1DEKA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
240
Chain Sequence
b'MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
molecule tags Phosphotransferase
source organism Enterobacteria phage t4
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
total genus 86
structure length 240
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1dekA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dekA01
1GITA 1TQDA 2CLSA 3TSZA 1IY2A 4FCVA 2OT3B 3EC2A 1NG1A 1SVKA 5G3YA 1YR9A 1X8JA 2IYYA 2FZ4A 3KUCA 3TVDA 2X2EA 2IF2A 1E9BA 3D8BA 3EWAA 5HCIA 4Y0AA 3UK6A 1HE8B 1DAEA 3TJZA 4ZCMA 4YMTA 4P0TA 2ZJZA 2YZ2A 1T8UA 2VP9A 1UDWA 3BB3A 2ANCA 3V00A 1E6CA 2WJIA 1QBKC 2HJVA 1KI4A 1JI0A 2PCJA 4HEJA 4EPTA 3MLEA 3SE0A 2MMCA 2IUTA 3EC1A 2FF7A 4P4UA 1K6MA 2J0SA 1M8PA 1LVGA 4G5OA 2JGNA 5JZVA 1MKYA 2IHBA 3SHFA 1JR3A 2IWRA 2VP6A 4DLRA 2QG6A 4PQFA 5DI9A 1MRNA 1AN0A 1RFLA 2ZJOA 1P61B 2JJ2A 4URUR 1GM5A 1IQPA 2D74A 2GVZC 2YOFA 2E9SA 2D2EA 3F8TA 3W8NA 3NBFA 2QROA 1EX6A 2CE7A 2JJ1A 1ZUHA 4YLGA 3L0OA 3IEUA 2B92A 2R65A 4FCTA 5KPDA 1Q1ZA 5KNDA 1L4UA 2WWFA 3QXXA 4H1VA 3FVQA 2DBYA 4NCIA 4L16A 2VHTA 1GL7A 2ZRJA 3NH9A 4DUGA 3LVRE 1E96A 4TL9A 1HY3A 1G5RA 3DMNA 2CVFA 3TMKA 2VHCA 1KMHA 2CCKA 1HE1C 4M1TA 3SJCA 3U7GA 4AY2A 2ANBA 4NDZA 2IS1A 1X1RA 2JLQA 1PVOA 2ATXA 3CPJB 4QHTA 2ORVA 1G20E 3C15C 2CNWA 1P9WA 4TTPA 3GLIA 4W5JA 1R5OA 5EP1A 4HLUA 1KI6A 1XZQA 4RVCA 1Q22A 1G3QA 1YE8A 4HAVA 3PR1A 4ZIRB 2KBEA 3I73A 4ESHA 2IYRA 1OXUA 1B0UA 2PL3A 2HXYA 4MRNA 4CEHB 3DL0A 2XSZA 2ZS7A 1EWQA 4ZKDA 1CEEA 3GJ4A 5JHGB 4DSNA 3KJIA 3AB3A 2RHMA 1Z63A 3ASZA 1W44A 1QHHB 2ORWA 3EIQA 1G8FA 3K0FB 3WYGA 2DWPA 1PLLA 2R6CA 4PAQA 4OI1A 4W5WA 3R7WA 4LYAA 5LB4A 3THYA 1KK3A 1OSNA 1DPFA 4JYBA 3QXHA 4HI0E 1II9A 4TQAA 4WZ6A 3AQ4A 2HEIA 4F4IA 4C2UA 1N0UA 4JSYA 5FL7D 2QT1A 2GJ8A 3U7FB 4DC9A 5K8TA 4B3GA 3PXGA 3ND9A 1US8A 3GQBA 2PEZA 4OK6A 1XD8A 1ZD8A 3RRNA 4JJKA 3R9XA 1JALA 3DOFA 1EX7A 2CL0X 2FGKA 3HP1A 3THOA 4NU0A 4XTRA 1W36C 4KU4A 4Q4HA 1W36D 3RYTC 2VSOA 2A5DA 1E2EA 1Z0KA 3A4LA 5AUPB 2IS2A 4JLBA 2BV3A 3VHXA 4A6PA 4A2QA 3OIVA 1DVRA 4C0QC 1WCV1 5CIQA 2NTYC 1S1MA 2FSGA 1CTQA 2VF8A 3HPQA 1OXTA 2H92A 5BQ5A 1E2FA 1QHYA 2FX3A 2Z43A 2CBZA 1NBMA 3ZQJA 4BFVA 4UNRA 3S1AB 2JJ1D 1VCOA 4II7A 1SULA 1YZLA 3DZ8A 5BXQC 3QG5A 4Q1FA 1P9NA 4DLZA 5P21A 1R0ZA 2O8FA 1G7TA 2IYUA 1A82A 3H86A 4NZYA 1OFUX 4B2IA 1QVRA 1XD2B 2ZITA 1CJKC 3E70C 3KL4A 2J41A 1KZGB 2V9PA 1Z06A 4Z1MA 4BFWA 3KKMA 2VHUA 1ZM7A 1G18A 4E03A 2ZXUA 3IO3A 5GVSA 4EAQA 3AF0A 4D2IA 2BIFA 1DBSA 2D62A 4EFLA 5J4LA 2NOAA 4LJ7A 2J45A 5HTKA 4A9AA 3BK7A 5J4KA 3NG1A 4RKEA 2R44A 4CEIA 2NO7A 4G5GA 3DO6A 1F48A 2DFTA 2NO6A 4HATA 1RC8A 1ZUNB 1XCGB 2ODEA 2RGGA 5BW8A 2FSIA 2ZEJA 3QVUA 1N3BA 4PTLA 3SHWA 5B58C 2QMOA 2P2LA 2DPXA 2H17A 1NSFA 3BIFA 4DLTA 3GLGA 3LVQE 2QBYA 4GI7A 2NZ8A 1OIVA 5FPTA 2BMDA 1DG3A 2WJVA 3QOFA 3C16C 4B3FX 4A2WA 5LBIA 3FDIA 1F60A 2C77A 4V02A 4IFEA 2AR7A 3OFND 2CJWA 2HJGA 3SYNA 1JR3D 2JLWA 1TPZA 2QAGA 4DCVA 4D25A 1NIPA 1TX4B 1YR7A 1X3SA 1G7SA 5JJKA 2NO9A 2GCOB 2JJ8A 2Y8EA 3KFVA 4TYPA 1HEIA 2W0MA 4BQSA 4RZUA 4GZMA 1U94A 3ECCA 3QKSB 5LDDC 1OF1A 4GP7A 3AF2A 4EPRA 4Q18A 5JJIA 2P5TB 5EE1A 1W4BA 2CK3A 3NEJA 2FJUA 3CRVA 3K0EA 5C18A 2J59A 5JCZA 4GRAA 2PEYA 5DYGA 5FTJA 4C4PA 2H57A 5BN5A 2QA5A 2QENA 3QBTA 4JLPA 4MGZR 1Q3TA 5FPSA 1KO7A 1G9XA 3KQKA 2FZLA 3EWSA 4MRVA 1BKDR 4DLYA 2GVDC 4DXAA 1HT2E 2F3TA 5EXTA 4Q7JB 3QF4B 3KTAA 3AP1A 3RC3A 1CKEA 4OQFA 1OXXK 1LF0A 3K09C 3QKUA 2A3RA 1FQKA 1EG7A 2DFKB 5F3WB 2ASEA 4V0OA 2VYFA 4LK2A 3W90A 4A2PA 4I81A 3N2IA 4CT5A 3LLUA 1TQ2A 1IJFA 3B1XA 5HCNA 2XB4A 3QXSA 1COWD 1O87A 1M34E 4AWXA 1EFCA 1FP7A 5FOUA 3KZ1E 3CNLA 2J7KA 4FMCB 1G3IA 1KGDA 4IRUB 2CDNA 4PC2A 2ZI9A 3VR3A 4HUTA 1G64A 1KDRA 4NBSA 1T0JB 4ZDWA 5JRZA 3OHMA 1UF9A 2YJTD 5H8WA 1OV4A 1Q1QA 2A5GA 3PEYA 2OXCA 3K0AB 2GXAA 1SHKA 1E1QA 1W0KD 1VG9B 4ESVA 4WZAE 1VCIA 2GEDA 3KTAB 3L0PA 3MG9A 2OHFA 5FOSA 4P4TA 1UEIA 4KI0A 5UKDA 4Q19A 3LO5A 3CBQA 4C0SA 4TN1A 1FPMA 2C98A 3NVAA 4CYMA 3L43A 1ZC3A 2ZE7A 4PPGA 4WOPA 3FHCB 3GEIA 1YZGA 3M0EA 4KFSA 4A0GA 2Q21A 4I1VA 3KQHA 4R7ZA 3T06B 2OFWA 4HZUB 5SZKB 3DDCA 1VYTA 4PAMA 3AVQA 3F5FA 3KJHA 5FPKA 4XSGA 2D7DA 4LDJA 1D2NA 4Q03A 2VF7A 3SI7A 3VU9B 1QG4A 2Z0MA 3IKJA 4K46A 4BLRA 4JKIA 1OH6A 1KI2A 1GKIA 2NQ2C 4LPSA 5EE5B 1LNZA 4DB2A 1CBUA 4BZXA 4U5XA 4YMVA 2IC5A 4BRWA 3C7KA 2CJWB 3NIBA 1N5LA 5M04A 5G53C 1JQLB 1N6NA 2XXAB 3HYTA 2ZUCA 4JYCA 4B44A 2J3EA 3LRPA 1FTSA 1QF9A 1SVIA 1UDXA 3IIMA 1OYWA 2ZJYA 3SJZA 4E22A 4G1UC 2QMHA 3K0CA 4A8JB 3GJXC 4PPFA 2WM9B 4OK5A 4QBGB 1W0JA 6Q21A 3GLGB 1JEDA 1PUJA 3OEEA 3AM1A 4AI6A 5EXPA 1RZ3A 1S4QA 5G41A 3CX8A 1OIWA 2EFDB 3THWA 2OZEA 3GFOA 1A1VA 2O0KA 1DS6A 4ASUD 4AKHA 3N2EA 1ZVQA 2MMGA 2WAXA 3P4XA 1YU9A 2BKUA 3DOEA 3MD0A 3EARA 3EZ6A 3A58B 4HB2A 2WHXA 3K9HA 2IYTA 1V5WA 4LI0A 4F4JA 2O8BB 1GUAA 1XCPA 3X1DA 1Z28A 2DHRA 2GEUA 2OAQ1 4A15A 1OH5A 5CK5A 5L3SB 3GEHA 3OE7A 4ABYA 3WMEA 4NPHA 3WY9A 4D26A 1G21E 2KWIA 5FBQB 4IKEA 4KCGA 3EZ9A 4B76A 1LB1B 3ADDA 5FTNA 4HLCA 3U7EB 1NP6A 2RB4A 1TU3A 4TZ0A 5H68A 3CNNA 3REGA 1QHSA 4LY6A 1EGAA 1XFAA 1ZW6A 3KKPA 1R10A 1ZM4A 2J0UB 4P4SB 4R9UC 3SBEA 3SC3A 3T5GA 4Z54A 3ZJYA 3JZAA 2ZM5A 2XTZA 1KSFX 4JBWA 4DEXA 2OFXA 1A2KC 1CLUA 4B34A 2OM2A 4F4CA 2P3SA 2YWFA 3VR1A 3QKTA 1E9SA 2IF0A 3GJ5A 4JLMA 4Q7LA 5D3MB 4HLUC 2ODNA 2Q6TA 3RS7A 4KFUA 3O8DA 1RW4A 3LD9A 4OQNA 1ETUA 1US8B 2ZRFA 1JAHA 2YOHA 3PJRA 3VHLB 4KFTA 3QUSA 1WRBA 3R20A 2XB2A 3THXB 1FW6A 2OILA 2ZJ5A 1VDZA 1KK0A 1OPXA 2AK3A 1OH7A 1KSHA 4DVGA 2CL6X 1VCNA 1XP8A 3PUVA 4XVQA 5HKKD 3TAUA 1E2HA 1YZTA 2FGJA 4BECA 4Q9IA 3H1TA 5EXSA 3THXA 2R6DA 5L3RA 5DYIA 2ZE8A 2EVWX 2J5XA 1NLYA 2IWHA 3VR4A 3ZGXA 2OBMA 2NMVA 1XMVA 3ZVLA 5LD2B 2ZJ2A 5DI3A 2XTMA 1XEWY 3WXMA 1NKSA 3H84A 4BPBA 3X1XA 2QTHA 5IT5A 2VP0A 4OI4A 4UNSA 4GZLA 4CVNA 1C1YA 1ZU4A 2OLKA 2RGCA 5TB5A 4TMVA 2ZSAA 3OAAD 4MGKR 8OHMA 1XF9A 1VPLA 1GVNB 3SYLA 2ZAOA 2XOKD 2ZI7A 2J0UA 1Z8FA 2ZSEA 3SNHA 3PUYA 4A0FA 1OXVA 1F2UA 3BOSA 1UPTA 2OFOA 3U44A 1T4GA 2CK3D 2O0HA 1G17A 2V6IA 4FCWA 3U6KA 5LD2C 3HWSA 2IYWA 3I72A 1CU1A 3LX8A 1XB2A 1R0XA 5FOTA 1TADA 2V6JA 3H2YA 4DZZA 2D7CA 1BO6A 1E0JA 1GL6A 4OK3A 3BH0A 5KDLA 2O8EA 1W48A 2H5EA 2RGBA 3IIKA 4TQUS 5L3SA 1E2GA 2Q0HA 2B8WA 4DRZA 2PJRA 5DLQC 4Q9LA 4QFMA 1NJFA 5J4VA 1DO2A 2JLUA 4Q9KA 2VP2A 3I62A 1A4RA 4LWZA 2FEOA 2REXB 3LWNA 2WWWA 1XBTA 1CRQA 2VP4A 3AKEA 3LY5A 3Q9LA 4V0NA 5FOWA 1ZUIA 3WNCA 3Q8XB 4AG5A 3GLHA 2ZS8A 2PZGA 3T1QA 2BMEA 2WSSD 1M2OB 2N46A 5BN4A 1R0WA 3CIOA 4KYUA 4MUAA 5SZIA 2CNWD 2C9OA 2I4IA 3TE6A 3OE7D 4TYQA 5JEEA 1IOZA 3CONA 3JVUA 2JA1A 1W5SA 3TW8B 1VYUA 4TMTA 1XTSA 2AX4A 2GZHA 1BS1A 4JL6A 4R2IA 4LC1A 3VR2A 4M1OA 2J9RA 2ERXA 4A8JA 1N5KA 4N0DA 1E9AA 4BFXA 3AVVA 3KKNA 5DN6A 4BLOA 3U60B 1GSIA 4Q4JB 4RKFA 1VG8A 3B13B 4IDPA 1AS2A 1XD2A 2ZVPX 3UMFA 2UVQA 3VX4A 4C3ZA 5ELXA 1XPOA 2QSZA 3VFDA 2VSFA 2O8FB 4Q4LA 2JCSA 3UMSA 1E2MA 5FBVB 4TL7A 1GILA 4PC1A 3OZXA 4JVNA 3KJGA 1SHZA 3KXLA 1Z47A 1FFHA 2WSMA 2DFNA 3B6EA 1GP2A 4NYMR 5HZKA 1CJMA 3HU1A 1XU4A 2WV9A 3WNDA 3B82A 2C9YA 3VU9A 1X1SA 1TMKA 5JWOA 2G1KA 3AVWA 3A4NA 4QM6A 2A9KA 1JPNA 4P32A 3CRMA 4M1WA 4UNNA 1T91A 4LHXA 4AYXA 5C2JB 5JSZB 4FMDB 4EPWA 1CXZA 1X8KA 5CB6A 3ZD7A 3BC1A 1W2GA 4B33A 4DDTA 1T5LA 4RSGA 2WWHA 2ZE6A 2VPPA 4NONA 2DB3A 3TR5A 4OQXA 2RAPA 5AWFC 3GPLA 4FXPA 2QP4A 1S2MA 4TWZA 1ZCBA 3AP3A 3TK1A 3A1VA 2EU8A 1JEEA 2XAUA 3K0AA 1R5NA 4NHOA 3B85A 1E94E 1AKEA 4H1UA 3FKSD 4XWAA 1NJGA 4ZDJA 3EX7C 1N5JA 4ZDKA 2GJAA 3IUYA 1E9RA 4A4DA 1DO0A 2IYQA 3AUXA 3H0KA 4LJ6A 4PC6A 3O8CA 1M7HA 1LS6A 5FR1A 3OEED 4Q9HA 2OO7A 2P6UA 1NRJB 2D2FA 4FIDA 5EE3A 1KZ7B 4XTCS 3SN6A 5B64A 4E07A 3EASA 1JBKA 4BFTA 3CB4A 4KLZA 3LX5A 2FA9A 3EPJA 1Q20A 1Q57A 2DCUA 2QPTA 1CP2A 4UQOA 3IHLA 5JI2E 2V1XA 2VBCA 4ZCLA 4EIWA 3LBHA 4JIMA 5CDFA 4JL5A 1XX6A 4BFZA 1G3UA 5KDOA 3W6PA 3KUDA 2BHRA 2RGDA 3DMDA 3I3SR 3MAAC 3RVBA 4DDUA 4PFSA 1N25A 1ZCAA 3BBPA 3D3QA 4M8NE 5KU1A 421PA 2CLCX 4URZR 2OG2A 3SBDA 4I99A 2B7BA 2PCLA 4MITA 1E2DA 1AGPA 4IDHA 4BLSA 2GEVA 3OFNA 3QKSA 4RD0A 1YR6A 4TL8A 1FP6A 3A1SA 1HV8A 1EFRA 1Z6XA 2GXUA 1OT3A 1QZXA 3ZZ0A 1P73A 3LBIA 1GWNA 5FUXA 5EQTA 4AKIA 3SEAA 2G83A 1HT1E 4PZZA 1DG1G 1LFDB 3MJHA 1IN7A 3A1UA 1DTSA 1WP9A 3HR7A 1ZYUA 2ZU6A 5CYOA 4A92A 2ZRNA 1NLZA 2WIBA 1VECA 4V0ME 3RRYA 1QHGA 4M9SA 2HF9A 3I1FA 5EE9A 4FWIB 2HUPA 1RRCA 1NKTA 1HQCA 2JAQA 3PG5A 2XZOA 3BH6A 1S3SA 3BFKA 4B2LA 4B47A 2XOKA 4GOKA 1W2HA 4BRUA 1PZNA 1NY6A 1VG0B 2VA8A 4GP6A 1AA9A 3BB4A 3RWMB 5KSYA 1KNQA 3I5XA 4NL4H 4FINA 3RRMA 1D5CA 1E2QA 1XXHB 1DAFA 1Z0JA 2WPDD 2VO1A 3GJ6A 2IHYA 2QQ0A 4KO8A 1SXJA 3W3AA 3Q5EA 4Z1MD 4B35A 3TVTA 3HYRA 2PT7A 1OFHA 2VQSA 1U8YA 3CZQA 3NWJA 4OHVA 3EPLA 1BOFA 2N1BA 2GXSA 1UKEA 4O25A 1XTIA 1IXSB 1R2QA 5FOVA 2QGZA 1KSJA 4QOSA 4UXJA 3NC1C 1N6LA 4KHZA 2PZEA 2ZPTX 3FYHA 3ZS9A 4KBGA 3NHAA 4NP6A 4XJXA 3B60A 2B7CA 3UKDA 2QT0A 4OHXA 5CLLA 2C04A 1E2IA 5J47A 3HU3A 4G01B 1VKJA 4LJ5A 4NMMA 4BFYA 2LWIA 2HCBA 1FUKA 1VMAA 2IW3A 3TQCA 4O2RA 2GK7A 4PHHA 1Z0AA 4QBIA 2F9LA 3JVVA 4DLSA 1PJRA 2R6FA 1NY5A 2C96A 3CH5A 2O8EB 2BEKA 2E1RA 4KFRA 4YXWA 4BFSA 1E79A 3EA0A 3O8RA 4WAUA 4NKRA 3UIEA 3WMFA 5IK2D 3LW8A 1OB2A 2IYVA 2Q3HA 4YMUA 3EA5A 2IA5A 2OESA 4DCUA 2WVJA 3A1TA 2ERYA 1UKYA 2OCYC 1EFHA 3X2SA 3FTQA 1OW3B 4RCYA 1HYQA 4D4KA 2ZRIA 3HJNA 3VNUA 2ONJA 3AH8A 2YYZA 2O8CA 3Q85A 1U2RA 1ZIOA 2GCPA 1AQYA 1BIFA 2CCGA 4GMXA 4C0JA 4Z51A 2WAYA 3A1WA 5J5CA 5JI3E 4EQ6B 3ADBA 5EXXA 3L0IB 2QQEA 1G5TA 1KKMA 1EFUA 3L82B 1EFTA 3MMPA 4G5RA 4YC7A 2B6HA 3BB1A 1D8TA 4BASA 1ZBDA 1RRFA 4B6FA 2BBOA 3CR8A 1ONBA 4PC3A 4DDWA 1I4DD 1QHHA 1E1RA 2AXNA 4EJSA 3ND8A 3W8RA 4B74A 1ZNZA 2GCNA 4A8JC 4ZV4A 1E0KA 3BD9A 3QY0A 1JB1A 1T3SA 2A7QA 2GBLA 5FI1B 4XVUA 1OKKA 4QC2A 5FBRB 5KSZA 3SOPA 3BH7A 3AGPA 1YKSA 3IPYA 2AL7A 4Q01A 5C46F 4KAXA 4NTZA 4POAA 1H8ED 2G88A 2I1VB 2ODBA 1K5DA 4MKHA 5DH9A 2D3WA 3SFZA 5AUNB 4PZYA 4DCSA 2AN9A 2WJJA 4NYJQ 3GJ7A 2FSFA 4C30A 2F1JA 1G8YA 3F3YA 4ASUA 3ZVMA 1U0LA 5D3MA 1DEKA 1W36B 1FMJA 3AGQA 2HV8A 5DE3A 1G6HA 1K8RA 2QE7A 3BERA 521PA 1E3MA 1IN8A 2P65A 4C9BA 1IXZA 1MOZA 2E87A 2OXRA 1WDTA 4KBFA 4LYJA 4NCKA 4BEBA 2ZJ8A 2BC9A 2FOLA 721PA 2AHOA 2JLYA 4D4LA 2X1VA 1F3OA 4HDOB 1G3RA 4XVRA 5EE0A 2F6RA 3WRYC 4M9ZA 4PSVA 4ARZB 3FFAA 4CT4B 1P5ZB 2REOA 1FL9A 3LLMA 2ZTSA 3C4JA 3ETLA 3VR5A 2OAP1 3RS4A 4HDCA 2QGNA 2SHKA 3IO5A 1GDDA 2F55A 5SZJA 3RS2A 3Q5DA 4AKGA 4TLCA 4S2EA 1G6OA 2W0SA 2C95A 2XITA 5LB2A 2AWOA 2XGJA 2J1LA 1SKQA 3W34A 1XRJA 3AVOA 1FNNA 1Z29A 1QHNA 3IBYA 1KSGA 1ODFA 3SS8A 5CK4A 2FPLA 1RJ9B 3AV0B 2JLVA 4AK9A 1R6BX 2NZJA 1XWIA 1CR0A 2OUKA 5IRCD 4DB4A 3CNOA 2ZRLA 4OYHA 2OCBA 5CM9C 1NVVR 2OLJA 4PQRA 4QXAA 5A4JA 5KNCA 2G0NA 4MH0R 2JLXA 5G40A 2H18A 4A0RA 4DKXA 2FSHA 1HA3A 4EPYA 5KPJA 2XZPA 3EIEA 2Q3MA 1N6PA 2YOGA 4TTQA 3SJAA 3T12A 2JJ2D 1U8AA 2FNAA 1JR6A 2CEAA 1DAGA 2NIPA 1UBFA 4MKIA 4M0LA 4IOKA 2QAJA 3QG1A 2WSSA 2QM8A 2I1QA 2YV5A 3IPXA 4MYHA 2XEXA 1MR3F 3RHFA 1G1MA 2HT1A 5JCPA 1C9KA 1IN5A 4TSFD 4DLXA 4LC0A 1IJEA 1K5GA 2AD5A 2NPFA 4Q4AB 5AUOB 1OLOA 3T5DA 1VG1A 4LYFA 2ZR9A 3AVXA 4Q7MB 1Y63A 3EZ7A 3MJRA 4L15A 4R2HA 5AK0A 2O0JA 5F2EA 1E9DA 1F2TB 5FPHA 2GWHA 1PLKA 4M22A 3SR0A 2J0VA 3IEVA 2F43B 4A82A 4X8HA 4IEEA 5IDVA 2PMDA 1G4AE 4GBMA 4D0GA 4EUNA 4GDFA 3N5CA 3GMTA 1FTNA 4EDHA 2AXPA 3OEHD 1QDEA 3K1JA 5EUMA 2BJVA 2NO1A 5BN3A 3FMPB 2LCFA 2P5SA 1SVMA 4NYMQ 4I1OA 1UM8A 3BJIC 3K70D 1N6IA 2BCJQ 4RZ3A 5JFGA 1T3LA 3LDAA 2B21A 4L5BA 1NN0A 1Z0FA 2GF9A 3FMOB 3U61B 5H1YA 1Z3IX 1I2DA 3GLHB 1L8QA 1MV5A 1MH1A 4LPKA 4XWKA 1RJ9A 2AK2A 4UNQA 3WYFA 3WYAA 4C2TA 2ZRDA 1P72A 4UNPA 5DSZA 5JS8A 3TRFA 1L7VC 4M53A 1SKYB 1FX0B 2VRWA 5BWMA 1P3JA 5CM8B 3T1OA 2LKCA 4OBEA 4QL3A 5JWRA 1GTVA 1XMSA 4CEJB 4XD7D 2RGNA 221PA 2C8VA 2WWIA 1U0HC 1KIMA 3E5HA 1PV4A 5F9HA 4ZO4A 4D4JA 5CLQA 5E7MA 4LGMA 4F38A 4TMWA 2XTNA 5FTKA 1XXHE 2ZI5A 1WE2A 4IHQA 5L3QB 1M74A 1DAKA 2K5UA 1E2NA 4P33A 2GRJA 3B5JA 1NN3A 4B32A 1E1RD 1KI9A 3AF4A 1TAGA 1MABA 3VAAA 1MABB 2ZI6A 1DADA 2CXXA 4V0MA 2QRNA 5JMTA 4JMPA 4L9WA 2JDID 4JBXA 1OB5A 2ZRGA 1NMYA 4EFNA 5AJXA 4BE7B 5BYKA 3T61A 1HH4A 3DVLA 3T35A 2YWEA 1RKBA 2V1UA 2OEPA 3CH4B 1Q21A 3UANA 4LJ8A 2DY1A 2W2XA 1GZSA 2VP5A 2RGEA 3WHLA 4IFBA 2ZRAA 1Z6TA 2IEYA 1G5PA 1NBME 2HDNB 4CEJA 2O8DA 3X1ZA 2IYSA 4DLWA 4ACBA 5TMPA 2F9MA 4HLQB 4HAWA 1W4CA 2P0EA 1XZPA 4B3DA 2IEZA 3J81k 1QG2A 1IXRC 4UKDA 621PA 4KITB 3C5HA 5FUYA 1JJVA 4I1SA 2F1HA 3OIYA 4GSYA 1OHHD 1KI1A 4B3BA 1D9ZA 3MCAA 4NCJA 4U02A 1ZMXA 4LX0A 3PUZA 1XNJA 2QP3A 4NYJR 4JLAA 3REFA 2BDTA 2BKEA 1J7KA 2NG1A 4B75A 1TQ4A 2FV8A 5DO9A 4QBHA 5J4HA 3BORA 5JRJA 1AZTA 4EKDA 4LJAA 1U9IC 2W2TA 2WWYA 4GPTA 2J7PA 1ZJ6A 4BZPA 3UXMA 1ELOA 4MGIR 1KJZA 4Q1DA 1GOTA 1YHNA 1ZIPA 4I4LA 4KV9A 5F9FA 3L8ZA 4IDOA 4JT2A 1N6OA 3CPHA 1MO5A 2UZ3A 4PO8A 5IK2A 5TVKA 3RNLA 2RGAA 2ZR7A 1YJ5A 1F2TA 2F3RA 3PEWA 5D3QA 3ZVRA 2GKSA 1KJWA 4EPXA 2ZSBA 1II0A 4PO9A 2G77B 1AJEA 4Q4AA 2ODWA 4R98A 4L8GA 4HAZA 1VHTA 4JKYA 2VEDA 1N6HA 2ZANA 1W0KA 1U81A 1P2TA 2FG5A 2Q3FA 1G41A 3T1VA 4TYYA 5DN6D 3HR8A 3RSLA 4DBLC 4UXHA 1CR2A 4AC9A 4OHWA 3T1TA 1KYIA 4RFSB 4RD6A 1ZM3A 3PEUA 3I61A 1XTRA 1EFRD 3K70B 1XPUA 2W6IA 2ZI3A 5JBQA 1Z2AA 1NVVQ 3QEJA 1WB9A 2CHVA 2BBSA 3OIWA 3EZ2A 4F7WA 2H1LA 3THYB 3WNBA 3MSXA 1U9IA 4IEIA 4C7OA 121PA 1GG2A 1SKYE 1E1QD 4ILEA 1TNDA 2JASA 3IGFA 3PUXA 4D4MA 2XZLA 3P4YA 4NYIR 2IYZA 3X1WA 2GF0A 5GJCA 1QVAA 2GAAA 1KAGA 2FU5C 3AKYA 3EG5A 3HPRA 4ZIRA 1ZNYA 4OI2A 1RYFA 3RWOA 2H16A 2OBNA 2YHSA 4HLDA 1S1CA 2VHJA 2FEMA 4B43A 4PSKA 1Z6GA 2H7VA 4ARZA 1I4LD 5JEDA 1KO8A 5CYPA 3ZLJA 2OCPA 5J40A 2HYDA 4HDQB 4LV8B 2BM1A 3IBGA 1G8PA 1N0VC 4MKGA 3UMRA 4TYWA 4TLBA 2HT6A 1M7GA 4U00A 2ZYUX 1KDOA 1IONA 2ZSFA 1HUQA 1Q1BA 3WRXC 1Y3AA 1LW7A 3UWOA 1ESNA 1H8EA 4C0KA 1G8HA 1CIPA 4US2R 1P60A 2N42A 3LNCA 3V4FA 4PHGA 5JLJA 3KQNA 4GNKA 4DDVA 1ZD9A 3CX6A 2P67A 3AKDA 3Q3JB 3I92A 4MDEA 1UJ2A 1Z83A 4KODA 4V03A 2A5JA 1EESA 1P4SA 2BCGY 2BWJA 5EP2A 3ASYA 2ORIA 4PQYA 3VTKA 3LW7A 5B2ZA 2X2FA 3R9IA 3G5UA 3FWYA 2V3CC 4B71A 4DWJA 3G0HA 4RY2A 3CF0A 4HB4A 2Q9CA 4BWYA 3EPHA 5KHOC 3FGNA 3N70A 5HE8A 2YC2C 3KX2A 2V54A 3MGCA 4RJLA 1GKUB 1S8FA 1KO5A 4EJSB 2A78A 4FMBB 5CB8A 5TV2A 3KKOA 3FHOA 2JLRA 2GK6A 4M1MA 3VQTA 2MSEB 2EYQA 3P32A 3FKQA 3AVPA 4JSTA 4OQLA 4JLOA 5FFMA 5GJWC 2IT1A 4TTRA 4LHZA 3ZD6A 2GETA 4PHTA 2TMKA 3U2QA 1ZM2A 2GZDA 2ZRHA 3T34A 1CF4A 3QPUA 2VHQA 5FL3A 3GLFB 1AS0A 1ZM9A 4PR0A 3X1YA 1S3GA 1FMLA 3AF1A 4RD3A 4O2LA 4XSHA 4PXAA 5KNBA 4D82A 2GJSA 3M4YA 4L4UA 5DNYB 2GCOA 2P6NA 3W6OA 3E2IA 2OSBA 1T6NA 4GMDA 5GADl 2WBLC 1D2EA 2C5LA 3FB4A 1XMIA 5IHPA 1AQUA 2QTFA 4IOJA 2NO0A 5C4GB 5JWHA 3NEYA 1NSTA 4PPNA 3CZPA 1XTJA 3GEEA 4B48A 1LTQA 4QHSA 1SZPA 5AUQA 4LHWA 1R5BA 2IUSA 3RC8A 1QHXA 2W6JD 3W5IA 1Q12A 4OQMA 4TZ6A 3QPWA 3I32A 4Q4JA 2XJ9A 2OBLA 2ZYWX 2XJ4A 1XD9A 1GNPA 4MDFA 4XWOA 1VIAA 4ON9A 1ZP6A 4TLDA 1Z6AA 3NBZC 3ZYCA 1KK2A 3D7MA 4YQFA 5FR2A 3AVUA 3U6BA 2OV2A 3EXAA 2F1RA 1AKYA 5DISB 3CR7A 3K9LA 1X86B 5K8LA 3AEZA 1UADA 1JPJA 1OH8A 4ACAA 4X8MA 2A5YB 1JXMA 2R2AA 2B8TA 3ONWA 1E79D 4HYYA 4LBVA 5FUWA 3W3ZB 5KOYA 3DM9B 5DHFA 3C14C 1XEXA 2XNDA 3WP1B 1IBRA 2GESA 5KO2A 1G19A 3WBJA 2ZUBA 5TDHA 4KXFB 1YR8A 3C5CA 5AJVB 3ICQB 3RAPR 3U3JA 3CW2A 1E2PA 2GJKA 1ZNWA 1KO4A 2PBRA 2ZRBA 4BLPA 4WXRA 5F98A 1NMZA 1SVSA 1D6JA 1JJ7A 1Z22A 3UWKA 4AG6A 3B1YA 4R71A 1GIAA 1F5NA 3GLGE 3U44B 1T0HB 4H9GA 1II8A 5DHAA 2Z6VA 3BAFA 4PC7A 3LXXA 3PENA 2LKDA 4Q4HB 4YMSA 3TH5A 1DELA 3DM5A 1U99A 2WPDA 1G7RA 4RZ2A 4C0HA 3RS3A 3R9WA 4PX9A 3GLFA 1UBGA 4ZPXA 3U7HB 4TSFA 3OAAA 2QL6A 1XCMA 1OE0A 1BMFD 2WJGA 1P2SA 2PJZA 5KDDA 2BEJA 2DFLA 2O52A 1Q3HA 2ZRMA 2Q9BA 5EZ6B 2GHIA 3CKLA 1U0JA 2L0XA 2NPIA 4PO1A 1NI3A 1Z07A 2RHDA 3VR6A 3K0FA 3K0CC 1R8SA 4IXNA 3SZRA 5E3HA 4CF7A 4IJMA 1E2KA 3HU2A 2WJYA 1Z08A 4QG7A 2UZIR 4PAOA 4AURA 2CMKA 1AS3A 4B2PA 4W9MC 4IDQA 2G9NA 4JVMA 1L4YA 3NDBB 1M6NA 3KQLA 4CEHA 821PA 1ZU5A 5B30A 4O3MA 4MRRA 1TQ6A 1AGRA 3B1WA 3QEOA 3WMGA 3I8SA 1KI6B 1J8YF 4LJ9A 4MGYR 2RCNA 1UAAA 1V43A 1NVUQ 4OHZA 2QAGC 1J70A 1WMSA 4WVFA 1NMXA 4JJZA 1BYIA 1GFIA 4EQ6A 2WTUA 1VCMA 4A6XA 3V9PA 4DSUA 4B3CA 3A8TA 2VSXA 2GDJA 3GLIE 2AFHE 3LV8A 4F93B 4PHFA 5LPNA 5FBLB 5J4YA 3KJEA 3FPAA 4TLEA 1CULC 1ZNXA 3K9NA 1TEVA 3QENA 4EPVA 1E4VA 3A4MA 3TR0A 3PUWA 5KSPA 4E09A 4FMDF 3GLFE 3G82C 4LV5B 1E69A 1UFQA 2QPOA 4QJ3A 4WBSA 1GAJA 3NC0C 4UXIA 4X8LA 2BOVA 1JECA 1LY1A 1J90A 5EJEA 1VYVA 1GRQA 4P4SA 2YWHA 4DJTA 1NNEA 1G291 2WOJA 2QTVB 4OJQA 1Z0IA 1JAIA 4Y0VA 1KDPA 2AKAB 4DLUA 1H8HA 2PX3A 1R4AA 1W46A 5JSZA 1DAMA 3UG7A 2PT5A 1XMJA 3QNUA 3IHWA 1Z2CA 3BE4A 3VKHA 4KVAA 1NLFA 5GJBA 3LH5A 4LYHA 2ATVA 2BBWA 2F7SA 2EFCB 4BUJA 2YKGA 3PFIA 4HB3A 2ZAMA 3QKRA 4BFUA 3MWLA 4BGDA 2O8BA 1FUUA 4EFMA 2EFHB 3LAWA 2ZJAA 3NBXX 4KJZA 1E0SA 3OF5A 4OL0A 4QKQA 5C4MA 5HZHA 3WP0A 1QHIA 3EIHA 5FH9A 4M9QA 2V7QD 3HDTA 1SXJB 1GKYA 5JECA 1COWA 2QEQA 2KE5A 1YZQA 4HUQB 5CJPA 3TAHA 4DUGD 1KMQA 1LV7A 3BRWD 2HXSA 2JATA 3EPKA 4QHYA 3TBKA 1NIJA 3MFYA 3AP2A 2AWNA 3BGWA 3JZMA 2IX3A 4LHVA 2XX3A 1WQ1R 2GTPA 3QIAA 1Z6YA 2BMJA 3SJBA 4QGGA 1IN4A 4M1YA 4A0HA 4U7DA 2GBLC 1KI3A 2FWRA 2W00A 2A30A 2ZRCA 2VLIA 1NF3A 1XDBA 1IY0A 3VX3A 3CF6R 4C0AC 1KI7A 2XSZD 1E0AA 2KJQA 2R6AA 4ZI2A 2A2ZA 1TU4A 3ZH9B 2C9CA 2WMOB 2OE2A 4GL2A 2QORA 4YXWD 1UBCA 4FW9A 4HAUA 2BMFA 2QM7A 2QUZA 3B1ZA 4DIEA 2RGNC 4DT1B 1JR3E 1IY1A 4M1SA 1AK2A 3O47A 2JIZA 4LJ4A 4B6EA 5BYJA 2IYLD 4B3XA 1KKLA 3QQ5A 1P75A 3P26A 3CWQA 2R8RA 1F2UB 4FMCF 4Q00A 5JS7A 2WMNB 1E99A 4B73A 4JBYA 1IHUA 4NYIQ 3I8XA 4Q48A 3AVYA 5FBWB 2GILA 5K8IA 4M4SA 2UKDA 3NHBA 1Z0DA 4QJ5A 4RD4A 4PANA 4DCNA 2REBA 5HPYB 5IF9A 3TQFA 4G5QA 2BVNA 4MQBA 5EZ5A 1E9CA 2EQBA 4OI0A 3GD7A 4MA4A 1W0JD 4XD7A 3F0TA 2RKOA 3IILA 1OYYA 4LUCA 2Z83A 2PZFA 3RS5A 3VKWA 4DCTA 3VNVA 4IVPA 2JEOA 1OHHA 3QXCA 1IM2A 3RANA 3VKGA 2G3YA 2CHGA 2CCJA 3ZIAA 1S0UA 1TUIA 4Q9JA 4LCBA 2RH5A 2J46A 2NGRA 1SXJD 3A6PC 4P3YA 1N6KA 2VIIA 3ADCA 3TUIC 2YVUA 4Q1CA 5EP3A 1I2MA 3TUZC 4HAYA 1N5IA 2A5FA 2OCAA 2ZJBA 3A36A 3I5YA 3L0SA 2PMKA 4BLTA 1GNRA 3I4LA 1GL9B 4QNRA 4US0R 3IQWA 2VL7A 3KFXA 5CJ2A 4M21A 3NXSA 4HSEA 3RDPA 3IIJA 3L2OB 3B1VA 3PEVA 1P2UA 1E98A 3K9GA 2KBFA 4JL8A 4NH0A 1SGWA 4TT3D 3DPUA 2D06A 4JLVA 2HLDA 1DOAA 2BBTA 1U8ZA 3TLXA 3GJ3A 2PLFA 4IOMA 1XJQA 3EZFA 2HF8A 4AYWA 4MUBA 4JT4A 3R8FA 1AIPA 5GVRA 1M7BA 2R6GA 3V4RA 5DIFA 3WHKA 3ZVNA 1KY3A 5FUVA 4IDNA 1SXJE 4QNMA 4LJYA 1G8GA 4URYR 1XPRA 2ZI4A 3CWZA 1S96A 4Q1AA 2HYIC 3QXJA 4HZIA 5KTYA 4KVGA 3H4MA 3NH6A 4IVRA 2DWOA 4E5UA 1KHTA 1P9RA 2EYUA 2C03A 3B9PA 1W1WA 1TF2A 3TNFA 3TGPA 1FX0A 4TMKA 5FTLA 1KOFA 2G0TA 2GAOA 1T8TA 2GNOA 2VTKA 3FMIA 4KSBA 4QM7A 3C8UA 1VIYA 1P62B 2QU8A 3LBNA 1CS4C 2FH5B 4MYCA 3U3OA 1E2LA 1DAHA 4DIDA 4CGZA 1WXQA 2J7PD 2FN4A 1YZUA 1XJCA 5L8VA 4G0NA 3RRZA 2KI5A 3CM0A 3SDZA 1OXSC 1YZNA 2QSYA 2X19A 5TARA 3VMFA 4CEIB 1OFTA 2IL1A 1Q1EA 1YRBA 2KSQA 2XNDD 2YWGA 2ZE5A 5K8UA 3THWB 1IAQA 1OKKD 3MRSA 2IUUA 2QP9X 3R8CA 4OHYA 3CRRA 4JS0A 3CRQA 1HQYE 2QN6A 4M2LA 4BLQA 3PVSA 2YINC 1R8QA 2GZAA 2DWQA 2GJ9A 3DHWC 3SU8A 1S9HA 3QE0A 4Q5IA 1DARA 4GOXA 4JVLA 1E2JA 1T5IA 1G16A 3B78A 4QJ4A 2F43A 2PX0A 5CDFE 4GFDA 3QI2A 4US1R 1HURA 2X77A 3LQQA 2C78A 4G5SA 2MSDB 5SZHB 2ONKA 1OIXA 2WOOA 4QGFA 3PV0A 1H8HD 4TL6A 3S1AA 1TF7A 4GOJA 1C4OA 1UKVY 4IOLA 4URVR 4OJKA 1MO4A 1NN1A 2WKRA 3FKSA 3AKCA 3GJ8A 2ZRPA 1SVWA 1M1YE 3KDSE 1RVDA 4QGHA 1A5TA 4K81B 3RS0A 3OESA 1NG9A 2WKPA 4IW3B 1VTKA 3PQCA 4A36A 1N6RA 3NTUA 1KY2A 3CUEF 4MYTA 1L2TA 2FFAA 3CPEA 3DKPA 2FFBA 3SQXA 5DI3B 2ZQ5A 1Q44A 2F1IA 1NL3A 3KB1A 1A2BA 1J2JA 2J0QA 1KTVA 2ZETA 2DYKA 1HTWA 2ZRKA 3K09A 3GP8A 4Q7KA 1OJLA 5KSOA 3FE2A 4N1AA 2WIAA 3D31A 4PPQA 1JNYA 2I3BA 4WZBE 3R7WB 3ZS8A 2EW1A 1SXJC 4ZKEA 2AKYA 4LOAA 4J0QA 2FFQA 4QBFA 1XEWX 2C99A 2J87A 4DSOA 3FHTA 3ZIAD 1PUIA 4V0KA 4MRSA 2DR3A 4D80A 1ESMA 1ZD1A 2QRZA 4MYUA 1OFIA 1YQTA 4W5HA 1NVWQ 4F91B 4FWTA 3PIRA 3GLIB 4Q1BA 4WIAA 1EXMA 3TSOA 2ZR0A 1DE0A 3BWDD 3FOZA 1VHLA 3D6TB 2H8KA 3K53A 2IK8A 5A5GA 2P6RA 1KNXA 1MO3A 5FI0B 3QSYA 1G7CA 3AF3A 2Q9AA 4LZZA 2JLSA 4DEYA 1KMHB 5EUQB 3U3MA 4PSAA 2FFHA 4YONB 1XTKA 1KI8A 4FD2A 2QZ4A 5L3VA 3MUFA 3B2EA 1TF5A 4LBZA 4LHYA 4NCHA 1U90A 2JIZD 3CLVA 5C1BA 4EJSC 1AZSC 1KJYA 3OEHA 1U98A 2Z4RA 5AJWA 1SVOA 4D6PA 4DT1A 4BEJA 5JHHB 1KK1A 3OIUA 3UPUA 1WBDA 2IXEA 2CHQA 4LBWA 4A1FA 2G6BA 1YVDA 4AIIA 2YC4C 1CRPA 3DEFA 2QAGB 3QVVA 3AVTA 2IS4A 4CDGA 4AYTA 4AD8A 3QBVA 1Q0UA 2IXGA 3W6NA 1CR1A 3U3KA 1TUEA 5CIWA 4C7OB 2FPKA 2PLRA 4GT1A 2ECKA 1D2MA 1UKZA 4QRHA 1KAOA 1RIFA 3ZDQA 3B7GA 4P31A 1IN6A 4Q47A 4TLAA 1RRPA 4XIGS 3TSWA 3TUJC 4FI3C 4WXPA 1NN5A 1LS1A 1YRAA 2VH5R 1D9XA 3P27A 4OKSA 3RABA 1BMFA 3UATA 1MRSA 5HE9A 4RFSA 4URWR 2ZYTX 3IQXA 4L9SA 4AKEA 2YNMA 3NDPA 4HUQA 3BFXA 4RZXA 4QGAA 4RFVA 4Q21A 5E95A 5G3ZA 5KUTA 2XXAA 4N0EA 3P1JA 4WA7A 2WICA 1TEXA 3KXKA 4C0BA 4KYIB 3PITA 3TKLA 2EFEB 3RLFA 1E9FA 4LV6A 1GNQA 1XEFA 2KB0A 2WJHA 2ZVQX 4M1KA 3QKRB 2MSCB 5FPYA 4TT3A 4X8OA 1W4AA 2D4HA 3LFUA 5AJZA 4ZDIA 4ERNA 2W6JA 3TIFA 3GJ0A 1EWRA 3SFVA 2AD1A 4RD2A 2IS6A 4V0LA 2ZU0C 3MWYW 2O5VA 4S35A 2HLDD 3AUYA 4HZUA 5A0FA 1FOEB 3Q7QA 1P7CA 1FZQA 1TTTA 1N0WA 3DKVA 2IYXA 1NBMD 2WZQA 3EW9A 4BZQA 4D0LB 2WWGA 5GJVC 2JDIA 2ZIAA 4MRPA 2RMKA 1J8MF 5B57C 1KDTA 1G4UR 1ZRHA 4W7SA 4LBYA 4CRWB 2ZSDA 4JVSB 1FNMA 5HR5A 2QPAA 1DAIA 1GRRA 4JLKA 3W9YA 4WW0A 1BYUA 2V55B 2Z5FA 4TYNA 3K70C 1N2CE 4YMWA 1J99A 2FE4A 1RPZA 2QNRA 3ICEA 4M9XA 1PLJA 4HB0A 4DLVA 5AR1A 1CR4A 4DHEA 4HAXA 5AJYA 2ZS9A 2ZYVX 3SQWA 1F6BA 3A37A 2IXFA 1P2VA 2RGXA 3FFBA 4ZI3A 2CE2X 2V4ZA 3E1SA 3DZDA 1RRGA 1XXHA 2G1JA 3EAQA 3U4QB 2R62A 4K8OA 3ZZUA 2O8DB 3SYKA 1ZC4A 2WWXA 2JLZA 1B23P 2V7QA 4MKFA 1I4TD 3ZQ6A 3B8HA 4YDHB 1AM4D 3GCGA 4IVQA 4JLDA 2FDCA 3TW4A 3QF4A 5HKKA 2W2VA 1QRAA 3WBKA 4FN5A 5KYKA 1P6XA 1SVLA 1W7AA 1E32A 4DSTA 4CIDA 4URXR 1O3YA 5TY0A 3O8BA 3KQUA 2EFGA 1W49A 3KKQA 2IBMA 4XOIA 1GRNA 4NCNA 4ZCIA 1E9EA 2CVHA 1H65A 1Z5ZA 2BJWA 2PH1A 1XJ0A 2ZREA 3CX7A 3RSOA 4D0NA 1ANKA 3GLHE 3NBYC 5E7JA 3ZZTA 3L8YA 1CJUC 3KB2A 1R7RA 3ADKA 4TMZA 5L3QA 1II8B 5EP4A 2EWWA 4CW7A 1E4YA 1LF5A 1W4RA 1JQJC 1XTQA 2CL7X 3W5JA 4TQ9A 2FPMA 1T9HA 2GXQA 4KSCA 4PZLA 3UG6A 2QMUA 1CJTC 5FOXA 2ZUDA 3GFPA 3P20A 3QPVA 1YZKA 4IXMA 4JLNA 4NE2A 3PCRB 2QBYB 4YDSA 4O0MA 1XEXB 1ZINA 1RYHA 2EWVA 4C0LA 1R0YA 3GFTA 3K0SA 3Q72A 2CLDX 1WBBA 3CO5A 3QF7A 4D81A 2QMEA 1W47A 3U4QA 1TL7C 1KO1A 1WF3A 4Z8YA 1BH2A 5ANRB 3U5ZB 5DGXA 3M6AA 4CZ2A 1X8LA 3Q7PA 2QI9C 4ITRC 2AFIE 5FL7A 5E4FA 4Q02A 2X8AA 2QE7D 2W83A 1NVXQ 1UBEA 4UJ3A 2O8CB 4UJ5A 3NKVA 3U3RA 1ZAKA 3LXRA 2Z4SA 2XNSA 2W6ID 1X6VA 2C2HA 3BFVA 3C41J 2WKQA 1A7JA 4RCZA 3BS4A 3IDQA 5FTMA 4KLNA 1EK0A 3BXZA 3LQRA 4I1UA 5TXGA 1CJVC 1T3HA 3CRW1 3T15A 5H70A 1RE0A 4JZKA 5CITA 3MWKA 3LA6A 3FMFA 1WA5A 1S9DA 3MWJA 4LSGA 1UEJA 1JXOA 2FMXA 1SQ5A 4RD1A 2R9VA 1W5TA 1MO6A 3QJYA 4Q66C 2GA8A 4LRWA 4TMXA 3B9QA 4Z8XA 1G3MA 2BM0A 3CF2A 2QY9A 1MT0A 2V8OA 4N3NA 5E7IA 1FQJA 4F92B 3M1IA 2ZROA 4XH9B 5JJLA 2HCJB 3K8YA 3KXIA 2W58A 4Q1EA 4JLJA 4G3XA
chains in the Genus database with same CATH superfamily
4MDHA 2QLBA 2CNPA 4ZYZA 3UGKA 1IY2A 2QEBA 3EC2A 1S2LA 3RUDA 3H97A 4MVXA 5G3YA 4QPPA 4XYMA 1JVBA 2I6XA 2VXCA 2WNHA 1X8JA 3CLTC 4G4JA 2FZ4A 4EECA 5HCIA 2IF2A 1E9BA 4S0ZA 2PR2A 3CN7A 3IUJA 5EGSA 4ZCMA 3CY6A 4PLCA 1M2JA 2RONA 1UBMS 3MINA 1XK7A 1IMOA 2WJIA 2CMDA 4RMHA 1GZ3A 1QBKC 1OWOA 2PUDA 1KI4A 1FTQA 4KEAA 1K89A 5KVAA 2QDIA 1CQJA 2CXTA 2DPYA 1RP7A 2YRXA 3MLEA 4OSPA 4F8EA 4DZTA 1IUKA 3EC1A 5HYDA 1UBKS 3EMDA 4OOFA 3P0EA 4P4UA 1E7WA 1JHRA 1RJDA 1QH0A 2FZCA 5JZVA 1G5IA 1MKYA 2R96A 3ML1A 4KQEA 2IHBA 1VDMA 1QR2A 4EQZA 3VYWA 5C8YF 2IWRA 4ZANA 3GYBA 5DI9A 4Y98A 4CMEA 4Q3CA 5F3DA 1AUIB 1YU6A 1EJ3A 3OB2B 2VJMB 2ZXEA 4INPA 2EGGA 2JJ2A 5TGDA 1GZ5A 2BR3A 4JQCA 4MSPA 4AB1A 3ZHRA 3MSEB 3ANNA 2YOFA 3F8TA 3JQFC 1CK4A 1ODTC 4XASA 2RDMA 1RWBA 1OC4A 3ASVA 3C6YA 3KXPA 4Q3LA 4A16A 1EX6A 2JJ1A 1X92A 3GDHA 3I0MA 3I34X 5CSNA 4QUEA 1B8PA 1KZ1A 2B92A 1VPDA 1EBFA 1NRIA 2WVHA 4X64B 3MK31 3M6LA 1C9YA 3QXXA 4OMCA 2C3MA 2BHSA 2UAGA 1C7VA 1B8VA 1N7GA 4H1VA 3UYKA 4KIGA 4QDJA 3ANMA 2IHTA 4WN9B 3MT7A 4NVRA 4D8YA 4CLRA 1GL7A 1OLSA 1TA4A 2ZRJA 5H3HA 1IWBB 4L8LA 3U9LA 2QD3A 3NV9A 4M38A 3TLKA 3VBEA 3DMNA 3IHKA 1GNSA 2BONA 2CVFA 1KMHA 3HFJA 2Y1OA 3H5NA 4AJ4A 3NYWA 2HWUA 2YQZA 3I5IC 2XWBF 2ANBA 4NDZA 3TM5A 5BWNA 4D9NA 4RPHA 2H3HA 3NEPX 4DLNA 1PVOA 2XCOA 4RK0A 5KEIA 1JDSA 4FJ0A 3CPJB 2OPBA 4H7EA 2PL9A 3P9PA 4OH7A 4QDTA 3T7IA 1QP7A 4IGIA 2B5WA 2ZT5A 1ISGA 2CYCA 4OCZA 1DCKA 3ELBA 3OZIA 1XZQA 4HLUA 1Q22A 4W5RA 1MOSA 3ETCA 3PR1A 3CVXA 3I73A 2EW8A 3W8DA 1JFFA 3CUTA 4KQ2A 3FIUA 4MRNA 2VDVE 4ISBA 4C07A 5JHGB 2EKBA 2AYXA 4TTJA 2RHMA 4OU5A 1TK9A 4CUKA 3HDQA 1Z63A 1EVQA 3BVPA 5H0IA 2OGSA 3EIQA 3L6EA 2KAYA 3PA6A 2PRJA 3MWDA 2F1OA 2R6CA 2PSHA 2YBDA 1T1IA 4PAQA 4RYDA 4JYBA 1W75A 3R7BA 3VOTA 3QXHA 4HI0E 1II9A 2CD9A 3FWKA 2HEIA 4YO7A 3QUTA 2C4TA 3AIMA 5TPZA 4AMYA 5JRDS 1RI4A 2QT1A 5J2TA 1BC5A 4PX2A 4QBKA 4N8DA 3ND9A 4Q0MA 4OK6A 2PEZA 4CKCB 1ZD8A 4BEVA 2C5AA 4G2NA 4JJKA 3R9XA 3A6LA 4XUEA 5EMJA 2V97A 2YUIA 2HLHA 3HRHA 3B3QA 1K7FB 4MR9A 4O59O 3IP5A 5I7FA 3D73A 3KXDA 4K6MA 4MI6A 1Z4JA 4MGEA 3N2GA 2NQ8A 1W36D 1GTL1 4LMRA 2UZ4A 4HVLA 5BNWA 4LXGA 2VSOA 4IL1A 3OC0A 1OGJA 2A5DA 2VHVA 3A4LA 3OSUA 2B34A 4A26A 4CKEB 4A2CA 3GR6A 1U5IB 1A8UA 3QMEA 1H2EA 1AB5A 2ADFA 1WCV1 3H9UA 5I9MA 2NTYC 5L7YA 2FSGA 1CTQA 5TQJA 2QTWB 1J6UA 3BMQA 2PS0A 1QHYA 5BQ5A 1YK0A 2FX3A 2CBZA 4UNRA 4BVGA 3PNPA 3S1AB 3K2QA 1SQFA 1NR1A 1EINA 1V3UA 2J31A 3OQBA 5TT1A 3LQKA 1CUWA 1P9NA 3GWGA 1DBRA 2O57A 4OSEA 1JDZA 1SR8A 4GLOA 2B1IA 4Q82A 4EB3A 4BCCA 1Z68A 1NVGA 1W88B 3KEMA 3GLQA 1OFUX 4B2IA 1QVRA 2ZITA 4GPZA 4JJ8A 4EB0A 1WZIA 1TK2A 2IHJA 2J41A 2G63A 3HADA 1H85A 1QGUA 2WT4A 2Z5VA 1Z06A 1QO0A 4KGVA 4XXHA 2WFZA 4BFWA 2VCHA 4CV0A 2VHUA 2A1TR 3EPRA 4QRDA 1G18A 4COOA 1IB0A 2FW7A 2HA0A 1TLTA 2BT4A 4TXJA 4DRXB 3IVTA 3G2IA 3OTHA 2RG1A 3WJ7A 2BIFA 2YYSA 1WUKS 1YBAA 1OAAA 4YGXB 5JNWA 2CZCA 2J45A 3WKCA 5FV4A 2Z3WA 2IPNA 1AK9A 2JT8A 4LVNA 3NG1A 2V4UA 5E9AA 4B4WA 1JQEA 4XCQA 3WA6A 4RKEA 4BHTA 4CLEA 1GSHA 2UYGA 2R44A 2QJRA 2NO7A 4J1NA 1AKWA 2DFTA 1DC5A 2NO6A 3C3MA 3KD3A 5JMPA 4IS2A 1Z88A 4EZIA 1UC4B 3HV2A 3FOBA 3CZRA 5K6RA 2ODEA 1SCMB 2RGGA 4R1UA 3WIEA 4ZVRA 4C6RA 1N3BA 3U4HA 1C3VA 4L08A 4ZQHA 5B58C 5DFAA 5GY7A 2IH4A 2DPXA 3L6RA 2QBYA 2BEVA 3BIFA 3HBLA 2XY4A 3LVQE 3EZNA 5D1HA 4GI7A 1KEWA 3UCFA 4YDQA 1R0CA 2B1GA 4UAGA 5KX5F 3L0CA 1KCYA 5LLTA 2BMDA 2JCBA 1I0LA 2ZSUA 4XIYA 1F60A 2C77A 1ESDA 1SEVA 2HJHA 2AR7A 2WZBA 3N8DA 4IFEA 1JW9B 2HJGA 5ENDA 3ZNQA 1TPZA 2OV4A 1M73E 3MB5A 3OU6A 4KWTA 1TX4B 1V5IA 5HA5A 4BMZA 1X3SA 1KZHA 5I7VA 4D25A 3MRXA 5FHQA 3Q3VA 2Y8EA 6REQB 3KFVA 3D0QA 1HEIA 3GJQA 5I9IA 2WUDA 2B94A 3SX0A 4RZUA 1KYWA 3ECCA 3QKSB 4DY4A 4COKA 5LDDC 4OIMA 3DBVO 3OLVA 1OF1A 3RJMA 4L5IA 5HP4A 3A10A 4BVAA 4CIBA 1Z5NA 4MICA 4Q18A 4IO0A 4TS4A 5C31A 4R5HA 4GXTA 1QJCA 4CLXA 3WICA 2FJUA 2PUWA 3K0EA 5CGQB 4ZT6A 4RTJA 1MLDA 5IJ0B 3NUQA 3NDIA 4GRAA 1NX1A 3F3KA 5DYGA 2WSLA 2QOEA 1Z8NA 3AETA 4J9VA 5CEFA 3SHVA 4K9PA 1MH9A 1EA5A 1TM3E 1EGMB 4MGZR 3V6LA 2HK7A 4BB5A 1XDDA 1ZSNA 2Z09A 3IDFA 1D7OA 5LKRA 3O83A 1BKDR 3KALA 3OJLA 2ZBGA 4QU9A 5CH8A 2FRDC 5GZ3A 1HT2E 5LOVA 2BGRA 3AR7A 1OMOA 3AP1A 3PI6A 1Z2NX 3ZGLA 4BVLA 3TPFA 4MMYB 1B43A 2DKNA 3K09C 1TT7A 5JI2E 2V6GA 3VRQA 4YRQA 2XRYA 2D0OB 2L51A 4V0OA 2VYFA 1V71A 4I81A 4W7IA 1GAQA 1L7EA 4QDUA 1ZO8A 2BI4A 3HKBA 2LNKA 5BR7A 5JCOC 2AFIA 3FBWA 1TD1A 1YB6A 1LDGA 2XB4A 1IG5A 3NHRA 5HCNA 4ZICA 1TTXA 3LUGA 3TF5A 4EA7A 4AWXA 1MXLC 3KZ1E 5JOQA 1SH7A 1FFEA 2QRJA 1NYLA 2CDNA 2YX1A 3Q3HA 1Z82A 3GH3A 4IRUB 3VOBA 1ICIA 1KDRA 3TJMA 4DWVA 2F8TA 4MW9A 4CMIA 4F60A 1ZK2A 3DUFB 3KV1A 1UF9A 3DDWA 1ACJA 4GU5A 5CFNA 3EOBI 2Q4RA 5GIOE 2LDXA 1HDEA 3SDBA 1O95C 1E8MA 2A5GA 1HDOA 5KTSA 2EW2A 1G6Q1 2AHRA 4GDMA 3BFHA 1E1QA 4Q15A 1VG9B 4ESVA 2GEDA 1IBKB 1AZLA 3CABA 1KMNA 2GBGA 1W581 5KBYA 1HM5A 5BOSA 1IH0A 1RXSA 4QEZA 4N39A 3C3AA 3T7SA 1ZWLA 1YB2A 1ORTA 2C98A 3NVAA 4P35A 2ZE7A 1DTWA 1NLMA 1DBIA 1YZGA 3M9WA 2GEJA 3OF3A 4R81A 3PKJA 3WIBA 4A0GA 1VL8A 2NVUB 3T06B 1C50A 1ILEA 3BQ3A 2ZT6A 1P7YA 1WW8A 1HNZB 3F5FA 3ZXSA 4K0KB 3O4XA 2QRHA 4Q3NA 4ZXFA 3ONDA 4XSGA 2D7DA 1YR1A 4J2OA 3CNQS 2C8JA 1WL8A 4BLRA 4TROA 3HKCA 3DZGA 1OH6A 4I5EA 2NQ2C 4OQEA 3JV7A 5EE5B 1GQRA 1HT0A 1J00A 3OOEA 4C6TA 2X4IA 3PQ7A 4LGVA 4RK6A 4FGWA 2GV5A 4QPJC 3AI3A 5JAOA 3GW8A 1D2AA 3CVVA 4IGFA 5JVDF 4BRWA 1RM5A 3HLYA 1NAIA 1OU4A 3L6UA 3FLBA 4B44A 3F73A 3LRPA 4EVRA 2H1RA 1ORRA 1C81A 1MX1A 1QF9A 3D4NA 5LQCA 3VSAA 2VJPA 5TQ0A 2IIVA 2XZTA 4E22A 2C9MA 1IHYA 4L22A 2JKYA 1H8BA 3GJXC 1J7PA 2WU0A 1Z4QA 3COJA 3GLGB 1JEDA 1V7PC 5AVWA 1DC8A 1XTZA 1DGQA 1RZ3A 1S4QA 1YRHA 3WRXA 2B78A 1QKJA 2FR1A 2FHSA 4ZP1A 2D5LA 1MO2A 3ZIDA 3DHYA 4RJJA 3A11A 2JKVA 3CT4A 1NVBA 3H11B 1OVMA 3FZQA 4AN1A 2BL0C 1QV1A 3P4XA 5F2KA 5FYDA 1PJAA 1JJIA 3ZBQA 3C4QA 3M9LA 3RTEA 2LMVA 1PT7A 2WCLA 4BTEA 1XZBA 5K3OA 3WO1A 4P4LA 3D0YA 1NVTA 5F23A 1PQPA 2BF4A 3ONNA 5E2BA 5TGZA 4IM7A 3QFHA 1XCPA 5ALVA 2YHIA 2XUAA 5L45A 1NVDA 1CY7A 2GEUA 2R8OA 1ITZA 3OE7A 5JNSA 2A1UA 5ILQA 1PK7A 3FUTA 3WMEA 5T7BA 2XTAA 5JMWA 3WY9A 2Z3ZA 4D26A 1SFRA 2KWIA 1K8YB 3LCRA 2AEMA 4UC0A 2LIVA 1MAHA 2YCLA 3P9KA 4OQ4A 4B76A 3ADDA 2YJNA 4FSDA 2LR0A 1NP6A 3L1KA 4MLPA 3UJCA 3DS8A 1A98A 1QHSA 2MYUA 3REGA 3JZFA 1H1TA 3EK4A 1U2ZA 3ZKAA 4R9UC 1ZW6A 3TXXA 2AZXA 4HQ0A 1J7JA 1BFUA 2GVNA 2EEZA 1HEYA 5SY6A 5L53A 1KH1A 3TNDA 2YMLA 4NOLA 3VH2A 4B34A 1XLWA 3FWHA 3N5KA 3RM1A 2W2OA 1E9SA 5DX8A 3VJKA 4CL0A 1R88A 4YV1A 1E77A 5K45A 3GJ5A 2ZFUA 4M88A 2W6NA 1WV0A 4DJEC 1X42A 2XUZA 2IYNA 1M6YA 2MU1A 4AF7A 1J2YA 2O7QA 3SXUB 3SAJA 1DJWA 4KFUA 3R9XB 2AEJA 4WCFA 1ZHHA 5KWJA 3LD9A 4MB2A 4OQNA 1US8B 4IBOA 2YJGA 2GERA 3PJRA 4Q1VA 1N2SA 3D4PA 4IDDA 1SXQA 1Z33A 2NVBA 4KQIA 4EABA 1WHTB 1OPXA 4R1LA 3OP4A 1VCNA 1FDTA 1THMA 2DOKA 1BCRA 4C3OB 1TCBA 1YZTA 3VISA 5KYWA 3VR3D 3AT1A 3Q9NA 1F0KA 4DC1A 1PJZA 2R6DA 2OSVA 3BWVA 2C4MA 5AVXA 2WB2A 3N8HA 5JYBA 1UT5A 2EVWX 4YV7A 2NXWA 2BISA 1XMVA 2PUTA 3ZVLA 4XDGA 1JFFB 3OBVA 2WE8A 2JIRA 3CUKA 1NHWA 5LZ4A 3D75A 1XEWY 1ZK3A 4X95A 1N4AA 3QYPA 3WXMA 3ITKA 4DAOA 3HB1A 4UTRA 3TINA 3E8MA 2GMWA 1J22A 1DKNA 5IT5A 2VP0A 4GPLB 1IU9A 2BKVA 3Q8MA 2CJXA 2FJUB 3VR5D 2IQIA 4CVNA 1C1YA 2W8BB 5TB5A 4C76A 3LF2A 3M3HA 5EA2A 4MGKR 1TWOA 3UNWA 1IM8A 4P84A 4E08A 2F62A 4EA6A 2HNBA 2AYZA 3SYLA 5AO9A 4XJVA 1QCDA 1V5FA 2J0UA 1Z8FA 2ZSEA 1SCUA 5DXJA 1SXIA 1U0OC 3TRIA 4L50A 1OXVA 3BOSA 4HH3C 3O4VA 3LPCA 1JIUA 4ZT7A 2OFOA 4UTPA 1W1IA 1F7VA 1T6XA 2ZNDA 1F9AA 4PALA 1M3SA 4FCWA 4N7JA 1R4MB 3HWSA 2IYWA 3DLBA 1OXBB 1OOGA 2FN3A 5TGTA 3WQSB 4I5IA 3J7AC 1TADA 2V6JA 4AJKA 4HEA1 3UHOA 5L7TA 2D7CA 2N1MA 4P36A 2O8EA 3MVEA 2RK6A 2XNCA 3C8ZA 3DE2X 4ZTUB 1ZL2A 3MTJA 3RE1A 2JAXA 4A4BA 1IK6A 2B8WA 1I1QB 1A9QA 2Q0HA 5DLQC 4DRZA 3H4VA 3P94A 4CTOA 3BWMA 1W52X 1EP3B 3DFKA 1RVV1 2YVQA 1RRVA 3PNBA 3WA7A 3PHHA 2JLUA 3EKHA 1WKCA 4L3WA 4PBTA 3I5HB 4Q9KA 5C7OO 1A72A 2XMZA 3O1LA 2VUIB 4N48A 2CT9A 2BKIB 1A03A 1X38A 1CNMA 1J2UA 2FEOA 2R1TA 3BDIA 1IZ8A 1QIGA 2IBTA 1E3QA 3FFXA 3OU7A 1WBJB 3AKEA 5E1MA 1SHTX 2BN4A 2XGMA 3WNCA 1X13A 1OBVA 2RHWA 3GLHA 1P1CA 2CVPA 4FZ5A 4IGAA 4J9UE 5ERXA 5H83A 1X7YB 3IA7A 4JJ7A 3QUQA 4Z53A 1CLBA 5JTUA 1GQ2A 1SG9A 2H1FA 4B85A 1VLQA 1Y1SA 4P58A 1R0WA 3TE6A 3R74A 4AZ0A 4BFTA 4BB9A 3NGVA 2IYAA 3LGSA 2DXIA 2I7CA 3CONA 2DQYA 4DR7B 5DTQA 2PAFA 3RYFA 2NXEA 2J9GA 1IZ7A 2IIPA 4R2IA 5BYBA 4LS3A 2J9RA 1J5EB 5EPUA 1BX3A 3KZVA 4N0DA 5EHQA 4BQRA 5C1DA 2R79A 1NGSA 3CZ5A 4IMRA 2VNAA 5I7OA 2KFFA 1SKTA 3R0ZA 2GPYA 1GSIA 3PSRA 5BY2A 1KQVA 5DNUA 4CQNA 3JQ8A 4QPNA 3H0CA 4FUTA 4X20A 1AS2A 3KUXA 2WUEA 5T4FA 2G5TA 2V45A 3DOOA 1NP8A 2QSZA 4DDKA 1LPAB 1QK3A 2VSFA 1AQIA 2A9JA 3G59A 3RFVA 1EP9A 1K5HA 3UMSA 1SRRA 4XM2A 3O3CA 3EMBA 2X5KO 4PC1A 2FN9A 1Z47A 2KQYA 1FFHA 2ACEA 2DPMA 2VLBA 1Z62A 1NV8A 2Z95A 2DFNA 1H5QA 2GWRA 3H7IA 4NYMR 1CJMA 3HU1A 4QLBA 4HN2A 5AJHA 4PYKA 3L4AA 1FDRA 3BMQB 1TMKA 3INNA 3IXMA 4JUFA 5JWOA 4FNOA 1RZVA 2QTNA 5GZ6A 4F56A 5CVTA 3DDUA 4P32A 1BVHA 1WUHS 3CRMA 4PLWA 4WVLA 2YWXA 3VHXB 3EULA 1KA9H 4N6NA 3ZX4A 5C2JB 5HZGA 3VO2A 2BUBA 4EPWA 1KMCA 3FHLA 3NVDA 1KS9A 3UCXA 2XYHA 3MAGA 1U0TA 5IVIA 2IE0A 3ZD7A 1VCHA 2Z5GA 4X3OA 1W2GA 2LIPA 3SG0A 4B33A 5D3KA 3P2YA 4UZFA 4DDTA 4ZEVA 3MJCA 2Q6IA 4ETWA 4V2UA 3TR5A 2HFKA 1DDOA 2NUAB 1N1EA 3IBTA 1SZDA 2RAPA 3TRJA 1OI7A 4P7FA 3GPLA 3B5EA 2CFRA 4QU8A 1G2IA 2L42A 1ZCBA 1RWOA 3QV2A 2NZXA 4EG4A 2H2DA 2X5NA 3O95A 1ECBA 2Y1WA 4JJEA 3X1JA 4D74A 4EHDA 4DV1B 1NUHA 3L5OA 1J39A 3N6XA 1KEVA 4DUQA 1H9AA 2QSUA 3G13A 1XFWO 2EZ8A 3EGEA 5IDYA 4ZDKA 5A9RA 1T14A 3DVSX 1DFGA 1GPAA 3N7TA 1JEAA 4EF4A 2DOQA 3DLTA 3O8CA 4N5DA 1OFUA 4B1FA 1M7HA 1LS6A 3SOZA 2PSFA 1VGRA 2G04A 4Q9HA 1U2GA 4E32A 1GTRA 3VZQA 3BEDA 3WGUA 4MCIA 2P6UA 2I7TA 3ICBA 1XZFA 2H4FA 3KNZA 5KWSA 3DBRB 3QX9A 3EASA 1JBKA 2C7RA 3ZI0A 1K6XA 4IFTA 4K6OA 4F1WA 2ZB7A 4HVTA 2DCUA 2QPTA 4UQOA 3SIWA 3IHLA 1THGA 4ZCLA 3B36A 1RXIA 3GRAA 3R3WA 4JL5A 2QTCA 4EHAA 2A0UA 4TVKA 1M1YB 4GNKB 1G3UA 1XHLA 3UGQA 3ZWMA 4RXTA 2C7PA 2XR1A 1TT5B 2LP2A 2BHRA 1TIPA 1YAHA 3EXHA 3KUDA 3OJ0A 4QUIA 4E2XA 3SWWA 1BU5A 1N5MA 4P86A 4OJNA 5JAMA 2IBSA 4X7MA 4DDUA 3D78A 1N25A 1YRQA 2PXAA 2Q1TA 3BBPA 3QKIA 4J0CA 4M8NE 1JLRA 4MLDA 5C3UA 3S1LA 1P0FA 3D6HA 4ENSA 3G8AA 4IQGA 3EZLA 5E4JA 5EFOA 4WFIA 4ER7A 1FDIA 5CVCA 1AGPA 3MJ4A 2LHLA 2V3VA 3HYNA 4BY9E 4QASA 1X15A 3MUOA 3A1SA 1HV8A 3B3AA 3NP7A 3AIKA 3VDMA 4WY8A 2VNJA 4ID3A 3RUIA 4Q7QA 1JSCA 2PZLA 1CYDA 3EBLA 4QTTB 5TMDA 5EQTA 3W8FA 4WSOA 2NPOA 2NLNA 1LLDA 1GGVA 2EFYA 4JXJA 4F5EA 3DC7A 5B4VA 4PZZA 4KYNA 3FCYA 3IRVA 4LRUA 1IN7A 5K89A 3FYDA 3IELA 4I9FA 5CXQA 1EUCB 3Q2IA 4A92A 4M9RA 4V0ME 1VECA 1M6HA 3RRYA 1QHGA 3LUJA 3A6FA 1SL8A 5AP9A 2I5PO 2HUPA 2WRZA 4M0UA 1NKTA 3Q7EA 1ADJA 2X0FA 4EEXA 1H0KA 3HCCA 5ADWA 5IVHA 1YH3A 3AOEA 2SCUB 1SK9A 1NFRA 3PG5A 3BH6A 3ZCVA 4YY3B 2XZOA 5ALLA 2AV6A 3BFKA 3EFHA 3K6SB 2XOKA 2I4RA 1VG0B 1NY6A 4GP6A 3RWMB 2CFTA 1AA9A 3L0YA 3TGWA 2ZP1A 3G49A 3A1NA 4MVJP 4NL4H 2WD7A 4HEA6 3RRMA 2XB6A 2OBXA 5JNTA 2OB1A 5ICMA 2VO1A 3GJ6A 4FZJA 3PQ6A 2HY7A 2QVCA 3Q5EA 3W3AA 4A5OA 2WQZA 4BAZA 1SCKA 3H3FA 3PYLA 4QXPA 1JG3A 2GD6A 1U8YA 2JFOA 1RLJA 4YRBA 1IY9A 1J2RA 1JFKA 2IVZA 2OYRA 2V3WA 4LKOA 1UKEA 1ZFSA 1XTIA 4O25A 4IMJB 1JDPA 1QKKA 2IUFA 4QT0A 3T0GA 1AV7A 4CMAA 3IUEA 1C4XA 4LVCA 2PZEA 3ZS9A 3WQQA 3NHAA 4WKOA 1QIJA 1SY7A 4FQ7A 2HQBA 3F5SA 3UKDA 4OHXA 3Q8LA 2RIPA 5LMUB 1YVLA 2DBRA 2FCAA 4WT7A 3ORHA 4D4HA 1YS2X 2Q9UA 3AY0A 2Q0QA 3MMXA 5GMOA 5C81A 1Z2CB 2NVWA 1VMAA 2EIXA 4MV0A 4FK8A 5CLGA 4OREX 3PFVA 5ERYA 5HFJA 2HV9A 3TQCA 2UYOA 3VVLA 5KC9A 3FWNA 2R6R1 1PK8A 4JUBA 3JVVA 2YQ4A 1QVZA 1A4IA 3WHUB 4X1IB 1L7MA 1U3WA 3SG6A 1T34A 3E23A 4LG1A 2OHOA 2HK8A 1UZMA 2BEKA 4KFRA 4YXWA 4FOTA 5K05A 3MGGA 3NC4A 3EA0A 3O8RA 1L4LA 4NK4A 4WAUA 2GN8A 2ZBFA 4P3PA 3S0DA 3H9EO 3L1JA 1SELA 3VVBA 3WMFA 2W70A 3ZR4B 4BO0A 4QGSA 2IYVA 2Q3HA 2XKBA 2IA5A 1WB4A 2VF4X 4I1IA 1LI7A 4G2TA 4BP1A 2ERYA 1GJYA 1BKYA 4MUGA 1MC8A 1GA6A 1UFKA 1RQLA 2C83A 3FTQA 3N2GB 1QWOA 2C4KA 3D2AA 3O4IA 3OEYA 4HL6A 4P5OE 9MHTA 3PCTA 4MVWA 4YIKA 1FEZA 4G07A 2H85A 3Q85A 1U2RA 1X7WA 4JIGA 3FW1A 1BIFA 4C0JA 4UBLA 1VKHA 5CW2A 3G7NA 3SGLA 3SQOA 1V1MA 3QU4A 2EJWA 1SB9A 2C07A 1P3Y1 4YASA 4D9CA 3ADBA 4YT8A 4YCSA 2B6HA 2VN8A 4RKYA 3L05A 1P80A 1ZBDA 2MIIA 5JIBA 4WA8A 4CN8A 5IUKC 1ZVKA 5HJ5A 1B93A 3KZXA 4PC3A 3YASA 3K73O 4JX8A 2YDYA 1A0OA 2GRUA 3GMSA 4MK4A 3RVDA 3ZHBA 2ATCA 1I4DD 1QHHA 1E1RA 2AXNA 4J0DA 2ZWIA 4U8DA 3OPYA 4KQXA 3DNFA 3VUFA 1H2HA 2GGZA 1V5EA 4BKUA 1V7ZA 2OMKA 1KEEA 2XLBA 2WIJA 4RQTA 3W8RA 1JU9A 4KTTE 4X3CA 1RAEA 1SG0A 4OXXA 4QYIB 5JO9A 3BFPA 3A1FA 4ZV4A 1GY8A 3UO8B 1Y3FE 3U4DA 2HREA 2PHZA 4EUSA 5FWNA 1JB1A 3L02A 3BZWA 2WHYA 3DWFA 2GBLA 5FI1B 3TXAA 2D0PB 1U63A 1SVUA 3RJ9A 1OKKA 1VE9A 1YI1A 1RJVA 1AKRA 1N8TA 3OHSX 4M7PA 2BFOA 3A6ZA 3DPIA 4M49A 2JFWA 3ZQKA 4EHLA 5C46F 4NTZA 3LL8B 2E4AA 1H8ED 5AOBA 3BMNB 2I3DA 3F74A 3SFZA 2B98A 4YRFA 4NYJQ 4Y30A 2FSFA 1XZJA 4C30A 2PUGA 2F1JA 4JBHA 1U0LA 5D3MA 1W36B 4H6XA 1FMJA 3KT6A 4ZQGA 2Q91A 1Y6JA 4ZZ0A 1K7SN 3QVGB 1JYSA 2CKDA 1L4BA 1G6HA 1FRNA 2WWRA 4TKMA 2E3JA 2QE7A 2ZSHA 3A6DA 3AOGA 3QOWA 2QE6A 2P65A 3BD6A 3JX9A 4RH1A 4KQGA 3S68A 3WSWA 4UBMA 2W9XA 4DBLE 1JLHA 2OXRA 1WDTA 4NCKA 3DVEA 5EKUA 4BEBA 1LJLA 4DV6B 2BC9A 1Y5IA 2FOLA 1QDLB 1WDLA 5DXAA 721PA 1OZSA 1TT5A 2AHOA 2XMBA 3P2IA 1PF7E 3WK5A 4WOBA 5T57A 2ENWA 2YHUA 4XVRA 1JNXX 3FFAA 1KK8C 1P5ZB 4JFRA 1FL9A 1AMUA 4FNMA 3LLMA 2PH3A 2D4AA 3OFJA 2PWPA 3NHJA 3R9KA 4HDCA 5G08A 4Z3OA 4BTLA 3FIJA 1F4OA 2SHKA 2Y99A 3HZHA 4F21A 1M67A 4TLCA 3O4GA 4H3SA 4S2EA 3AR6A 1CY2A 4CE6A 2YHIB 1G6OA 3UHJA 4UTXA 1RHUA 4IJWA 4UCFA 4YLEA 3OM9A 3MJTA 4YBHB 3OY7A 3ZLVA 2J1LA 4IIJB 1XTTA 2NZ0A 4OKIA 5FUQA 2MDTA 2ZGVA 3AFIA 4OLFA 1QHNA 2A0XA 3IBYA 4IF4A 2F3YA 1RJ9B 3AV0B 4R9RA 2XB8A 2JLVA 2JW5A 3ZWXA 1J55A 5B7GA 1R6BX 5F1KA 2OUKA 1XWIA 1CR0A 1XQYA 3HA7A 2GNAA 3CNOA 4G86A 2OCBA 2EQAA 2B9VA 5ER9A 3WL4A 3PNKA 4N65A 4Z1OA 1HYEA 1TRHA 4YCAA 5DBHX 4AU1A 2G0NA 4E51A 4W5NA 1G33A 2H18A 5G40A 1LDNA 3K9FC 1QU3A 2FSHA 1HA3A 1GPJA 1QH8A 4LIPD 5DNDA 4EPYA 3RSGA 1YE3A 1DQYA 4H60A 3AIOA 2ACWA 2YOGA 4GYJA 3R5KA 4Z7JA 4TS3A 2XKAA 2QRVA 1R9JA 2OKGA 1JR6A 2JVIA 1IJ6A 2EBHX 1VE3A 3E6AA 2P3QA 1KWGA 3ACBA 5A2GA 1SCJA 1A97A 4M0LA 3FUCA 3NTXA 5AVKA 4DWWA 4BNJA 1IQ5A 4RPKA 5F2NA 5ALKA 2YV5A 2BRUC 2XEXA 2KLEA 3RHFA 3THRA 1G1MA 2HUNA 3LY9A 5LBUA 5C5IA 3Q88A 4TSFD 4DLXA 4I1RA 2NPFA 2AD5A 1DB3A 5LOVF 1UXIA 2CHFA 1S6YA 1X02A 1VG1A 2ZR9A 4FQ5A 3UMGA 1W6RA 2NACA 2WI8A 2BMVA 3AF6A 4QFCA 5F2EA 4KDFA 3T9EA 1YAJA 2AOXA 1YA6A 5HIJA 1I94B 2GWHA 5K3FA 1HE5A 2VZEA 4MQ5A 4TSKA 3Q2OA 5FEMA 3VHQA 4MTCA 3SVZA 2ZT7A 3GFGA 3SR0A 2TRSB 3LTEA 2UXBB 3PDIB 3TIIA 1NX9A 1W85A 2VCYA 1ISJA 1QRRA 4IEEA 5BW6B 1TKAA 2WHRA 2YV2A 4EUNA 4DQUA 3N5CA 2LVIA 1QV6A 1NX2A 1KHHA 2ZB4A 2PSRA 1DTWB 4W9RA 4UDNA 3OEHD 3DWIA 1YBMA 1ZRNA 2BJVA 1YUMA 1ZUD1 2JVKA 2ZBUA 4X85A 2LCFA 1FFSA 1CZKA 1JG7A 1XYGA 1ZXLA 4KWHA 2Y1LA 4WZBB 5J59A 4NYMQ 2IOQA 4C14A 3NTOA 3IE1A 3ABQB 3L9XA 3RU7A 3K70D 3UM9A 1N6IA 2E0IA 2C57A 1PIWA 2BCJQ 2O6LA 4RZ3A 2PE5A 4DEVA 2GM3A 4AO8A 2NU6B 3KYDA 2J08A 4AZ3B 2JFQA 4Y8VA 2GF9A 5C8VA 3A04A 4XD2A 3KR9A 2HW8A 4BWVA 3ABRB 1Y1KE 4IH9A 5I4BA 1FJGB 5FLXA 3E81A 3WSTA 3WYAA 2IEBA 5FWXB 2QG4A 4NMHA 4R7TA 3HYSA 4Z3DA 5FO1A 4C88A 3KU1A 4RVHA 3BMOB 3DEYX 4PCUA 2BZSA 3TRFA 4BO3A 3AUAA 1CUGA 4WBXC 1FX0B 2ISCA 3SHOA 4CM1A 1BXZA 2GSDA 1STOA 1PR6A 3GH1A 4B9AA 3O82A 2E37A 1W5FA 3PN7C 4XD7D 2R86A 3L0ZA 4AMUA 1KIMA 1CUXA 1PV4A 5F9HA 4D4JA 4HWTA 5CLQA 3QE9Y 4XM0A 1VQ1A 2JBHA 2I4NA 1E3LA 4MQEB 4MRAA 1RI1A 4TMWA 4Q34A 3NNDA 3EGXB 4O4HF 4WBNA 4IKPA 2RBEA 4RH0A 4FYKA 2ZWVA 1GQOA 1DAKA 3IAXA 3JQAD 1C7EA 1E2NA 2ZT8A 3HBFA 4O2AB 5LMCA 2NO5A 3B5JA 1KQPA 2FQWA 1NN3A 3GBSA 2FLVA 1E1RD 3WNVA 3A7EA 3ZDRA 1KIFA 1TYAE 5DULA 3AF4A 4L28A 1I51A 3NOOA 4CG0A 2PS9A 3K21A 3DMYA 3Q6MA 4H7PA 1ISPA 4YQEA 5AI9A 8ADHA 1EX1A 4D3FA 2JDID 1OB5A 4U7GA 3QE2A 4QNNA 2NCOA 2PKQP 1N57A 4LFAB 3VKFA 3A28A 3ZHTA 2M7LA 4GLLA 5HKOA 5I2QA 5JROA 2KBMA 4LJ8A 2MWMA 3EIFA 2W2XA 2FDXA 1MTOA 1L5WA 2BMWA 4R2MA 2WAOA 2VP5A 1D4ZA 3QE3A 5D6NA 3LWDA 3WHLA 1Q91A 1RQXA 1XI2A 2NXNA 3M49A 1U7UA 2EGDA 3Q41A 4G24A 1KE2A 3ST7A 3QELA 1MBZA 1EGHA 3DL2A 1CHNA 4G0XA 3AKBA 3JQ7B 4V03A 4D3SA 1EUDA 4HWPA 2F9MA 3DHEA 4HLQB 4KUGA 4BVFA 1X94A 3PUJA 5KZMB 4B3DA 2VWGA 4OR9B 2WILA 2EC6C 4RNDB 1T9BA 1F8XA 1QG2A 1YVEI 2NYVA 1RKXA 5EZYF 5F4ZA 4EHBA 5MN6A 1FMTA 4KITB 3C5HA 3BN3A 4C0XA 3BFJA 1FTWA 2F1HA 4GSKA 4L74A 3M9XA 1C7IA 4RPGA 2V7PA 4J2HA 2P75A 1KI1A 2WU8A 1JQBA 1QTIA 2QN9A 3KQMA 4A7PA 5IX8A 3ZBPA 2EV9A 1ZMXA 4V3CA 4TSRA 2GPSA 1ECPA 1XFZO 3UPDA 4JJ6A 5HF8A 1H6AA 3NKFA 3IDOA 1SL9A 1FP2A 3N2YA 4MWCA 3MQ2A 4WK6A 4CEHB 3FGZA 4HNAB 4EI8A 1J7KA 2EBFX 2NG1A 2LTAA 4FP9A 4AMGA 2XE7A 4M60A 4AVYA 2QU7A 4XEHA 1U9IC 1P77A 4GUDA 1SY9A 2M49B 3UXMA 5AW7A 3O4JA 2QDKA 1KJZA 5LXTB 1R0LA 4BP9A 1OOJA 2PQ2A 2WYIA 3B6JA 3LL4A 3O90A 4I8XA 4I4TA 4K6GA 4UVIA 4KHPB 1C3YA 2F67A 2UZ3A 3GHHA 4BC0A 2SECE 1BE1A 3CA8A 3R41A 4JZYA 2R48A 1O0BA 3G8BA 4NESA 1HDCA 4HGQA 1F2TA 3PEWA 3GFSA 5D3QA 4DANA 4FR0A 2I0FA 4MV4A 2C94A 2FSVC 4XQCA 5D7NA 2YY6A 4X63A 3E61A 3CEJA 4C20A 3AONB 1AJEA 2C7BA 2QUJA 4KACA 4G65A 4U2CA 4ZMSA 4OF4A 4F6RB 5C51B 3EW7A 4XCVA 2I6UA 4GQAA 1W0KA 2PQ6A 1U81A 5EKXA 2G1PA 4EI7A 2FG5A 2PRYA 4D9HA 4EGFA 1L7XA 3A4UB 4LXIA 4B4OA 4DBLC 2V53A 1U28C 4UXHA 4ZI7A 5AVOA 3ET4A 1Y42X 1AN9A 3OM1A 4OHWA 4U7HA 1I3KA 3ROEA 4RFSB 2F1KA 1J5XA 2WUVA 3F49S 4RD6A 1YS4A 4KG7A 2EL9A 3DXZA 2W6IA 4MUJA 2ZI3A 1NVVQ 5C32A 2VDQB 3P0IA 2FB9A 1HDIA 1ZGCA 2FPIB 2DHCA 3M5DA 4D8WA 4KRXA 4YQYA 5TVGA 5KU7A 2VS1A 3LPDA 3DD4A 3S2ZA 1U9IA 1L4KA 3NBAA 1UK6A 3G0BA 4IEIA 3HI4A 2O8NA 3EBPA 5KNDD 1E1QD 4OYYA 3UGTA 5B7NA 2HQ1A 3WR5A 4PLYA 3JD1A 5EJMA 4XI9A 4QJIA 2G1UA 1QTNA 1ZOLA 3OCUA 4F46A 3L4LA 2CL5A 4FGKA 3TZLA 3ZX5A 2GF0A 1K5PA 3OLQA 4OVNF 1UT6A 1C0EA 3UMCA 4D96A 1DCFA 3AKYA 1ZNYA 3A7DA 1HTTA 1HNNA 1WAMA 5FORA 4FFLA 5CJJA