 3CYZA 3OGNA 5HKZA 4MRXA 4WQ3A 2KLDA 1CDPA 1CLMA 3FWBA 2HF5A 4IJ7A 4OKHA 5DKQA 3CS1A 1NP8A 1QLSA 1JF2A 4CPVA 1LA0A 2K61A 2ZKMX 1CFFA 2KAYA 5KTYA 2WCKA 3F45A 3BFHA 3VRPA 3IQQA 1SMGA 1ALVA 1SCMC 1Y6WA 3BFBA 2K7BA 2LVJA 2LMTA 1SNLA 3NGVA 4ETOA 3GOFA 2HETA 4GBAA 3QRXA 3TS5B 1OQPA 5K89A 1M46A 3AKAA 3S0EA 1IJ5A 3LK1A 5DKNA 2H8VA 3NSOA 4INXA 1BLQA 4Q04A 2JULA 1S26D 1EH2A 3TS5C 5HKYA 3DF0A 5JOLA 2FCDA 1J7QA 1EG4A 1H4BA 3CZ2A 5AANA 2M97A 5CSFA 1WRLA 5AFPA 1LA3A 1EJ3A 3SG2A 2QPTA 2P6BB 5AERA 2I7AA 1UWOA 3KPXA 5BPJA 2WCHA 1MXEA 2WCJA 4YI9A 2HPSA 2JOJA 5HLVA 3SG7A 3PLFB 2TN4A 3CGAA 3DD4A 4OCIA 4DRWA 1DJWA 1OOHA 1B8CA 5CSJA 1DELA 1OE9B 1YUUA 1ZUZA 2R2IA 1U5IB 3GK4X 1RROA 1YR5A 1N65A 1NX1A 4FQTA 4OV2A 3D75A 4BY5A 4XYNA 1PK0D 1F54A 4PHMA 4D1EA 4F0ZB 1QX2A 1SPYA 4YGAA 4GFTA 3PALA 1KQMB 1SY9A 1NUBA 1UHHA 1PVBA 3IVTA 3VB1A 1CLBA 2CCMA 3A8RA 3SG4A 1D1OA 1A2XA 2LP2A 4PE7A 4P5OE 5ER5A 1EG3A 3O6BA 3L47A 5KU1A 1K8UA 4I5LB 2EHBA 1KQMC 4NDDA 5FI7A 1AJ4A 5B8IB 2KAXA 4MEWA 3B6XA 2H61C 4MZLA 1ORGA 3D73A 2F3YA 1WLZA 3VRQA 2BNXA 2JC2A 2LUCA 3D0YA 4M2QA 3FE8A 1OOFA 1G8IA 1DJGA 1B8RA 3R1OA 1XA5A 3ZNIA 1DVIA 4I5NB 2MBXA 3PATA 3DVJA 1DTLA 1M39A 1MWNA 2CT9A 2BKIB 1BODA 1KFUL 1TIZA 2WC5A 3JVTB 2L5XB 4ORAB 2Q91A 5IBWA 1J7PA 3CR2A 4QJ3B 3S0DA 3EVRA 1DGVA 1KK8B 4DUQA 1FF1A 2F2OA 1K2HA 2M1KB 3DZTA 3EG5B 3DVKA 5FI2A 1V1FA 3JVTC 4MRYA 4ZCVA 1NCZA 1K9UA 3SIAA 2BBNA 1KWOB 1QV0A 3S0AA 1KQVA 1RK9A 1KK8C 1R6PA 1TN4A 1V1GA 2NCOA 5HLOA 3SG5A 3JTDB 1NWDA 1JFJA 2MLEC 1LVCD 2JU0A 2WORA 2KBIA 5TNCA 3SG3A 4QJ4B 1DF0A 2KFFA 5I2OA 1KWOC 4YGCB 1XFVO 2LLTA 1TCFA 3KEVA 3JTDC 1K90D 1L7ZA 3BUMB 1ZFSA 1K9PA 3B86A 1A03A 3LCPC 1UHJA 5F6TA 2CTNA 2NLNA 4XJKB 1OMDA 2H2KA 1DJXA 1Y0VH 1OMRA 3L4AA 2KQYA 3LLEA 3D78A 1CDNA 2EC6B 4DCKA 2ZRTA 2B1UA 4N1FA 1CFCA 3BOWB 1RTP1 2WCEA 1KCYA 3AAJA 3OB1B 2HQWA 2QEHA 1K9KA 2PRUA 2JWWA 4IL1A 1Y1XA 2RGIA 4TNCA 1BOCA 1XFYO 1LXFC 2EC6C 3OP0A 4BY4A 1SCMB 4CIDA 1BMOA 3RLZA 1QIVA 3NSKA 2KLEA 2K2AA 1XFWO 3VGOA 1NYAA 1PULA 1MHOA 1TTXA 1GJYA 2GGMA 4GAOA 3NXAA 4ICBA 3WXAA 5HKWA 1WDCB 1YX8A 2QEBA 1F71A 1QJTA 1TNPA 2LLSA 2QEOA 5DKRA 2P70A 2GTEA 1N0YA 3KF9A 1J7RA 2JZIA 2PASA 1TOPA 3DY9A 2KGRA 1F70A 1H8BA 3SIBA 3LL8B 3CZ1A 1YUTA 1TRFA 3H4SE 5DICA 4A4BA 4WQ2A 1K95A 1JFKA 1WDCC 4PDZA 1QWVA 4PHNA 4MVFA 1TCOB 3WHUB 1VRKA 1B1GA 4MLWA 4MSPA 2L4HA 1YX7A 2M7NA 3QMEA 4I5JA 3L4LA 1KSOA 2JT3A 4AQIA 4PHJA 1F4OA 3BUOB 4C0LA 1U5IA 1NPQA 3BUXB 2BCAA 5GQQC 1AJ5A 5ER4X 2JQ6A 2KFHA 2M3WA 2ZFDA 2ISDA 1S5GZ 1J55A 2ZNEA 3CTNA 2LMVA 1YUSA 2NCPA 3I5IB 1CKKA 2BBMA 3TUYB 2LCPA 3NSLA 2H61A 4DIRA 3I5FB 1SCVA 1RJVA 3OB2B 4L9MA 1OMVA 4M2OA 5AEQA 2QDIA 1QVIZ 4C0KA 1FPWA 3I5IC 4MBEA 1DGUA 1XK4A 3TUYC 5FYXA 2LNKA 3KO0A 1S3PA 1OOGA 1B7TZ 3I5FC 3NHIA 1A29A 2KBMA 1G33A 1FW4A 1K96A 2PSRA 2PYQA 1GM0A 1QXPA 1IH0A 1OZOA 1Y1AA 5J3XA 1Z2CB 3B88A 3CABA 3CWGA 3WHTB 2BE4A 2KGBC 1Y1UA 1ZOTB 2K7CA 2M49B 3BUNB 1S6CA 1BJFA 2K60A 2KPHA
chains in the Genus database with same CATH topology
4JD9A 3S0AA 2L2CA 3CYZA 3OGNA 2FJYA 3K1EA 4OZDA 3FE9A 2WCKA 4F7FA 3BFHA 4INWA 2ERBA 3R72A 3B86A 3BFBA 3DXLA 3NGVA 3L4AA 1OOIX 3D78A 3S0EA 2QEHA 1DQEA 2H8VA 4INXA 1C3ZA 3RZSA 3CZ2A 2QEVA 2QEBA 2P71A 3NHTA 2QEOA 2WCHA 3D77A 2WCJA 2P70A 2GTEA 2JPOA 3DY9A 2WC6A 3CZ1A 3V2LA 5DICA 3DYEA 3CZ0A 1OOHA 1QWVA 2WCLA 3FE6A 3B7AA 3R1PA 1XFRA 1TUJA 3N7HA 4FQTA 3D75A 3R1VA 3QMEA 3L4LA 3VB1A 1P28A 3S0GA 4PT1A 3L47A 2PQLA 2WCMA 3B6XA 1TWOA 3B87A 3D76A 1ORGA 3D73A 2QDIA 3FE8A 1LS8A 1OOFA 3D74A 1C3YA 1OOGA 3R1OA 3NHIA 3BJHA 3Q8IA 3S0BA 1GM0A 2WC5A 1T14A 5EL2A 3B88A 3CABA 3PJIA 3S0DA 3S0FA 3CDNA 3DZTA 3BFAA 1OW4A 2KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD9 A;  3S0A A;  2L2C A;  3CYZ A;  3OGN A;  2FJY A;  3K1E A;  4OZD A;  3FE9 A;  2WCK A;  4F7F A;  3BFH A;  4INW A;  2ERB A;  3R72 A;  3B86 A;  3BFB A;  3DXL A;  3NGV A;  3L4A A;  1OOI X;  3D78 A;  3S0E A;  2QEH A;  1DQE A;  2H8V A;  4INX A;  1C3Z A;  3RZS A;  3CZ2 A;  2QEV A;  2QEB A;  2P71 A;  3NHT A;  2QEO A;  2WCH A;  3D77 A;  2WCJ A;  2P70 A;  2GTE A;  2JPO A;  3DY9 A;  2WC6 A;  3CZ1 A;  3V2L A;  5DIC A;  3DYE A;  3CZ0 A;  1OOH A;  1QWV A;  2WCL A;  3FE6 A;  3B7A A;  3R1P A;  1XFR A;  1TUJ A;  3N7H A;  4FQT A;  3D75 A;  3R1V A;  3QME A;  3L4L A;  3VB1 A;  1P28 A;  3S0G A;  4PT1 A;  3L47 A;  2PQL A;  2WCM A;  3B6X A;  1TWO A;  3B87 A;  3D76 A;  1ORG A;  3D73 A;  2QDI A;  3FE8 A;  1LS8 A;  1OOF A;  3D74 A;  1C3Y A;  1OOG A;  3R1O A;  3NHI A;  3BJH A;  3Q8I A;  3S0B A;  1GM0 A;  2WC5 A;  1T14 A;  5EL2 A;  3B88 A;  3CAB A;  3PJI A;  3S0D A;  3S0F A;  3CDN A;  3DZT A;  3BFA A;  1OW4 A;  2KPH A; 
#chains in the Genus database with same CATH topology
 5G08 A;  1NX0 A;  1KK7 Z;  5KSZ A;  1CMF A;  3NSI A;  2I18 A;  4ZCU A;  2KAV A;  3C1V A;  1KFU S;  1CDL A;  2F33 A;  5PAL A;  1CNP A;  1N2D A;  4MN0 A;  4PCW A;  3E3R A;  2MAZ A;  3DVM A;  3O2P A;  1ALW A;  1S5G Y;  2LP3 A;  5CPV A;  2M1U A;  2KYC A;  4OZD A;  3LK0 A;  3FE9 A;  3IQO A;  5D7F A;  3SS4 A;  2QAC A;  2JXC A;  1WY9 A;  3O4X A;  1XVJ A;  2GV5 A;  1CTR A;  2JTT A;  4U8D A;  3SS3 A;  1SR6 B;  2M0R A;  2LLU A;  1F4Q A;  2ERB A;  2F3Z A;  4E68 A;  1GGZ A;  1WLM A;  2Y1M A;  3GK2 A;  2ZN8 A;  2BCX A;  3EKH A;  1SW8 A;  3PM2 A;  1IJ6 A;  1CLL A;  2K7D A;  3BUW B;  1NSH A;  1PSR A;  1IG5 A;  1OSA A;  1SR6 C;  2BE6 A;  1XO5 A;  3A4U B;  1CDM A;  1XFZ O;  2NXQ A;  2YGU A;  1BR4 B;  4AOM A;  1REC A;  1J1D A;  2BEC A;  3KHE A;  5FI6 A;  4XJK A;  1DQE A;  1CB1 A;  1S36 A;  2JPT A;  4JKT A;  1WRZ A;  3OX6 A;  2SAS A;  3O78 A;  4AQJ A;  4DS7 A;  1B4C A;  2WCF A;  1C3Z A;  3IF7 A;  4C0J A;  2ZND A;  3BOW A;  1TNW A;  2DOQ A;  1QIW A;  5JJG A;  1NCY A;  1DEK A;  4PAL A;  1F55 A;  1HQV A;  1KK7 Y;  2KI6 C;  1MF8 B;  2QEV A;  3VRR A;  3NHT A;  1K93 D;  1KFX L;  3AAK A;  3D77 A;  2FOT A;  2I94 A;  4YRU A;  1IRJ A;  1CM4 A;  1AK8 A;  4JWQ A;  1CFP A;  1QX5 B;  3VRO A;  1QLK A;  4JQ0 D;  2WC6 A;  2L98 A;  1SBJ A;  1FI6 A;  1BT6 A;  2L50 A;  2LAP A;  1AUI B;  1QAT A;  3DYE A;  1YRU B;  1JF0 A;  5HYD A;  1JSA A;  3PSR A;  1PVA A;  2OPO A;  2WCL A;  1TNX A;  3FE6 A;  2AMI A;  3B7A A;  3R1P A;  1JWD A;  1UP5 A;  1NX2 A;  1TUJ A;  1XFR A;  2KDH A;  2LHI A;  4GUK A;  1JBA A;  2JT8 A;  1M45 A;  1EL4 A;  3R1V A;  2BAP A;  4JPZ B;  5I2L A;  1IKU A;  2ZN9 A;  1EXR A;  3HCM A;  2G2B A;  2Q4U A;  3UNW A;  3M0W A;  2LAN A;  2WND A;  1R2U A;  1L2O B;  3BQ3 A;  1UHI A;  1CMG A;  2VRG A;  4GGN A;  4KYN A;  4PT1 A;  4GGF C;  1Q80 A;  2Y5I A;  1UHN A;  3K21 A;  3PN7 C;  2WCM A;  1BF5 A;  2CBL A;  5CSI A;  1L2O C;  1KSM A;  1XFU O;  2F8P A;  1K94 A;  1TWO A;  3B87 A;  4HRH A;  1ZAC A;  3DVE A;  2PAL A;  1JUO A;  2KYF A;  2KHN A;  1MR8 A;  1WRK A;  1BG1 A;  1A75 B;  5D3O A;  1YUR A;  1W7I B;  1LS8 A;  2D8N A;  3I5G B;  4YI8 A;  1C3Y A;  1SK6 D;  2JNF A;  4PE1 A;  1IGV A;  1ODB A;  2SCP A;  2PVB A;  2LHL A;  3S0B A;  2LUX A;  1S6J A;  1CFD A;  1M63 B;  1T14 A;  2KI6 D;  3I5G C;  3SJS A;  2L5Y A;  3S0F A;  4YBH B;  3CDN A;  1YTZ C;  3AKB A;  1DMO A;  1S6I A;  3BFA A;  1ZMZ A;  1SL9 A;  1IQ5 A;  1OW4 A;  1PAL A;  2F2P A;  2K0J A;  2L4I A;  3FWC A;  4MZK A;  4NQG A;  5CSN A;  1MQ1 A;  1SSE B;  3EK4 A;  3ICB A;  3OX5 A;  4ORB B;  2JRF A;  4OR9 B;  1S1E A;  1YVL A;  2L2C A;  2A4J A;  2FJY A;  2K2F A;  4P2Y B;  3K1E A;  1BR1 B;  2MA2 A;  1DT7 B;  2WOS A;  1RFJ A;  2Y4Q A;  1XFX O;  2O5G A;  4NDC A;  2LVV A;  1J7O A;  1PRW A;  1X02 A;  1C7W A;  4N1G A;  1DJZ A;  1FBV A;  1UHK A;  5I94 A;  4F7F A;  4INW A;  4PHK A;  3R72 A;  4GPL B;  1QTX A;  2V53 A;  4GNK B;  3MSE B;  3GK1 A;  2G9B A;  3DXL A;  1GGW A;  1OOI X;  1SL8 A;  4HRE E;  1RWY A;  1E8A A;  3DF0 B;  2OS8 B;  2LM5 A;  2WC8 A;  1NX3 A;  2IS9 A;  2LMU A;  2O60 A;  4QJ5 B;  1W7J B;  2MLF C;  1MXL C;  3CZT X;  1AP4 A;  2KSP A;  2JNX A;  4I5K A;  2OS8 C;  4YGE B;  1J1E A;  2E6W A;  3SS5 A;  3RZS A;  2FJU B;  1M31 A;  2PMY A;  1A4P A;  4MZJ A;  1QS7 A;  2M8U A;  1UUR A;  3VRN A;  4YGD B;  2P71 A;  4YGB B;  2KOT A;  3ZWH A;  2LVI A;  2JPO A;  3BYA A;  4PE4 A;  2M7L A;  3TZ1 A;  1QVI Y;  3OHM B;  1DJY A;  3RM1 A;  1IWQ A;  1W9Z A;  4WRI A;  2HQ8 A;  1NIW A;  3V2L A;  2FCE A;  1B7T Y;  3CZ0 A;  3EK8 A;  3TDZ A;  3HX4 A;  1QAS A;  3PM8 A;  2MRD A;  4R1E A;  1BU3 A;  3EVU A;  3N7H A;  3EK7 A;  4CFQ A;  2LV7 A;  1KFX S;  2E30 A;  1XK4 C;  5D69 A;  1G4Y R;  5HL1 A;  2LC5 A;  1DC1 A;  2CXJ A;  2JXL A;  2EGD A;  2L2E A;  2NZ0 A;  1YVH A;  1OOJ A;  1PSB A;  2KI4 B;  1QV1 A;  3CLN A;  1FI5 A;  2JTZ A;  1B47 A;  1P28 A;  4GGF A;  2BKH B;  4HRG A;  3S0G A;  3EVV A;  2Y1N A;  4HSZ A;  3UO9 A;  4CFR A;  2PQL A;  1XYD A;  3CR5 X;  4CLN A;  2BL0 B;  3BXK A;  1SRA A;  3CR4 X;  2KI4 C;  4NDB A;  4N5X A;  1LKJ A;  1LIN A;  1TUZ A;  2K7O A;  3D10 A;  5I2Q A;  2KQ6 A;  3D0Y B;  2MJW B;  5I8N A;  3SG6 A;  1QX7 A;  2JT0 A;  2OTG B;  3D76 A;  1AHR A;  3PFV A;  2M9G A;  2BL0 C;  2BCB A;  2COL B;  1IQ3 A;  1OZS A;  5AXI A;  2KNE A;  1C7V A;  1DJI A;  4ORC B;  2LVK A;  2I2R E;  4USL A;  3TDU A;  2GGZ A;  3D74 A;  3O4Y A;  4A4C A;  1JC2 A;  2OTG C;  1AVS A;  3TDI A;  1NCX A;  4PE0 A;  2AUC A;  2LE9 B;  2MHH A;  4UPG A;  3BJH A;  1SL7 A;  2WCB A;  1UUS A;  3OBV A;  1A75 A;  3FS7 A;  3Q8I A;  1C07 A;  1TNQ A;  3PN7 B;  1SKT A;  2ZRS A;  1IIO A;  1Z4H A;  5EL2 A;  2L0P A;  3PJI A;  1DJH A;  4M2P A;  3I5H B;  2AAO A;  4FTG A;  1CM1 A;  1F8H A;  2KFG A;  1YRT B;  1SYM A;  2CNP A;  3WNX B;  4OVN F;  2L51 A;  3EKJ A;  4JD9 A;  1DF0 B;  1HT9 A;  1MUX A;  1B9A A;  3FIA A;  4FQO A;  1B8L A;  2K8M B;  3I5H C;  2M29 A;  1GQM A;  3CYZ A;  3OGN A;  5HKZ A;  4MRX A;  4WQ3 A;  2KLD A;  1CDP A;  1CLM A;  3FWB A;  2HF5 A;  4IJ7 A;  4OKH A;  5DKQ A;  3CS1 A;  1NP8 A;  1QLS A;  1JF2 A;  4CPV A;  1LA0 A;  2K61 A;  2ZKM X;  1CFF A;  2KAY A;  5KTY A;  2WCK A;  3F45 A;  3BFH A;  3VRP A;  3IQQ A;  1SMG A;  1ALV A;  1SCM C;  1Y6W A;  3BFB A;  2K7B A;  2LVJ A;  2LMT A;  1SNL A;  3NGV A;  4ETO A;  3GOF A;  2HET A;  4GBA A;  3QRX A;  3TS5 B;  1OQP A;  5K89 A;  1M46 A;  3AKA A;  3S0E A;  1IJ5 A;  3LK1 A;  5DKN A;  2H8V A;  3NSO A;  4INX A;  1BLQ A;  4Q04 A;  2JUL A;  1S26 D;  1EH2 A;  3TS5 C;  5HKY A;  3DF0 A;  5JOL A;  2FCD A;  1J7Q A;  1EG4 A;  1H4B A;  3CZ2 A;  5AAN A;  2M97 A;  5CSF A;  1WRL A;  5AFP A;  1LA3 A;  1EJ3 A;  3SG2 A;  2QPT A;  2P6B B;  5AER A;  2I7A A;  1UWO A;  3KPX A;  5BPJ A;  2WCH A;  1MXE A;  2WCJ A;  4YI9 A;  2HPS A;  2JOJ A;  5HLV A;  3SG7 A;  3PLF B;  2TN4 A;  3CGA A;  3DD4 A;  4OCI A;  4DRW A;  1DJW A;  1OOH A;  1B8C A;  5CSJ A;  1DEL A;  1OE9 B;  1YUU A;  1ZUZ A;  2R2I A;  1U5I B;  3GK4 X;  1RRO A;  1YR5 A;  1N65 A;  1NX1 A;  4FQT A;  4OV2 A;  3D75 A;  4BY5 A;  4XYN A;  1PK0 D;  1F54 A;  4PHM A;  4D1E A;  4F0Z B;  1QX2 A;  1SPY A;  4YGA A;  4GFT A;  3PAL A;  1KQM B;  1SY9 A;  1NUB A;  1UHH A;  1PVB A;  3IVT A;  3VB1 A;  1CLB A;  2CCM A;  3A8R A;  3SG4 A;  1D1O A;  1A2X A;  2LP2 A;  4PE7 A;  4P5O E;  5ER5 A;  1EG3 A;  3O6B A;  3L47 A;  5KU1 A;  1K8U A;  4I5L B;  2EHB A;  1KQM C;  4NDD A;  5FI7 A;  1AJ4 A;  5B8I B;  2KAX A;  4MEW A;  3B6X A;  2H61 C;  4MZL A;  1ORG A;  3D73 A;  2F3Y A;  1WLZ A;  3VRQ A;  2BNX A;  2JC2 A;  2LUC A;  3D0Y A;  4M2Q A;  3FE8 A;  1OOF A;  1G8I A;  1DJG A;  1B8R A;  3R1O A;  1XA5 A;  3ZNI A;  1DVI A;  4I5N B;  2MBX A;  3PAT A;  3DVJ A;  1DTL A;  1M39 A;  1MWN A;  2CT9 A;  2BKI B;  1BOD A;  1KFU L;  1TIZ A;  2WC5 A;  3JVT B;  2L5X B;  4ORA B;  2Q91 A;  5IBW A;  1J7P A;  3CR2 A;  4QJ3 B;  3S0D A;  3EVR A;  1DGV A;  1KK8 B;  4DUQ A;  1FF1 A;  2F2O A;  1K2H A;  2M1K B;  3DZT A;  3EG5 B;  3DVK A;  5FI2 A;  1V1F A;  3JVT C;  4MRY A;  4ZCV A;  1NCZ A;  1K9U A;  3SIA A;  2BBN A;  1KWO B;  1QV0 A;  3S0A A;  1KQV A;  1RK9 A;  1KK8 C;  1R6P A;  1TN4 A;  1V1G A;  2NCO A;  5HLO A;  3SG5 A;  3JTD B;  1NWD A;  1JFJ A;  2MLE C;  1LVC D;  2JU0 A;  2WOR A;  2KBI A;  5TNC A;  3SG3 A;  4QJ4 B;  1DF0 A;  2KFF A;  5I2O A;  1KWO C;  4YGC B;  1XFV O;  2LLT A;  1TCF A;  3KEV A;  3JTD C;  1K90 D;  1L7Z A;  3BUM B;  1ZFS A;  1K9P A;  3B86 A;  1A03 A;  3LCP C;  1UHJ A;  5F6T A;  2CTN A;  2NLN A;  4XJK B;  1OMD A;  2H2K A;  1DJX A;  1Y0V H;  1OMR A;  3L4A A;  2KQY A;  3LLE A;  3D78 A;  1CDN A;  2EC6 B;  4DCK A;  2ZRT A;  2B1U A;  4N1F A;  1CFC A;  3BOW B;  1RTP 1;  2WCE A;  1KCY A;  3AAJ A;  3OB1 B;  2HQW A;  2QEH A;  1K9K A;  2PRU A;  2JWW A;  4IL1 A;  1Y1X A;  2RGI A;  4TNC A;  1BOC A;  1XFY O;  1LXF C;  2EC6 C;  3OP0 A;  4BY4 A;  1SCM B;  4CID A;  1BMO A;  3RLZ A;  1QIV A;  3NSK A;  2KLE A;  2K2A A;  1XFW O;  3VGO A;  1NYA A;  1PUL A;  1MHO A;  1TTX A;  1GJY A;  2GGM A;  4GAO A;  3NXA A;  4ICB A;  3WXA A;  5HKW A;  1WDC B;  1YX8 A;  2QEB A;  1F71 A;  1QJT A;  1TNP A;  2LLS A;  2QEO A;  5DKR A;  2P70 A;  2GTE A;  1N0Y A;  3KF9 A;  1J7R A;  2JZI A;  2PAS A;  1TOP A;  3DY9 A;  2KGR A;  1F70 A;  1H8B A;  3SIB A;  3LL8 B;  3CZ1 A;  1YUT A;  1TRF A;  3H4S E;  5DIC A;  4A4B A;  4WQ2 A;  1K95 A;  1JFK A;  1WDC C;  4PDZ A;  1QWV A;  4PHN A;  4MVF A;  1TCO B;  3WHU B;  1VRK A;  1B1G A;  4MLW A;  4MSP A;  2L4H A;  1YX7 A;  2M7N A;  3QME A;  4I5J A;  3L4L A;  1KSO A;  2JT3 A;  4AQI A;  4PHJ A;  1F4O A;  3BUO B;  4C0L A;  1U5I A;  1NPQ A;  3BUX B;  2BCA A;  5GQQ C;  1AJ5 A;  5ER4 X;  2JQ6 A;  2KFH A;  2M3W A;  2ZFD A;  2ISD A;  1S5G Z;  1J55 A;  2ZNE A;  3CTN A;  2LMV A;  1YUS A;  2NCP A;  3I5I B;  1CKK A;  2BBM A;  3TUY B;  2LCP A;  3NSL A;  2H61 A;  4DIR A;  3I5F B;  1SCV A;  1RJV A;  3OB2 B;  4L9M A;  1OMV A;  4M2O A;  5AEQ A;  2QDI A;  1QVI Z;  4C0K A;  1FPW A;  3I5I C;  4MBE A;  1DGU A;  1XK4 A;  3TUY C;  5FYX A;  2LNK A;  3KO0 A;  1S3P A;  1OOG A;  1B7T Z;  3I5F C;  3NHI A;  1A29 A;  2KBM A;  1G33 A;  1FW4 A;  1K96 A;  2PSR A;  2PYQ A;  1GM0 A;  1QXP A;  1IH0 A;  1OZO A;  1Y1A A;  5J3X A;  1Z2C B;  3B88 A;  3CAB A;  3CWG A;  3WHT B;  2BE4 A;  2KGB C;  1Y1U A;  1ZOT B;  2K7C A;  2M49 B;  3BUN B;  1S6C A;  1BJF A;  2K60 A;  2KPH A; 
#chains in the Genus database with same CATH homology
 4JD9 A;  3S0A A;  2L2C A;  3CYZ A;  3OGN A;  2FJY A;  3K1E A;  4OZD A;  3FE9 A;  2WCK A;  4F7F A;  3BFH A;  4INW A;  2ERB A;  3R72 A;  3B86 A;  3BFB A;  3DXL A;  3NGV A;  3L4A A;  1OOI X;  3D78 A;  3S0E A;  2QEH A;  1DQE A;  2H8V A;  4INX A;  1C3Z A;  3RZS A;  3CZ2 A;  2QEV A;  2QEB A;  2P71 A;  3NHT A;  2QEO A;  2WCH A;  3D77 A;  2WCJ A;  2P70 A;  2GTE A;  2JPO A;  3DY9 A;  2WC6 A;  3CZ1 A;  3V2L A;  5DIC A;  3DYE A;  3CZ0 A;  1OOH A;  1QWV A;  2WCL A;  3FE6 A;  3B7A A;  3R1P A;  1XFR A;  1TUJ A;  3N7H A;  4FQT A;  3D75 A;  3R1V A;  3QME A;  3L4L A;  3VB1 A;  1P28 A;  3S0G A;  4PT1 A;  3L47 A;  2PQL A;  2WCM A;  3B6X A;  1TWO A;  3B87 A;  3D76 A;  1ORG A;  3D73 A;  2QDI A;  3FE8 A;  1LS8 A;  1OOF A;  3D74 A;  1C3Y A;  1OOG A;  3R1O A;  3NHI A;  3BJH A;  3Q8I A;  3S0B A;  1GM0 A;  2WC5 A;  1T14 A;  5EL2 A;  3B88 A;  3CAB A;  3PJI A;  3S0D A;  3S0F A;  3CDN A;  3DZT A;  3BFA A;  1OW4 A;  2KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...