1DEKA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
240
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
total genus 86
structure length 240
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1dekA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dekA01
4A9AA 2AXNA 3FMOB 1G64A 3EA5A 4M2LA 4TMTA 2UKDA 4P4SA 1OH7A 2ORIA 2C5LA 1CS4C 1U8AA 4HATA 2ZUBA 1T3SA 4A6PA 2YINC 3L82B 4D25A 4JJKA 4Q00A 1P5ZB 1P62B 4XIGS 3ZZTA 1R10A 4BPBA 3UG6A 4F4CA 3AEZA 4IDOA 4DLVA 3R8FA 1YR7A 4MKFA 5HR5A 2FZLA 1M7HA 2Z43A 2HV8A 1V43A 3OIVA 2NGRA 4B3CA 1WXQA 1IXSB 1OYYA 3NEYA 3A1SA 2LWIA 2O8CB 4RD2A 4LPSA 3AF4A 3RANA 1Z0DA 3PR1A 3GLGE 1NBMA 3CR8A 1E3MA 3DKVA 2C9YA 1JXMA 2AN9A 1S4QA 3Q8XB 2ZRGA 4OL0A 4OQLA 5M04A 1DPFA 1LTQA 1UBFA 3G82C 2FU5C 4ZDKA 2ZROA 2J7PD 1AQUA 1G7CA 2QAGB 4KSBA 1Z0JA 3U7HB 4MDEA 1S0UA 2Y8EA 3RSLA 2GWHA 3A1TA 3GJ0A 3GFOA 4YMSA 1G5RA 2W2XA 4HDQB 2NZJA 4Q9KA 3W6OA 5JZVA 5FI0B 3B9QA 4HB3A 2QPAA 1E2LA 1VG9B 4HZUA 4DLRA 4ACAA 1TF7A 1TF2A 4RCYA 1G20E 1DBSA 4F92B 2YHSA 3VAAA 4P4UA 2HJVA 3QJYA 1KSJA 2IF2A 3QE0A 4Q9IA 2OESA 3LDAA 4XWKA 2PCLA 1ZM9A 4MH0R 3ZVMA 3K0SA 1FTSA 3P4XA 4ZO4A 3B78A 2CXXA 3PEUA 4OHVA 2A9KA 3BC1A 3TE6A 1W5TA 1E79D 5G40A 4EIWA 2XSZD 3CRMA 1KI7A 1YRAA 1XNJA 2BCGY 2WICA 1RYFA 3A4LA 3RS0A 4TLBA 3A6PC 2QT1A 1X6VA 1K6MA 2CE7A 4LC0A 2EFEB 3AP1A 3FMIA 4M9ZA 4TMWA 4EJSC 4L15A 4EQ6B 4PZYA 3GEHA 2ZEJA 2D7CA 1GRNA 1RE0A 4NCNA 2QMHA 3BRWD 3AQ4A 4Q9HA 3PEYA 1HUQA 1UPTA 3QVUA 1ZU4A 1DAIA 3K0CA 4DDVA 3QXHA 1DVRA 1IN6A 3JVVA 4TYQA 2XJ9A 1N5JA 4B3FX 3IUYA 4GDFA 4YQFA 1OH6A 1BH2A 3NC0C 3HYTA 3ZD7A 3RS3A 1J99A 4JJZA 4ZDWA 5A0FA 3PV0A 4Q1DA 1DAGA 1DAFA 5IF9A 2JLSA 2QU8A 2EW1A 4N0DA 3WHLA 4M1KA 3AVUA 2FSGA 3OFNA 2XZPA 1EFRD 3LX5A 3ZGXA 2ZIAA 2BBTA 1Z28A 4TLDA 3VNVA 1CJVC 1JI0A 4QL3A 2LKDA 4E22A 1Z8FA 1NVXQ 3AKEA 1NNEA 4LYJA 5EE3A 4M1WA 3AF1A 1VIYA 3ECCA 1TQDA 2H92A 1OSNA 3WMFA 2D7DA 1A2KC 2HLDD 1QVAA 4OI1A 3K09C 1EFUA 2O8BA 4AWXA 4FWTA 1OF1A 3HYRA 1Z6AA 1TQ6A 2QM7A 3QF4B 4AG5A 2C2HA 1RJ9A 3W8NA 2VSXA 4V0KA 2JDID 3KKQA 1OXSC 2VHQA 1L4UA 5H8WA 5TMPA 4Q5IA 2AD5A 5J47A 1QHHA 3ADCA 3TAHA 1S96A 4PO1A 5AJXA 4D81A 1W47A 1KI1A 2OXRA 2ZSBA 4JZKA 3TUZC 4PQFA 2JJ1A 3K0AB 3QBVA 5FTJA 4BFXA 3GLIA 1IY1A 2H8KA 3DZDA 4PSKA 4ZKDA 3FGNA 1SKYE 3DKPA 1GUAA 1QRAA 4LJ9A 4B74A 1GOTA 2RB4A 3WNCA 2XXAB 2VHTA 2WPDD 3L8ZA 4G5GA 4IEEA 1E9DA 2DFNA 2BVNA 2GJ8A 1G5PA 2AX4A 4RFVA 3HU2A 4JMPA 4JSYA 4Q4HA 4DLYA 5EXSA 3GFPA 2QTHA 2QY9A 4FWIB 4YMVA 1CIPA 4V0OA 3U6KA 1U0JA 2GHIA 5C4MA 1TTTA 1W4CA 2ODEA 4YDHB 1IM2A 3A1UA 4LSGA 5C46F 2CHVA 1II8A 2GTPA 1S9DA 4RFSB 5EZ6B 2CK3D 4R7ZA 3RWMB 5D3MA 4JLPA 1Z6TA 4PX9A 1PLKA 3OEEA 2CLCX 3RRNA 2ZRLA 4XSHA 2ZR9A 2PJRA 4XWAA 3FKSD 4I1OA 1A5TA 3LXXA 4LI0A 4EUNA 1XB2A 2WJYA 1FMLA 4IOJA 4DCTA 1E0AA 4CF7A 2IWHA 2GJAA 1VCIA 2ATXA 5CIWA 1CJTC 1W44A 3EZFA 4M9QA 1G4AE 3K0FA 4QGGA 1JNYA 3MMPA 4WXPA 3LVRE 3K70C 4XH9B 3CO5A 2ZE6A 4QBHA 3GFTA 2K5UA 5UKDA 1MO6A 1SXJD 1ZC3A 1CR4A 4PFSA 4EPRA 1OHHA 4L8GA 3PCRB 2F43B 1Z0AA 1NVWQ 1ZMXA 5DSZA 1Z07A 4EFMA 4YXWA 5F3WB 1G8YA 2QTFA 2NIPA 2OCPA 3IPXA 4EFNA 1LFDB 4CW7A 1E96A 3AP2A 4Q9LA 1E4YA 4LOAA 1EFTA 1H8ED 4OHWA 2JIZD 4II7A 4XJXA 2IYLD 1SVOA 3TIFA 5FPSA 3B2EA 5TVKA 1F48A 3CPHA 5CLQA 3OZXA 1XZPA 1A4RA 1V5WA 1XXHE 1US8A 3VNUA 1R8QA 4JS0A 2ZE8A 2O8CA 1AS0A 2F9MA 3BK7A 3HPRA 3PFIA 4J0QA 2HCBA 1X8JA 3TGPA 3BWDD 4C7OA 5E7MA 2DPXA 2P5SA 4LX0A 2X2EA 1QHNA 3L0IB 2IS6A 4FCVA 1KK3A 3ZLJA 3C41J 4NCKA 4I4LA 3RS2A 2V3CC 3C8UA 4MGIR 3RLFA 1UEJA 4D0NA 4P31A 1SHKA 3O8RA 3BB4A 2ASEA 2Z0MA 1U2RA 1ONBA 2RGCA 5AJVB 1DG3A 3A1WA 221PA 4RZ2A 1GFIA 3A36A 4OK3A 4KVAA 4MYUA 3I8SA 4QKQA 2YZ2A 3KKPA 1E1QD 1YJ5A 2XNSA 1WBBA 3P20A 5AWFC 3WBKA 1N6IA 2IYSA 4HEJA 4HB0A 2CL0X 4DLUA 1NVUQ 2FX3A 2XAUA 1DTSA 4OI0A 1XEXB 3H0KA 3T12A 5FPTA 1N6PA 2WM9B 1OLOA 3EZ7A 1WQ1R 2YVUA 5FL3A 1HTWA 5SZJA 4JSTA 2IUUA 4F91B 2IK8A 2WSMA 3AF2A 4G01B 3QOFA 5DO9A 1E0SA 1ZUNB 2XB4A 3CH5A 3IKJA 3L8YA 3QENA 1XZQA 4LPKA 2J3EA 5G41A 4B2IA 1I2DA 1R5NA 4AK9A 1WDTA 3ZYCA 1D6JA 2W83A 3K8YA 1XPUA 4PAOA 621PA 3H4MA 1KSFX 4MQBA 3TNFA 4AYXA 2G6BA 3QG1A 2QPOA 2D3WA 2VP4A 4FMCB 4HLQB 4KYUA 4DUGA 1R8SA 2QQEA 2AWNA 2VSFA 4MUBA 4OI2A 1ZCBA 1KYIA 1II0A 4B32A 2Q0HA 1MO3A 4NKRA 1OXXK 2ZSFA 4M1TA 3PXGA 2YWGA 5TY0A 5DI3A 2W0SA 4HB2A 3THWB 1XJQA 1JR6A 1T8UA 3X1DA 1G1MA 2OFXA 3M6AA 3AKYA 4ZIRB 3N2IA 4NCHA 4HSEA 5KDOA 4FW9A 3EPLA 1W4RA 1FL9A 2WJVA 2HT6A 4LJYA 5HTKA 4PZLA 5JRZA 1D9ZA 2ZREA 4H9GA 1FMJA 4JKYA 4JKIA 1G291 2IYTA 3GJ6A 3SJAA 1M74A 2PEYA 1IHUA 4DHEA 3MG9A 4PHHA 1LS1A 1GG2A 2ZR0A 2VA8A 2E1RA 4C30A 1NG9A 2V1XA 3A1VA 2WWIA 1E9RA 4UJ5A 5JHGB 4JL8A 2ZI5A 1MRSA 2VQSA 4D26A 1OB5A 2ZM5A 1AIPA 5FTMA 4BFSA 2CEAA 2JEOA 5KNBA 2ZI6A 1OH5A 1EFCA 3FHCB 3I92A 5TV2A 4RD6A 2XNDA 1D9XA 3DMNA 2OBLA 4ON9A 2A5JA 2GDJA 2KI5A 3T1VA 1PZNA 1QHSA 2VP9A 4Q47A 5SZHB 1OIWA 3K0AA 3GJ7A 3D31A 2D62A 1PJRA 3NBYC 4FMDB 4PO8A 2BHRA 4B73A 4DDWA 5HPYB 3EX7C 1XBTA 1NMXA 1HYQA 3GEIA 5KPJA 3PUVA 4M9SA 1E99A 1GVNB 4LGMA 1U8ZA 4BQSA 3QKSB 1GAJA 3OHMA 4RD4A 1NJGA 2WOOA 4LHVA 2CJWA 4URVR 1XWIA 1JXOA 2R6FA 3RS4A 3B9PA 4ZDIA 2JLVA 3CLVA 4FIDA 4PC2A 4ACBA 1PVOA 3BH0A 4P4SB 2C9CA 1RZ3A 3N70A 5G53C 1P72A 3F8TA 4RKFA 1CEEA 5JS8A 1QF9A 3ZH9B 5DN6D 3BJIC 3NBZC 1N5LA 1SXJC 4KSCA 1SVKA 5DIFA 2GNOA 3TQFA 4DLTA 3GLGB 1DAHA 4A2QA 2ZS9A 2RGDA 4PHTA 3B6EA 3CNLA 4JBWA 2FEOA 3CW2A 3EC2A 4A15A 4QM6A 5KDLA 3Q72A 4DBLC 1RVDA 1I4TD 4KJZA 4AIIA 3TQCA 5DYIA 3TW8B 3M1IA 4Q7MB 2GILA 4KFUA 3KKOA 5TARA 1GSIA 3RS5A 5JI3E 1ZM4A 3KFVA 2P6UA 4G5OA 2AFHE 2QEQA 3CIOA 5AJZA 2EFCB 3U4QA 2O0HA 4MRNA 1TX4B 3BOSA 3DDCA 2RGNC 3PQCA 5FUVA 5CDFE 4KI0A 2GJSA 1RRCA 1RKBA 1CR0A 1L8QA 2DFLA 3QXSA 4NZYA 2W2TA 3CRQA 1U90A 2W6JA 1IN5A 1VKJA 2F43A 1K5DA 1G9XA 3HWSA 5FL7A 3B13B 3I3SR 1CLUA 4PPGA 1M8PA 1FP7A 3PIRA 4HZUB 2ZRDA 1TQ2A 5IDVA 2HXSA 1UBCA 1P2UA 2BJWA 3OE7D 4LYFA 1UBEA 1T5LA 4A0RA 2OEPA 4DDUA 3FFAA 3SYKA 4BE7B 4B44A 3SHFA 4NYIR 1SVWA 1KI6A 3R9XA 4URWR 1ZP6A 3C14C 3RS7A 1DAEA 5CITA 2ZSDA 3UPUA 1P2TA 2JATA 2B21A 5L3RA 2ZYVX 4X8OA 4E5UA 4K8OA 2BBOA 2BEJA 4LRWA 5CM8B 1KAGA 1ZW6A 3TAUA 3H84A 4B6EA 4WOPA 2N46A 3IIJA 4ITRC 1CJMA 2CHQA 2R6GA 2OBMA 3FWYA 1SVSA 4AURA 1XJCA 2JJ2A 1YZNA 2ZI3A 4D0GA 2H17A 5IHPA 3WP1B 2JAQA 1E2JA 4GOKA 1I2MA 4F4JA 5KTYA 3MSXA 4LCBA 4NYMR 1CR1A 4NYJQ 1IXRC 2FEMA 3UATA 2ZITA 1BOFA 4R9UC 1E0JA 4B2PA 2PZFA 2VF8A 3TMKA 5A5GA 1Z6XA 3WRXC 1JEDA 3LY5A 1XEXA 1AN0A 2IW3A 2MSCB 4TN1A 4WW0A 2HF9A 4C3ZA 5JJIA 3VHXA 1SKYB 3CZPA 3MJHA 2GXQA 2ZXUA 1OJLA 1ZIOA 4TT3D 4MGYR 5JMTA 3SE0A 2OV2A 4V02A 4IOLA 2DWQA 5HCNA 1AJEA 1AK2A 4B2LA 2X1VA 3HDTA 3EPHA 2GAOA 3ASYA 4WA7A 2O8BB 2F1RA 1NF3A 1Q12A 3Q7PA 4JLKA 5HE8A 1Q1EA 2I4IA 3OEED 4BFUA 2F1JA 4D4LA 4B43A 5EQTA 2XTMA 5FOVA 4GP7A 5KHOC 2VH5R 4DLWA 1T91A 2ZUDA 5CM9C 2C03A 3IO5A 5KSZA 2P65A 2YNMA 2PMDA 2EQBA 1QHHB 5IK2A 3O8DA 1X8KA 4Q18A 3PEWA 4ESVA 3UK6A 3THWA 2ZJ5A 1G3MA 2QT0A 3D3QA 3X1ZA 1P2SA 2BBWA 4ZIRA 1EXMA 1HEIA 4KAXA 2PX3A 4A6XA 2OUKA 3EPKA 3QG5A 4LHXA 4MYCA 5AUOB 3CX8A 5BQ5A 3VR5A 4Q48A 2P6NA 2B8WA 2AKYA 3KJIA 4YXWD 2Q21A 4AKEA 3W3AA 1W7AA 1SXJE 3WYAA 1GL6A 3C5CA 2A5YB 3MAAC 4YMWA 4CT4B 4C2UA 3AVYA 1G6HA 1CBUA 5DE3A 5FBLB 5B30A 4Q4HB 2G0NA 4NMMA 3AVOA 4U5XA 1ZNXA 1ZD9A 3GEEA 4OK5A 1G3RA 4IDQA 5L3VA 4A0HA 3KB1A 3CRW1 4KODA 1GNQA 3ZZ0A 2EU8A 2XOKA 5FPHA 4RKEA 1W2GA 1WE2A 1II8B 2Z83A 3EIQA 4V0ME 2ZRMA 3SHWA 5C4GB 5BN4A 3BFKA 3CPJB 4LJ5A 4US2R 1W5SA 4IKEA 5FBVB 4NONA 5JJKA 1X86B 5E3HA 2WZQA 1PLLA 2ZJBA 4QJ3A 1JBKA 1UAAA 3Q7QA 2ZRKA 3BFVA 2WJIA 1T6NA 3NTUA 3GLGA 1G41A 5EP1A 4NE2A 1NLZA 1WRBA 2GK7A 1KZGB 1MV5A 1KZ7B 1VECA 3P4YA 3LW8A 4EPTA 3AUYA 3K0FB 1XMIA 3X1YA 4NBSA 1KKLA 2VL7A 1CRPA 3MCAA 1AA9A 4DB4A 4KLNA 3TUJC 1Q21A 3KQUA 1P6XA 3R9WA 1Q3HA 2V7QD 1X8LA 1E2DA 3FFBA 1MOZA 4A8JB 4GFDA 2IYXA 4XVQA 2RHMA 1ZBDA 3Q85A 4MYTA 3BGWA 2ATVA 1WMSA 3E70C 4HI0E 4LJ6A 1KSHA 3QPWA 4ASUD 1HQYE 5HZKA 4C0HA 4L4UA 1G3QA 4TSFD 3UKDA 2PZGA 1HA3A 4P0TA 1NKTA 1FQJA 4KBGA 2QMEA 1DOAA 2QNRA 5KUTA 2QAJA 5C2JB 2V1UA 3CR7A 1VCMA 1ZUHA 1U9IA 1J7KA 2FF7A 3R20A 4GP6A 4BECA 1YU9A 4IOMA 4DCUA 2CCJA 1JQLB 1LB1B 2E87A 3MRSA 1KO4A 4BLTA 1US8B 3CH4B 1R4AA 2IEZA 2TMKA 4DIEA 1ODFA 5JLJA 1GRQA 1UF9A 3BAFA 4BASA 3DEFA 1GIAA 1TNDA 2OHFA 3K70D 4C7OB 3REGA 1IXZA 3CNOA 4NDZA 4TLAA 1UFQA 1WCV1 1Z0IA 4OYHA 2DCUA 1COWA 2QENA 2VEDA 4ZDJA 2XTZA 2P67A 4LBVA 4FMCF 3TW4A 2AXPA 4KVGA 4AD8A 1XEWY 3OEHD 3SFZA 1NIJA 2Z4SA 4OHZA 3C16C 2O8DB 1NMYA 1YRBA 3ADDA 1W0JA 3TVTA 2WOJA 3I61A 2YOGA 3PJRA 3N5CA 3VHLB 4HB4A 4M9XA 3PG5A 3GJ3A 1KNQA 1FPMA 3M0EA 4R2IA 3ZQ6A 2OZEA 4D6PA 4CYMA 5L3QA 3RABA 1U8YA 3WHKA 1NN0A 1SZPA 3OAAD 3C4JA 2IBMA 2EFHB 4JYCA 2XEXA 2IXEA 3WY9A 1ETUA 4Z1MA 1N6RA 4TMXA 4W9MC 1W0KA 4R71A 4DLSA 3KQLA 2ZU0C 5EXXA 3K53A 4RD3A 1E2EA 2J46A 3BB3A 5EE9A 1TMKA 1ZC4A 2QBYA 2X8AA 4QOSA 2IEYA 1KI2A 3N2EA 5HCIA 5DGXA 5LD2C 3B1ZA 1AGPA 1G18A 1KHTA 1T3LA 3B7GA 2WMOB 4RD0A 1Y3AA 5CK5A 1R7RA 5C1BA 4AKIA 1G5TA 3U7GA 5TDHA 1IN7A 4AYWA 5BW8A 2WAXA 4DSTA 2G83A 2EFGA 4Y0VA 1VG1A 4I1SA 3THXA 4I99A 1T0HB 1AKEA 1VYUA 3BD9A 3CF0A 4LHYA 5K8LA 1O3YA 2X19A 4OK6A 3CF2A 2WMNB 4M21A 4R98A 5L8VA 1XTQA 1OXVA 1M7GA 5DI3B 4MRRA 2OSBA 2FSFA 4Q7LA 2N42A 3DM9B 1CXZA 3VR1A 3IBYA 4A92A 3QI2A 5KPDA 4D4JA 5G3YA 4QBFA 4PXAA 3VKWA 3AB3A 1R6BX 1NL3A 2WJJA 3U3MA 3FHOA 3U2QA 1OT3A 2ZI9A 4I1UA 5E7IA 2PT5A 1N0UA 3QUSA 1QBKC 1E32A 3T06B 4CEJA 4ZPXA 2GJKA 2ZS8A 3D6TB 5H70A 1KDTA 2O52A 3TVDA 1OB2A 3DPUA 2RAPA 2ZE7A 1W1WA 2CVFA 4A82A 2IYZA 3NBXX 2A2ZA 4LY6A 4MGKR 1F5NA 4N3NA 4XD7A 5IT5A 5FOUA 4IXNA 4LBZA 2J7KA 3FB4A 1ZM3A 5DI9A 4ERNA 1E4VA 5JECA 2ANCA 3KXKA 2FOLA 1E2HA 1NLYA 4DEXA 5K8UA 2HYDA 4UNSA 5JRJA 3WRYC 4IVQA 3GPLA 1KKMA 3RYTC 2PMKA 4US1R 1TPZA 2QAGC 1M7BA 2WKRA 3UIEA 2W6IA 2PLFA 2CJWB 2WWYA 3IEVA 3ZVNA 1JJVA 3AH8A 2WWHA 4BFVA 1G21E 4C9BA 4CEIB 4AKGA 3QXJA 4PC6A 4CZ2A 3SOPA 3SN6A 4QRHA 3GLFE 5H1YA 2OT3B 2YOHA 2YV5A 1H8HD 4HAYA 2BJVA 5HKKD 4H1UA 4FCWA 3KTAA 2A3RA 2BOVA 3CUEF 2MMCA 2JCSA 5DNYB 3CF6R 4Q4LA 4YMTA 2KE5A 2ZRJA 3L0PA 1BMFD 2ONJA 1GNRA 3CWQA 3SBEA 5BWMA 3UWKA 1GKUB 1L2TA 4KLZA 1IONA 2BV3A 4Q1AA 8OHMA 2DB3A 2I3BA 4NHOA 3EWSA 3PVSA 1YR6A 4M0LA 1AS3A 1C1YA 1NMZA 2FGJA 3U4QB 2IS2A 4NTZA 2F9LA 3J81k 1CTQA 2QUZA 1XEFA 4M1OA 3AF3A 5HE9A 3R7WB 5CIQA 2CVHA 1QG2A 3UMSA 4A8JA 2EYQA 3HPQA 3TSWA 1X3SA 4X8MA 1DAMA 3VKHA 3JVUA 4KO8A 4YONB 2PZEA 1AZTA 2H1LA 2WHXA 3SJZA 4LUCA 4TL9A 3GLIE 3LWNA 1FNNA 3WP0A 3CB4A 4EPYA 1G16A 1HV8A 1LS6A 4UKDA 1AQYA 1D2MA 4QBIA 3Q9LA 1L7VC 2XGJA 3KB2A 3AP3A 3KX2A 5J5CA 4DT1B 2BDTA 4TTPA 4CT5A 2KWIA 3DM5A 1KI6B 1VMAA 4G5SA 3PUXA 2WWWA 2OCBA 2GEVA 1ZJ6A 3K09A 1JECA 1J70A 2FFBA 3IO3A 1Z63A 2VP0A 4JLJA 2KB0A 2IF0A 3SR0A 1YQTA 4IRUB 3ZIAD 4B6FA 3S1AA 5FTLA 3BXZA 421PA 4NCIA 4WZAE 2P6RA 2ZU6A 3H86A 4P32A 1W4BA 4CIDA 2NZ8A 3LBHA 4LBWA 2V6JA 1T4GA 3LNCA 1XRJA 3K1JA 2O8DA 2CBZA 2QPTA 3FE2A 4M53A 3SS8A 3W34A 4A2WA 1PUJA 1XTKA 3TH5A 5FR2A 1FX0A 1KMHB 2V54A 3L0SA 4LC1A 4PC3A 5J4HA 3T34A 2B8TA 2E9SA 2CHGA 3SEAA 2Q3HA 1TUEA 4DJTA 2ERYA 5C18A 2WSSA 1GILA 3OIWA 4HAZA 3LW7A 3I1FA 4UQOA 1N0WA 2F7SA 3TUIC 4D2IA 1UADA 4Z51A 2YJTD 1WB9A 4HLUC 1XCPA 4IDHA 2FDCA 1LY1A 2XX3A 1KO8A 1M2OB 1XFAA 3B5JA 3LQQA 2R8RA 4Q4JB 5JHHB 2FPKA 1NN5A 2B6HA 2O5VA 3I5XA 1SKQA 3QXCA 4TYYA 2VP5A 2AK3A 4GNKA 4OI4A 1G8FA 1QDEA 2OCYC 2DWPA 4GBMA 2ZSAA 5FOWA 3EW9A 5J40A 3T5DA 4MDFA 1NJFA 1DELA 1XU4A 3Q5DA 4BLQA 1ESMA 5CYOA 3NXSA 5FBWB 4OBEA 4IXMA 1ZCAA 2MSEB 4KU4A 4JVSB 3CBQA 3CWZA 3W6NA 4AG6A 3T61A 4RSGA 3PEVA 2FFAA 2QE7D 4Q1FA 1CULC 3QF7A 2O0KA 4UXHA 2ZJ8A 1W48A 4PR0A 3U3KA 2NG1A 1OKKD 4HLDA 1U99A 4Z54A 4AC9A 1EFHA 3ZVLA 3VTKA 1HY3A 1F6BA 1Z0FA 1UKEA 5KOYA 1XTIA 3WBJA 1EG7A 2KSQA 4FXPA 1EX7A 2ZRCA 4LK2A 5GVRA 4C0KA 4EPVA 3LO5A 4TL7A 2ZTSA 5JEDA 4DC9A 1OPXA 2ZYUX 1DAKA 4B76A 1GP2A 2IT1A 3MWKA 1DADA 4GMXA 3IBGA 4I81A 3T35A 4QJ5A 3IDQA 2J7PA 3NH6A 2J0UB 1JPNA 1F60A 3FMPB 4MYHA 2GF9A 4Q66C 5H68A 3ZQJA 4TYWA 4O2LA 1KJYA 1W2HA 3T1OA 4Q02A 5EE0A 4IDPA 4TTQA 1N6NA 1XTSA 1XTRA 1ZYUA 2ZANA 1KDPA 4BLRA 1W36B 1KDRA 1ZUIA 2B7CA 2FMXA 1GDDA 1YZKA 2QGZA 2XB2A 3E5HA 4MGZR 2WAYA 2JASA 5L3SA 1S8FA 4M1SA 1EWRA 1E0KA 1QG4A 4OQFA 4PPQA 2QA5A 4URUR 3VMFA 4BZPA 1P61B 2J0VA 5FPKA 3V4RA 1NBMD 1GWNA 4PPNA 3VQTA 3EXAA 1G3IA 4PAMA 5JWRA 4W5WA 1NVVQ 1OE0A 4TTRA 1N3BA 1ZM7A 2OXCA 1COWD 1O87A 2FE4A 1VYTA 4Q4AA 3SYLA 3DHWC 2VP2A 3GJ4A 1CP2A 2WIAA 1E79A 2WKQA 2Z6VA 4DSNA 3P1JA 1H65A 3SC3A 3OESA 3NHBA 2IYRA 2XSZA 2ZETA 5JWOA 3EASA 2ZVPX 1RRPA 4G5QA 2W00A 4Q1EA 2ZS7A 1U94A 2VHJA 3BBPA 5LB2A 1S2MA 2G1JA 5CDFA 3SZRA 4S35A 3EARA 4A1FA 4QGFA 3W5IA 2QQ0A 1XCMA 1BKDR 1U0HC 2RCNA 3WMEA 1NLFA 2WKPA 4CEIA 3JZMA 4EKDA 2D06A 3A58B 4A0FA 1D2NA 4ARZA 1U98A 2AWOA 3EWAA 3I32A 2OLJA 3GP8A 1G17A 1HH4A 2GBLA 2KBFA 1NN3A 2PJZA 3NG1A 4L9SA 4BLPA 1T3HA 2VP6A 3E1SA 2RGEA 3NKVA 3THYA 2WWFA 2RGBA 4QHYA 4XSGA 5JS7A 3B1WA 4DB2A 1EFRA 5ANRB 3DO6A 2FJUA 1XMVA 2YWHA 4Q21A 4DLXA 1G8HA 1LV7A 1T5IA 4ZCIA 2A30A 3PUYA 3HJNA 1YZLA 4B71A 4U02A 2VO1A 4TQAA 1PUIA 4GMDA 1MKYA 4ILEA 5EUQB 1N5IA 1UDWA 3RRYA 3U5ZB 3B8HA 2GF0A 2ORVA 2SHKA 3R7WA 1XF9A 2ZRHA 1KTVA 2G1KA 2ECKA 2X77A 4M22A 3M4YA 3TBKA 4Z8YA 4B75A 1EK0A 3P32A 4G5RA 2ZJAA 4XVUA 1G7RA 2JDIA 3QBTA 1KGDA 2FNAA 2ONKA 2VF7A 1QZXA 1W46A 3D7MA 3TR5A 1G19A 3LRPA 3AGQA 4Q7KA 3U44A 1VCNA 2IUTA 3OFND 5E4FA 4Q7JB 1S9HA 2GVZC 4QHTA 5L3QB 3IHLA 2NO6A 2WIBA 4TL6A 1MABA 4NYJR 4MRPA 4DT1A 2RMKA 2VPPA 3H2YA 4TQ9A 2HUPA 2CMKA 3KKNA 2YYZA 2NO1A 3A4NA 2Q9BA 4JLNA 3UANA 4BRWA 1KI9A 4GOJA 2RGAA 4L9WA 1ZU5A 1BS1A 4HDOB 5FR1A 4BFYA 1Z29A 2WPDA 3FPAA 2QBYB 2Z4RA 3RHFA 2R6DA 4URXR 4US0R 2P2LA 3R9IA 2FA9A 4QJ4A 4OQXA 1FNMA 1S3GA 4E03A 1GL7A 3K9HA 1JR3A 2BMEA 1GKYA 2JJ8A 4V03A 3TRFA 4DDTA 2UVQA 3BS4A 4QXAA 4HAVA 2NTYC 1KK2A 2WJHA 3GQBA 3KL4A 1IJFA 4AY2A 3UWOA 2GETA 2IUSA 3F0TA 1KMHA 3AVPA 4MRSA 2IWRA 2CK3A 3THXB 3GCGA 1Y63A 2JJ1D 3AGPA 1P7CA 2V9PA 1F2TB 2G0TA 2N1BA 1SVMA 3GJ8A 2JLWA 1Q20A 2NO9A 1NY5A 2OM2A 2QSYA 3FKSA 1S3SA 3KJGA 2O0JA 4URZR 4IOKA 3SU8A 1II9A 4PQRA 3ZZUA 4GT1A 3VFDA 1P73A 2QRZA 4Q1CA 2GA8A 2Q3MA 4Q4JA 4CRWB 2QP3A 3IQWA 2VTKA 5LB4A 1JALA 4WAUA 1T9HA 2ZE5A 1SXJA 3L2OB 1IN8A 3KXIA 2JLYA 5KDDA 3KQHA 5AJYA 3ZD6A 4W5JA 2C8VA 4FINA 2NO0A 2LCFA 4JLMA 4CEJB 5KU1A 2BC9A 1FTNA 1GTVA 1GRRA 1TL7C 2ZJ2A 2WBLC 1E1RA 1KY3A 2REXB 3EG5A 1P3JA 5EP4A 3I73A 5EZ5A 4GI7A 2GZDA 4B3BA 1H8EA 1Z5ZA 2JIZA 2IA5A 3MJRA 2JLXA 3BE4A 1RYHA 2J1LA 4V0MA 4GRAA 4B47A 3RRZA 1FQKA 1R2QA 4RZUA 1RRGA 2GKSA 2ZRNA 3AV0B 2F55A 3EZ2A 2HXYA 1R0XA 1A2BA 5FH9A 4WIAA 4YLGA 1N6OA 2BBSA 1OXUA 1KK0A 2FSIA 1OFIA 4TLCA 3CPEA 4ESHA 5BXQC 4X8HA 4OHXA 3EPJA 1OHHD 3VX4A 2O8EA 1W49A 4IVRA 2YWFA 2J0UA 2CCGA 5DYGA 2OE2A 3EA0A 1E9FA 4JT2A 2F6RA 1LF5A 1FUUA 5B64A 2YWEA 2FV8A 4QGHA 2IYUA 5TXGA 4PSAA 3EIEA 4WXRA 1UKVY 3QPVA 1M34E 2BIFA 4Y0AA 2BM1A 4MKGA 3ND9A 2GK6A 3G5UA 2XTNA 1Q57A 3KFXA 1UM8A 4E09A 2ZVQX 3NIBA 4W7SA 3AVTA 2C99A 3KTAB 2ZAMA 721PA 6Q21A 2C78A 3MGCA 4QGAA 3VR3A 3AF0A 4KBFA 2CL6X 5AK0A 1E98A 2HEIA 2PT7A 3EZ6A 2NPFA 1Q22A 1KSGA 1XXHB 1N5KA 1X1RA 3A8TA 2ODBA 1SGWA 2IYYA 5K8TA 1ELOA 3VX3A 2RGXA 2ANBA 1YVDA 4EJSB 2V8OA 1N2CE 2IC5A 2VRWA 3X1XA 1E9BA 1HE8B 2P5TB 1OYWA 1BYIA 4K46A 4POAA 5JBQA 2EYUA 4AI6A 1ZD1A 3FKQA 3KKMA 2C96A 3WNDA 3K0CC 4O2RA 4DXAA 4OHYA 2NQ2C 1KO1A 2DFTA 2LKCA 4KFSA 4KV9A 1DS6A 2OAQ1 3FHTA 4MA4A 2H5EA 4JVMA 2EWWA 2GZAA 5GJVC 2AR7A 3W8RA 1Z2CA 1Z08A 1SVLA 2AK2A 2AL7A 3UXMA 2EVWX 3QIAA 3FMFA 1TEXA 5P21A 1RRFA 1R0YA 1DE0A 1NN1A 1CF4A 3WMGA 3I8XA 3O8CA 4BLSA 2QMOA 1FW6A 4M1MA 3UMRA 2VHCA 1LW7A 3GLHE 2G3YA 5IRCD 2IXGA 3HR7A 2XZLA 4KCGA 3RVBA 3U6BA 5CJ2A 1KIMA 1MO5A 1OW3B 2BWJA 2C95A 3O8BA 1AGRA 1DARA 1FOEB 1P9NA 4KXFB 5KYKA 3K0EA 4WZ6A 3KJEA 1C4OA 4LYHA 5FUXA 3S1AB 1XMJA 1YE8A 2WWXA 3EIHA 3AVVA 4DUGD 2ZRBA 1KK1A 3V00A 521PA 3I72A 3U3RA 1K5GA 1ZNZA 2H16A 5J4KA 4L16A 4JLDA 1HURA 2WWGA 1YKSA 3WXMA 3GJXC 5FTKA 1FX0B 4DCSA 2D74A 2ODNA 1E69A 3V4FA 5SZIA 1A1VA 4V0LA 1P75A 5FOTA 1QHXA 2GZHA 3SBDA 1E2GA 1F2UB 1AS2A 2JLRA 4D80A 4WZBE 2NOAA 3A4MA 2HJGA 2W2VA 4KHZA 4YMUA 2OFOA 1G6OA 5LBIA 3U3JA 3CX7A 5CB6A 1Q44A 4EFLA 1XDBA 2GCPA 1JPJA 5TB5A 1KI3A 1G8PA 2W0MA 3RAPR 4WVFA 1FUKA 3W90A 4NCJA 2ZR7A 1XPRA 4A2PA 2GXSA 3BH7A 1IBRA 5B58C 1J90A 1Q3TA 4YDSA 3SFVA 3Q3JB 5DHFA 2QRNA 4IJMA 4LJ4A 4OJQA 4O3MA 4HZIA 1N6KA 5DN6A 3FVQA 2O8FA 3ND8A 1NSFA 1BYUA 1SVIA 2BMDA 2GCNA 3AVQA 4LHZA 2XNDD 1T0JB 5FPYA 2C98A 2A78A 4PTLA 1NBME 5LDDC 4FMDF 1GL9B 3LFUA 1F2TA 2PL3A 3KXLA 4BWYA 3IPYA 3MFYA 3AVXA 4NPHA 2BCJQ 5SZKB 2ZYTX 1C9KA 1RIFA 1BO6A 1MH1A 2FFQA 1P2VA 4UNPA 3WNBA 4MITA 4DEYA 3K70B 2R6CA 4FI3C 2AHOA 3AKDA 3MWYW 5JEEA 5FOSA 1D5CA 2DY1A 4GSYA 5E95A 2RKOA 4JBXA 4B48A 1RC8A 5GJBA 3NHAA 2F1HA 1M1YE 1Z47A 3U60B 4RJLA 4JLVA 4DRZA 4A8JC 4LJAA 2WTUA 3VKGA 1YZGA 2J45A 1P4SA 3AUXA 5CJPA 1TF5A 1TAGA 4H1VA 1E2MA 4TMVA 3GLFA 5L3SB 3BERA 4TZ6A 1X1SA 5CK4A 1CR2A 2JA1A 3TR0A 3VR2A 1NI3A 3QNUA 3KZ1E 2G88A 1VHLA 1VG0B 2FGKA 3OE7A 2OAP1 4LV6A 4BEBA 2JLZA 3CX6A 5G3ZA 2GRJA 5JJLA 2FWRA 1QVRA 5GJWC 1VYVA 3B82A 4P3YA 3SJBA 5BN3A 1G8GA 4AKHA 3T15A 1PLJA 4BZXA 1UJ2A 2PH1A 2I1QA 4C0SA 5EP3A 4D4MA 4HAUA 4L5BA 2CNWA 4Q4AB 3RSOA 2IS4A 1DO2A 2H18A 2ZI7A 4D82A 2GXUA 2W6JD 3C15C 4BZQA 5B57C 3ETLA 4C0BA 3KDSE 5JSZA 3SQWA 5ELXA 3QKTA 1XMSA 4DLZA 5BYKA 3TLXA 2Q6TA 4Q03A 5FL7D 4B34A 1R0WA 2HYIC 1ZAKA 3DZ8A 1R5BA 3P26A 1TEVA 1ZD8A 3IQXA 4DCNA 1QHGA 4JVLA 4A36A 3IHWA 1NP6A 3MWJA 1TU4A 3FTQA 1Z3IX 4UXJA 4ARZB 3CRRA 5AUPB 1QHYA 3R8CA 1A7JA 3KQKA 1Q1QA 1TQ4A 3HU1A 5KSOA 2R9VA 2NPIA 1RW4A 4DSUA 3THYB 2H57A 4DSOA 2IS1A 2AFIE 1Z06A 2HF8A 2QL6A 3DVLA 3VR6A 4UNQA 1XXHA 2VBCA 3FYHA 4RZXA 1G7SA 1ZNWA 4Q01A 1JQJC 1KOFA 2FZ4A 4QNRA 1Q1ZA 4ZV4A 1JR3D 4TT3A 3V9PA 1UKYA 1OIXA 3B1VA 4IHQA 1Z6YA 3T1QA 4JL5A 1KY2A 2PX0A 2XITA 2OFWA 2JJ2D 4EJSA 3X2SA 4ZCMA 3FDIA 4NH0A 1KI4A 4LYAA 1KJWA 4HUQA 3TK1A 1OFUX 4QHSA 4IVPA 4FD2A 4GZLA 3VU9A 1LVGA 5EE1A 2IX3A 1RPZA 4HAWA 1UDXA 3LH5A 1D8TA 2W58A 1NRJB 2QN6A 2CLSA 3U44B 4EPWA 3PUZA 4CGZA 4UNRA 3K9GA 3W9YA 4UNNA 4A0GA 1IAQA 4ZI2A 1A82A 3QY0A 2OG2A 2QROA 1MABB 3BH6A 1KI8A 2PLRA 2UZ3A 1VDZA 2HT1A 3EAQA 4LHWA 1P60A 4C0LA 2DHRA 2A7QA 4KFRA 4LV5B 4EDHA 3U7EB 4G1UC 3ONWA 4OJKA 1ZINA 1EWQA 4KITB 2C9OA 1ZRHA 2D2FA 3E2IA 3W3ZB 1E1RD 3QPUA 4PHFA 5GVSA 5HZHA 4JLBA 3ADBA 1LNZA 4EPXA 3NDPA 1W4AA 4IFBA 2R6AA 4MKHA 1SULA 1NKSA 5JWHA 2REOA 5JFGA 1E94E 1IY0A 4NP6A 4KFTA 5A4JA 1N0VC 4XOIA 1VIAA 5IK2D 4O0MA 2B92A 1E2NA 3MD0A 4QNMA 4TMZA 4JYBA 2ZJYA 3REFA 1Q1BA 3TSOA 3MLEA 4PANA 2ZUCA 3FOZA 4B35A 1F2UA 2GVDC 1I4DD 2Q9CA 1FFHA 2BKUA 2QGNA 2CDNA 1YZUA 2QAGA 1MT0A 1Z2AA 2J41A 1K8RA 2XJ4A 3LD9A 1CJKC 4RZ3A 1ANKA 4TLEA 1Z6GA 2C77A 4QC2A 3ZJYA 2GEUA 4IEIA 5EUMA 2HCJB 4M1YA 3X1WA 1IQPA 2G9NA 1XJ0A 1W36D 3LAWA 4U7DA 4M4SA 2NMVA 3CZQA 3WYFA 3LBNA 4CEHB 4BEJA 1SXJB 2KBEA 3B1XA 2ZSEA 3DL0A 2V7QA 3B60A 2JLUA 1JAHA 3IGFA 1T8TA 4YC7A 2XOKD 3I5YA 4ZKEA 1XPOA 1TUIA 2ZRIA 4PAQA 3SQXA 1DG1G 2ZRAA 4ASUA 2DR3A 1EGAA 4XTCS 2GBLC 1NG1A 1P9RA 1AM4D 2CL7X 2GAAA 4TSFA 5AUNB 1ZM2A 2OBNA 4WBSA 5KSPA 4BLOA 3NVAA 5F98A 1P9WA 3SDZA 4TL8A 4DKXA 4MUAA 2YC2C 5JI2E 2YKGA 3A37A 4TQUS 4QFMA 3I62A 1D2EA 3LQRA 1B23P 3ICQB 4BRUA 3VR4A 1UEIA 1XD2B 3F5FA 2VLIA 3MWLA 2GESA 3U7FB 4B3GA 2IYWA 1NVVR 4IW3B 3P27A 4EQ6A 1E9EA 2CE2X 2MMGA 2Z5FA 3BORA 4C0JA 2ODWA 1N6HA 4PC7A 1SQ5A 2OO7A 3SJCA 2O8EB 1UKZA 1GITA 3C5HA 4F7WA 2B7BA 5JCPA 2PCJA 3OEHA 3LV8A 4IDNA 3QVVA 4BUJA 3C7KA 1E2IA 2CCKA 4LWZA 1KO7A 4XWOA 2KJQA 1XP8A 3UG7A 5J4YA 5LPNA 2QM8A 1DEKA 4B3XA 3W6PA 1XD9A 4DZZA 2FFHA 4PSVA 3OAAA 1MR3F 2GCOB 4OKSA 1JJ7A 3T5GA 4Q9JA 3ZDQA 3QKRB 4CVNA 3RC3A 4KYIB 1EESA 2ZYWX 3L43A 1G3UA 2BKEA 1JAIA 2IHBA 2J87A 4LBYA 2J0QA 1Z22A 2FN4A 3GLHB 1OFTA 1ZNYA 2QMUA 1GM5A 5AR1A 1XCGB 2EFDB 2V55B 3GJ5A 3QF4A 4XTRA 3B1YA 2CLDX 2HDNB 4BGDA 1XD8A 4G0NA 1SHZA 4RCZA 1W0JD 1NIPA 4TYNA 3AVWA 2ORWA 1EX6A 2VSOA 1E9AA 2YC4C 3JZAA 1N25A 4XVRA 2QG6A 3K9LA 1OV4A 1ZIPA 4S2EA 4GL2A 3H1TA 2R62A 5DLQC 3AKCA 2IHYA 3DMDA 2R2AA 4F38A 3KJHA 3OIYA 4N0EA 3CM0A 3RNLA 4C4PA 1YHNA 1TU3A 1Z0KA 1KJZA 1WA5A 2PEZA 4JVNA 4K81B 4Z1MD 3B85A 4HLUA 1W0KD 1YR9A 2J5XA 2H7VA 2IXFA 2V4ZA 3DOFA 3MUFA 5AJWA 3TJZA 1VG8A 4P4TA 1J8MF 2DFKB 3U3OA 3Q5EA 2XXAA 1KMQA 4PQYA 2AD1A 3QXXA 4JLOA 4D4KA 3G0HA 4R2HA 2A5GA 3ASZA 4DCVA 4LJ7A 1VCOA 3PUWA 4URYR 2D2EA 1MRNA 4EAQA 5F9FA 1E9CA 5FI1B 2JLQA 4ABYA 3LLUA 4DIDA 4NL4H 1F3OA 1VPLA 4JT4A 1OXTA 1NSTA 5F2EA 2HLDA 4C2TA 2BM0A 3RDPA 4RFSA 2Q9AA 3CKLA 3WYGA 5BYJA 1CJUC 2NO7A 3GMTA 4V0NA 4ZI3A 1G7TA 2BMJA 5BN5A 2Q3FA 3NDBB 4MKIA 3QEOA 5EJEA 3NWJA 2JGNA 3CONA 4LJ8A 1JB1A 3HR8A 2J59A 2RGGA 1HQCA 3BB1A 4TMKA 4LV8B 3D8BA 1U0LA 2ZAOA 4BFWA 1XX6A 1M6NA 3KQNA 2WVJA 5K8IA 2FPMA 3CRVA 4JL6A 3ZVRA 1VHTA 2I1VB 1R0ZA 1ZVQA 121PA 3O47A 5J4LA 1MO4A 1E2KA 1HE1C 2EWVA 2V6IA 1NY6A 1CRQA 1VTKA 2D4HA 4I1VA 5FBRB 1Q0UA 2QZ4A 1E6CA 4HDCA 4JIMA 3QQ5A 2IYVA 3GD7A 1J8YF 3K9NA 4BFZA 5E7JA 3ZS9A 1KO5A 1W36C 5CB8A 1J2JA 1G4UR 1GKIA 4HYYA 2R65A 4TYPA 4B3DA 2GXAA 4XD7D 4HAXA 2X2FA 3SI7A 4FCTA 3NBFA 2ZJOA 2RHDA 3BIFA 3OF5A 4PZZA 1H8HA 2O8FB 2FSHA 3QKUA 5HKKA 3EZ9A 1KDOA 2CNWD 3PITA 2DWOA 3NH9A 1FP6A 1BMFA 2QORA 4UXIA 5DHAA 2QI9C 4PC1A 5D3QA 1DO0A 2J9RA 2PBRA 2REBA 4LDJA 3KUDA 2A5FA 2W6ID 5AUQA 5FUWA 5FUYA 2MSDB 4D0LB 4M8NE 5DH9A 1GNPA 3HU3A 5FBQB 3LBIA 3UMFA 4IFEA 5GJCA 5B2ZA 2VHUA 4JLAA 2WV9A 1IN4A 1XEWX 2DYKA 4CEHA 4AYTA 2F3TA 2IYQA 2ZRFA 4E07A 3OIUA 1L4YA 4FMBB 4ZCLA 1AKYA 2J0SA 4B33A 4C0AC 2XZOA 3BFXA 3TSZA 2QSZA 4NYIQ 2A5DA 3KUCA 3CNNA 1E2QA 4OQNA 1I4LD 1RFLA 2FH5B 3ICEA 4LZZA 3RWOA 4MRVA 3GLFB 4C0QC 1TADA 5EP2A 4O25A 1U9IC 2VIIA 4OQMA 3SNHA 3U61B 2QP9X 1YR8A 1GZSA 2QTVB 1BIFA 1IOZA 2R44A 2ZI4A 1XTJA 2OCAA 3W5JA 4HUTA 4F4IA 1XD2A 2WJGA 1FZQA 4Q19A 3RC8A 4HLCA 1JR3E 2RH5A 2RGNA 2AKAB 2P3SA 3SYNA 2OLKA 1E2FA 2OILA 4JBYA 3IIKA 4QBGB 1U81A 1E9SA 821PA 2IL1A 5JSZB 3ZIAA 1RJ9B 4CDGA 3QSYA 4FN5A 4NYMQ 4RVCA 3QEJA 4QG7A 4X8LA 5FTNA 4RD1A 5KSYA 2L0XA 3NC1C 4U00A 2F1IA 4BFTA 3TKLA 5DISB 1HT1E 1N6LA 3THOA 2C04A 2BEKA 5KO2A 1YZQA 1OFHA 1WP9A 5CYPA 2BMFA 2DBYA 2UZIR 3LLMA 3IIMA 3HP1A 5EXPA 1PV4A 1HT2E 3I4LA 3AM1A 1CKEA 1S1MA 3PENA 4RY2A 4TWZA 1S1CA 3RRMA 4A4DA 2GEDA 2ZRPA 2ZJZA 2FPLA 3GLIB 4PPFA 1E1QA 5KNDA 3IILA 4GPTA 3LA6A 2GCOA 1OH8A 3QKRA 5F9HA 2ERXA 2VYFA 2ZQ5A 1JEEA 4PHGA 4Z8XA 2ZPTX 3GLHA 5FOXA 3LVQE 1KNXA 3LXRA 4Q1BA 5LD2B 3NEJA 5J4VA 4PO9A 1R5OA 4GOXA 5GADl 1AZSC 2FG5A 2F3RA 3DOEA 4G3XA 2G77B 1IJEA 4NU0A 5JCZA 4GZMA 4TZ0A 3ZS8A 1WBDA 5EXTA 1ESNA 1WF3A 1QHIA 4HUQB 3EC1A 4DWJA 3L0OA 3LX8A 1IY2A 5D3MB 3VU9B 1KAOA 5EE5B 1YZTA 2WSSD 4UJ3A 4F93B 2QE7A 4N1AA 4QM7A 4W5HA 4DVGA 1OKKA 1B0UA 1UBGA 1Z83A 1LF0A 2YOFA 3F3YA 2P0EA 3T1TA 1CU1A 2QP4A 5FFMA 3IEUA 4P33A 3ADKA 3QKSA 5CLLA 1OIVA 2GJ9A 5KNCA 1E2PA
chains in the Genus database with same CATH superfamily
2XAAA 4I9HA 3EA5A 3QJGA 3SXUA 1Y5LA 2RGRA 4BB9A 3PRYA 3V1NA 4ZZ0A 4R8VA 4L78A 4QYIA 1PGQA 2MINA 2P2ZA 3VR4D 4B17A 4RD2A 1Z0DA 3PR1A 2MSLA 5KOJA 3GLGE 2IQ5A 3LS2A 1S4QA 4J4HA 1P28A 1KEEA 3G82C 3WMRA 1QP0A 2L5YA 4KSBA 3U7HB 3L4BA 1S0UA 2Y8EA 5T3UA 2GWHA 2COEA 3ESZA 5FLKA 4KQJA 1X7YB 4FX2A 4I6EA 3SPXA 1TF2A 4P4UA 3CBGA 2VDVE 2RJNA 4DREA 1M6HA 1H6DA 2A9KA 4PYOA 5FWXB 2YY6A 4RVHA 4W5RA 5G40A 3CRMA 4TLBA 4OMCA 3A6PC 5HM6A 4BNIA 2DG2A 4YRFA 3EXHC 1WD7A 2W4MA 1TI7A 3OE4A 4F84A 1VYHA 4FCCA 4TYQA 1NSYA 4GDFA 1J99A 1DAGA 4UM7A 5CA0B 3LX5A 3ZGXA 2CLKB 2I67A 1MQ8B 4WNAA 4M1WA 1UZAA 2H92A 2PWAA 3E61A 3WA7A 1V9SA 4AWXA 4EUKA 4DQKA 4FWTA 3PUHA 2QM7A 2O06A 2ID8A 1NUSA 4ZCPA 4GDMA 5L4NA 1GYQA 5TMPA 3STHA 2OXRA 3QP9A 4MVXA 5LP6C 4HY3A 1SR8A 4XIJA 1SURA 5BSUA 4AL4A 3L8ZA 5EZYB 3QITA 3H8WA 4Q4HA 4KIUA 1RZUA 5AW9A 5G0UA 2ODEA 4KR6A 3DOOA 1Y3DE 1RLMA 1RPTA 2P4SA 2IS9A 3RRNA 4HYTA 1E0AA 1XU9A 2EFYA 1ADYA 5IUKC 4E33A 3HTXA 1Q92A 1RI5A 1KSMA 3IESA 5DSZA 4EFMA 2QTFA 2YWCA 4EJMA 2B2CA 4IMPA 4OB6A 4YBHB 4II7A 2GAJA 3TI9A 3KKZA 2JGMA 3RS2A 4YGAA 2O8VA 4FEYA 1A7UA 3L1IA 1PDOA 4K0RA 3OZUA 4OH7A 1AB5A 2OZLB 3KKPA 2CL0X 2JC3A 1PWYE 1P17A 4JJ4A 2HQWA 3QEMA 2IEDA 5C31A 1K89A 4YFYA 2GOYA 2JLCA 1L5MA 5TNCA 3NEPX 1QFYA 1QVIY 5T4BA 1L4LA 4OO3A 3WYNA 1YDGA 2QRVA 5H80A 1EFPB 3IUMA 2FZWA 5M5BA 4PZLA 1K2WA 4JKIA 3SJAA 2PS0A 1BN7A 3R7NA 4I5IA 2QR5A 1USKA 2V1XA 1E9RA 4BFSA 2ZI6A 1R9MA 4RD6A 2OBLA 3EXEB 2D5AA 2OVBA 2D62A 5EI5A 4PIVA 4WEQA 1NJGA 3ZU2A 3I2HA 5BVGA 4PC2A 1PVOA 5G53C 4EW1A 1FUIA 1QF9A 3NBZC 5DIFA 3J81A 4ZVOA 3ENQA 2VZ0A 4MA5A 2QEQA 3WMWA 1P1KA 3U4QA 3T4UA 1TX4B 1Z4IA 3WK9A 2DFLA 3ITEA 2W6JA 3IUBA 3A05A 4TRNA 5IANA 3IAHA 4N9WA 16PKA 4U6NA 3LHDA 4GBGA 4NK4A 2NT3A 1N57A 1T29A 2OS8C 4K3VA 4DM7A 3SVLA 4EGJA 3OTHA 1ZW6A 5DSXA 1F6DA 4YHHB 3IIJA 1CJMA 3USES 1C0EA 4FB4A 3RV4A 1GGVA 3JTDC 3JQQA 1E2JA 1VMDA 3E53A 2B4AA 1U11A 5HG0A 3INTA 3PGVA 4PVCA 1WCYA 4MROA 4OA8A 4RXUA 1JEDA 3ZV6A 2MSCB 5TMBA 3ONFA 2JT3A 4BN5A 3B6MA 2I4IA 5FI3A 4D4LA 1SA0B 3F2IA 3OPYB 4V0QA 3CX4A 2X6TA 2V3WA 4WFJA 3N5KA 2RHTA 1I01A 2CLHB 2XNKA 1SEVA 1T1JA 1N2IA 1ITZA 2NUAB 3GR6A 1EXMA 2C4MA 4A6XA 5DNVA 1A9RA 3NSIA 1SFRA 3MUEA 4YGXB 5HF8A 3L4BC 1EBUA 5G4LA 4ALIA 1OFVA 5FBLB 1EBBA 2G0NA 1U4SA 1CB7A 3TFWA 1JAXA 1K3UB 3AIIA 3IR7A 4B4UA 4US2R 2FW7A 3KQOA 2ZJBA 3P0EA 3BFVA 5J59A 2NM0A 4Q0MA 4RPKA 1KZGB 5E8JA 2E85A 5HDQA 5HXAA 3EPRA 1B41A 3NVKI 4NWIA 4EY6A 3E70C 3DQQA 4EABA 4L4UA 4KXXA 5AJTA 4RA9B 4HNAB 1FI6A 3ESQA 1BS2A 2VI5A 4BLTA 1ZL2A 1YOVA 1L7MA 4JYZA 1KP9A 1Z0IA 2BBMA 3N1UA 1COWA 2XTZA 2P69A 4CMIB 3OC0A 1ZOLA 3SFZA 2OCIA 3ZHTA 1WZIA 3GJ3A 2Z8YA 3AG6A 1W59A 4LOIA 2OZEA 1HZJA 3ADOA 3SZUA 1SZPA 3B3AA 4QATA 4B45A 4YCAA 3FUWA 4YRJA 2M1XA 4D02A 1K27A 4CLRA 2NT4A 3FI9A 4YASA 1TMKA 1Z4JA 2X8AA 1GTMA 5HKZA 2Z9CA 1G18A 3CLTD 3QVMA 4X00A 4HX9A 3E0XA 4MMYB 2NYVA 1R9GA 1SBQA 4ICBA 4Y2RA 2WSIA 3JQEA 3Q1LA 4MWBA 2N42A 1INLA 1MD9A 4RHCA 3ELBA 1ZCJA 3QVOA 2V7VA 4J0GA 3K3PA 4PRKA 1OT3A 3HCNA 1NHWA 4HJRA 4ZPXA 4ZCTA 5TX7A 1OB2A 1AGXA 1MTZA 1W1WA 4BTLA 2CVFA 1QGUB 1YAJA 3FB4A 2G4LA 4ERNA 4MOWA 4DEXA 3EFBA 2H1RA 2UYOA 5KKNB 3RYTC 4KQGA 1QZUA 4FFDA 4US1R 4M9CA 4YB8A 2XQIA 4Q1VA 2FX2A 1GJYA 2W6IA 4TMYA 4XM0A 2GBPA 3DC2A 3QXJA 2P11A 2H7XA 3MJFA 1O8BA 1FJHA 5FD8A 1ZCZA 3DF0B 3DCIA 1QV0A 1R1DA 2EZUA 1PJTA 2Q62A 1XFYO 3HKDB 5DBEX 1C1YA 1H9AA 1GNLA 2P27A 2ZWVA 3J81k 4NMWA 1UPUA 1KP2A 1WMAA 3CC8A 1V3VA 4L8YA 2GKGA 1RYBA 4UKDA 2QS9A 1DTLA 1R18A 2BDTA 3NM4A 3AILA 3DM5A 5CSIA 3KXDA 2VA9A 5JNSA 3IO3A 1ZLXA 1I30A 2VJYA 4NCIA 3HP4A 2P6RA 1WRZA 3LBHA 5BWNA 3LCJA 3NP7A 4L4YA 3UWDA 3BCSA 4JI3B 3TTSA 5JFTA 3N53A 4HLUC 4B4WA 3L6BA 5C3UA 1NN5A 4FBGA 4AQYB 2VXCA 2OCYC 4YY3B 1VE1A 5A4MS 4KU4A 3VC3A 5F2OA 5H7XA 3DVMA 2ZSHA 4J0JA 3VR4H 4D8YA 4S1VA 5DT9A 1CLMA 4UW9A 3JQ8A 3NH6A 2PAAA 2G25A 2JT8A 5EE0A 1L2OB 5I8NA 4FR2A 1EAMA 3BL5A 3M5CA 5IBCA 1CS0A 1S7GA 2LW7A 4MQLA 2WMYA 4X1KB 1Z26A 1CP2A 2WIAA 1KH1A 4HADA 2PO5A 4EMBA 1BMTA 1YMQA 2B5OA 1X0XA 3A58B 1GTG1 3PJDA 4AMZA 4BLPA 5ELLA 2CNBA 3NKVA 1QUEA 2GUGA 1YDWA 1YTUA 4DB2A 2P41A 2FMHA 4NE7A 5IPFA 1C9EA 3LKBA 3K8OE 1L5RA 4B71A 3LYUA 4LA4A 3SP1A 1FX1A 1R0SA 2ECFA 4XZ3A 1KTVA 1AHIA 1Z39A 3TR5A 4EBBA 4TV8B 1VCNA 3B70A 2I66A 5L3QB 4NYJR 1Z4KA 4MRPA 2P90A 3K20A 4BRWA 4R7TA 3DEYX 2RGAA 1BS1A 3QU9A 2VT7A 1RR6A 5AESA 5FHRA 1JR3A 3FDXA 4DDTA 4FFOA 4Y2UA 4QXAA 1U65A 2GETA 3L92A 3OX4A 3BJRA 3NHKA 2DR2A 2JVKA 5JARA 2JBAB 2VSNA 3IDSA 3VZCA 3W9BA 3W8DA 4RVOA 1SXJA 2W2LA 5DIZA 3LDHA 5AJYA 4DJ5X 2AQHA 1R3UA 2FI1A 4J16C 1TL7C 3JVTB 1TKBA 4ME6A 2REXB 2NN3C 4Q3OA 4RVUA 1D4ZA 2GKSA 1ILWA 2DPGA 3Q98A 1K4KA 2PX6A 5BXQC 3WKAA 4YDQA 5K51A 4DYDA 2G76A 2WU0A 3WWZA 1B8RA 2YWEA 4V1CA 4I3GA 3RC1A 3HDHA 1TIBA 3NIBA 3UNWA 2E18A 4CF3A 2IY8A 2G9QA 3I2IA 3H5NA 2YZMA 5IKEA 4OV6B 1MF7A 5CDGA 5FXMA 1YF3A 2R5WA 4AI6A 2WY2D 5K7SA 3E9CA 5DWVA 3UXMA 4DBVO 4KR2A 5BSMA 3T7TA 3BUMB 2P1DA 5CHYA 3NYQA 1CF9A 2B8JA 4KCGA 3KELA 2C95A 3O8BA 2OO5A 2VF4X 4E2YA 5KYKA 4BXOA 3DMGA 4AQJA 5SY6A 1VGVA 3BRQA 1OX4A 2JXLA 3HZRA 4RQUA 2HGSA 5JVDA 2OZPA 3VISA 1PK9A 2REQA 4N5DA 5DHQA 1XVVA 3MGGA 1KI3A 4BN0A 2AOUA 4A23A 4NJEB 2J3HA 1UBOS 4ZEVA 1VQ1A 1GRCA 1S8AA 2SBTA 5K6AA 3FS7A 1SU6A 4BUCA 4J49A 4OJQA 1F38A 1LLUA 3MBKA 1XNGA 1TQ8A 3V1YA 5AI0A 2X4IA 3IE2A 5LR6A 3NIGB 1VBKA 2OKCA 5SZKB 5FV4A 2XCRB 2HQ1A 2OYCA 4R05A 3RVRA 5C8DA 1ST2A 3VKGA 3O0DA 2QUIA 2P40A 5B6JA 1RXWA 5E38A 1L7QA 3BERA 1R6DA 3KZ1E 3PBKA 4BVAA 2OAP1 4OFZA 5JW6A 1OI4A 5JJLA 2QX8A 1U5BA 4IV5A 2XT9A 1MVOA 5GGXA 4DTIA 3AYZB 2W6JD 3DZCA 2I34A 3UB3A 4MUXA 3GDWA 1OYOA 3IQXA 2EDAA 1GZ4A 3EZNA 4AJHA 3GUVA 4UXJA 3GVPA 3BWXA 3NAGA 5BT9A 3B53X 3ZJTA 4I9UA 4U7FA 1A5SB 4R0VA 4DSUA 4ZGWA 1NBAA 4RZXA 2P7IA 4BQQA 1C2YA 4QNRA 1ZK2A 1KMIY 3B1VA 2PX0A 3C43A 3FY4A 4NH0A 2CKMA 2CJFA 1W5EA 4LN1A 2R3SA 4EYQA 1J0XO 3IUPA 1LVGA 4HDNB 3TNJA 5CHEA 4ER5A 4NJOA 3K8QA 3QY0A 2E37A 2HMVA 4NU5A 1A7KA 5HA5A 2A7QA 4B6QA 4YJHA 4FJ1A 2I6FA 3FTCA 1POWA 1M2VA 2C2BA 5TEWA 4KO4S 4B7AA 3V4PB 2VH1A 1H4SA 4QTZA 4NP6A 5A4JA 4RHXA 2VQ6A 4JYBA 4ZCRA 3OTOB 4MIEA 2HMUA 1Q17A 1QVIZ 1S4MA 4TZKA 3U7JA 3S81A 2VF2A 1ANKA 2J6HA 4QDTA 4GNRA 4ITUA 4Z4FA 3QHQA 2C00A 1DTEA 4U7DA 1K0FA 3D8HA 4UBKA 3O8QB 2CL7X 2BE7A 3KD2A 3RSZA 1DKLA 4JELA 4J07A 2YKGA 3HA2A 4BNVA 3DCYA 2N0SA 2VHWA 4QEDA 4UD6A 4R4JA 2ZZNA 2WCMA 1IPHA 2C9BA 3FDFA 5LOVA 5JCPA 3EUFA 3ZI0A 4U0KA 3QVVA 1K3TA 4ENSA 4MB0A 2X7HA 4XWOA 4X44A 5T5QA 3F67A 1BCRA 1G8MA 1MXHA 1PJQA 4DZZA 3A6JA 4OKSA 5F1KA 1ZKMA 5CVCA 4FQTA 1S02A 1IZYA 5JTTA 4HC4A 2J08A 3T1HB 1F8HA 2NTVA 5FFFA 1XD8A 4RCZA 4U9IS 1XZDA 2R62A 1KQVA 3RNLA 1Z0KA 4ARCA 1KGSA 3Q5EA 5I9SA 4I5KA 3NPAA 4UDXX 2BFBA 3G85A 3PUWA 2V53A 4EAQA 4FYJA 5JSKA 3AHIA 1OXTA 4CFYA 1QF7A 2EKBA 1ISPA 3P2EA 3R3XA 1SKTA 2BMJA 2GCEA 4MKIA 3EFEA 3P96A 1XLWA 1FFBA 2ZUTA 4QUEA 3PSRA 4TMKA 4LV8B 5K8IA 5IXYA 4JL6A 2ZN9A 5J4LA 3E9MA 2V6IA 3P0RA 3G0GA 1W93A 4E3ZA 3ZWMA 4IDAA 5KOHB 4HAXA 2EX4A 1VHWA 4X24A 1VJDA 2B4KA 3T9DA 1QYXA 4PRYA 4PC1A 3R0IA 5JD6A 2VS1A 2W6ID 1T4CA 4AJ9A 3EK4A 4GBED 5DH9A 2FLVA 2FETA 4MVJE 2PFSA 1G6Q1 3JWPA 1A0OA 4QOHA 1UPAA 1H85A 4EO4A 1YNOA 3S6JA 4MRVA 4PBRA 2Y93A 2J48A 2OC9A 3C1UA 3GELA 5CNJA 2AFIB 3MRXA 4BJ3A 2OILA 4JBYA 3CMCO 1U81A 3ZIAA 4FN5A 2CSXA 4U00A 3O4VA 4B5KA 3BFPA 3UMBA 4HLNA 1YV9A 2H51A 1Z2PX 1VGQA 2W37A 4E1VA 2RGYA 2R1TB 2ZQ5A 3ZVKA 4Z3OA 3LXRA 1GDHA 4Q15A 4Y1RA 1OZHA 4BVFA 2HPSA 3OLWA 1C8LA 3EC1A 4A26A 4MR7A 1RQNA 2IITA 4EW2A 2G28A 4N1AA 1V5EA 3S0DA 4R6WA 4YCMA 3QKSA 2H1HA 3RS8A 3MYYA 2LVKA 4RPJA 3DOCA 1U7PA 1E1YA 1WVGA 2I0FA 1VJTA 4MYDA 3O4RA 1F9AA 4HX2A 4NDBA 1NBOA 4M2OA 3I30X 1JE1A 1Q11A 3UHJA 1A9XB 1G9TA 1XQYA 2QQGA 1T9AA 1S7CA 1NBMA 1R66A 2EGHA 3VOBA 1E3MA 2JD0A 1QLKA 4YAFA 2BGKA 3CZ4A 2CLMB 4REQA 4ZK2A 4YCBA 5AW6A 1NT2A 2DZDA 1V8BA 4B7XA 4UUBA 4BNTA 4IDBA 4HDQB 5JZVA 4M54A 3E48A 5FTWA 4DLRA 1VL1A 1SK9A 1GU1A 4ZQHA 1KYTA 2XIJA 1TXGA 3N8GA 4NMHA 5CIYA 1LPOA 5CX1A 3B20A 3P4XA 3B78A 1RBYA 3BA1A 1Z0ZA 3PI7A 5DK4A 1DRWA 1TW3A 3M5PA 3B1KA 1LXFC 2EFEB 3AP1A 1NYLA 1GRNA 4J0EA 2C0PA 1MBZA 3EXFB 3MGAA 2BY4A 2O6LA 4XWTA 2QU8A 3TTUA 1H0SA 4PYMA 2LHLA 2QTVA 1U28A 4MW6A 1Q0SA 9LDBA 4DTCA 5L7TA 4TXNA 2PSFA 3FYSA 4LE1A 4Z9YA 2UVDA 3I5HB 4G0VA 3S68A 2BNXA 2I2XB 3DAYA 4PO1A 4AS3A 1SZCA 3A3PA 3BGDA 2GK3A 1AKQA 1FJGB 1A29A 5ALPA 6ABPA 4DIFA 1W7IB 4Q3BA 1UM9B 2AMLA 2H61A 4AP9A 4LSGA 3ML1A 1PZGA 2Q0XA 4Y9SA 2HDHA 4LI0A 2QRLA 3UJ7A 2H1IA 2ATXA 1EUYA 3KT3A 1GA6A 4P80A 1A5AB 1HBJA 1BX1A 1SXJD 2W2LD 1CR4A 3G7SA 5AP9A 2OP1A 1L5NA 4YXWA 4ZYLA 4FWBA 2NIPA 1XYYA 2OCPA 2WOSA 4Q9LA 5HIMA 3QE9Y 3ZGVA 3GN1A 1PO7A 4L8WB 4OX9Y 4JI6B 4A6DA 2H3HA 1VSQA 3DJFA 1FNCA 4ZHQB 1YJXA 1A8IA 1MFPA 1W8IA 4MYUA 2YZ2A 5HMLA 4NR0A 1O0SA 2CVOA 1WBBA 2B5VA 4C29A 2F8SA 3UMMA 2AJCA 4PIPA 2R84A 2ZVDA 4YAKA 2HF7A 5C8VA 3QOFA 4FSXA 2HF2A 1ZJJA 3LQFA 4AK9A 1XPUA 3VXKA 2VNHA 1R8SA 1EXWA 2FZ5A 3CCFA 4B32A 3RQSA 4UTPA 2VJDA 1EEXB 2I6TA 4NZNA 4DR2B 1IB0A 2KYCA 1T9CA 3DPSA 5BOVA 3BZWA 5HBRA 2R4UA 3ELDA 2IZ5A 2JNFA 4LDNA 5L7WA 2E1RA 1BAPA 4M46A 1MH9A 4JEUA 2EBUA 2QG4A 2JFWA 1R4MA 3E7FA 1ZXXA 1SWVA 2CJWA 4URVR 3CLVA 3LDUA 3LK1A 4L9RA 4Z9AA 1WTAA 1JH8A 4JBWA 3TPFA 4C07A 1I4TD 1UQTA 2QEOA 3PK0A 1ULUA 2FXIA 1SAYA 4JA0A 1Z4QA 2QLTA 1RKBA 5TT1A 3O73A 3CRQA 5KTPA 2CVPA 3I3SR 1MAUA 1FP7A 4O3FA 4UE3S 4OVKA 2EV9A 2VOEA 4URWR 1ZP6A 2GEJA 1PGPA 4CKBB 1P2TA 3H5IA 2ZYVX 4UNIA 2AE2A 2JFBA 2VRCA 2DH6A 4DCKA 4F86A 5AVOA 2P9ZA 3IALA 1FBTA 1I2MA 1BX3A 2VYVA 1ZVVA 2Q07A 1C4WA 4YAJA 1Z5OA 4KPYA 3R2JA 2IUYA 2IW3A 3V8MA 1M63B 3ZE7A 3CUKA 4JC0A 1AJEA 4B2LA 3KHEA 3KLBA 2FJYA 4JLKA 1LPAB 4KXYA 1Y0BA 4GE0A 3GXOA 2AQIA 2VQEB 4DLWA 3IL2A 2FMUA 5CEJA 2AV6A 3BUXB 4EUFA 4ESVA 4ITVA 1YZ3A 1G3MA 2NX2A 4GH5A 3I4FA 1HEIA 2QEBA 2WUEA 3AT1A 3KJIA 2RHJA 3HWRA 1GL6A 2A5YB 2NLNA 3QV2A 1EM6A 2VBGA 4DBLE 5B30A 3G8CA 4OK5A 2RHLA 2DHQA 1DLJA 1O96B 3SIPA 4RTQA 3T52A 2VWHA 1JBKA 3Q7QA 3CINA 4BMOB 1T6NA 4A5OA 1KMNA 3I9LA 1CZUA 3L0ZA 3UBTA 5JNRA 1WS6A 1YFKA 4ENWA 2ZZMA 2JLBA 2SICE 1P6XA 3R9WA 1E18A 2J4DA 3Q85A 2I5PO 4E51A 3ACBA 5AVWA 5DKNA 3M0WA 3UKDA 3ZLVA 4BP8A 1QTIA 1LA3A 5DHRA 1N3IA 5DNDA 3LK0A 4IOMA 3CH4B 3ON5A 4DIMA 4NDZA 2BEWA 4YT8A 3LCCA 4PGFA 3CZAA 1CQJB 1QYCA 4ND3A 6ADHA 1YBAA 5T4HA 1UC5B 4CF6A 3GDFA 1XZAA 3TS1A 1DXYA 2P71A 1NW6A 5DX0A 3M0EA 3SMVA 3R41A 3JYOA 5EJFA 2H1CA 1Q0RA 3UAGA 1T9GS 3QYPA 5JD3A 4RD3A 2E4AA 1ZC4A 2W6MA 2PXHA 4FGZA 4G5YA 1R7RA 1G5TA 3M82A 1SD5A 4ZPJA 3GG9A 4PR3A 3RD5A 2FLWA 1IDN1 3NP9A 2C7BA 1WQ4A 4DMKA 4K5QA 1CUCA 2VNAA 4QBFA 3VKWA 2A94A 2WTNA 3RZSA 3KLPX 3I6IA 3GZNB 1E32A 5BV8A 4CEJA 2A9RA 1KDTA 4WX2B 3TVDA 4EHLA 4R41A 3OG9A 1A5ZA 4HQ0A 4LBZA 4NBTA 2PZAA 4Y9TA 4OLJA 4GMFA 5BNZA 3BG5A 2JTZA 1XUOA 2HDOA 4OHMA 3PFKA 1X7HA 1Y80A 1TJ4A 3VPAA 3FGOA 3PCXA 4X84A 5LQMA 1DCKA 5FI5A 3SFTA 4EVQA 3IP6A 3TIGA 3QYJA 3VRRA 3JCZA 5TQ2B 3QTLA 3GA0A 4IY1A 4YRRA 1OBHA 1ZI9A 1DZ3A 2PUCA 2ZT6A 1T2FA 3EXHA 4CDNA 4YAEA 1EVKA 3UOAB 2V96A 5DICA 2BD0A 4E7PA 1KXJA 1AZTA 2PZEA 2PS9A 5JFOA 3LWNA 5FKJA 5LMUB 1L7VC 1DC5A 1GSHA 3KB2A 5J5CA 3WADA 1J5XA 3TB4A 4BU0A 4JLJA 3WJAA 2J5KA 3ZIAD 5FTLA 3OZRA 3S2YA 4LBWA 2V6JA 3LNCA 1XRJA 4M53A 3SS8A 2CLEB 5GZ3A 2V54A 3L0SA 2JVJA 3CJQA 3UT5B 2HQSA 5LP6A 1POXA 3S29A 3FJYA 2VJBA 1E7YA 1AY0A 2QW8A 4FHZA 3KBOA 3T5DA 4B4KA 3ROGA 5IBWA 4UBNA 1DKPA 2KBIA 5IVIA 4HLDA 3VTKA 1IWPB 4KIGA 2ST1A 5CTAA 1EX7A 1QIIA 3DB1A 3LO5A 2ZTSA 1KEPA 2VT2A 3D4IA 1PEDA 3KKKA 1V8PA 3HB1A 3RVLA 4BMPB 3GCXA 2FAXA 3ZHYA 2MSWA 3PHLA 2PRSA 1SD1A 1NBMD 1RU3A 4R8KA 5AVXA 3NR2A 5D1NA 1N3BA 1ZM7A 1U5IA 3ILVA 4QASA 4YJ3A 2WKQA 5IUJC 3P1JA 5EG5A 3SC3A 2ZETA 2W4QA 2FEPA 2ZS7A 4D8VA 2OQ2A 3IDOA 5LB2A 1RXVA 4YLYA 2G08A 4IYRA 1U7WA 1M1XB 3NJRA 3TDMA 1NN3A 4L9SA 1GPH1 3P9PA 3BMQA 2WWFA 2D5BA 1ZFSA 1XMVA 3R40A 3QVJA 1GN8A 5T64A 1G8HA 3DZIA 2Y66A 3HJNA 3GBPA 2ZBRA 3R4VA 3U5ZB 3UK0A 4R2LA 3IB3A 4W7HA 1TM5E 4L7VA 1XO1A 4D1EA 3B2QA 1M73E 1RCUA 2VF7A 1QZXA 1JYEA 3U44A 1DXOA 2G8LA 3AJ9A 1DC3A 3UXYA 4WKOA 1I3MA 4JR2A 3KYIB 2X13A 4J94A 4ESEA 4FOLA 5A6SB 5DT2A 4JLNA 4WASA 5CLJA 2YV1A 1QLSA 3D4NA 4BFYA 2C58A 3RIMA 4E03A 4CR6A 3TRFA 1XU7A 3MWGA 3M33A 2NTYC 1B7TY 1RFGE 1TNPA 4CLEA 3EXIA 5FQOA 1PSZA 1SQFA 2O0JA 1W76A 1ISSA 3SU8A 5EZYF 5BR4A 4OFWA 1YDHA 3HGMA 4E12A 1P73A 2GPBA 3LRXA 3FBTA 1IPEA 3NM6B 2W43A 1JILA 3EE6A 1W9MA 4CG2A 4KUHA 2J1LA 3WLHA 1ZESA 4AOMA 1JQEA 4DJDC 3TLYA 1F0KA 4P6VF 4OHXA 1JDSA 2AVDA 1WR8A 2IHZA 3PC2A 1E9FA 3GB9A 5JTUA 2CBGA 3OJLA 2JGFA 4YRIA 2BAGA 3IBCA 2Z8XA 1N92A 2WC1A 3WSVA 2BGLA 4B3SB 2NPFA 5K8TA 2JIOA 4H3VA 1N2CE 2VRWA 1E9BA 2P4QA 4POAA 2H7YA 3W1WA 5ITZB 5IM4A 2I7XA 2KFGA 1FLDA 2DFTA 2XWJI 4MA4A 4HH0A 2H7CA 1HSZA 2XA2A 5T3YA 2ZTHA 1CD5A 2QD3A 3QWBA 1DMOA 1H6AA 2KDHA 3TCNA 2IEBA 3L1KA 2G3YA 3E7DA 5CJ2A 1UOEA 4X95A 3CCBA 3WDMA 1OTXA 3MTQA 4O2BA 2ZBPA 3L07A 5A7GA 3OPYI 4AKTA 1XMJA 2IHJA 1P0MA 1ALVA 2H16A 1SUWA 1KY4A 4ZCUA 4C2BA 3AZPA 2D74A 4RY9A 3GFBA 1HRDA 5J3JA 3ZK7A 4G0YA 2ZIFA 2B7LA 2QEVA 1AS2A 3AINA 3ZXXA 3K9BA 4WZBE 2NOAA 2BDEA 3VDNB 4ARBA 2WIFA 5TB5A 1R12A 3A27A 2IU4A 2E5WA 3UK2A 3IVTA 2ZDQA 1TUZA 1RQ7A 3RTEA 3GMSA 2ZOSA 3AVQA 2C98A 3DE4X 4WNCA 1EB8A 5C8XA 1LD3A 1F7VA 1J0BA 4UEWA 1C9KA 1JBQA 3M3HA 4B48A 4L95C 4D43A 4F9FA 2OD2A 2R48A 5JBIA 4DQVA 1Z68A 3QLEA 1V9CA 1B4CA 5A04A 4KUEA 1UK9A 2CNPA 3C1TA 5I4BA 1M1NB 3WYCA 4WBNF 2QJWA 5IAOA 2FZKA 1Q7CA 3HN6A 1TT5A 1H2BA 2ZI7A 1ALWA 4BZQA 3SQWA 3BTSA 4B34A 1R5BA 1HX7A 3MWJA 4FYPA 5LZ2A 5HK9A 1TQ4A 2XTAA 2PR2A 4DR4B 4XE5A 2YWDA 1IEWA 2A7XA 4UBLA 1XXHA 2VRCD 1UKYA 2OFWA 2RARA 2VYQA 3FDIA 4CM9A 1KWOB 4Z53A 2VYVD 1T24A 3SQNA 2ZSUA 3PC7A 3QNMA 3MXOA 2DAPA 3FDZB 4MP8A 2FPOA 1BN6A 5CX4A 1G1AA 4XEUA 1SVNA 2X0EA 4QPCA 1ZVMA 1P60A 3I1JA 3BMCB 4LV5B 3E2IA 1E1RD 4PHFA 3ADBA 2YQ5A 3Q40A 1XTVA 2R6AA 4NCBA 3C6BA 2B92A 4TMZA 2O3QA 3U56A 4TV9F 3G2MA 3JARA 4B83A 4D9BA 5YASA 1I4DD 1FFAA 2HSZA 2KM1A 3FD8A 1LA2A 1NR5A 4W6QA 3ZJYA 2Y1FA 1JAHA 1D1TA 2JFPA 4KQFA 3PHGA 3I5YA 5KVAA 1VRKA 1ZM2A 3RADC 3S0EA 1BW9B 4ZT2A 4C0JA 2CE2X 2Z5FA 2J09A 3V80A 4YP1A 1VHDA 1JQDA 3I0MA 2V98A 3HRKA 3CZ9A 4BUJA 1P39A 2JQ6A 3C7KA 1SJ9A 1VE7A 2JARA 3D6HA 4CMGA 2FZVA 3W6PA 2L19A 4NOLA 3L9XA 1PW5A 2JFHA 2Y1DA 1YX7A 4LBYA 4YQYA 1KDYA 7GPBA 1K7SN 1LBEA 1NQTA 3F74A 1I4OA 3WK7A 4CLXA 3FLAA 3B1YA 1DQPA 4P7FA 3ANYB 3LWZA 1J8QA 3F5QA 1NIPA 1E9AA 3JZAA 3ZUPA 4S2EA 1NMQA 1AV7A 3GDGA 2EKQA 5BNTA 4H4CA 4LXXA 3PQ4A 1YHNA 2PU7A 1Z17A 4HLUA 1DQSA 3C6QA 5AJWA 3X44A 4LIPD 2XXAA 3KYCB 4R2HA 3VUFA 2J5QA 3EVBA 5F9FA 3UMJA 3F6SA 2JLQA 1Q0TA 3NO4A 1I10A 4PGAA 5CB4F 4R8MA 4XDGA 3ZCUA 1UL1X 4AUKA 2C59A 3BD7A 1QCYA 4KI7A 4MVJG 3I23A 1Q3KA 3PUIA 3Q7RA 2JGNA 2FYTA 4NI5A 5ITWA 1AQLA 3R24A 2FWNA 3KQNA 3F5DA 3ZVRA 3H2KA 2RHOA 3JWGA 1ZL0A 3N0WA 2CLIB 4G8BA 3ZIUA 2E6KA 3GD7A 2HNAA 3NBMA 1EM8A 3ABOB 2R65A 1SL7A 1SN7A 5EXEA 2RHDA 2AS0A 2FSHA 1J20A 3EZ9A 1KDOA 2O4UX 4DQUA 3Q0EA 2OD7A 1BMFA 1U1FA 3FMGA 1T1SA 3X3HA 3D2AA 4YRPA 1QOQB 3NDJA 3UMFA 4YBRA 4ZXFA 2WV9A 2A88A 1CRLA 4RELA 2DYKA 4S1NA 4RLQA 1SPYA 4JNCA 3H9EO 1G21B 3KUCA 1E2QA 2YFQA 3L8FA 4ZALA 3KF9A 3NUZA 4O25A 2CLOB 2ZI4A 4NJMB 1QQBA 2I76A 1E9SA 1S6JA 3V33A 1DB3A 4NYMQ 1J5PA 3QYAA 4ESOA 1WP9A 5IZ4A 4KR7A 5EGSA 5J2UA 3H9CA 1J9ZA 2AQKA 2WKSA 4DYHA 1QQ6A 4EF4A 4JV5B 4PHGA 2D0IA 4R83A 2PUHA 1VKNA 4TOIA 3TLEA 3AR7A 3O95A 5B1IA 1WBDA 1X9IA 1ESNA 3H0CA 3VU9B 3IKLA 1J8VA 1PG2A 4F93B 4DVGA 1EXRA 3RF7A 1YC2A 2QP4A 3C1OA 5KNCA 3KQVA 3BMNA 3VSEA 3VBCA 1K90D 4J16A 3C7CB 3TZKA 4KEAA 4XIGS 3GUUA 1SCAA 2Q6KA 4Y30A 3ZW8A 4DPMA 4QOIA 2I2WA 3VC1A 2DPLA 1UT6A 3FWBA 3IP7A 1GR0A 3MTGA 4BC1A 5TPWB 3HJFA 5J63A 4C7JA 1CUJA 1LW6E 2NU7A 5F5NA 2C88A 4N1GA 1E2LA 1VM6A 3TE7A 1AQNA 2WJZB 3A6EA 1UP6A 3QJYA 1RXIA 3DDNA 2RBEA 4AJPA 3AEYA 3TTTA 3OQIA 2CXXA 2QLLA 5BMVB 4H6VA 4FE4A 3G1UA 3QVLA 2Y0DA 5D6OA 3GUHA 2Z2ZA 1L1QA 1WY9A 1UMBA 4WI1A 4LC0A 3B9RA 3GOHA 4Q9HA 3WQQA 3OY2A 4W1RA 3MNFA 1DVRA 2D8MA 1N5JA 4L8VA 4UCWA 1GZ3A 3FOFC 3LL8B 4ZDWA 3IC5A 1GPUA 5JSUA 1IK4A 4ZU1X 5LBUA 1LNSA 4G67A 4NV3A 4EGAA 7REQA 1V8ZA 1QVAA 4TWJA 5A9SA 2VHEA 3KC2A 2ZBEA 1AMOA 2C7RA 1SR6B 1QB7A 1YE5A 4YWHA 3BDIA 1E6UA 2HPHA 1Q6YA 1QHHA 1S96A 9ATCA 4BFXA 3GLIA 1V48A 4UULA 4E14A 1YJAA 1QK5A 4G5GA 2PFKA 4ORCB 2DFNA 1G5PA 1CUFA 1P7ZA 3AMVA 2WYWA 3K1ZA 2JCGA 2YHIA 3EAGA 1C4XA 5GM2A 1Z6TA 4FPXA 4D9CA 1U7OA 1RWOA 1HDGO 4DXDA 2ATCA 1NYTA 3AJRA 4H2DA 4ISCA 1YDEA 3N2KA 5DN9A 5DYWA 1JSAA 3USCS 2YRWA 1TJ3A 3Q3EA 1EFTA 2IYLD 4AJEA 1US8A 3O38A 5DYYA 4TT8A 4J0QA 1BF5A 4MP6A 3DEIA 5E7MA 2X2EA 3BXPA 3RLFA 1ZISA 2AC7A 2WU3A 4UZFA 1ODCA 3A1WA 4JT9A 3EQ8A 2F90A 2JI7A 4KVAA 1NQUA 1M1ZA 4WKNA 1NFRA 1YUNA 3T7IA 2IYSA 4OKNA 4HEJA 3EGOA 4FYHA 4OI0A 1BFUA 3T12A 2E48A 2NNLD 4AAYA 4JSTA 2AOXA 3AG5A 1Y6GA 1DV1A 4LDQA 4FKMA 4RTMA 4HLQB 4NKRA 1X1DA 4M1TA 3LUKA 1YVLA 3P2YA 4HSEA 3GNSA 3AEKA 2D1QA 4CLOA 3RG8A 3V6MA 3R7LA 4MXDA 4PLHA 4DM4A 3VGOA 4WLFA 3FAZA 2ZR0A 4BKPA 1TAHA 5DCYA 4JL8A 4B31A 1P2FA 5FTMA 1L4FA 1YB5A 2Q0SA 3H4TA 3DMNA 1A2XA 1NUAA 1FFYA 3NBYC 4M9SA 5D7NA 3TW6A 3I9NA 4CKEB 1RBZA 1JTVA 3QEKA 5E0OA 4BJHB 1BX0A 4I6JA 2GNOA 2Y1XA 5INTA 3FBGA 1D7AA 2JRCA 3B6EA 2LVJA 3RRXA 4NAVA 4TVBA 2A86A 2WNDA 4E15A 4UE6A 4PN7A 1IRIA 4CI0B 4D8TA 3GLTA 4O2AF 3KEOA 3VU0A 1RRCA 4HYQA 1B7TZ 5FO1A 2VWPA 3LSYA 4C14A 2EC6C 5K0BA 1XXLA 4BQNA 3T3OA 4X61A 3LGAA 3GF4A 1T0UA 1M66A 4DE5A 4BMNA 1IHPA 2AJLI 3BQ9A 2Y99A 2D2VA 2XDQA 1DEAA 1KAGA 4M0KA 2J9GA 2CVZA 3BSSA 4C87A 2ATIA 4QQFA 4ITRC 1XWWA 4IHAA 1Q14A 3DZBA 1AH2A 3TDUA 5AKYA 3HJGA 2M98A 3WP1B 2VTBB 3FE9A 3F5MA 3F7TA 3IOCA 4KYNA 2OORC 4B2PA 4IV8A 4YRLA 1AN0A 4MS3B 3CZPA 2BUAA 4XR4A 5BWCA 3AHEA 4CM9D 2X1VA 1TD1A 4R6XA 4QDXA 1U0RA 1JHVA 5FOVA 2BGJA 5KHOC 4QPDA 2WHYA 4ZAGA 3THWA 4UARA 4M2QA 1TT7A 5DRYA 1TGYA 4LHXA 5BQ5A 4M38A 5E2BA 1C81A 2F33A 1D6SA 1J2UA 2R66A 1O9HA 1VDMA 3VYRB 4LWOA 1WPRA 3NOVA 3SF8B 3ZLBA 4LJ5A 4KXQA 1AX9A 3UHOA 1YKFA 2BFNA 4IFTA 1UZNA 3FZQA 4IX9A 2KQUA