1DEKA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
240
Chain Sequence
b'MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
total genus 86
structure length 240
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1dekA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dekA01
2ODWA 4Q9IA 2G9NA 2FMXA 4LV8B 2WAXA 1JR3A 2C03A 1XJCA 1XTIA 3BFXA 1WP9A 2J3EA 5JECA 1VG9B 4M9SA 1H8HD 2GJKA 2CBZA 5BN4A 4TYYA 2J7PA 1HE8B 2ZS9A 2WZQA 2ZU6A 5EUQB 3GLGE 1E32A 1AKYA 2AK3A 2QORA 2R44A 3VR1A 2ORVA 3LQQA 1WE2A 4NE2A 2Q0HA 3GLIE 4Y0VA 3HP1A 3W5JA 1EESA 521PA 2YWFA 4TYWA 2W83A 5KNBA 4W5JA 4PFSA 5CYPA 3X1YA 4C0AC 3QNUA 2B7CA 4UKDA 2EWVA 4PANA 3B85A 4LC1A 4QXAA 3UATA 2Z4SA 3CLVA 2WWXA 4Q4AB 2JLRA 2PZGA 5JWOA 4DB4A 1T5IA 4PTLA 4B76A 1FZQA 1YR7A 2XNSA 4LDJA 4JLDA 5FPHA 1OXXK 5IF9A 1XD2B 4PAOA 5FR2A 5FTJA 5HPYB 3KQNA 1QF9A 1KSFX 2CCJA 2OFWA 2VF8A 2ZRBA 5EXSA 5DNYB 2VP4A 5EP4A 2HXSA 3CZQA 3D8BA 2RH5A 4N3NA 3D31A 3IHWA 1M7BA 2QQ0A 2V6JA 5SZKB 5H8WA 2QG6A 1SQ5A 1DADA 3SU8A 3UXMA 2QMOA 3SOPA 4DLWA 4RSGA 4CF7A 2PJRA 2X1VA 5KNCA 3SYKA 4NCKA 3OEED 3P20A 2VH5R 2EU8A 4RKFA 4OQLA 4M1MA 2G1KA 3LLUA 4XOIA 4D80A 5JLJA 1R8QA 5A4JA 3AEZA 4KBFA 1D2EA 4TL7A 4B73A 5CB8A 1FQJA 4JZKA 1RPZA 2OG2A 1FW6A 3BS4A 3T15A 3KKQA 2FF7A 1N5JA 2ZE6A 3ZZ0A 4MRSA 2IYRA 3OE7D 2A7QA 4YMSA 2WKQA 2R2AA 5CIWA 2A5DA 1E2MA 1XXHA 4XSHA 821PA 5GJVC 1ZD9A 3I61A 4GSYA 1P5ZB 4NL4H 1KK0A 1FL9A 3LNCA 4V0ME 2B6HA 5BWMA 2XAUA 1TF5A 1Q44A 2HXYA 2DFTA 2W6IA 2O8DB 1XBTA 3DMNA 5L3RA 3ZIAD 2ZM5A 1XTJA 221PA 2DYKA 3B6EA 5FPTA 3GMTA 4UJ3A 4Q9LA 2JLWA 1Z6AA 3SEAA 1AQUA 2HEIA 2J7KA 1CJTC 1WMSA 5FUWA 3AF0A 1W44A 1FPMA 3VKHA 1JB1A 2Q9CA 5C1BA 1WBBA 1Z0FA 3QKRA 4HLCA 1XB2A 4XVRA 2JDIA 1SULA 3E5HA 1AS2A 3FHOA 5CJ2A 1XZPA 4B44A 5LBIA 4TTPA 3AKCA 4PPFA 1NMZA 1KMQA 1Z83A 3QXCA 4Q1BA 2BWJA 2QL6A 1NVVQ 4DRZA 4RJLA 3HU2A 5EE9A 5CM8B 1JR3E 1MO6A 4QBIA 1Z0KA 3T61A 4D6PA 2RAPA 1RVDA 4KODA 2C04A 3K0CA 1E0SA 4GNKA 4RY2A 3KQKA 3BWDD 1ZU4A 4QG7A 4D81A 2IS6A 2A5GA 2CNWD 1KO4A 2F43B 1E98A 4HDCA 1W49A 3F0TA 4OJQA 4M4SA 4G5SA 1GNRA 3QKUA 1FQKA 1ZD8A 1P3JA 1DAMA 4LBVA 4BE7B 1OYYA 4DLZA 3THWB 1FOEB 3BE4A 3C41J 1V43A 1ZJ6A 3M4YA 4NKRA 1ZM4A 1N6OA 4C0QC 1I2MA 1KY3A 4RCYA 2EFDB 4OQXA 2RGXA 4H9GA 3L0OA 3OIVA 5FBVB 5E4FA 2XB4A 1QHSA 5JWHA 3HWSA 3FGNA 4AG6A 1OH8A 1LF0A 1ZRHA 5CM9C 2ZJ5A 3FMIA 3PFIA 1F2UA 1KIMA 1VHTA 4A8JA 4Z1MA 3FYHA 4NYIQ 2QBYA 4AYWA 3FHCB 4X8OA 2VP0A 3L8ZA 4B71A 1T9HA 1VPLA 1P62B 2BBTA 3B5JA 1TQ4A 1KDRA 3TBKA 2IYLD 3GPLA 2ZS7A 4ZI2A 1SXJD 2XJ4A 2ZIAA 1SXJC 2CEAA 1CJKC 1R6BX 2E9SA 3LDAA 4UNPA 4XD7A 4NCHA 5FBRB 4B3DA 1S8FA 3MFYA 2ZU0C 3AVPA 1Q1EA 1PLLA 1NKTA 3EARA 4ARZB 1ODFA 5FH9A 4NMMA 4B3GA 3D7MA 1VG1A 2DY1A 5K8TA 2CJWA 3PCRB 1GDDA 2OCBA 3FTQA 4ZPXA 3VHXA 2Q3HA 5GADl 1KKMA 1XTQA 1RC8A 3QUSA 1XD8A 3BH6A 1NIPA 1ZUNB 2AFIE 3T34A 5EXTA 4UNRA 4DDVA 4KFUA 2QUZA 2FSIA 3ZVNA 2QP9X 2GK7A 2GA8A 4QKQA 4GZLA 1L2TA 1ZCAA 2GAAA 3A1WA 1G6HA 2JJ1D 1XXHE 3BAFA 1GIAA 4IOLA 4LI0A 3AGPA 5SZJA 4D0GA 4R71A 3L0IB 3K09A 5KSPA 1UAAA 3LX8A 2VBCA 2KBEA 4TMKA 4UXJA 5E7MA 1M2OB 2W2VA 5C2JB 2GZAA 3RABA 3MJRA 2IEYA 1T3HA 3T35A 2VHJA 4A82A 5TMPA 1GNQA 5FTLA 5EP2A 5HE9A 4S35A 2O8CA 3EG5A 4C9BA 4CEHA 4PO8A 5KSYA 3WHKA 4Q02A 3QKTA 4JMPA 1E1RA 1YU9A 4D4KA 1L4YA 5DE3A 3SR0A 1E2FA 1R8SA 3REFA 1E79A 2V54A 3Q3JB 4B3FX 4IW3B 2FDCA 5JI3E 3BOSA 4A0RA 3G82C 3AP3A 5JRJA 2ZRFA 2QAGA 3QXJA 2ZRAA 1UM8A 2GZHA 2ZVPX 5KUTA 1GRRA 1SXJB 4JLPA 4LYJA 5EZ6B 1NJFA 1X1RA 1R4AA 1A2KC 1GKIA 3A4NA 1VYUA 3U61B 3AVWA 3B13B 1M7HA 3PVSA 4DC9A 4IHQA 4P4SB 3VX4A 2IXFA 2I4IA 4EPTA 3L8YA 2WWFA 4NYMR 3B2EA 4A2PA 1UPTA 4JLAA 2RGCA 1MV5A 1N6HA 3UWOA 3WNCA 2V55B 4LHZA 1NN5A 3AKYA 4QJ3A 4C0SA 4B3CA 1NBME 3OEEA 4NCJA 3TE6A 1OH5A 3I4LA 1MO5A 3AVVA 4P32A 3NKVA 2ZQ5A 3DHWC 2FOLA 1GUAA 1R5OA 4FWTA 3A4MA 2PX0A 4LHWA 3EW9A 3UMRA 4F7WA 2G77B 4DSOA 4UNNA 4OK6A 2EQBA 4OI4A 4DSUA 3R9WA 3NXSA 2C9OA 2FH5B 1S2MA 2ZYWX 2Q6TA 4UJ5A 1VIYA 2V9PA 2W0SA 3OE7A 3TVDA 5J4KA 1M8PA 2H92A 4NCIA 3B82A 5CK4A 4XSGA 2FFHA 4Z8YA 2NQ2C 3IEVA 1HQCA 3WMFA 4DCUA 2PBRA 2YOHA 2ZI9A 4MH0R 3U2QA 1FX0B 4E03A 1LVGA 2OXRA 5LD2B 2ATVA 2PEYA 2VO1A 3TVTA 3U4QA 1E2QA 3P26A 5G3YA 3ZIAA 2HF9A 1I4TD 4PAQA 4US1R 3TR0A 4RFSA 4X8LA 5JEDA 3DVLA 2IL1A 2FSHA 4TMTA 3EIEA 4DLUA 2IT1A 3U3OA 3G0HA 1P2UA 1OE0A 4D26A 2QRNA 4BZQA 2JLYA 1JPJA 5EE3A 4EFMA 1N3BA 2HV8A 1X8LA 4OJKA 2GKSA 3EA5A 3NC0C 4DSTA 2YC4C 4Q4LA 2BCJQ 3JVUA 1TTTA 3LQRA 1R2QA 2VHUA 5CB6A 3ZJYA 1XEWY 3RRMA 1Z5ZA 2UVQA 2ZEJA 4HZIA 2AR7A 3RSLA 1Z2AA 1KI4A 1G5PA 4L8GA 1SKQA 2WWHA 4MYTA 4PC1A 5J4HA 2J9RA 3WP1B 3AVXA 5L3SB 2YOGA 2FX3A 1A7JA 4YDHB 1DVRA 2IHYA 2HT6A 4XJXA 3RC3A 2BDTA 1E1QD 3FDIA 3ND8A 4B6EA 2F1JA 4PX9A 2ZS8A 4URXR 2O8EB 3R7WB 4PQRA 1KZ7B 4O0MA 2GEVA 2C8VA 1Q3TA 1VCNA 1Y63A 3RHFA 4PHGA 1D8TA 3L0PA 3R20A 1YKSA 1OPXA 2YKGA 1S1CA 3UWKA 2JIZA 1XPUA 2EFCB 1KI6A 2A78A 1ZM9A 5CK5A 4LWZA 5DISB 1W2HA 2C98A 3W3ZB 4F91B 3RS0A 1YRBA 5JFGA 3KQUA 3IIJA 3FMOB 2JCSA 4RD0A 2RCNA 1B23P 1Z0DA 1RFLA 2OZEA 3QY0A 4NYJQ 2CVHA 3NEJA 1NSFA 1XX6A 2IYVA 2R65A 1CS4C 4P4TA 3RYTC 3AM1A 2FE4A 4V0OA 5AJVB 3GLHA 2GRJA 2ORIA 3EWSA 2DR3A 2FGJA 4HAXA 2O0KA 1KI3A 1VECA 1DAKA 1NN0A 1JAIA 3BK7A 4MYCA 1C4OA 1LS6A 4V0KA 3I5XA 1JEDA 4KVGA 4AD8A 1IXZA 4LX0A 4O3MA 1GNPA 2WWYA 1H65A 1X8JA 2GK6A 2C2HA 4JJKA 5HZKA 3CIOA 4HUTA 1E96A 2Z0MA 2QP3A 3AF2A 3MWYW 3QXSA 1U0LA 1XD9A 2H8KA 4O25A 2UKDA 3T1QA 2AL7A 2R6CA 4US0R 2G0NA 2ZITA 3P1JA 1KNQA 3A8TA 2PX3A 2X19A 3MLEA 1GWNA 3K0AB 2RGAA 1ZINA 2EYUA 4II7A 1UF9A 1GITA 2SHKA 3GJXC 4DBLC 3CNNA 4B2LA 2GCPA 1JEEA 1W48A 3IIKA 4ACAA 2ZRHA 1E2HA 3CO5A 1GILA 1L8QA 5FTNA 4LOAA 4U7DA 1FX0A 4PQFA 3NIBA 4V02A 5G41A 4PC2A 2J0UA 4YLGA 3BGWA 4B2PA 3IQWA 1XCMA 3CONA 4C7OB 3PUZA 1CR4A 4ABYA 3LVRE 3NVAA 2GEUA 2ZE5A 3VU9A 5GJBA 1XEFA 4TMWA 4LBZA 4DCTA 2J0SA 2BV3A 3OEHA 4PHFA 4QHSA 4B74A 2QTHA 3GEEA 3VR2A 2KJQA 1M74A 1W0JD 1DO0A 2CLSA 2PEZA 3LWNA 4IVPA 4Q1DA 1OSNA 4XTCS 3FKSD 2ZROA 2ANCA 5GVRA 4QGFA 1E2IA 4FN5A 3DL0A 2YNMA 2EFHB 1EFRD 4RFVA 1BH2A 4CDGA 2W2TA 2QPTA 4X8MA 4LCBA 3NWJA 2GWHA 4DLRA 1LF5A 5LPNA 1G8YA 2ZUBA 2YVUA 2R9VA 4TYQA 1GL9B 3CBQA 3CRQA 1VIAA 1W1WA 2ZJOA 2OILA 3KXKA 4QRHA 5FOWA 4DZZA 1S4QA 2ZSEA 4S2EA 5CITA 3EZ6A 2G6BA 5M04A 1Z6GA 2ODNA 4M53A 1VCMA 1Z6TA 2BC9A 3R9XA 4JBYA 3FHTA 4BLSA 2XZPA 3K70C 4DT1B 4OKSA 5AWFC 3ZS9A 4A6PA 4JVNA 1NMYA 4N0EA 2LKDA 3QG1A 1FUUA 1BYUA 2V8OA 3CWZA 3QXHA 2WPDD 4M1YA 1OH7A 2Z6VA 1W46A 3B8HA 2OFXA 3I1FA 4Q4JB 4XVUA 4V0NA 1U81A 3GLGA 4C30A 4D0NA 1HY3A 1SXJE 1DAFA 1KOFA 4QBGB 2AXNA 4R2HA 5EUMA 1KSJA 4B43A 1XTRA 3CW2A 5EE0A 3KJIA 2X8AA 421PA 2V1UA 1P9RA 1LFDB 3GLHE 1OIXA 1ZCBA 3GJ8A 4LYFA 1BO6A 1OYWA 4G5GA 1RYFA 3QQ5A 4Q03A 4XIGS 3ZLJA 3MGCA 1KMHB 3ADBA 1UBGA 2VSFA 4IFBA 2QY9A 2WJGA 3IO3A 4KHZA 3I73A 2NPFA 1U8ZA 4YMUA 1TEXA 1GRNA 4A6XA 1SHKA 1Z06A 4M1SA 4EQ6A 5DYIA 3T1VA 2ZE7A 3M0EA 4EPYA 2C78A 4P31A 2AKYA 1HURA 3U60B 1CRPA 3PEVA 2WJYA 2IC5A 2J1LA 4L5BA 4HAVA 1C9KA 3Q7QA 4AK9A 2PZEA 4G1UC 1CF4A 1XNJA 1ZNYA 1G3UA 2HJGA 1T91A 4IOMA 3U3KA 3VKWA 2IHBA 1D9ZA 1W4AA 1ZAKA 2CDNA 3PV0A 4FMDB 4I81A 4WBSA 1E6CA 2GEDA 4FINA 1S9DA 2HUPA 3QVUA 2XITA 4WA7A 4URYR 3K1JA 3ZVMA 2WICA 2FNAA 4PPQA 3KX2A 5DN6A 4BFZA 2IUTA 2IS2A 4IOKA 1K8RA 4P0TA 1E2LA 4WOPA 5EXPA 4IEIA 2XB2A 4QHYA 1KGDA 3CF6R 1IN8A 1XJQA 1X86B 1E9EA 6Q21A 2ZREA 5CLLA 3OIYA 3N2EA 1PVOA 1E1QA 3AP2A 2WHXA 2RHDA 1XU4A 2R6FA 2QA5A 1K5DA 2ZRIA 1AS3A 4TMZA 4K81B 5B64A 1TF7A 4JL6A 1SHZA 1P75A 4FMBB 2QPOA 4HAYA 4TWZA 1KO8A 1G8FA 2IS1A 1TU3A 2V7QA 3IUYA 4KO8A 4Q1CA 1EGAA 2I1VB 1LY1A 1X1SA 3L43A 4EJSC 2DCUA 4Q21A 3K9LA 5JEEA 3KDSE 1LTQA 5D3MB 3ZVLA 2W58A 1E99A 5KO2A 3MD0A 2ZI6A 2ZPTX 4MKFA 5HCNA 4FI3C 3K9HA 2OESA 1QHHB 1RRFA 4MQBA 1OIVA 1ZC3A 1KZGB 2BEKA 4BLQA 3VR4A 2J41A 5H68A 4HDOB 5P21A 3A1TA 4CEJA 3RRYA 3SI7A 1XMVA 3L82B 3OESA 4WZAE 2VP9A 2QP4A 4ZV4A 1SVWA 3B1XA 2IXGA 4TTRA 3ZZTA 5JJKA 1M6NA 4WXRA 2FFBA 3C5CA 2P65A 3HJNA 3V9PA 4OL0A 3QVVA 3W9YA 2RGEA 2WSMA 3LLMA 4UXHA 5FI1B 1F3OA 4HLDA 4HB4A 4DLTA 2JJ8A 1J99A 3ZQ6A 2IYSA 1I2DA 4R7ZA 5AJYA 1JR6A 3MAAC 4RVCA 2X2EA 4LJAA 3WBJA 2WJHA 1WB9A 2BBOA 5C18A 1GKUB 1US8B 4URZR 3SJAA 4Q1AA 2ZRKA 2BMDA 4B48A 5L3QA 2ANBA 4DCNA 3Q8XB 5G53C 1UEJA 1AK2A 1QVAA 3LXRA 2OUKA 4YXWD 3KKMA 3KUCA 5DIFA 2FEMA 2GETA 4JL5A 1FTNA 4TSFA 1IHUA 3QIAA 4PZYA 5IRCD 3RC8A 5GVSA 2NZ8A 3GFPA 3SN6A 4ZCIA 1FTSA 4YQFA 2W6JD 1MRSA 1W4BA 4PZZA 3WNBA 4QHTA 4EJSB 5D3QA 3AVTA 1XEXA 3BJIC 3V4RA 1IY2A 4TL6A 2GCOA 1R5BA 2G83A 2DWPA 4M1OA 3THXB 3NBXX 2IX3A 4JL8A 2D7DA 1J8YF 4JBWA 3QF7A 4ZO4A 1W0JA 3ADKA 4OHYA 1GRQA 1WQ1R 1YR9A 1GAJA 2QROA 4MKHA 4OI2A 1S9HA 4NTZA 3C4JA 1TUEA 4LC0A 1MR3F 4HI0E 1OH6A 5IHPA 2ZJBA 1ETUA 1EFRA 1G4AE 3OIWA 3U3MA 3P27A 2A3RA 4AWXA 4B3BA 1AS0A 3OFNA 3EPKA 4FMCF 4TL8A 1R7RA 1F2TB 1Z08A 3CR7A 4HZUA 2VF7A 4GDFA 1MO3A 4A15A 3CWQA 4Z8XA 3U44B 2FPMA 1NI3A 1KTVA 5GJCA 1KDOA 1E2KA 1TQ2A 4JT4A 5IDVA 4Q7MB 3CKLA 4LJ8A 1XTKA 1U0HC 3BFVA 5EP3A 3B1WA 5FOUA 4LUCA 3SC3A 1P73A 3VKGA 3IDQA 2BBSA 3C7KA 3FE2A 2X2FA 3LV8A 1GVNB 2XTZA 4GL2A 1ZD1A 1T5LA 3TQFA 2FWRA 2RGNA 2WPDA 2YOFA 3D3QA 3LW7A 2OSBA 4PHHA 4DIDA 3KZ1E 3PUVA 3IIMA 4NONA 4OBEA 3RDPA 3PG5A 3PJRA 4LRWA 1ZNXA 1PLJA 1U9IC 3SNHA 3C8UA 2Z83A 4Q01A 4UNQA 3ND9A 4QL3A 1OW3B 2A30A 3ZD6A 2BMEA 5KDDA 4DLVA 2ATXA 3QKSB 2PZFA 2ZAOA 1JALA 2HYDA 1P6XA 5J4VA 1I4DD 2IA5A 4TZ6A 2I3BA 5SZHB 1D6JA 3A37A 4M0LA 2QENA 4CT5A 1KI2A 1C1YA 1NL3A 2H16A 4MGZR 3WMEA 2FFQA 5JCPA 1QHHA 3CX6A 121PA 3S1AA 4EAQA 4YC7A 2ZRJA 2F55A 2AWNA 3EAQA 1KSGA 5JSZB 4ZDIA 3ZD7A 4Z51A 1N5IA 2QAJA 4I4LA 3I3SR 2CL6X 4BLRA 4GOKA 1E4VA 3BH7A 5EE5B 3W8NA 1JJ7A 4JVMA 1SKYE 1OXTA 2AFHE 2CL7X 2FZ4A 4LGMA 1NBMA 3T1TA 4JLVA 1N5KA 2BCGY 1T3LA 3WRXC 1J90A 3BORA 1WDTA 1L4UA 1N6RA 4KFSA 2GBLC 3EZFA 3SZRA 2WSSD 2GJ9A 3GLFB 1OKKD 2MMGA 4PC3A 4PPGA 1N6IA 3IO5A 4TLAA 5KOYA 4J0QA 4NYMQ 1T8TA 1US8A 4AIIA 4AI6A 2K5UA 4HAZA 2PMKA 1VTKA 1JQJC 1WCV1 2XOKD 3GFOA 3IHLA 4LYHA 4Q4AA 4RZUA 2BKUA 4RZXA 2XNDD 4KSBA 1RJ9B 5EP1A 1WF3A 1XD2A 4WXPA 5A0FA 4F38A 4E09A 3QG5A 1O3YA 1EX6A 3CPHA 4NH0A 4GI7A 5HE8A 4XVQA 3J81k 3FOZA 1II8B 4PPNA 3UMFA 1Q0UA 1SVLA 3RLFA 4N1AA 4JS0A 2HCBA 2O5VA 4YDSA 5G40A 2REXB 4EJSA 4JJZA 1PJRA 1ZIOA 1E2JA 2VIIA 1NVXQ 5EXXA 1XMIA 4BQSA 3PEWA 1S96A 3UIEA 4W9MC 1EWQA 4QGHA 2X77A 4Q7JB 1IJEA 2OM2A 2KBFA 1JAHA 4ZCMA 5DI3B 1YHNA 3VR6A 4DVGA 3B9PA 2P5TB 3KKNA 5TY0A 4PR0A 3W5IA 2QE7D 3MWKA 5EJEA 2ZI3A 3IEUA 4TQAA 1MO4A 3VMFA 3ETLA 1NIJA 1GP2A 5L8VA 1Q3HA 1CTQA 1H8HA 4E22A 1XWIA 5J5CA 5LD2C 2O8DA 3AB3A 3U7FB 3H0KA 5JWRA 2B92A 5AK0A 3K0FB 2AWOA 2GILA 3EZ9A 1RW4A 3F8TA 4MKIA 3KQLA 2CK3D 3UKDA 1S3SA 5J47A 3D6TB 4CEIB 5KNDA 1NVUQ 3EXAA 2JATA 2OT3B 2J87A 3M6AA 4JYCA 2IUUA 5B30A 3Q72A 1TL7C 1YE8A 3PQCA 1HQYE 2VL7A 4TZ0A 2GJSA 3E70C 3HR8A 3WYGA 4BFSA 1V5WA 2KE5A 4K46A 1N0WA 5TB5A 1QVRA 3UPUA 1DE0A 4F4IA 1G5TA 2YC2C 3QKSA 1GOTA 1QHNA 2KWIA 4US2R 2DWQA 2Q3FA 4I1OA 1JECA 1P72A 1XMSA 2ZJ8A 3VR5A 2DBYA 2D06A 5EQTA 4LV5B 1HE1C 1AZTA 3K8YA 2F43A 1ELOA 1R0XA 3VNUA 4TN1A 1GZSA 3QEOA 4LHYA 2QMHA 3THWA 3TQCA 5JSZA 3TAHA 4PSVA 2QM8A 5FTMA 2IBMA 2ODEA 1FFHA 5HTKA 3TIFA 4Q47A 3EASA 3RS7A 1TADA 2A5YB 1G64A 1VCOA 4JT2A 2P6UA 4R98A 1HEIA 4ZIRB 4PZLA 4BRUA 1GL6A 2YJTD 2H18A 2OCAA 1TUIA 1ZC4A 1G7SA 1JPNA 2D4HA 2ORWA 3H84A 2OE2A 4A4DA 3KFXA 3I5YA 4ILEA 3GLFA 2GCNA 2IUSA 4Q4HB 3WYFA 2BMJA 3V00A 5KYKA 1YZQA 3BBPA 3TNFA 4QBHA 1ZP6A 4PSAA 3AVQA 5BW8A 2NGRA 5KTYA 3Q9LA 1CXZA 1XPOA 2JLSA 2GJ8A 3SDZA 4U5XA 4HAWA 4PXAA 2B7BA 5ANRB 1RJ9A 3WNDA 5B57C 1SZPA 3T5DA 4TT3D 2DB3A 3LVQE 3BB3A 4DSNA 4Q7LA 2WM9B 4BEJA 4ARZA 4O2RA 1LS1A 3WYAA 2FJUA 3GJ5A 1P60A 4JLKA 1CR2A 4O2LA 3RSOA 1EG7A 1II8A 3NBFA 3FMFA 4A2WA 1HTWA 2O8BB 1HT2E 1U9IA 3ASZA 4CVNA 1X8KA 1R10A 1U2RA 5DO9A 2FPKA 4NPHA 4OI0A 2FFAA 4MRNA 1ONBA 4JLNA 1E9FA 2JLUA 3LAWA 4TYNA 1E2GA 2OBLA 4D4LA 3THYB 1OT3A 1BKDR 1Z47A 2AHOA 2NO0A 2FGKA 3EZ7A 4L16A 5FFMA 4BLTA 1D9XA 3A1UA 2JJ2D 4OQFA 1RKBA 1DPFA 2CNWA 2YINC 5FI0B 1A1VA 1EFUA 1TAGA 1EWRA 2G3YA 3KKPA 1N2CE 1AGRA 2BEJA 2D7CA 3F5FA 3OAAD 2GXSA 1OFTA 2E87A 2I1QA 3W6OA 1FP7A 2VLIA 4BFWA 2GDJA 5BXQC 2ZANA 4ERNA 5KSOA 4RD6A 3BERA 1B0UA 1YZUA 4HUQB 4Q5IA 5BYJA 2A5JA 2ONJA 3U6KA 1WRBA 1DELA 1LNZA 4LHVA 1NNEA 1N25A 1XJ0A 4G3XA 3EIHA 4I1SA 4URVR 3UG7A 4MRPA 2P67A 4MYHA 1COWD 1CJUC 2ZRNA 5DHAA 2PLFA 3K0FA 4TQUS 2QSYA 2GBLA 1U8YA 3QXXA 2QTFA 2XXAB 1VCIA 3QF4B 2ERXA 2UZIR 2PJZA 1G7RA 5FUXA 4MDEA 5FOSA 1DG3A 4V0LA 4UNSA 1KJYA 2FSGA 3NBYC 2L0XA 2G0TA 1SXJA 4PQYA 3U5ZB 2O8FB 1GL7A 4D82A 2ODBA 2XNDA 3MMPA 1JBKA 3I72A 2XJ9A 1TNDA 4EFNA 4A1FA 1AGPA 1Q21A 5LB2A 4AKEA 4E07A 4P4SA 3R8FA 2N1BA 4CRWB 1Z8FA 1Q1QA 4WW0A 1UFQA 4Q18A 1Z0AA 3GLIB 4C0LA 5FTKA 3SBDA 1R0WA 4KVAA 2H1LA 4KFTA 4QFMA 5KU1A 1P2TA 4B47A 1YR8A 1W5SA 1E69A 1ZW6A 3HYRA 721PA 5TXGA 3WY9A 2RGDA 1Z2CA 4RCZA 3LX5A 1OHHD 1MKYA 2WMOB 1DEKA 4L9SA 4M22A 1MABB 4N0DA 3TH5A 4NP6A 4TLCA 4C3ZA 4TMXA 1RYHA 1UJ2A 2JJ1A 3PR1A 3B1VA 4IDOA 3LBHA 1NKSA 4FCVA 3GLFE 1Z63A 2KI5A 1HYQA 2VQSA 3QI2A 1II9A 4QGGA 2ZR9A 3W90A 2QE7A 2OHFA 4BFXA 2YWHA 2WV9A 4DCVA 2J7PD 4DB2A 4HEJA 2W00A 4NCNA 1G8HA 2YWEA 1E9DA 1F6BA 1G3IA 3ZVRA 4EPRA 1G7TA 1SVOA 2QNRA 2EYQA 2ZSFA 3H1TA 1GM5A 3UK6A 4HLQB 4UXIA 4PHTA 2IK8A 2Z4RA 1KK1A 2GF9A 3QJYA 3NH6A 4LK2A 3IQXA 3KXLA 3GJ7A 4B2IA 5TVKA 1W0KD 4MGKR 1TX4B 5HCIA 2XEXA 3I8XA 1TMKA 3LD9A 4LJYA 1UBFA 3VAAA 3P32A 2WTUA 2GAOA 1OFUX 2D3WA 4L9WA 2CXXA 4Y0AA 4F4CA 2XGJA 3CH5A 2F9MA 3L0SA 3T1OA 1UKEA 2PT5A 3EX7C 4TYPA 1MT0A 2OCPA 2F9LA 5DYGA 4GOJA 1D5CA 4IDQA 3CUEF 5LB4A 3VR3A 1NY5A 4DKXA 5CDFE 2GZDA 4JLOA 3BH0A 1OB5A 4CGZA 1E0AA 2GVDC 4XWKA 5E7IA 2HYIC 4RKEA 1Q1BA 2GXUA 1T6NA 5L3SA 4HLUC 5BN5A 3BB1A 4QM7A 1ZUIA 4NZYA 5JZVA 1E3MA 1IM2A 2WVJA 3TAUA 3UMSA 1G5RA 1D2NA 1II0A 2P0EA 4HUQA 3A6PC 2FZLA 1JJVA 2IYXA 3MG9A 1Z28A 3GCGA 3QENA 4LJ9A 1KKLA 1XMJA 2QGNA 2O8EA 4DEXA 1E2NA 3R7WA 1BMFD 1FMJA 2AD1A 2ONKA 3CB4A 4MGIR 3NG1A 4M9XA 4NYJR 3ICEA 1AQYA 2WKRA 1DAEA 1G19A 1G8GA 2GVZC 1JQLB 3FMPB 1S3GA 4XH9B 4ZKEA 2D2EA 3QBTA 2JGNA 1CKEA 5TDHA 3KL4A 3B9QA 4OI1A 1F48A 2H7VA 4LJ5A 4DJTA 5DH9A 1NRJB 4MRVA 3DDCA 3JVVA 1KHTA 2OLJA 3GP8A 1UDXA 4KFRA 1T4GA 1KO7A 3T5GA 5HR5A 4JVSB 3X1XA 3PIRA 1J2JA 2GXAA 2O8FA 3SJBA 4TLDA 1PLKA 3T06B 4JSTA 2QMUA 2BM1A 2JDID 3DKPA 3KTAB 2ZXUA 3AKDA 3EC1A 5TV2A 2BJWA 2OLKA 3QOFA 3BC1A 1K5GA 1XZQA 3ADCA 3TSOA 4BLOA 3U7GA 1ZBDA 1Z6XA 1Z0IA 3NH9A 3TUIC 1M34E 4RD4A 4PAMA 2H17A 3N70A 2IW3A 3NHBA 4D0LB 1M1YE 1A2BA 2KB0A 3KJEA 3LXXA 2JJ2A 5J40A 1RIFA 1G6OA 4M21A 4BFTA 5JBQA 3RWOA 1Q20A 4TLEA 4U00A 1XDBA 4DDUA 1G41A 3HYTA 4D2IA 4B3XA 2IEZA 1VKJA 3DZ8A 1N0VC 2P6NA 4CZ2A 2ZR0A 3K0AA 3WMGA 4POAA 1IONA 2G1JA 4QGAA 4B34A 5DI9A 1UKZA 2FG5A 2VHCA 2MMCA 2ZRPA 2OXCA 5FBQB 1IXSB 2IYQA 2ZSAA 1QDEA 1I4LD 1UDWA 2HF8A 3QSYA 4C0KA 1PZNA 3WXMA 1XXHB 5F3WB 1OXSC 2DFKB 2VHTA 2WIAA 2V6IA 1AKEA 4CYMA 1GKYA 2CHGA 3FFAA 2ZJZA 4C7OA 2ZRLA 5JS7A 1W2GA 2ZYUX 4QBFA 3LH5A 2PCLA 1DARA 2OBNA 1CR0A 4HB0A 4YONB 3X1ZA 2Q3MA 1RRPA 2NO1A 4NHOA 1QHGA 1G3MA 2AN9A 4EPXA 1Z0JA 4WVFA 5B58C 4HB3A 2QRZA 3MJHA 4BZXA 2AD5A 2MSEB 3BIFA 4KSCA 3KKOA 2WJVA 3AF4A 3QKRB 2OBMA 4M9ZA 4OQMA 2QPAA 5FOTA 1KO1A 2MSCB 4RZ2A 1OF1A 4A0HA 4G01B 4ESVA 2Z43A 3UANA 2ZJYA 3ADDA 4URUR 2VP5A 2FEOA 2HLDD 4LV6A 2D2FA 2VP6A 1KDPA 1NY6A 5J4YA 3I8SA 3TSWA 1NF3A 3E1SA 3W6PA 3RRZA 4M8NE 2HT1A 3DOFA 4A2QA 1YZNA 1H8ED 1JNYA 2BKEA 2ZRDA 1YZTA 2ZETA 3OF5A 2J0QA 2DFLA 5IK2D 2FPLA 4DT1A 2O0JA 5AJXA 621PA 3LA6A 2CE7A 1U0JA 3CNLA 5FPKA 4JKYA 2YHSA 3MWLA 4MDFA 5A5GA 4K8OA 3AF1A 3ZS8A 3HPRA 4Q4JA 2J45A 1QBKC 5AJWA 2VYFA 2CCGA 4DCSA 2VRWA 3KQHA 1P61B 4Q48A 5AR1A 1S0UA 3K0EA 1E1RD 3TR5A 1N6KA 4FD2A 2PH1A 1IY0A 4LBWA 2V1XA 1E79D 2MSDB 3KB2A 1F2UB 1CRQA 4A8JB 1IJFA 2QBYB 1KMHA 2NG1A 4PC7A 3DOEA 4L15A 4IXNA 1CLUA 1W0KA 3KJGA 3EPLA 4AYXA 2QAGC 1G17A 2NTYC 3NHAA 3PUWA 4OK3A 2REBA 3KTAA 1QHXA 1Z07A 2QEQA 3W34A 3AVYA 3CRRA 1ZIPA 4TLBA 2RHMA 4H1VA 3O8RA 1J8MF 3CPEA 3L2OB 4G5RA 2BVNA 4G0NA 4A0FA 3KXIA 3FKSA 4EPVA 1E9RA 1L7VC 1TPZA 3DKVA 2CJWB 4FXPA 3X1WA 3RAPR 2WOOA 1VHLA 5EZ5A 4KV9A 1Z22A 1VYVA 1DAIA 3SJCA 1PUIA 3X2SA 4NBSA 1TU4A 2BJVA 3PEUA 4U02A 1E2DA 3AF3A 1BYIA 1M7GA 3ZQJA 2WWWA 2ZUCA 1UADA 5H70A 2FU5C 1SGWA 1R5NA 3Q5EA 4HSEA 4CW7A 2ERYA 2XTNA 5DGXA 4HLUA 2J59A 3CRMA 3F3YA 3ZDQA 1T0JB 5KHOC 4KYIB 2WKPA 1FP6A 4DLXA 1PV4A 3ZZUA 4JLMA 3Q85A 4KCGA 1XPRA 1WXQA 1NN3A 1XFAA 1KO5A 3AVUA 1E94E 3WBKA 5F2EA 3EC2A 3DM9B 1BMFA 2W0MA 4Q66C 2O8CB 2XZLA 4JSYA 1EFTA 3ICQB 1BOFA 1IN4A 1U8AA 2GHIA 2GF0A 1HV8A 2P2LA 5CJPA 4IDHA 3TJZA 2IF2A 1ZVQA 2IWHA 4CEHB 1D2MA 1P2SA 1E9CA 2RGGA 2UZ3A 2C9CA 2HCJB 4ASUD 5BYKA 4F93B 1AIPA 3EA0A 3H2YA 2HJVA 4QNMA 1KI8A 1YZGA 5JI2E 1XEWX 3U7EB 4YMWA 5D3MA 1ANKA 2OV2A 3IBGA 4BFVA 2EFEB 5B2ZA 1E0KA 1KK3A 2OAQ1 3AH8A 3TLXA 5G3ZA 4IDNA 2QAGB 1YVDA 3RRNA 1BIFA 1ZNWA 5TARA 3KB1A 3OZXA 3CNOA 1Y3AA 2IXEA 1G3QA 2C5LA 4WZBE 3DMDA 3TW8B 2ZI5A 3LRPA 1A5TA 3C15C 3B7GA 2J46A 2JLQA 4E5UA 5H1YA 4DWJA 3ONWA 3DM5A 2JLXA 1IXRC 4DEYA 1VMAA 2QTVB 2QM7A 4G5QA 3CPJB 2CE2X 3BB4A 5JHHB 3GEHA 4IKEA 4WIAA 1P9NA 3CF2A 2AKAB 4XTRA 1OFHA 5JCZA 2Q21A 1XP8A 1KK2A 3EPHA 1YQTA 2C95A 4RD3A 5AJZA 2F1HA 3LBIA 2BHRA 3GJ4A 4OHXA 1E9AA 2EFGA 1KI1A 4W5WA 3R9IA 3VFDA 3LY5A 3THOA 1W5TA 4IFEA 2XSZD 4BGDA 4C4PA 1QZXA 3Q5DA 4KJZA 2H5EA 5IT5A 2W2XA 4QM6A 1KI7A 2PMDA 2OAP1 4PC6A 4LZZA 4C0BA 2P6RA 4LSGA 3CZPA 4M1WA 2F1IA 3EPJA 1W36D 1W36C 4AY2A 4PO9A 4GBMA 2IWRA 4BECA 2IYZA 2NZJA 4JIMA 1N6LA 1KJWA 3AV0B 1NVWQ 2RMKA 3AKEA 2JIZD 2R6GA 1W47A 2ECKA 2HDNB 4EDHA 2QT0A 4IRUB 1SVMA 4HATA 1VDZA 2B8TA 4Z54A 1BS1A 1KY2A 1XTSA 3U4QB 4MUAA 2AX4A 3THXA 4P3YA 4ZDJA 4RFSB 3GJ6A 5FL3A 1AN0A 4ACBA 4YMVA 1OJLA 3CRW1 4DUGD 4DIEA 4I1VA 1KNXA 1G1MA 1KYIA 1ZYUA 3EZ2A 1U90A 3NDBB 1Q22A 4M2LA 5FL7D 4D4MA 4MUBA 2VSOA 1K6MA 3ASYA 3TW4A 2ZUDA 1E9BA 2LKCA 2C99A 4QJ5A 5JJIA 2QGZA 1LB1B 3X1DA 1UEIA 1F2TA 4JYBA 2HLDA 5JMTA 1P9WA 2JASA 2GXQA 3I92A 3U44A 4ZCLA 1QHYA 1UBCA 1TQDA 4KAXA 3A1SA 4MKGA 3QPVA 1H8EA 4TL9A 3VNVA 3AUXA 1AA9A 1NJGA 2EVWX 1KSHA 3CH4B 2F1RA 5IK2A 5BQ5A 2NPIA 1AJEA 3O8DA 3RNLA 1AZSC 1NVVR 3BFKA 3W3AA 3IGFA 3SHWA 3K53A 4ZKDA 1IOZA 4Q19A 3SQXA 3V4FA 2FN4A 4RD2A 1HA3A 3RS5A 3K9GA 3W8RA 4F4JA 1DTSA 2DWOA 4FWIB 3HU1A 3MRSA 5SZIA 1KDTA 3SJZA 2ZJAA 2OO7A 1Q1ZA 1ZNZA 4DLSA 2R6DA 4YXWA 1W36B 4EIWA 1NP6A 2TMKA 4LBYA 3TMKA 1NLZA 1N0UA 4JBXA 5EE1A 1GFIA 4A9AA 5DHFA 2LCFA 5KDOA 1EFHA 3ZGXA 1KI6B 3G5UA 3OEHD 2W6JA 3U6BA 2LWIA 2IS4A 3N2IA 4QNRA 2A2ZA 1IY1A 1SVSA 4CIDA 2EWWA 3UG6A 2Z5FA 1CU1A 4FMDF 1HT1E 4B35A 1G3RA 4OHWA 1YJ5A 1IBRA 2R8RA 2NO9A 1HUQA 2YZ2A 4GP7A 4OYHA 5DLQC 4AC9A 4MGYR 5AUQA 4D25A 1FNNA 2ZE8A 2OCYC 1Z3IX 3GLHB 1MRNA 1G21E 1EK0A 2QU8A 4IVRA 3HU3A 1XCGB 4LHXA 3OHMA 1W4CA 4X8HA 3M1IA 2D74A 1XF9A 1ESMA 3PITA 4EKDA 1UBEA 2CVFA 2WJIA 1Q12A 4IOJA 2V3CC 4M9QA 4BLPA 2ZTSA 3A58B 3CF0A 1TEVA 1KAOA 4GMDA 3DZDA 5KPDA 3RS4A 4I1UA 2RB4A 2YV5A 4XWOA 4BFUA 4KU4A 1J70A 4ZI3A 1E2PA 1SVKA 3DO6A 3RANA 3SHFA 4AG5A 5C4MA 1SVIA 2PLRA 4C2TA 1A4RA 3PUYA 2H57A 4IDPA 4D4JA 5KSZA 1TQ6A 4GZMA 1GTVA 2ZR7A 4LJ6A 3TRFA 4NYIR 4UQOA 1CR1A 4Q1EA 3AP1A 3TUJC 4BZPA 2AXPA 4ESHA 4URWR 2KSQA 5E95A 1OXVA 1P7CA 2WBLC 5F9HA 4CT4B 2DFNA 3SFVA 5L3VA 1DG1G 4YMTA 5F98A 2J0UB 4ASUA 5HKKD 5FBLB 3GD7A 2NIPA 3TGPA 1AM4D 3VU9B 4C0JA 3EWAA 3PUXA 4MITA 4ZDKA 2B8WA 2CHVA 2WAYA 5FUYA 2N42A 3P4YA 4ON9A 5DI3A 1NLYA 4XWAA 3CRVA 5AUPB 1S1MA 1NSTA 4NU0A 4KBGA 4Q1FA 1CEEA 1F60A 1G18A 1G9XA 1LW7A 1QHIA 3H4MA 4TTQA 5CDFA 3SFZA 3LW8A 3FFBA 3IPYA 2WOJA 4L4UA 4HB2A 2G88A 3HPQA 5E3HA 2RGBA 3FPAA 4RD1A 1OLOA 3LO5A 1KAGA 3QPWA 3LBNA 1OIWA 5FOVA 3B1YA 1CJMA 5JS8A 3REGA 2PCJA 1IN7A 2DHRA 3Q7PA 3MSXA 1Z6YA 2NO6A 2XTMA 3C16C 5DN6D 5J4LA 5F9FA 1E9SA 2VPPA 3O47A 2IYTA 2ZYVX 1CJVC 2WSSA 3VTKA 4DDWA 4C2UA 3TKLA 2BIFA 4QOSA 1OKKA 5GJWC 4CEIA 1IQPA 2XSZA 3PENA 5UKDA 2REOA 1DOAA 4FMCB 4BEBA 2CLDX 5FPYA 3FVQA 2ZSDA 2XOKA 3BD9A 2VEDA 3A1VA 1IAQA 1PUJA 2NOAA 5CLQA 3GLGB 4OK5A 1X3SA 5LDDC 1F5NA 1RZ3A 2WIBA 3NBZC 4OHVA 3U3RA 2O52A 2V7QD 2V4ZA 3GEIA 2GNOA 3AVOA 1G8PA 3A4LA 5JHGB 3B78A 4Q9HA 4G5OA 1N6NA 4RZ3A 4Q00A 4BASA 2XX3A 3I62A 3KUDA 3WHLA 1RRCA 1Q57A 2C9YA 2WWGA 3CM0A 4HAUA 2QSZA 1G16A 3MCAA 4DUGA 3VQTA 5FUVA 4EQ6B 2R6AA 3QEJA 1UKVY 3W6NA 1JR3D 4JLBA 4Q9KA 2EW1A 2OEPA 4GMXA 2J0VA 2NMVA 2YWGA 2F7SA 2NO7A 5FL7A 4ZIRA 2ZJ2A 2JAQA 3FB4A 4QJ4A 1ZM2A 3KJHA 3VHLB 4AKIA 3SYLA 1ZM3A 1P2VA 2A9KA 3TUZC 4R2IA 3K0SA 1MH1A 2IYUA 4BFYA 1JI0A 4GT1A 4B33A 1G4UR 3A36A 3B60A 3HR7A 4FIDA 4Q4HA 1NLFA 5KPJA 2QMEA 3AQ4A 4DXAA 2ZRGA 5HZHA 1T0HB 2CHQA 3WRYC 1N5LA 3OIUA 3IKJA 3GJ3A 1NN1A 2DPXA 2CK3A 4FCWA 3PXGA 5DSZA 3TSZA 2XZOA 1G291 2F3RA 1DAGA 5K8IA 5K8UA 1MOZA 2E1RA 1LV7A 5E7JA 1NG1A 2PT7A 2CLCX 4C0HA 1OXUA 2FSFA 4R9UC 4DDTA 1XCPA 2O8BA 3VX3A 1GG2A 2BOVA 1FMLA 8OHMA 5ELXA 1NMXA 3C14C 2FA9A 4GOXA 4TSFD 3ZH9B 4GFDA 4MYUA 4KLZA 3NEYA 4QC2A 4DHEA 1G7CA 4GRAA 2IYYA 2Q9BA 3HDTA 4I99A 4EPWA 3AGQA 3THYA 3O8BA 2GJAA 3GQBA 2BM0A 2C77A 3K9NA 3DPUA 1U99A 1W4RA 1ZU5A 2JLZA 1CP2A 4MRRA 1VG0B 1J7KA 2WJJA 3CX7A 4WZ6A 2F6RA 2ZRCA 1YR6A 4H1UA 1IN5A 4BPBA 3IILA 3JZAA 3BXZA 1FUKA 1N6PA 4IVQA 3RVBA 3SBEA 2Q9AA 3P4XA 1E4YA 2VP2A 5K8LA 1ZM7A 1YZKA 2FV8A 5JJLA 4CEJB 3OFND 4W5HA 1RE0A 4ITRC 2GTPA 2ZSBA 3FKQA 3I32A 3RS3A 3RS2A 3H86A 3DEFA 2QQEA 2VTKA 4OQNA 4ZDWA 4P4UA 4AURA 1NG9A 1JXMA 4HDQB 1HH4A 2W6ID 2AK2A 2Y8EA 2XXAA 3K70D 1VYTA 2QT1A 2ZI7A 3QF4A 2C96A 5AUOB 5JRZA 1DS6A 4TMVA 3SQWA 4AKHA 1YRAA 1ESNA 1JXOA 4KLNA 4Q7KA 4LPSA 3T12A 1CULC 3ZYCA 4EUNA 4IXMA 3LFUA 1KI9A 2RGNC 3BRWD 4B75A 1E2EA 1SKYB 4JLJA 1Z29A 4TT3A 3NDPA 4FW9A 2ZAMA 4KYUA 5L3QB 2PL3A 1DAHA 3N5CA 3NC1C 2B21A 5C4GB 1VG8A 1EX7A 3GLIA 2P5SA 2CMKA 3SS8A 2J5XA 2QI9C 5C46F 4FCTA 1DBSA 5HKKA 3CR8A 1QRAA 3TK1A 3K0CC 1T8UA 1ZUHA 2BBWA 2QN6A 1MABA 4LJ4A 1XEXB 3RWMB 4LJ7A 4F92B 2GCOB 1UKYA 1ZMXA 3WP0A 3PEYA 5FBWB 4KI0A 2ASEA 2WWIA 1GSIA 3NTUA 4JVLA 2VA8A 1WA5A 4DLYA 3GJ0A 4AKGA 1FNMA 4AYTA 4P33A 2OFOA 3OAAA 4IEEA 4KITB 2VSXA 3QPUA 5FOXA 4LYAA 3U7HB 2JEOA 2R62A 4PSKA 3U3JA 4LY6A 4OHZA 1NBMD 2O0HA 2A5FA 2GESA 1W7AA 3QE0A 4A36A 4A92A 4HZUB 1O87A 4WAUA 5CIQA 5BN3A 4M1KA 4Z1MD 1T3SA 1OFIA 1RRGA 4A8JC 3IPXA 4MA4A 1COWA 4GPTA 5FPSA 1QG2A 4BRWA 4B6FA 4IJMA 2CL0X 4V03A 4KXFB 5FR1A 3R8CA 3K70B 1CBUA 1U94A 1R0ZA 3MWJA 2JLVA 1IN6A 1TF2A 4XD7D 3AUYA 2N46A 1E0JA 3EIQA 3FWYA 1R0YA 2ZRMA 3SYNA 1U98A 3O8CA 4NDZA 4Q9JA 4W7SA 2QZ4A 1EXMA 3SE0A 4V0MA 1OV4A 1G20E 4BUJA 2VHQA 1EFCA 1KJZA 3C5HA 4A0GA 4GP6A 5AUNB 2WMNB 5CYOA 1QG4A 1XRJA 2ZYTX 4JKIA 2CCKA 1DO2A 3GFTA 3JZMA 2RKOA 4PO1A 2IF0A 4LPKA 2P3SA 4BWYA 1P4SA 2ZI4A 1X6VA 2D62A 3MUFA 3KFVA 4EFLA 3B1ZA 1A82A 1OHHA 4HYYA 5KDLA 1CIPA 1YZLA 2BMFA 2F3TA 2ZVQX 4TQ9A 3E2IA 2IYWA 2JA1A 2YYZA 3ECCA 3IBYA 3K09C 4M1TA 3S1AB 3CX8A 4B32A 1OB2A 3QBVA 1WBDA
chains in the Genus database with same CATH superfamily
1IOWA 2ODWA 4Q9IA 3LQYA 4ZI7B 4I5EA 1PS8A 1XTIA 1ZW1A 4JNCA 3OX3A 2NO4A 4DLBA 5KYGA 1NC1A 3NOXA 1GT91 3GLGE 3T94A 4NSNA 3MTAA 5BVHB 1EQUA 5SY9A 2XZDA 1X0XA 1DWUA 1DC4A 5KNBA 4CR6A 5A4AA 1P2BA 2F4NA 1OXXK 1G42A 1D1QA 2LW7A 4UUPA 5C8YF 2W2KA 1ECFA 4OMUA 4ZJZA 4BATA 5F51A 1NATA 1UH5A 2JHAA 2QMOA 4RSGA 4Q39A 2MCFA 1DIOB 4OA8A 1XT6A 4MUFA 3HGMA 3H11A 1VFNA 1FVHA 3HGQA 3ZWKA 1LI7A 2ETXA 1UJNA 3BS4A 3OF3A 4Q04A 1BXKA 2CD7A 3OE7D 2JARA 1CZUA 4EF4A 4OATA 3D4NA 5K3EA 1D0SA 4I9UA 1L4MA 8GPBA 1XYGA 3LPMA 5AVVA 3B5EA 2HXYA 4EA8A 5JNUA 4WFIA 1EK1A 2JLWA 3R9KA 3IUJA 1JB1A 1U3TA 1R37A 3JQ8A 4XVRA 2OO5A 3AKCA 3CR3C 1RROA 2BE6A 1NQOA 4RJLA 4DRZA 4WESA 4LF4B 5DM70 5DLEA 1PYDA 1V1GA 4RCYA 4JI4B 1ZK3A 2C29D 1P80A 4ZQFA 2NTEA 1B1CA 2P4SA 4ESOA 4GKJB 3ENNA 1Q1EA 1WW2A 4KUEA 5K8TA 2CNPA 3PCRB 2F62A 4UUOA 4GPBA 5F33A 3PYMA 2W2LA 1ZMOA 1RLUA 2GAAA 1BZYA 4BMVA 1P44A 3TS5B 1R9GA 3RABA 1NTOA 5TMPA 3FPFA 4AZ3A 2ERBA 1C1XB 2WP0A 1QP7A 3E81A 1WZNA 3PB3A 3R77A 1QV1A 2V54A 2BFDA 1NVTA 4DOMA 3PX2A 1GRRA 3V7WA 1SXGA 4URHA 3A4NA 3UMJA 1UP4A 1O6GA 4FBGA 1NYRA 2CY0A 4N39A 2I4IA 5JANA 3C24A 2R7KA 5KC9A 1ZD3A 3I76A 4LHZA 5TMEA 1Z2CB 1ZMRA 2O2SA 4FNAA 1JDVA 1RT9A 1D4AA 4F7WA 2ZR8A 4J49A 1QZ3A 4ORBB 1PKXA 1XTPA 1Z8HA 3V2GA 3WMFA 1DJXA 3CXRA 1F9EA 1NBOA 1FRQA 1V7ZA 3P26A 1I1QB 3KVRA 1V8PA 3ZN2A 2EW2A 3WFIA 1YCFA 5KC8A 3SPXA 3AR8A 4U7FA 5G02A 3LYLA 5AP9A 5DRTA 1SKQA 1NONA 2C0CA 1PS9A 1YMQA 2HBQA 4RSRA 1ORRA 2QTTA 1DVRA 2G9QA 2HLHA 1C1XA 1JYEA 1H3FA 4W7IA 4JCOA 1OX5A 2C98A 4LE1A 3RUDA 4ZMBA 4X92A 4D8TA 1D8AA 4UDYX 4J94A 3ZW7A 1Z0DA 1RFLA 3UJ6A 2WB4A 2CVHA 1WV0A 3MS4A 2EKBA 4QBTA 3OHPA 2PHZA 1NN0A 1NUSA 2L2QA 2MSLA 3UA4A 2A86A 2EIXA 1BHJA 1VP9A 1SUWA 5HZKA 2AOVA 2QP3A 2HSZA 3CRNA 3P9KA 4XWTA 1FCJA 2G0NA 1UXGA 4HQ6A 4L27A 4Z3DA 1KYYA 4OB8A 2OBFA 3L5OA 2C4NA 5B6IA 4R1OA 2JIDA 4GE0A 4NZZA 3CO5A 5I7VA 3E1KA 4LSWA 3LQ1A 1ODKA 1DX9A 4Y9UA 3DD4A 3VU9A 4ZGWA 4UVHA 4DMGA 1X77A 4G81A 4DQXA 2FMFA 1YQUA 1W0JD 3NBUA 4RKRA 3X0DA 3FKSD 2DHQA 1IOVA 4K8RB 4HP8A 1M9NA 5K4GA 4B6OA 1V1RB 4KUHA 1WQ3A 2YVUA 3HXKA 2PQ0A 2YV4A 4JKTA 4ZZ0A 4RK1A 3O4XA 3ORHA 1E3WB 2LRHA 3ZDBA 2YYSA 3FJYA 3QG1A 1BYUA 3CWZA 1SUSA 2AFHB 5DYYA 2DMRA 1YBMA 3V8PA 1BO6A 4XIGS 4C4SA 1ZRNA 1XZFA 1G6KA 4KHZA 1F2DA 4U7TB 2DCMA 4L0DA 5FWYB 4UU7A 4PLGA 4UCWA 2P9HA 1E2UA 2I76A 2HJGA 1POXA 4GIBA 3WL3A 1KU0A 3ZVMA 2CNOA 4Q0MA 1P1IA 4QGBA 2XB2A 3EEQA 1X86B 3H2BA 4DPLA 2X0JA 3UMGA 5GONB 1YZYA 5HZGA 3VHRA 4CQLA 4RKYA 2V7QA 1GTJ1 4RSMA 4IVNA 3NO4A 3O4HA 1RAAA 3OOEA 2W58A 2I3GA 4O2BB 5FLEX 2GLUA 5KQGA 4WZAE 2VP9A 4IUYA 1A75B 1L4NA 1O94A 1KE2A 5I9MA 4TS9A 4S3MA 1UHIA 3W3AD 2I18A 4W6ZA 5D1HA 4RVCA 3ZHYA 2BM9A 4ORAB 4C08A 2P1ZA 3AL2A 1EL4A 3M6XA 4OHRA 5G53C 1QVAA 3BMCA 2OUKA 4ZOLA 2Y6VA 2FUCA 3AOGA 1MRSA 5ALUA 3IVCA 3WFZA 2I3ZA 5ECYA 1DDGA 3HVIA 4TL6A 5I7OA 1DKPA 1YB5A 1FX1A 4OHYA 2Z8XA 1SVUA 3GZNB 1DGVA 3T3NA 1I8TA 3GT7A 1GA1A 4IJKA 2MU1A 4KGZA 2BKAA 4HZUA 2J3QA 3OICA 2IV3A 4B5KA 1YL5A 3B51X 1W75A 4C89A 3G7SA 4L50A 4UUAA 3FE2A 3MCZA 1Q84A 2YOFA 5GONA 4KUGA 1AUIB 1I7QB 1T9BA 1QHFA 3EQ2A 3SNHA 4LZWA 4X3OA 4CUKA 3IQDB 3GU3A 1MQ1A 2VXYA 4YV2A 3WGOA 1NA5A 4DILA 3M6LA 4O2BA 1N8TA 2RHGB 5CVCA 3OKPA 5FQNA 3OHMB 1U2GC 1FS4A 2FZ4A 2BCGY 5BT8A 1TVKA 1N6RA 4G97A 1QYIA 2PMKA 3GFOA 3RWOA 4R1UA 1N1EA 3WDSA 4GI7A 1Q0UA 1SVLA 4DUZB 4H27A 2HCBA 1XMXA 2G5PA 5DXJA 3ET5A 4RH0A 4XCVA 1NVXQ 3QMPA 5CLIA 1O54A 4QGHA 2OM2A 1C5KA 3WRVA 3GZNA 3C4QA 4AN0A 4QLBA 5ICGA 3SICE 3VMFA 3LZCA 4OJYA 4DYHA 1CTQA 1H8HA 1ZO8A 5EQFA 3G1WA 1YUUA 1CQWA 2O8DA 3AB3A 3U4IA 3OZBA 3EZ9A 1M6YA 2XDQB 2CK3D 2H1SA 3NMUF 5A4DA 1QYRA 2M1UA 4TV9A 4LZOA 1CEYA 4J1TA 1X38A 1TL7C 1YE8A 3PQCA 4ZOAA 4E5SA 1V5WA 1Z7WA 2XNJA 1QVRA 2VPWA 4ZT5A 5SICE 3DBLB 1JE0A 1GOTA 1J1IA 2P2ZA 4F5YA 3N2NA 4KVZA 3K8YA 5CH5A 3VOTA 1NMSA 4EHFA 1NPQA 4ECAA 4FGKA 1AKTA 5B7QA 1G0NA 1T1JA 2Q7DA 5C51B 5IKXA 5L95A 3OM0A 4CF6A 3UMMA 1ZP6A 4PSAA 1WY7A 3MWDB 4U5XA 3OOWA 4Q7LA 3RK4A 1Q80A 2A0YA 1U9IA 4OUKX 4LTDA 3IJ5A 4W99A 1R6PA 5FFMA 3GQBB 5E4TA 3EDMA 1A1VA 4TM8A 1EWRA 3TCKA 9MHTA 2HY7A 2D7CA 1TCFA 2CFSA 1B93A 3M7IA 3AEYA 2O2CA 5BXQC 3N2YA 5GQSA 2XDAA 1LNZA 3N2LA 1NNEA 1TJ4A 1XJ0A 1OQPA 1FLAA 4F2PA 1L7AA 3RI3A 1W5EA 1UR5A 5ELLA 3P96A 1LBEA 4GXQA 5FUXA 3S68A 2VZLA 2FPSA 1TLTA 3R7NA 4PQYA 3DLTA 5LMZA 3B3GA 3NCHA 3SBDA 3EQZA 2QAIA 3SHTA 721PA 4AY4A 1N2JA 1EVEA 2JJ1A 3GLFE 4G1BA 4JSRA 2IPOA 2ZB7A 3LDUA 3OPVA 1J42A 2W00A 3WIOA 2EGHA 3TTYA 2QNRA 4BXOA 2ZSFA 2C2BA 1YE3A 2OZLB 4G0WA 3PC8A 2FR0A 5IAKA 3GCXA 3S8YA 2IELA 1SHUX 4YUWA 1VKOA 3W9UA 2H61A 3G17A 5JSHA 3LPAA 1A03A 1QIMA 3IT2A 4QM7A 3RYIA 1ZUIA 4IX9A 5ULLA 3P0FA 3CZ1A 4CM8A 3NHFA 1VHQA 2BLNA 2TS1A 5BN4B 3GJYA 4RHTA 1VIDA 1Y1QA 2PVCA 4H6WA 5FFNA 1KO7A 1U4OA 4FZ5A 1PLKA 3E9CA 3KTAB 2OD7A 3O2PA 1P29A 5TV2A 4JUIA 2OLKA 3BC1A 5C8VA 2QX6A 3M0WA 2VNHA 5LJLA 4RD4A 4E6EA 4YRMA 3L7LA 3ZWNA 3DUWA 2PGNA 5CPVA 2GN2A 3HYTA 4PV7A 1W2WB 2RHCA 4R1LA 3WMGA 4FR5A 2VUUA 3EF0A 3KT3A 3HADA 2X5XA 4NAHA 3QSYA 2OZLA 3WXMA 2DFKB 2ZIXA 3VM6A 1TA0A 2EBUA 2ZBUA 1PJBA 4O1HA 1Y8ZA 1OSAA 4L7QA 1RRPA 2AN9A 1G3MA 1JKMA 3IVGA 4RHYA 4G01B 3E3NA 4PZ9A 4DRWA 3ADDA 4LV6A 5I7HA 4IL1A 2BKEA 3HUUA 3H2HA 2J0QA 1RD4A 4YB8A 1NUHA 2LCIA 3IOMA 4KKXB 4E1VA 1W9ZA 1OOHA 1MFZA 5BMOA 1HDYA 1A9SA 4HNAB 3OZRA 4WFKA 5BQXA 3D8TA 3RM3A 3TEJA 1EUCA 1GR0A 4DQKA 2I7VA 1N2DA 4MEBA 5IABA 5KB3A 3NHAA 4ZEVA 3KTAA 3EEOA 4WOCA 2RHMA 1KPHA 2AI3A 4FXPA 2B34A 1DAIA 3NWEA 1E2DA 2A6PA 5HKAA 3JRNA 2FU5C 1WIWA 4QPZA 1B42A 2QR3A 4FVTA 5KHOC 4HTFB 5LQKA 2MJWB 1JF0A 1PV4A 2AZMA 1M46A 3AU8A 3CEHA 4HOYA 4YALA 2B8JA 4KNYA 3BREA 1Z2NX 3WWEA 2EFEB 4K2HA 2DT8A 1KK3A 1GUYA 3CVVA 4IDNA 2GM9A 1YVDA 5ECWA 5TARA 2FSVC 1Y3AA 3D77A 3DMDA 5CFOA 2HQOA 3QJGA 2GPAA 2SECE 1RP1A 5BSGA 3QEKA 2RIPA 4G5QA 2N1MA 4F0JA 4GVLA 3A9SA 1XFRA 3SWWA 1DPGA 2XSZD 3FN4A 4POOA 1HLDA 1KL7A 1Z62A 4QASA 2PIDA 1C1DA 5IKOA 2R8XA 3QA9A 4R6XA 4PQEA 2ECKA 1U3DA 2QVYX 2V7GA 1IQ5A 2YHIA 4J0HA 1GZ7A 2FQYA 1JMYA 1K6MA 1PSRA 1E9BA 1A9PA 5JJIA 1E5TA 2X7HA 5JMTA 3IUBA 1TQDA 1VL0A 2WCKA 1WCXA 1L5WA 4LDQA 4MKGA 3TRKA 1ADJA 1AA9A 3AILA 1SZDA 1JFFB 1IOZA 1OOIX 5KYXB 4KJXA 4LZLA 2XCIA 3I9OA 5EE1A 2HCRA 5KDOA 3ZIDA 4DR7B 2ZIEA 4Y7DA 2WK1A 3UG6A 2WC8A 4GP7A 3DZIA 2DGDA 1YKFA 2AG5A 2JFUA 3SIWA 2AVDA 4DCCA 1XCGB 4LTMA 4EKDA 4MPTA 1AUQA 4JI1B 3WSVA 4AN1A 1IBLB 4PPYA 2VZEA 3TLGA 2YV5A 4XWOA 3H05A 4ZI3A 5C4MA 4OHOA 4INZA 4BO7A 5EL0A 5BSKA 2I78A 2WIJA 1DG1G 3HKCA 2PXCA 5WRFA 5HKKD 3GD7A 2H5LA 5IBWA 3HP7A 4I8DA 3B1KA 4PLTA 13PKA 3UUGA 1ABFA 4TTQA 1DKLA 4IIJA 3DP7A 2WOJA 1JUOA 4HB2A 5ALLA 2RGBA 1CM1A 1Q7BA 3GHHA 3DZBA 3REGA 3Q7PA 4I5LB 3B6MA 1ECLA 1FBNA 4NZPA 1J1DA 1CJVC 1FMTA 5D01A 3TX2A 5J23A 3GV0A 4BYMA 2O60A 1PJQA 5IARA 5KYXA 3EVNA 3GLGB 3WAJA 4QUDA 1R3UA 2KPOA 3B78A 3O7MA 4Q9HA 4H35A 3PWZA 1ZJJA 2XUAA 5LJIA 3CM0A 3DJYA 1XRMA 4DUGA 1LD3A 2PRIA 5JY1A 2WSYB 3ILYA 3QY9A 4LOKA 3FTFA 2ZBDA 4KIJA 4EITA 3D02A 4D9NA 4FT4A 3MJFA 1ZJWA 3ZHBA 3B60A 4R2XA 1KGSA 4MJ3A 2PVPA 3W2GA 2CLCX 2NYVA 4L28A 4CHGA 5ALMA 1FMLA 5TX7A 2ZDGA 4ZRNA 2H8GA 3JQGA 2VRGA 4WHMA 1G20A 2G6TA 5JPCA 3BWEA 3A6GA 1GNTA 1KJ9A 3BXZA 3JZAA 4Z9BA 4IG4A 3N0WA 4WEQA 4W5HA 2JFQA 1IZ0A 2GTPA 3FKQA 1H2FA 3DEFA 1NG9A 2PBLA 1XOIA 2C96A 2CF6A 1YRAA 1VIMA 3T12A 1NUBA 1CULC 4XVCA 4N3BA 1O95A 3NDPA 3RASA 5C4GB 2YW9A 2FWAA 1MOQA 2PGAA 2XE7A 2C3MA 1DX4A 2C3YA 3RRFA 4MI6A 2AS0A 1TVCA 5TGTA 4KQCA 3BFBA 3NLLA 1PX2A 1GSIA 5KQRA 4Y30A 3A1NA 3WMXA 3L04A 4EJ6A 1KWGA 1EA5A 4YGXB 5FHQA 4BRWA 4JX9A 3R8CA 3OZSA 3ES9A 4G1CA 1IN6A 3AUYA 3EIQA 1R0YA 4GMHA 2G36A 3WLHA 3A14A 3TOZA 4UUNA 4RGVA 1KJZA 2ZRSA 5AUNB 2F64A 1ZNQO 3GFTA 3JZMA 4PO1A 1B74A 1OTHA 4HYYA 1YZLA 1VRCA 4LOJA 2Q1WA 3RBVA 4QDKA 2BL0B 1EVJA 1PGQA 1CUUA 4XCXA 1U1EA 5E8JA 2OD9A 3C45A 4F2DA 3EHEA 2QRHA 1I3MA 4AO7A 3AZQA 3DNFA 5E6SB 4PTLA 3FHJA 3CLTD 1RBQA 3CBGA 2OFWA 2CCJA 5EXSA 4MVJM 1E3QA 1GZHB 4C22A 5EKTA 4D80A 1DF0A 1FJGB 3QFRA 2R48A 2HK6A 5BRJA 4FB5A 1Q83A 3RW9A 1E6LA 4NZMA 3KQTA 3NGXA 2J4FA 3ACBA 5J59A 3OZGA 3UNWA 1KFXL 3TZHA 3U9TA 4HJRA 3ZEIA 1Y1UA 2P90A 3SEAA 4BNNA 1HDZA 1EUDB 3EG9B 3IUEA 1JV2B 5ESXA 4YLEA 4QTUB 4MS3B 1BCSB 1KEKA 4MQMA 2FSUA 2P40A 4L8VA 4QUAA 5J2UF 3BWVA 4P3OA 4GNKA 4QG7A 3UV7A 2CXJA 1GD1O 2A5GA 2F43B 4M1ZA 1OYYA 4P8RA 3LHSA 4OGLA 4XZ3A 3G7NA 4K9RA 1ZM4A 4NY1A 5HF6A 3ZE7A 4L5JA 4H9GA 4FFBA 2GBFA 1SBIA 3TIVA 3HWSA 2M2IA 3MW8A 4A8JA 4RF2A 3VSCA 1K2WA 5C31A 5B3AA 2YN0A 1QHEA 2QTRA 4NBLA 2PX8A 3KYBA 5MGBA 4UNPA 4NCHA 2M49B 4OTZA 2FJUB 2PQLA 1SA0A 2Q3HA 1M31A 1RC1A 5CBPB 1RYEA 4B7ZA 2FSIA 1TJYA 2J3LA 2GA8A 2LR0A 1JHXA 3C98A 3ILHA 4G5HA 4PFQA 4NYIQ 2ZBRA 1GIAA 2E21A 4D0GA 1UXHA 4G0MA 4D8WA 2KBEA 4UXJA 1M2OB 4HJXA 1VJ1A 4O29A 5FTLA 1KOGA 1I4OA 3PFVA 2BEVA 3KC2A 1U0BB 4O8ZA 5KSYA 3QKTA 4UHJA 4P1ZA 3L7KA 4R0VA 2A59A 1Y9JA 4IW3B 3NEPX 2V3VA 3BOSA 2QU7A 2ZRAA 4G09A 4YRFA 1B8OA 4DV2B 3G5TA 4IHQA 4EPTA 3N8GA 2C2ZA 3O2QB 3B2EA 4YJ3F 3W7VA 2X5OA 1C3LA 3A11A 3C3KA 4XWYA 2M1KB 1CFFA 2KPHA 3L7MA 1E92A 5L51A 3OTOB 5KJEA 2NU9B 1YDHA 1LKZA 5LQJA 1BE8A 3ICCA 1W4ZA 4MO9A 5CFLA 3IEXA 5FLKA 5LD2B 3E22B 2VT3A 3HMQA 4PAQA 2JF0A 5JEDA 1B26A 3DVLA 1UPCA 3KXDA 2NCPA 4JJEA 4BZQA 1VYHA 2DKNA 3I05A 4KDFA 2J9FA 4OJKA 2PGOA 4GYJA 4ZA2A 1XR3A 2EHDA 2UVQA 3MXOA 1Z2AA 1ZUZA 1G98A 5F2KA 4BVAA 4MYTA 3KPJA 3CMMA 2J9RA 3AVXA 3NHPA 2QKYA 2R60A 1UOEA 1U7DA 2P91A 2O57A 4WZAB 2YXLA 3EXIB 2VR1A 1Z36A 1GGFA 3RHFA 1D8TA 3ZWPA 1JG2A 5AHRA 1KI6A 2A78A 4LWZA 2F4VB 1AY0A 1VI6A 4TRMA 2OZEA 2ZKIA 1RWBA 1JILA 1V8OA 4CLNA 2ORIA 1DAKA 4O3MA 2RI1A 4ORCB 4TKZA 2WOSA 3CIOA 2OS8B 3MWYW 4X6YA 1SIBE 3W1EA 3NAGA 4EVIA 3CE6A 1ZWKA 2Q5QA 1UC4B 1UEXC 2NU9A 3FVTA 1RLTA 3MLEA 2PMWB 4ACAA 2C07A 1GILA 1RXWA 2B2XA 1U2ZA 4PC2A 3FUVA 3N2KB 2Z2JA 2GEUA 4H59A 3B36A 2ERCA 3K6SB 3SR3A 3FAZA 3QV2A 2MHHA 4RFVA 3COPA 3NUZA 2LE9B 3NWJA 3LUPA 1MB9A 3KXKA 1W1WA 2ZSEA 1VJTA 3CR4X 4DT1B 4L4YA 4A6PA 4MCAA 3WRWA 4AWAA 1G8JA 1UP6A 1U81A 4KR3A 4NVRA 1Z5UA 1NBAA 4TLLB 4A8PA 4UAJA 1NYLA 3G89A 1C29B 1XTRA 1G5FA 2AJBA 2WF8A 3ZLUA 3GLHE 4IH9A 1XIVA 2BDUA 4MWOA 4ZTZB 1QR6A 3SHQA 1U8ZA 3LU1A 2Q07A 4CQJA 3KQQA 4CIXA 1JJBA 1G2OA 1U3CA 3R7LA 2C78A 1RBYA 4R83A 3IQIX 1P9OA 1F2VA 3P9ZA 3G5LA 1T91A 5DGDA 2GYYA 1PZGA 2PNFA 3QLEA 3PU6A 5C7LO 5BPHA 4JUFA 1ZRSA 3L1JA 5CT8A 1VHJA 3WIUA 4CIBA 3PYLA 4KO8A 1PK7A 2I1VB 1SQFA 4BX0A 5D3MB 2X4DA 5IVKA 3S5UA 3K6SA 5AKIA 3PKZA 2W6NA 3FWCA 2O4UX 2VKQA 1VOTA 2YMPA 4BQOA 2PPVA 5H68A 3QOYA 4E51A 3LX4A 2XB8A 2P2SA 1KQPA 1CLBA 4YAOA 4IS2A 3NBKA 2G17A 5JZBA 2JJ8A 5KNDD 2Z8YM 4Y2QA 1ZMBA 1GU0A 5L3QA 4ZQIA 5IASA 1A5SB 1UEJA 4CMGA 5I4BA 5DBGA 5CM2Z 2Z1DA 3L3BA 5LXTF 4GOOD 4EJSB 2FP4B 5K9ZA 2J31A 4EX6A 2BI4A 2YJ5A 3Q7IA 4YP7A 4YAFA 4OI2A 3HRHA 4ZHSA 1MR3F 4B3BA 4YI5A 2AH5A 1JVSA 1E20A 4A15A 4BNVA 4UPGA 1K8ZB 1Q17A 3B1WA 5EIEA 3IDQA 3LP5A 4X7BA 5ICSA 4GL2A 1IDN1 3CUKA 2FWRA 3FYUA 3K92A 3MEQA 4WY5A 4S04A 3PG5A 3ONNA 1V4NA 4CCAA 5DP2A 2FXIA 1PD1A 3IAEA 3SXUB 4CDMA 2B83A 1OWNA 5JTTA 3GRUA 2NZUG 4E5VA 2ZRJA 1ID1A 5JSZB 1LPPA 1L3BA 3IEIA 3O0TA 4CV3A 4V1CI 2G70A 3JW8A 3SG2A 4D3SA 3Q2IA 4E0BA 1VA4A 2XA1A 1SKYE 3CMCO 4X0EA 4EGAA 3UUFA 4RVDA 4D9CA 3GLFB 1BFUA 1FVXA 2G9RA 4IHJB 5KOYA 4HAZA 1E63A 4RZXA 4FYPA 3L46A 2R4QA 1X8XA 4V38A 1XDWA 4HXFB 3TSAA 1SURA 4IO0A 4PPNA 3RU3A 5B6JA 1YS6A 3PE3A 4EJSA 1Z6ZA 1XMIA 1T2VA 2FLVA 2XKAA 1E1YA 1PWXA 5TY0A 1V1MA 3W5IA 3WIDA 3HBAA 4EBBA 2BFWA 4B84A 5L8VA 2F33A 2ZZKA 3EQ9A 3V48A 5E4YA 5EGNA 2QQ5A 4F4DA 1RW4A 4MKIA 3KQLA 4L07A 1KBQA 2J87A 3PT9A 3QX3A 1ZOLA 1SCJA 3UT5A 1X7DA 3BGDA 3SXUA 5TPWB 5E6RA 1HE1C 1AZTA 1ZN8A 2R00C 4Z5XA 1GZSA 5DEIA 5JSZA 5JH7F 3NOOA 4RIHA 4R98A 2I22A 3VTZA 4M9CA 1GL6A 2D4HA 3GNTA 1HM5A 2PKXA 3GLFA 2WCLA 2AF4C 1QWOA 4F6CA 4IHJA 4PSUA 4CTOA 3Q9LA 3ANLA 1O4VA 2GPWA 2O5EA 3BB3A 2MYUA 3SSMA 3MWFA 1AO0A 1EG7A 4CKWB 4NE9A 4A2WA 1HTWA 1HT2E 4OGFA 4ZI7F 3Q9NA 1YQQA 2OBLA 2Y76A 1E7SA 3ZU6A 2ZUVA 1D7AA 1XFWO 2O5GA 4OFWA 1BROA 4D0SA 4MQLA 2DQYA 2BEJA 1PL7A 3BJRA 1X70A 1QLHA 1J24A 4BQIA 3L93A 1OAKA 2QL9A 3UV3A 3SE7A 1PV2A 1KDVA 4I1SA 4MUIA 3MMZA 2G5TA 4PE1A 2BKLA 3EIFA 3CJTA 2XXAB 3CLSD 1FLVA 4JEHA 4GDMA 3EF3A 5BWCA 4JD9A 4OU4A 5FYQA 1WQ4A 2XJ9A 1I4WA 4ETIA 1Q77A 5HF9A 3NT4A 4BNDA 5TPWA 2MLEC 1ALWA 1CS0A 5EGSA 4NP6A 1PWYE 5AM5A 1W52X 1AJ4A 4IF4A 2ZUFA 5JYCA 2NACA 2CVPA 3HDGA 5JATA 4OUDB 3K1EA 1MQ8B 2XA9A 4FOPA 2R6R1 2L5XB 1KEEA 2D8MA 1XK4A 4B2IA 1W0KD 5HCIA 1QB8A 1V2GA 1UPUA 3A10A 4F5WA 2OHJA 2ZWMA 3RQIA 4FZRA 1YA4A 4GLLA 2DUJA 9LDTA 4IPTA 3PE6A 4DLKA 2P5UA 1U8EA 2F1KA 4BB0A 2ZIUB 4AECA 2HYIC 3H1EA 1UKAA 1ZKDA 4D5EA 4OP1A 5HLOA 2NSHA 5H4GA 1RJDA 2AZXA 5LSAA 3FF4A 1NX2A 4L0QA 1VLHA 4AJJA 1MX1A 4DEXA 3ZBQA 4ZO6A 1MW8X 2OENG 4Z3OA 1LBSA 3AHHA 5F5NA 1TT5A 5DH9A 3B7AA 2ZVJA 1J2JA 2A1IA 1K6XA 2YBDA 1I6MA 4HNUA 2QMUA 3MGKA 2FP3A 3LRXA 3QVGB 3WKCA 2YIVX 1H4SA 2E18A 5FFFA 3AUAA 4D9KA 4MPDA 3K0HA 3ROKA 1EQAA 4ME6A 1U2EA 3OX1A 4YRJA 4U00A 3H11B 3LUAA 4D2IA 3F97A 4WGFA 1D09A 3ROGA 2AQKA 3BXFA 2MTBA 2C00A 1ZDMA 1B8RA 2HF8A 2RCYA 5KYWB 2CHGA 4ZT2A 3ND5A 4QBFA 2DZDA 3QLVC 4ZQGA 2OBNA 2VZ9A 5I9NA 5FUQA 5EQJB 2VVTA 1QHGA 3PWTA 2QD3A 4UCQA 3JQ8B 4XJTA 1EHIA 2QPAA 3IT0A 2JEYA 2MBXA 2VSYA 4MIKA 4WESB 1IG5A 1O8CA 1V5IA 4BQQA 4CI9A 5F2NA 3CN7A 1H8ED 2DFLA 5AJXA 2L4HA 4DREA 2B2CA 5A5GA 5DYTA 1E18A 3M70A 3UCEA 3MRVA 5KJCA 1E1RD 1MPXA 3FOFC 4J3FA 4FOSA 1IIRA 4PE7A 1CRQA 3GFBA 4FZVA 5KAMA 3NHMA 5HKZA 1TN4A 1FS5A 4B2YA 2QRKA 2O7VA 2QAGC 1LDNA 3W5HA 2LVBA 2VI5A 3FSJX 2WDZA 3QVGA 1D5WA 1F0YA 1ZS9A 1N4DA 3GAFA 1W8DA 2H4YA 4DV5B 2QMZA 5ITZA 4G0XA 4RA6A 3EK2A 3RAEC 4DIRA 1MVOA 2A9QA 4QPCA 4K6CA 2OB2A 2XCSB 9ABPA 4DPKA 2O7RA 3H17A 4C14A 2JI4A 4AZ3B 1RWOA 2P2LA 5KYWA 1T5OA 3HFGA 3EA0A 4UBIA 1XEWX 2IQIA 4RDIA 2BFDB 4L51A 4QUJA 3FROA 3QELB 5B3JA 3KDAA 3BD7A 3D7SA 3K73O 3RRNA 3PNPA 1YULA 3CNOA 1THMA 2V98A 2ZI5A 4ER0A 4OMFG 5K0FA 3VPGA 5B2EA 1HLPA 4PZUA 3CF2A 4B4OA 1VM6A 3LY5A 1DJOA 3FSEA 2ZT5A 2CMHA 3FFXA 1KI7A 3EPJA 5AH0A 2RMKA 4WASA 3TRJA 4TWIA 3OJCA 2E5FA 5FL3A 3GJ6A 2JJYA 3ELUA 3T99A 1OZAA 2X40A 3DOIA 5DEOA 1G1MA 2QK4A 4Z4FA 1THGA 4R7TA 3KEGA 5FL7D 1SUIA 3PFGA 1NP3A 2XWJI 1H93A 2JFGA 3QX8A 5H7XA 4Q34A 3A1SA 5JAPA 3OOHA 4ARCA 2GN8A 3I28A 2D0DA 1WJGA 1UFKA 3SLGA 4ZKDA 3SQXA 4N6NA 1GPAA 2Q0SA 1LXFC 5DHFA 5L7TA 2HO5A 3QELA 4YREA 4CIDA 4OJMX 3FRJA 4DG8A 1ESDA 3NVMB 1HUQA 5CFRA 5FOQA 1HBJA 1ORHA 1YHZA 1EK0A 1HOTA 4KTVE 1W4CA 3N07A 3CVOA 2MYPA 1ENYA 3CF0A 1YMUA 5GONF 1I2ZA 3F74A 1DQYA 1SVKA 4AJLA 5KTPA 1WCIA 3JAMA 2PLRA 4IMRA 3S2YA 5KSZA 5LNK6 3AP1A 2QTAA 3A6KA 2B98A 4UM9D 2AXPA 4MP8A 1OXVA 2NVWA 4O2BF 3TGPA 1K90D 2AMIA 1KETA 3VU9B 4ZDKA 3GZJA 2Z3WA 2DOKA 1MRZA 2BFFA 1CEEA 1JQBA 2QR5A 4PCAA 1M1UA 1PFWA 3H2KA 1CDDA 4F97A 6YASA 1OLOA 3LO5A 3GH3A 4MHOA 4PE0A 3KKEA 1RIIA 3TQIA 4HMQA 3JAKA 1BG6A 1SD1A 2K4MA 4CEIA 3F5SA 4D4HA 3U40A 3GWZA 1DOAA 1NGSA 4DG5A 4C4XA 1X7GA 4EY5A 1ADGA 1BD4A 1W19A 3RTDA 2C5HA 4OHVA 4HFMA 4TKUA 4JOQA 1JI3A 3KB6A 2CJXA 4RZ3A 5TF0A 2HSEA 3TPFA 1V37A 4YXFA 3NHTA 5IAOA 1B0ZA 2LMVA 1FXWF 4E1BA 1Q7RA 3L4LA 5KINB 3IQEA 3PC3A 3C6XA 4TV9F 2C2GA 4FIDA 3HR7A 5BN3B 3KZVA 4WLUA 5KNBD 1YX7A 1S2GA 4FCWA 3PXGA 1G291 4MJ7A 4GYYA 1L1FA 3GPIA 4WK2B 1XCPA 1O58A 5ELXA 4CQLB 1T3ZA 3NEYA 4O4IB 3IA7A 2RHHA 1SHLA 3Q4GA 3RZSA 3LT5A 4NK4A 1J7KA 4QPPA 2WJJA 1OWMA 1SBJA 5BPJA 2ILTA 1RU3A 1CNEA 1GU1A 4I19A 4LECA 5F7OA 3JR3A 4CLOA 4BE4A 3NZEA 5FF9A 1KDYA 1QAOA 4OREX 3ZBTA 1OCEA 3SIPA 5C4IA 3T3IA 5AUOB 1PR1A 4Q7KA 2I33A 1I5RA 5J63A 2OCDA 2HMUA 5JYDA 3FBWA 1SOWA 3BMCB 3ND6A 1KBZA 3SS8A 2W6MA 5EJ9A 4ZOLB 4D99A 2JQ6A 4ZOEA 2HR1A 4MPRA 1Y4AE 1EHCA 5IJ0A 2W4QA 2XGSA 1XRNA 5IX8A 4BVBA 3NTUA 4EMTA 4KXXA 1Q0SA 5CX4A 1NC3A 5AXAA 3IDOA 1PD0A 1EE9A 2G09A 4Z86A 4HZUB 1DX6A 5BN3A 3GH1A 2WUGA 5FR1A 4WCVA 1CBUA 1V39A 3I5HC 5JC8A 1UWVA 3VC1A 1S5PA 1EFCA 2HRRA 1GM0A 3BD6A 2KAXA 4O4IA 4GQBA 1MH9A 2NXJA 2P3SA 2GTEA 2C7OA 3W9SA 2W2LD 4EFLA 4RMHA 3B1ZA 4L08A 1GPUA 2EHJA 1KZ6A 3SC6A 4D4IA 2G9NA 1CUJA 3AI3A 2WAXA 3CN9A 2IH5A 2P9ZA 1EVQA 5F73A 1MO2A 1RLIA 2AK3A 1T2FA 1F70A 4NE2A 5IT4A 1TVKB 4I1IA 3HNOA 5B36A 1S4MA 1R3DA 3GLIE 4OLAA 2JK0A 1T8PA 1XF1A 2CUTA 3BZBA 5DNVA 1E6WA 3QNUA 2M98A 3O3OB 4LC1A 5EIOA 3ZJUA 2D3TA 1A7UA 3A3KA 2VDUE 3CLTC 5FTJA 3IR6A 3ESAA 2FVYA 1DADA 2ARKA 3JQBC 1BW9A 3P20A 1SBYA 3GYBA 3PRHA 2JRCA 3TSYA 4TL7A 1QYCA 2Y66A 3RVMA 1IOLA 3KKQA 4WOJA 4N8DA 1AKUA 3TNYA 2WC6A 5JSKA 2AQIA 2C20A 2A5DA 3ILVA 2OV6A 1ENOA 3FPCA 1GGEA 1TF5A 2O8DB 2HQSA 1BHQ1 4JUBA 1XBTA 5F7JA 5L3RA 5AKZA 1YFZA 2ZUSA 4WLOA 4TV9B 3VKHA 3D4OA 2QN1A 4Y0NA 1Y37A 4DUQA 4TTPA 5AVJA 3KL2A 5FLYA 1ZGAA 3G0IA 5DXAA 1Z0KA 2RAPA 2HH9A 4DMMA 3A31A 4OJQA 5B55A 4JDPA 3WJ2A 2V7XA 3GN1A 2G1AA 1PZHA 1KY3A 1J06A 3CO0S 3AOEA 5IM4F 3KSDO 1VPLA 1N9ZA 2BBTA 3B5JA 3ZI7A 4CMIA 4DS3A 3WQSB 1FQWA 4DR6B 3BJEA 3COYA 3IP1A 2GO1A 1VG1A 2VHZA 5GADl 1RC8A 1NIPA 2VNAA 2Q0QA 1ZKMA 1NNI1 4N40A 1XXHE 4LI0A 1A8HA 3B88A 4KQIA 3BSWA 1EH2A 4KP7A 1QQTA 4YQYA 4CEHA 3ZWMA 2R47A 2M7NA 1KS2A 5DE3A 4QYMA 4GBJA 5F64A 4N5MA 5AXCA 2DLNA 4JVOA 2GO7A 1HLFA 2X76A 2XCOA 2O2JA 3PICA 4CKCA 5EZ6B 1R4AA 1GKIA 3I2IA 3W06A 3PVSA 4WLVA 2IXFA 3L8YA 3TI7A 4NYMR 4RHEA 3B12A 2GEKA 1JSZA 1LDYA 2TMYA 1NN5A 2L17A 2DJIA 3ZJ5A 3C97A 2YWBA 4FBMA 1SKAA 3R3ZA 1JDTA 1GTRA 4B7AA 2QV7A 3WLIA 3AIKA 4BXOB 1P7PA 3U2QA 5BUZA 1CIJA 1SC9A 2IL1A 3HDJA 3HCOA 1N3BA 2WIDA 1QIGA 3LQRA 2VHUA 3ZHUA 1USKA 4EHBA 2RHLA 4C43A 4S1PA 3G9TA 3PDHA 1NBWB 3DXYA 5HUHA 3RYIB 4J9VA 2Z9CA 2HT6A 5E0KB 4CM8B 3EBLA 3LDHA 4PQRA 3M34A 2WMDA 4H3HB 1Q3TA 4RXMA 3AK4A 4O59O 2FKNA 5AI6A 4IUCS 3QITA 1UT6A 1R4NA 2A58A 1IHYA 4EHDA 1B23P 5ADWA 4J07A 3C6YA 3GLHA 1NMEA 1S26D 2PAFA 3NSIA 1C4OA 3JWIA 4F3NA 5M7EA 1HKUA 3N8KA 1X8JA 1WD5A 1ATIA 4EGCB 1U0LA 1QU2A 5CLJA 3T1QA 3UJ9A 4JXJA 5CSFA 1O9HA 5AJUA 4QTYA 2GBIA 2EYUA 1YK1A 3OPMA 1GITA 4MLPA 4DBLC 3N2GA 3BJHA 3GZTB 2ZIXB 4EY4A 3HH8A 4DV4B 1OOFA 4D8YA 5IF3A 5DCWA 5EJ7A 2CZGA 1EJ2A 4QHSA 4E5PA