3S0FA

Apis mellifera obp14 native apo, crystal form 2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 46
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0fA00
2PQLA 3S0GA 3S0FA 3CZ1A 3D76A 2WCJA 3DZTA 2FJYA 3D75A 1OOIX 1OOFA 2JPOA 2WCHA 3B86A 3BJHA 3L4LA 3FE9A 3DY9A 3FE6A 3S0EA 3NHTA 3S0BA 4INXA 3D77A 3QMEA 3R1VA 2L2CA 3OGNA 3CZ0A 3K1EA 1OOGA 1DQEA 1OW4A 2P70A 1P28A 1XFRA 3L4AA 2GTEA 2WC6A 3CABA 3B7AA 3RZSA 3PJIA 3VB1A 3D73A 3BFAA 3CZ2A 3NHIA 5DICA 3DXLA 2QEVA 3R1PA 4PT1A 5EL2A 3B6XA 3V2LA 1T14A 1ORGA 3B88A 3D78A 2QEHA 3S0DA 3D74A 3S0AA 1TWOA 1OOHA 4FQTA 3CYZA 1C3ZA 1GM0A 3FE8A 3R72A 4INWA 2KPHA 2WC5A 2P71A 3R1OA 1C3YA 3L47A 1LS8A 2WCMA 2ERBA 3BFHA 2H8VA 3NGVA 4OZDA 2WCKA 3BFBA 1QWVA 2WCLA 3CDNA 2QEOA 3N7HA 4F7FA 1TUJA 3DYEA 2QEBA 3B87A 4JD9A 3Q8IA 2QDIA
chains in the Genus database with same CATH superfamily
1AHRA 1G8IA 1S6JA 2KI4C 4YRUA 1F4OA 2KHNA 1Y1UA 2EGDA 1BT6A 4MSPA 3S0FA 3TDUA 1B8LA 1MWNA 4JWQA 1KFUL 4N5XA 2L5XB 3EK7A 3DZTA 2FJYA 2G9BA 1S3PA 3VRRA 4CLNA 4MN0A 3B86A 1IQ3A 1H4BA 1XFVO 2CNPA 4ORAB 4OVNF 3IVTA 2LM5A 2KSPA 3FE9A 3ICBA 3L4LA 2KGBC 4HREE 3DY9A 5GQQC 2NCOA 2CCMA 2JXCA 2KGRA 1UWOA 3S0BA 2E6WA 1DTLA 1PVBA 4HSZA 1K94A 3DF0B 3K21A 1TOPA 4YI9A 1CDNA 3R1VA 5ER5A 1JWDA 4GNKB 2I18A 1KQMC 1G33A 1M31A 1TIZA 1AUIB 3TS5C 3ZNIA 5AERA 1M46A 1SCMC 2L4HA 2ISDA 1R2UA 4M2PA 1IIOA 2HQ8A 1OW4A 1Z2CB 4I5LB 1XFRA 2KBMA 3L4AA 2KQYA 4ICBA 3ZWHA 2JOJA 2I94A 2ZNEA 1L2OB 1SYMA 1XO5A 1TRFA 3BUMB 3VB1A 4PDZA 5I2LA 4FTGA 4AQIA 5AFPA 3NHIA 2KI6D 4PE1A 3OHMB 1H8BA 1CLLA 2M1UA 3DXLA 1DJHA 3R1PA 2Y5IA 2FJUB 1F4QA 1QS7A 1KWOC 3OP0A 1TCFA 4PHNA 3RLZA 2LVJA 3IQOA 1Y0VH 3PFVA 5DKRA 1B4CA 3DVJA 2FCEA 1DJGA 1S26D 4MLWA 4MZLA 2VRGA 1XFWO 1KK8C 1F55A 2M1KB 1PRWA 1FI5A 4M2QA 1YRTB 3D78A 2LMTA 1TWOA 4AQJA 2OTGC 1UHKA 1NYAA 4ETOA 1S6CA 2JULA 3TUYB 3SJSA 5I2QA 1BU3A 4DS7A 1MF8B 1SNLA 1BR1B 2LHIA 5CSFA 4BY5A 1IKUA 1QIWA 1C3ZA 1FBVA 1FW4A 2WCFA 3D10A 4ORCB 1XVJA 2LUCA 2BL0C 4YGDB 3FE8A 3GK1A 3SS5A 1RECA 3C1VA 1YTZC 1XK4A 3PALA 3R72A 1JFKA 5DKNA 1W7IB 3TDIA 3I5FB 1S5GZ 2KDHA 4PE4A 2KYFA 1IJ5A 2MRDA 5CSIA 2LVKA 3TZ1A 3JVTB 5J3XA 1B7TZ 1IH0A 4OKHA 1XYDA 3EK8A 3LCPC 4PHJA 4C0LA 2YGUA 2KI4B 2LNKA 2QACA 2KLDA 1DGVA 2SASA 1Y1XA 2BKHB 3NGVA 3EKHA 1CMGA 2K61A 1SW8A 1KSMA 1QWVA 2KYCA 2WCKA 5DKQA 1OOJA 2L5YA 4F7FA 3GOFA 3DYEA 1R6PA 2BE4A 2L50A 2H61A 1TNQA 2COLB 3VRPA 4ZCVA 1X02A 4I5NB 3B87A 4MRYA 4N1GA 3Q8IA 2QDIA 5FYXA 1PULA 1M45A 2MA2A 2ZNDA 2PQLA 1DF0B 1K9UA 1JF0A 1TNPA 1OQPA 2BBMA 2BCBA 1NUBA 3UNWA 1VRKA 1KQMB 2PVBA 3D76A 2PSRA 3TS5B 1SCMB 1IJ6A 2M97A 1XA5A 1RTP1 1SRAA 1TUZA 3CLNA 1SBJA 3SIBA 4C0KA 2EC6C 1EG4A 1K8UA 1KFXL 2GV5A 1OOFA 2I7AA 2PYQA 4HRGA 1EH2A 2K8MB 1PALA 3KO0A 1B7TY 3AKAA 4QJ5B 1J1DA 2BECA 2L2EA 5B8IB 3A8RA 2LUXA 2CT9A 1QIVA 3O6BA 4NDCA 1PK0D 2E30A 3FE6A 3PM2A 4R1EA 5TNCA 1M63B 3NHTA 1DGUA 1V1GA 4MBEA 1AP4A 5AEQA 1KWOB 3EVUA 1HQVA 3D0YB 5AANA 4DRWA 5KU1A 3WHTB 3K1EA 3A4UB 1QJTA 3BXKA 1DELA 1EXRA 2Q4UA 5HLOA 5I2OA 1AJ4A 1KK8B 3WHUB 3MSEB 2GTEA 1YR5A 1F71A 1J7QA 2OTGB 3FIAA 4MZKA 2BCAA 3CABA 5CPVA 3B7AA 1Y6WA 2HETA 1AVSA 1BOCA 1LXFC 2KFFA 4GUKA 1RJVA 3BFAA 1WRZA 1UURA 2ZRSA 1J7OA 1BODA 1JUOA 2F33A 4P5OE 2NCPA 1KFUS 3O78A 4I5JA 1GJYA 4MVFA 3PLFB 3SG3A 2BL0B 1KK7Z 2K2FA 2ZN8A 3QRXA 1U5IA 1AK8A 2KAXA 2WC8A 2K0JA 1TN4A 1F54A 3CWGA 1MXEA 3PN7C 1SK6D 1A29A 1YUSA 2BBNA 2JNFA 1SL9A 4JPZB 4WQ2A 1K93D 2PALA 1SL8A 1T14A 3VRNA 3I5IC 3B88A 3RZSA 2QEHA 1CDMA 2LE9B 3BOWB 3D74A 1RFJA 3I5GC 1OOHA 1CTRA 4BY4A 1DVIA 1J1EA 4FQTA 2ZKMX 3CYZA 1IG5A 1K90D 4NDBA 3O4YA 2MJWB 2LV7A 1F8HA 4GPLB 4PCWA 2LLSA 2LHLA 2RGIA 3F45A 4CFQA 2M0RA 5BPJA 2FCDA 4INWA 1K9KA 3CR5X 2PRUA 1CM1A 3FWBA 2Q91A 4OCIA 1B47A 2L98A 1OMRA 3BUWB 4YGBB 2LLTA 1XK4C 1UHJA 1WRLA 1YX8A 2KAYA 3OX6A 3EG5B 5FI6A 2ERBA 1ZACA 2OPOA 2LP3A 1KK7Y 1A75A 1CFCA 4QJ4B 5HKWA 4MEWA 4OZDA 5JOLA 4XJKA 1K2HA 2JTZA 3LL8B 2TN4A 1BLQA 2ZN9A 4KYNA 3GK4X 5KSZA 1YX7A 1ODBA 2K2AA 1CLMA 2EC6B 4F0ZB 3BQ3A 1NPQA 4QJ3B 4UPGA 1LVCD 1CDPA 1OMDA 1QLKA 2LMUA 1CFDA 3PATA 2P6BB 3PM8A 4JQ0D 1KQVA 4HRHA 2CTNA 2MAZA 2FOTA 2QPTA 2CXJA 2F3ZA 1C7VA 1ZFSA 4L9MA 2LVVA 4GGNA 3CZ1A 5PALA 1QV1A 3O4XA 4E68A 2H61C 1C7WA 2M9GA 2HQWA 4PE0A 4WRIA 4MRXA 3HCMA 2LC5A 3SS3A 2DOQA 3D75A 1JFJA 4M2OA 2JPOA 4OV2A 2EHBA 2JPTA 2WCHA 5AXIA 2O60A 4IL1A 3BUXB 2I2RE 1LA0A 1OE9B 3DVKA 3VRQA 4GAOA 4OR9B 1GQMA 3SG7A 3AKBA 1YVLA 2JQ6A 4GGFA 2O5GA 3D77A 4INXA 3RM1A 4CIDA 2F8PA 1BMOA 2R2IA 4PHMA 3SG2A 2L2CA 3OGNA 2V53A 4XYNA 3PN7B 1J55A 1UHNA 2BCXA 1OOGA 1YUUA 3FS7A 1SSEB 4NQGA 1QX5B 2P70A 1P28A 2ZRTA 4DUQA 1TTXA 1LA3A 4YGAA 3I5IB 3I5GB 1LINA 2LANA 4PE7A 4ZCUA 1K9PA 1EG3A 1N0YA 1J7PA 2JU0A 1S6IA 4TNCA 1MXLC 1L7ZA 1MQ1A 1UP5A 3PSRA 4PALA 5DICA 2QEVA 1FPWA 1OZSA 4PT1A 4DIRA 3LK1A 2CBLA 1JBAA 2NZ0A 1QATA 2JT8A 2K7OA 5EL2A 4ORBB 1KFXS 2HPSA 3B6XA 1A75B 1WDCC 3O2PA 1XFZO 2M3WA 2KOTA 2Y1MA 1YRUB 1KSOA 3KPXA 1DJIA 2F2OA 1ALVA 2BNXA 5G08A 3I5HC 4CPVA 2NLNA 3H4SE 2K60A 2AMIA 1IQ5A 5I94A 1NX1A 1WLZA 2A4JA 1GGZA 2JRFA 1DJYA 1N65A 2GGZA 2WCEA 5JJGA 1SMGA 4WQ3A 1DJXA 4U8DA 1CB1A 2KPHA 3CGAA 3SG6A 1DT7B 1W7JB 1ZUZA 2D8NA 2WC5A 2JT0A 1HT9A 3AAKA 2B1UA 3NSLA 3SS4A 3VGOA 1N2DA 4IJ7A 3IF7A 3KF9A 1JC2A 5HLVA 1IRJA 1Z4HA 1M39A 1J7RA 2L51A 1TCOB 5ER4X 3EVVA 3CZTX 1CFFA 1SR6C 1Q80A 1NCYA 1QASA 2JNXA 2H8VA 3OB2B 1YURA 1SKTA 3BFBA 1NX2A 2WCLA 2QEOA 2JXLA 4DCKA 2PASA 3NXAA 1E8AA 3IQQA 2KI6C 2ZFDA 3WNXB 2QEBA 1NCXA 3AAJA 4JD9A 1OSAA 5FI2A 2SCPA 1NSHA 2JZIA 2G2BA 5HKYA 5D7FA 1A4PA 5HKZA 3S0GA 1CKKA 2NXQA 1MUXA 3SG5A 1YVHA 3JTDC 2K7BA 3OX5A 1RWYA 1DMOA 1IGVA 1QVIY 2MLEC 1Y1AA 1KCYA 2WCJA 3M0WA 2KFGA 2OS8C 3OB1B 1CFPA 1DF0A 1QX2A 1K96A 1OOIX 3SG4A 5F6TA 1DEKA 1NIWA 2JT3A 3E3RA 3BJHA 3KHEA 4FQOA 2WORA 1QXPA 3S0EA 4CFRA 3BUOB 2LVIA 4MZJA 5HYDA 1PSBA 1CNPA 3CR2A 4P2YB 1RK9A 1ZMZA 3QMEA 4A4CA 1FF1A 2KQ6A 1A03A 3CZ0A 1S36A 1FI6A 1XFUO 2LLUA 2M7NA 1WDCB 4C0JA 1EJ3A 1DQEA 1WRKA 1DJZA 2JWWA 1F70A 1BG1A 2F3YA 1XFXO 2AUCA 4YGEB 4GGFC 3D0YA 3LK0A 2WC6A 4I5KA 2M7LA 1U5IB 2M8UA 1CDLA 3I5HB 1A2XA 3PJIA 5D3OA 1NX0A 3D73A 3EK4A 3VROA 1C07A 2MBXA 3CZ2A 5IBWA 1QLSA 2BE6A 3CTNA 1IWQA 2JC2A 2WOSA 4JKTA 4A4BA 3DD4A 1UHHA 4D1EA 1OMVA 1BF5A 2IS9A 2M49B 4N1FA 2WNDA 5HL1A 4YI8A 1TNXA 2BKIB 3V2LA 1CLBA 4YGCB 5FI7A 1ORGA 1QV0A 2Y4QA 3OBVA 3S0DA 1W9ZA 3S0AA 1MR8A 1NP8A 1BJFA 1UUSA 1L2OC 3EKJA 3NSOA 1PVAA 1DJWA 1JF2A 3DF0A 4AOMA 1ALWA 1SY9A 1UHIA 2WCBA 1GM0A 3LLEA 2MLFC 3BOWA 4Q04A 2L4IA 1SR6B 2BAPA 2AAOA 3UO9A 1BR4B 3WXAA 2MHHA 1CM4A 1TNWA 3KEVA 4YBHB 1PSRA 1AJ5A 4GBAA 4NDDA 2P71A 1WY9A 2JTTA 3R1OA 1D1OA 1GGWA 1C3YA 5K89A 3NSIA 4USLA 3HX4A 3L47A 1NWDA 1YUTA 2L0PA 2LAPA 4GFTA 2HF5A 5I8NA 1XFYO 5D69A 4XJKB 3TUYC 1SCVA 1LS8A 2PMYA 2WCMA 5KTYA 3BFHA 2KNEA 3TDZA 1ZOTB 1RROA 3BUNB 3EVRA 1QX7A 1QTXA 1V1FA 1S5GY 1JSAA 1LKJA 2KBIA 3DVEA 3JTDB 3GK2A 2M29A 2F2PA 2KAVA 1WLMA 3CDNA 3CR4X 3FWCA 3N7HA 2H2KA 1S1EA 2GGMA 2OS8B 1K95A 3CS1A 5CSJA 1OZOA 1B8RA 2LMVA 1G4YR 3I5FC 4PHKA 1TUJA 5CSNA 1MHOA 2K7DA 1QVIZ 1SPYA 2Y1NA 2LCPA 1CMFA 1DC1A 1EL4A 2KFHA 3JVTC 3SIAA 1NX3A 2LP2A 1B1GA 1SL7A 1B8CA 3NSKA 2KLEA 1B9AA 2K7CA 3BYAA 3DVMA 1NCZA
chains in the Genus database with same CATH topology
2PQLA 3S0GA 3S0FA 3CZ1A 3D76A 2WCJA 3DZTA 2FJYA 3D75A 1OOIX 1OOFA 2JPOA 2WCHA 3B86A 3BJHA 3L4LA 3FE9A 3DY9A 3FE6A 3S0EA 3NHTA 3S0BA 4INXA 3D77A 3QMEA 3R1VA 2L2CA 3OGNA 3CZ0A 3K1EA 1OOGA 1DQEA 1OW4A 2P70A 1P28A 1XFRA 3L4AA 2GTEA 2WC6A 3CABA 3B7AA 3RZSA 3PJIA 3VB1A 3D73A 3BFAA 3CZ2A 3NHIA 5DICA 3DXLA 2QEVA 3R1PA 4PT1A 5EL2A 3B6XA 3V2LA 1T14A 1ORGA 3B88A 3D78A 2QEHA 3S0DA 3D74A 3S0AA 1TWOA 1OOHA 4FQTA 3CYZA 1C3ZA 1GM0A 3FE8A 3R72A 4INWA 2KPHA 2WC5A 2P71A 3R1OA 1C3YA 3L47A 1LS8A 2WCMA 2ERBA 3BFHA 2H8VA 3NGVA 4OZDA 2WCKA 3BFBA 1QWVA 2WCLA 3CDNA 2QEOA 3N7HA 4F7FA 1TUJA 3DYEA 2QEBA 3B87A 4JD9A 3Q8IA 2QDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQL A;  3S0G A;  3S0F A;  3CZ1 A;  3D76 A;  2WCJ A;  3DZT A;  2FJY A;  3D75 A;  1OOI X;  1OOF A;  2JPO A;  2WCH A;  3B86 A;  3BJH A;  3L4L A;  3FE9 A;  3DY9 A;  3FE6 A;  3S0E A;  3NHT A;  3S0B A;  4INX A;  3D77 A;  3QME A;  3R1V A;  2L2C A;  3OGN A;  3CZ0 A;  3K1E A;  1OOG A;  1DQE A;  1OW4 A;  2P70 A;  1P28 A;  1XFR A;  3L4A A;  2GTE A;  2WC6 A;  3CAB A;  3B7A A;  3RZS A;  3PJI A;  3VB1 A;  3D73 A;  3BFA A;  3CZ2 A;  3NHI A;  5DIC A;  3DXL A;  2QEV A;  3R1P A;  4PT1 A;  5EL2 A;  3B6X A;  3V2L A;  1T14 A;  1ORG A;  3B88 A;  3D78 A;  2QEH A;  3S0D A;  3D74 A;  3S0A A;  1TWO A;  1OOH A;  4FQT A;  3CYZ A;  1C3Z A;  1GM0 A;  3FE8 A;  3R72 A;  4INW A;  2KPH A;  2WC5 A;  2P71 A;  3R1O A;  1C3Y A;  3L47 A;  1LS8 A;  2WCM A;  2ERB A;  3BFH A;  2H8V A;  3NGV A;  4OZD A;  2WCK A;  3BFB A;  1QWV A;  2WCL A;  3CDN A;  2QEO A;  3N7H A;  4F7F A;  1TUJ A;  3DYE A;  2QEB A;  3B87 A;  4JD9 A;  3Q8I A;  2QDI A; 
#chains in the Genus database with same CATH topology
 1AHR A;  1G8I A;  1S6J A;  2KI4 C;  4YRU A;  1F4O A;  2KHN A;  1Y1U A;  2EGD A;  1BT6 A;  4MSP A;  3S0F A;  3TDU A;  1B8L A;  1MWN A;  4JWQ A;  1KFU L;  4N5X A;  2L5X B;  3EK7 A;  3DZT A;  2FJY A;  2G9B A;  1S3P A;  3VRR A;  4CLN A;  4MN0 A;  3B86 A;  1IQ3 A;  1H4B A;  1XFV O;  2CNP A;  4ORA B;  4OVN F;  3IVT A;  2LM5 A;  2KSP A;  3FE9 A;  3ICB A;  3L4L A;  2KGB C;  4HRE E;  3DY9 A;  5GQQ C;  2NCO A;  2CCM A;  2JXC A;  2KGR A;  1UWO A;  3S0B A;  2E6W A;  1DTL A;  1PVB A;  4HSZ A;  1K94 A;  3DF0 B;  3K21 A;  1TOP A;  4YI9 A;  1CDN A;  3R1V A;  5ER5 A;  1JWD A;  4GNK B;  2I18 A;  1KQM C;  1G33 A;  1M31 A;  1TIZ A;  1AUI B;  3TS5 C;  3ZNI A;  5AER A;  1M46 A;  1SCM C;  2L4H A;  2ISD A;  1R2U A;  4M2P A;  1IIO A;  2HQ8 A;  1OW4 A;  1Z2C B;  4I5L B;  1XFR A;  2KBM A;  3L4A A;  2KQY A;  4ICB A;  3ZWH A;  2JOJ A;  2I94 A;  2ZNE A;  1L2O B;  1SYM A;  1XO5 A;  1TRF A;  3BUM B;  3VB1 A;  4PDZ A;  5I2L A;  4FTG A;  4AQI A;  5AFP A;  3NHI A;  2KI6 D;  4PE1 A;  3OHM B;  1H8B A;  1CLL A;  2M1U A;  3DXL A;  1DJH A;  3R1P A;  2Y5I A;  2FJU B;  1F4Q A;  1QS7 A;  1KWO C;  3OP0 A;  1TCF A;  4PHN A;  3RLZ A;  2LVJ A;  3IQO A;  1Y0V H;  3PFV A;  5DKR A;  1B4C A;  3DVJ A;  2FCE A;  1DJG A;  1S26 D;  4MLW A;  4MZL A;  2VRG A;  1XFW O;  1KK8 C;  1F55 A;  2M1K B;  1PRW A;  1FI5 A;  4M2Q A;  1YRT B;  3D78 A;  2LMT A;  1TWO A;  4AQJ A;  2OTG C;  1UHK A;  1NYA A;  4ETO A;  1S6C A;  2JUL A;  3TUY B;  3SJS A;  5I2Q A;  1BU3 A;  4DS7 A;  1MF8 B;  1SNL A;  1BR1 B;  2LHI A;  5CSF A;  4BY5 A;  1IKU A;  1QIW A;  1C3Z A;  1FBV A;  1FW4 A;  2WCF A;  3D10 A;  4ORC B;  1XVJ A;  2LUC A;  2BL0 C;  4YGD B;  3FE8 A;  3GK1 A;  3SS5 A;  1REC A;  3C1V A;  1YTZ C;  1XK4 A;  3PAL A;  3R72 A;  1JFK A;  5DKN A;  1W7I B;  3TDI A;  3I5F B;  1S5G Z;  2KDH A;  4PE4 A;  2KYF A;  1IJ5 A;  2MRD A;  5CSI A;  2LVK A;  3TZ1 A;  3JVT B;  5J3X A;  1B7T Z;  1IH0 A;  4OKH A;  1XYD A;  3EK8 A;  3LCP C;  4PHJ A;  4C0L A;  2YGU A;  2KI4 B;  2LNK A;  2QAC A;  2KLD A;  1DGV A;  2SAS A;  1Y1X A;  2BKH B;  3NGV A;  3EKH A;  1CMG A;  2K61 A;  1SW8 A;  1KSM A;  1QWV A;  2KYC A;  2WCK A;  5DKQ A;  1OOJ A;  2L5Y A;  4F7F A;  3GOF A;  3DYE A;  1R6P A;  2BE4 A;  2L50 A;  2H61 A;  1TNQ A;  2COL B;  3VRP A;  4ZCV A;  1X02 A;  4I5N B;  3B87 A;  4MRY A;  4N1G A;  3Q8I A;  2QDI A;  5FYX A;  1PUL A;  1M45 A;  2MA2 A;  2ZND A;  2PQL A;  1DF0 B;  1K9U A;  1JF0 A;  1TNP A;  1OQP A;  2BBM A;  2BCB A;  1NUB A;  3UNW A;  1VRK A;  1KQM B;  2PVB A;  3D76 A;  2PSR A;  3TS5 B;  1SCM B;  1IJ6 A;  2M97 A;  1XA5 A;  1RTP 1;  1SRA A;  1TUZ A;  3CLN A;  1SBJ A;  3SIB A;  4C0K A;  2EC6 C;  1EG4 A;  1K8U A;  1KFX L;  2GV5 A;  1OOF A;  2I7A A;  2PYQ A;  4HRG A;  1EH2 A;  2K8M B;  1PAL A;  3KO0 A;  1B7T Y;  3AKA A;  4QJ5 B;  1J1D A;  2BEC A;  2L2E A;  5B8I B;  3A8R A;  2LUX A;  2CT9 A;  1QIV A;  3O6B A;  4NDC A;  1PK0 D;  2E30 A;  3FE6 A;  3PM2 A;  4R1E A;  5TNC A;  1M63 B;  3NHT A;  1DGU A;  1V1G A;  4MBE A;  1AP4 A;  5AEQ A;  1KWO B;  3EVU A;  1HQV A;  3D0Y B;  5AAN A;  4DRW A;  5KU1 A;  3WHT B;  3K1E A;  3A4U B;  1QJT A;  3BXK A;  1DEL A;  1EXR A;  2Q4U A;  5HLO A;  5I2O A;  1AJ4 A;  1KK8 B;  3WHU B;  3MSE B;  2GTE A;  1YR5 A;  1F71 A;  1J7Q A;  2OTG B;  3FIA A;  4MZK A;  2BCA A;  3CAB A;  5CPV A;  3B7A A;  1Y6W A;  2HET A;  1AVS A;  1BOC A;  1LXF C;  2KFF A;  4GUK A;  1RJV A;  3BFA A;  1WRZ A;  1UUR A;  2ZRS A;  1J7O A;  1BOD A;  1JUO A;  2F33 A;  4P5O E;  2NCP A;  1KFU S;  3O78 A;  4I5J A;  1GJY A;  4MVF A;  3PLF B;  3SG3 A;  2BL0 B;  1KK7 Z;  2K2F A;  2ZN8 A;  3QRX A;  1U5I A;  1AK8 A;  2KAX A;  2WC8 A;  2K0J A;  1TN4 A;  1F54 A;  3CWG A;  1MXE A;  3PN7 C;  1SK6 D;  1A29 A;  1YUS A;  2BBN A;  2JNF A;  1SL9 A;  4JPZ B;  4WQ2 A;  1K93 D;  2PAL A;  1SL8 A;  1T14 A;  3VRN A;  3I5I C;  3B88 A;  3RZS A;  2QEH A;  1CDM A;  2LE9 B;  3BOW B;  3D74 A;  1RFJ A;  3I5G C;  1OOH A;  1CTR A;  4BY4 A;  1DVI A;  1J1E A;  4FQT A;  2ZKM X;  3CYZ A;  1IG5 A;  1K90 D;  4NDB A;  3O4Y A;  2MJW B;  2LV7 A;  1F8H A;  4GPL B;  4PCW A;  2LLS A;  2LHL A;  2RGI A;  3F45 A;  4CFQ A;  2M0R A;  5BPJ A;  2FCD A;  4INW A;  1K9K A;  3CR5 X;  2PRU A;  1CM1 A;  3FWB A;  2Q91 A;  4OCI A;  1B47 A;  2L98 A;  1OMR A;  3BUW B;  4YGB B;  2LLT A;  1XK4 C;  1UHJ A;  1WRL A;  1YX8 A;  2KAY A;  3OX6 A;  3EG5 B;  5FI6 A;  2ERB A;  1ZAC A;  2OPO A;  2LP3 A;  1KK7 Y;  1A75 A;  1CFC A;  4QJ4 B;  5HKW A;  4MEW A;  4OZD A;  5JOL A;  4XJK A;  1K2H A;  2JTZ A;  3LL8 B;  2TN4 A;  1BLQ A;  2ZN9 A;  4KYN A;  3GK4 X;  5KSZ A;  1YX7 A;  1ODB A;  2K2A A;  1CLM A;  2EC6 B;  4F0Z B;  3BQ3 A;  1NPQ A;  4QJ3 B;  4UPG A;  1LVC D;  1CDP A;  1OMD A;  1QLK A;  2LMU A;  1CFD A;  3PAT A;  2P6B B;  3PM8 A;  4JQ0 D;  1KQV A;  4HRH A;  2CTN A;  2MAZ A;  2FOT A;  2QPT A;  2CXJ A;  2F3Z A;  1C7V A;  1ZFS A;  4L9M A;  2LVV A;  4GGN A;  3CZ1 A;  5PAL A;  1QV1 A;  3O4X A;  4E68 A;  2H61 C;  1C7W A;  2M9G A;  2HQW A;  4PE0 A;  4WRI A;  4MRX A;  3HCM A;  2LC5 A;  3SS3 A;  2DOQ A;  3D75 A;  1JFJ A;  4M2O A;  2JPO A;  4OV2 A;  2EHB A;  2JPT A;  2WCH A;  5AXI A;  2O60 A;  4IL1 A;  3BUX B;  2I2R E;  1LA0 A;  1OE9 B;  3DVK A;  3VRQ A;  4GAO A;  4OR9 B;  1GQM A;  3SG7 A;  3AKB A;  1YVL A;  2JQ6 A;  4GGF A;  2O5G A;  3D77 A;  4INX A;  3RM1 A;  4CID A;  2F8P A;  1BMO A;  2R2I A;  4PHM A;  3SG2 A;  2L2C A;  3OGN A;  2V53 A;  4XYN A;  3PN7 B;  1J55 A;  1UHN A;  2BCX A;  1OOG A;  1YUU A;  3FS7 A;  1SSE B;  4NQG A;  1QX5 B;  2P70 A;  1P28 A;  2ZRT A;  4DUQ A;  1TTX A;  1LA3 A;  4YGA A;  3I5I B;  3I5G B;  1LIN A;  2LAN A;  4PE7 A;  4ZCU A;  1K9P A;  1EG3 A;  1N0Y A;  1J7P A;  2JU0 A;  1S6I A;  4TNC A;  1MXL C;  1L7Z A;  1MQ1 A;  1UP5 A;  3PSR A;  4PAL A;  5DIC A;  2QEV A;  1FPW A;  1OZS A;  4PT1 A;  4DIR A;  3LK1 A;  2CBL A;  1JBA A;  2NZ0 A;  1QAT A;  2JT8 A;  2K7O A;  5EL2 A;  4ORB B;  1KFX S;  2HPS A;  3B6X A;  1A75 B;  1WDC C;  3O2P A;  1XFZ O;  2M3W A;  2KOT A;  2Y1M A;  1YRU B;  1KSO A;  3KPX A;  1DJI A;  2F2O A;  1ALV A;  2BNX A;  5G08 A;  3I5H C;  4CPV A;  2NLN A;  3H4S E;  2K60 A;  2AMI A;  1IQ5 A;  5I94 A;  1NX1 A;  1WLZ A;  2A4J A;  1GGZ A;  2JRF A;  1DJY A;  1N65 A;  2GGZ A;  2WCE A;  5JJG A;  1SMG A;  4WQ3 A;  1DJX A;  4U8D A;  1CB1 A;  2KPH A;  3CGA A;  3SG6 A;  1DT7 B;  1W7J B;  1ZUZ A;  2D8N A;  2WC5 A;  2JT0 A;  1HT9 A;  3AAK A;  2B1U A;  3NSL A;  3SS4 A;  3VGO A;  1N2D A;  4IJ7 A;  3IF7 A;  3KF9 A;  1JC2 A;  5HLV A;  1IRJ A;  1Z4H A;  1M39 A;  1J7R A;  2L51 A;  1TCO B;  5ER4 X;  3EVV A;  3CZT X;  1CFF A;  1SR6 C;  1Q80 A;  1NCY A;  1QAS A;  2JNX A;  2H8V A;  3OB2 B;  1YUR A;  1SKT A;  3BFB A;  1NX2 A;  2WCL A;  2QEO A;  2JXL A;  4DCK A;  2PAS A;  3NXA A;  1E8A A;  3IQQ A;  2KI6 C;  2ZFD A;  3WNX B;  2QEB A;  1NCX A;  3AAJ A;  4JD9 A;  1OSA A;  5FI2 A;  2SCP A;  1NSH A;  2JZI A;  2G2B A;  5HKY A;  5D7F A;  1A4P A;  5HKZ A;  3S0G A;  1CKK A;  2NXQ A;  1MUX A;  3SG5 A;  1YVH A;  3JTD C;  2K7B A;  3OX5 A;  1RWY A;  1DMO A;  1IGV A;  1QVI Y;  2MLE C;  1Y1A A;  1KCY A;  2WCJ A;  3M0W A;  2KFG A;  2OS8 C;  3OB1 B;  1CFP A;  1DF0 A;  1QX2 A;  1K96 A;  1OOI X;  3SG4 A;  5F6T A;  1DEK A;  1NIW A;  2JT3 A;  3E3R A;  3BJH A;  3KHE A;  4FQO A;  2WOR A;  1QXP A;  3S0E A;  4CFR A;  3BUO B;  2LVI A;  4MZJ A;  5HYD A;  1PSB A;  1CNP A;  3CR2 A;  4P2Y B;  1RK9 A;  1ZMZ A;  3QME A;  4A4C A;  1FF1 A;  2KQ6 A;  1A03 A;  3CZ0 A;  1S36 A;  1FI6 A;  1XFU O;  2LLU A;  2M7N A;  1WDC B;  4C0J A;  1EJ3 A;  1DQE A;  1WRK A;  1DJZ A;  2JWW A;  1F70 A;  1BG1 A;  2F3Y A;  1XFX O;  2AUC A;  4YGE B;  4GGF C;  3D0Y A;  3LK0 A;  2WC6 A;  4I5K A;  2M7L A;  1U5I B;  2M8U A;  1CDL A;  3I5H B;  1A2X A;  3PJI A;  5D3O A;  1NX0 A;  3D73 A;  3EK4 A;  3VRO A;  1C07 A;  2MBX A;  3CZ2 A;  5IBW A;  1QLS A;  2BE6 A;  3CTN A;  1IWQ A;  2JC2 A;  2WOS A;  4JKT A;  4A4B A;  3DD4 A;  1UHH A;  4D1E A;  1OMV A;  1BF5 A;  2IS9 A;  2M49 B;  4N1F A;  2WND A;  5HL1 A;  4YI8 A;  1TNX A;  2BKI B;  3V2L A;  1CLB A;  4YGC B;  5FI7 A;  1ORG A;  1QV0 A;  2Y4Q A;  3OBV A;  3S0D A;  1W9Z A;  3S0A A;  1MR8 A;  1NP8 A;  1BJF A;  1UUS A;  1L2O C;  3EKJ A;  3NSO A;  1PVA A;  1DJW A;  1JF2 A;  3DF0 A;  4AOM A;  1ALW A;  1SY9 A;  1UHI A;  2WCB A;  1GM0 A;  3LLE A;  2MLF C;  3BOW A;  4Q04 A;  2L4I A;  1SR6 B;  2BAP A;  2AAO A;  3UO9 A;  1BR4 B;  3WXA A;  2MHH A;  1CM4 A;  1TNW A;  3KEV A;  4YBH B;  1PSR A;  1AJ5 A;  4GBA A;  4NDD A;  2P71 A;  1WY9 A;  2JTT A;  3R1O A;  1D1O A;  1GGW A;  1C3Y A;  5K89 A;  3NSI A;  4USL A;  3HX4 A;  3L47 A;  1NWD A;  1YUT A;  2L0P A;  2LAP A;  4GFT A;  2HF5 A;  5I8N A;  1XFY O;  5D69 A;  4XJK B;  3TUY C;  1SCV A;  1LS8 A;  2PMY A;  2WCM A;  5KTY A;  3BFH A;  2KNE A;  3TDZ A;  1ZOT B;  1RRO A;  3BUN B;  3EVR A;  1QX7 A;  1QTX A;  1V1F A;  1S5G Y;  1JSA A;  1LKJ A;  2KBI A;  3DVE A;  3JTD B;  3GK2 A;  2M29 A;  2F2P A;  2KAV A;  1WLM A;  3CDN A;  3CR4 X;  3FWC A;  3N7H A;  2H2K A;  1S1E A;  2GGM A;  2OS8 B;  1K95 A;  3CS1 A;  5CSJ A;  1OZO A;  1B8R A;  2LMV A;  1G4Y R;  3I5F C;  4PHK A;  1TUJ A;  5CSN A;  1MHO A;  2K7D A;  1QVI Z;  1SPY A;  2Y1N A;  2LCP A;  1CMF A;  1DC1 A;  1EL4 A;  2KFH A;  3JVT C;  3SIA A;  1NX3 A;  2LP2 A;  1B1G A;  1SL7 A;  1B8C A;  3NSK A;  2KLE A;  1B9A A;  2K7C A;  3BYA A;  3DVM A;  1NCZ A; 
#chains in the Genus database with same CATH homology
 2PQL A;  3S0G A;  3S0F A;  3CZ1 A;  3D76 A;  2WCJ A;  3DZT A;  2FJY A;  3D75 A;  1OOI X;  1OOF A;  2JPO A;  2WCH A;  3B86 A;  3BJH A;  3L4L A;  3FE9 A;  3DY9 A;  3FE6 A;  3S0E A;  3NHT A;  3S0B A;  4INX A;  3D77 A;  3QME A;  3R1V A;  2L2C A;  3OGN A;  3CZ0 A;  3K1E A;  1OOG A;  1DQE A;  1OW4 A;  2P70 A;  1P28 A;  1XFR A;  3L4A A;  2GTE A;  2WC6 A;  3CAB A;  3B7A A;  3RZS A;  3PJI A;  3VB1 A;  3D73 A;  3BFA A;  3CZ2 A;  3NHI A;  5DIC A;  3DXL A;  2QEV A;  3R1P A;  4PT1 A;  5EL2 A;  3B6X A;  3V2L A;  1T14 A;  1ORG A;  3B88 A;  3D78 A;  2QEH A;  3S0D A;  3D74 A;  3S0A A;  1TWO A;  1OOH A;  4FQT A;  3CYZ A;  1C3Z A;  1GM0 A;  3FE8 A;  3R72 A;  4INW A;  2KPH A;  2WC5 A;  2P71 A;  3R1O A;  1C3Y A;  3L47 A;  1LS8 A;  2WCM A;  2ERB A;  3BFH A;  2H8V A;  3NGV A;  4OZD A;  2WCK A;  3BFB A;  1QWV A;  2WCL A;  3CDN A;  2QEO A;  3N7H A;  4F7F A;  1TUJ A;  3DYE A;  2QEB A;  3B87 A;  4JD9 A;  3Q8I A;  2QDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...