1DEKA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
240
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
total genus 86
structure length 240
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1dekA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dekA01
1TUEA 1Z6YA 2OCYC 1F2TA 4I1SA 2KWIA 3KKNA 1AIPA 1XMJA 4Q1EA 3B5JA 3V4FA 4Z1MD 2WAXA 3TUIC 1KO5A 4BUJA 4XVUA 2IYUA 4DLVA 3KTAB 1M7HA 2H92A 3H0KA 1U8AA 1TF2A 3KKQA 3GLGB 4QFMA 3P4YA 1OB5A 1IJEA 2P5SA 3THXB 1Q44A 1TMKA 1E9CA 3DKVA 2LCFA 3RS5A 2XJ9A 2P3SA 4ACAA 3UIEA 5B64A 2GKSA 2AX4A 2VF7A 2GCOA 5CM8B 2FE4A 4B6FA 4NYIQ 2YOFA 4HZUB 4ZI3A 3O8CA 4Z54A 1XXHB 3ZVLA 1LF5A 1H8EA 4D81A 4GP7A 3K0AA 4ACBA 3NBFA 3SZRA 2WSMA 1S3GA 3OAAA 5FTNA 3A1WA 5HKKA 2FSGA 2WJHA 3FKSD 2ORVA 2IYSA 2IL1A 4LHWA 1E9FA 2XNDA 3N5CA 4LBVA 3B1ZA 2ZJOA 1UBCA 2BBSA 2OSBA 4CVNA 4U00A 3AVYA 3MSXA 4M1MA 4GDFA 5E95A 2HYIC 4BFUA 4JLDA 3BGWA 2DBYA 3L8YA 1NIJA 1YJ5A 2V8OA 2VTKA 3AKEA 4DUGA 1P4SA 4QBHA 4RKEA 1P6XA 2ZYTX 1TTTA 3BB1A 3WBKA 1P7CA 2ATVA 4P4SA 1KZ7B 3WP0A 1MR3F 2QMHA 2VYFA 1E1QA 3I73A 1D9ZA 4BFWA 1OF1A 1M2OB 4B74A 2QP3A 4MDEA 2OM2A 2UZIR 2QG6A 5DSZA 3LD9A 4XSGA 3MJRA 1H8HD 2A7QA 2OXCA 2F1IA 2F3RA 4EJSA 3LXXA 4HUTA 1Z07A 3VKGA 1DAMA 2XTMA 1SVMA 2WPDD 4HAXA 4ZCIA 6Q21A 1KMHA 1RZ3A 1GOTA 3RLFA 3PVSA 3DDCA 3M4YA 4L4UA 3CX6A 5EUQB 3W6NA 4Z8XA 2ZQ5A 3TQCA 2OFOA 4HB2A 4TL7A 4MITA 2IEZA 1RRGA 2FPMA 1OH7A 4LV8B 1GKYA 3EA0A 2PT5A 2PCLA 3AF0A 3QSYA 4OHZA 1WXQA 4TYPA 2ZIAA 4TTRA 2Z0MA 3TAUA 3O8BA 2FGKA 3OEEA 2PJRA 5GJBA 2XX3A 4GOKA 1UKVY 2WSSA 5BYKA 1N6PA 1DAFA 2JIZD 4GZMA 2KE5A 5H8WA 4BFXA 2KI5A 3GLHB 3FMFA 3QE0A 4ZIRB 4QGHA 1EWRA 4DLXA 5KU1A 1NJGA 4TL6A 1E79D 2AWOA 1W36B 1FW6A 3SOPA 4OL0A 2FZLA 2VQSA 4WXRA 4NH0A 1M34E 4XSHA 4YMVA 1OIWA 1DAKA 2FFQA 2PL3A 2DWQA 2D06A 4P4TA 1GRNA 5FBWB 4QGFA 2HF8A 4D2IA 3T1OA 4WVFA 1GNRA 1COWD 1TF5A 3M6AA 2VP5A 3NVAA 1XEXA 1XTRA 2ZRPA 2D7CA 2OAP1 4RZ3A 1G7CA 5BN5A 2NGRA 2ZS8A 2F1HA 2IX3A 4Q9IA 4DIEA 3BWDD 2J9RA 5KSPA 4M9SA 5G53C 4JYBA 1SKYB 4V02A 1UPTA 1G3UA 3N2IA 2OCAA 1KAOA 3NHAA 2XGJA 3O47A 1Q0UA 1UBFA 1AGPA 1JEDA 2REXB 2NPFA 3GLGE 2XZLA 2O0HA 1E1RA 3QKRB 4RCYA 1KJYA 4LC0A 3IDQA 4ON9A 4AIIA 3PUZA 4MRNA 5FL7A 2IS4A 3EW9A 2ODWA 1Z47A 4LJ5A 3CNNA 4PPQA 1S3SA 5CK5A 1XXHE 4URUR 2YC4C 2RKOA 3FMPB 4BGDA 1KSHA 1TEVA 1WQ1R 1OKKA 3QENA 2GHIA 2IYWA 3BJIC 2B8TA 1OV4A 2VHJA 4RVCA 2P0EA 3NBZC 4O2RA 3C8UA 4US0R 4TMXA 1Z6TA 4MKGA 4XJXA 1JR6A 1YZUA 2EWWA 3SS8A 1W49A 2IS6A 1XJQA 1SVLA 4AKGA 4LUCA 4PPFA 1ZM7A 3IILA 4LHYA 2WWYA 2FEOA 5JRZA 1J8YF 2R9VA 4G5RA 4NPHA 5FI1B 1BOFA 2IUUA 3LY5A 2A5YB 4KCGA 4G01B 3REFA 5AJZA 1FP6A 3ONWA 1A2BA 3FB4A 3U3JA 2O8FB 3QF4B 3D3QA 1AK2A 2ERYA 3BS4A 4B3GA 1XFAA 4JBYA 1ESNA 3OE7A 4FINA 5F9HA 1EGAA 3H86A 5CB8A 1OH5A 5KDOA 2H5EA 3MCAA 5GJCA 1L4UA 2HJGA 3BOSA 4M0LA 2FMXA 4PQRA 1MKYA 2CHQA 4QC2A 5LB2A 2VSXA 3CM0A 4DDVA 2R6AA 1KOFA 3QPUA 4ZDJA 3KQNA 1NBME 4FXPA 1X1RA 2J0UA 1IXRC 2D62A 1E2GA 4EKDA 3KX2A 4F4IA 4WAUA 1CLUA 1KNQA 4Q9JA 2CVFA 1NLZA 4EPWA 1LS6A 2IYLD 4R71A 3KFXA 4FD2A 2WWXA 4NCNA 3A37A 2ZAMA 4R98A 3WHKA 2ZI7A 4UNNA 3TE6A 3KKOA 2BJVA 1EK0A 3T12A 4W7SA 1U99A 2WICA 3GLHE 3GJ7A 1E9RA 5G40A 4YC7A 5FTLA 121PA 3LQRA 1EX7A 3K53A 2WKRA 4LV6A 2ZR0A 3UWOA 4IDQA 2Q9CA 2D3WA 3QKSA 5EXTA 3W8NA 4E09A 1S9DA 4TYNA 4D6PA 1E9SA 2WWIA 3BORA 4ABYA 1XF9A 2VA8A 4JLBA 4JBWA 4B32A 3RANA 5BWMA 3H2YA 2HDNB 3CIOA 5CDFA 4BWYA 3ICQB 3UK6A 1S9HA 4PO8A 3ZD6A 1SKYE 2PLFA 3K0FB 3RRYA 1CJVC 3DO6A 2XOKA 1RRFA 2RGNA 4FMBB 2WM9B 3ZQ6A 1ZU4A 3FFBA 3K70C 5AJWA 5DE3A 1GRQA 2P5TB 3JVVA 3SBDA 4C3ZA 4YMUA 1W4CA 4GBMA 1XRJA 3RC3A 4OJQA 1KAGA 2QSZA 3LFUA 4Z1MA 2GBLA 2XZPA 3QUSA 3CX8A 1G4UR 4A36A 2IYXA 4MUAA 1S1CA 3AF3A 2GVZC 3UATA 1W36C 5J4KA 2BEKA 4KV9A 2D7DA 2R2AA 3KJIA 1D9XA 1U8ZA 1MT0A 4KODA 1WCV1 4XD7D 4D80A 2GEVA 4NMMA 2C99A 2GJ8A 2HCJB 2GZDA 1FQJA 4A2PA 3ZQJA 2ZETA 4YDHB 3A8TA 4BRWA 1N0VC 2ZSAA 1RYHA 1P2VA 2FOLA 3KZ1E 4HLUA 4I1UA 4XVQA 1HH4A 2EFHB 3BB4A 1AM4D 1M8PA 3KQLA 2JGNA 1X1SA 1FNNA 1NVWQ 1QF9A 1OFHA 1J90A 5JRJA 1RIFA 3FKSA 1F6BA 1CRQA 3EIEA 5FUXA 3PEVA 3REGA 3Q72A 1QBKC 2OV2A 3W90A 4ILEA 1T8UA 3RRZA 4XIGS 4QNRA 1XEWX 2XZOA 3PEYA 5HCNA 2FPLA 4G5SA 2RB4A 5A5GA 1KO4A 4S2EA 4IOKA 3WNDA 2ZRAA 1EG7A 1Z83A 3QVVA 3GFPA 1MRNA 4RFSB 3FTQA 5EUMA 2HCBA 2ODNA 2CJWA 4PAOA 1KTVA 3HWSA 3MWLA 4TL9A 1E2LA 2F55A 4Q4JA 4MGKR 4NKRA 2QU8A 4PQYA 1CS4C 5BN3A 5LD2C 2WMNB 4ASUD 4DLSA 1DELA 2F43A 3AF2A 2OXRA 4B75A 5KNDA 1F60A 3ZVRA 4QKQA 5DI9A 3FDIA 2QTHA 3FHTA 5DIFA 3WBJA 1H8HA 2XNSA 4C0JA 3CBQA 2BWJA 4Y0AA 2O8BB 2OZEA 4DZZA 4GL2A 1E96A 1M6NA 2WPDA 1Z0KA 3EX7C 1EWQA 3TLXA 4RD4A 1E9DA 4TMKA 4JLMA 4LJ9A 2JJ1A 3TVTA 1QHGA 1EFTA 3WY9A 1OSNA 1Z08A 2Q21A 1I4DD 4PHTA 1G6HA 1CTQA 1NG9A 1KO1A 1XX6A 1YQTA 4HEJA 2BIFA 3R20A 4M9QA 2WJVA 4NCIA 2H7VA 3TUJC 3M1IA 4P32A 1CR2A 4HZIA 4Q01A 4CZ2A 5IF9A 1C4OA 3PUWA 1LY1A 1X3SA 3P4XA 1E79A 1XWIA 2Y8EA 1KDOA 2ODBA 1MABB 3PEWA 1CRPA 3HR8A 1R0WA 4OI4A 3VTKA 3WMGA 4HLCA 4CDGA 3IPYA 2ZU6A 3A1UA 3LVQE 1AS0A 1E0KA 3SN6A 3EZ2A 1G8YA 2QI9C 4YMSA 2E1RA 1COWA 2VRWA 3DOFA 3EXAA 1GKUB 2C9OA 3WNCA 3QVUA 3H84A 1W36D 1JR3E 1DAHA 1E2MA 3IHLA 1R5NA 2VHCA 5AUOB 1ZUHA 4KITB 2EVWX 3THOA 1X8KA 3H4MA 1Q57A 4PC2A 3CRMA 4II7A 1FPMA 1CJUC 1MO5A 1JBKA 1UM8A 2WWHA 1G5PA 2Z43A 4OK3A 4W5HA 4EQ6B 3MLEA 2OBMA 2FNAA 1BH2A 5IHPA 2QZ4A 4BQSA 4F91B 2IC5A 5CJ2A 2JLXA 4HUQB 1Q21A 3SI7A 3IHWA 2HYDA 3IKJA 2C04A 4XH9B 2EU8A 1SULA 2BEJA 1W4RA 1Z28A 2ZTSA 3B1YA 1W2HA 1G7RA 1ZM9A 2C78A 3K9HA 3SC3A 4Q02A 3VFDA 1UJ2A 1GL6A 3P32A 1FQKA 5JWOA 1LB1B 3AGQA 4D0GA 5D3QA 1K5GA 1TQDA 5AUNB 2KB0A 5EP3A 3CRVA 3OIUA 3PENA 3W9YA 2ZJZA 1ZM4A 4LJ8A 5J4HA 4ZDIA 3AVUA 2A3RA 4LPKA 2GXSA 1G16A 3DMNA 4LV5B 3A58B 4M1SA 1XMIA 4TYWA 4I4LA 1JI0A 3I3SR 2VP2A 1XCGB 2CE7A 2IYVA 2QT1A 2ZROA 5CITA 4TMZA 5K8UA 4QG7A 2NIPA 1EESA 4AYTA 5EJEA 3ETLA 1KJWA 1VIAA 4LCBA 5KUTA 3L0SA 1DADA 4B3XA 2OCPA 2OFXA 4IDOA 3GJ0A 1G41A 3CR8A 1T9HA 1KI8A 2X1VA 1NSTA 4QGGA 4DDWA 2AKAB 3CWQA 3R9XA 1AZSC 3HYRA 1VCOA 2NZ8A 4NE2A 2O8CA 5H68A 4PHFA 2J0SA 3UG6A 5FOWA 4JVMA 1JPJA 1W48A 1OFTA 1JJVA 2AKYA 4DHEA 2YWFA 3TJZA 4CEJB 2RCNA 4KI0A 4OQXA 4OHXA 1BO6A 4URZR 3U6KA 1ZNWA 3Q7QA 3QXJA 2IWRA 4A0GA 4F7WA 1D6JA 3QEOA 5A0FA 1V43A 2GF9A 2WVJA 2FX3A 1HQCA 4WZAE 4XVRA 2VSFA 4AKHA 2EFEB 2JCSA 4U02A 2IYYA 4LJ4A 4GFDA 5H1YA 1N5IA 2TMKA 5SZKB 2HV8A 1OIVA 2HXYA 4AG6A 3U7EB 2F9MA 2UZ3A 2BM0A 2RGXA 2IF0A 5DNYB 4IDPA 1A4RA 1XD9A 2JLQA 3THYA 2P2LA 3K0SA 3KKMA 2JLRA 1G64A 2AXPA 2W2VA 3Q85A 1DS6A 3OHMA 3SU8A 3C14C 2EFGA 1M1YE 4QJ4A 4RZXA 1KDTA 4D4KA 1IOZA 1OW3B 4W9MC 2AK3A 2FH5B 2O5VA 3U44B 2YC2C 1A2KC 1TL7C 4BEBA 1E2KA 3P26A 2QQ0A 1SVKA 1LF0A 4HLUC 1MO4A 1KMQA 4OHWA 4RSGA 5J4YA 3CLVA 1U90A 4TLDA 4E03A 2QORA 1KY3A 1SKQA 5JBQA 3LXRA 3GLFB 4UKDA 4DSTA 4URVR 4JLPA 1EFRD 5GADl 4DJTA 3B1VA 1DARA 4Q1FA 1NJFA 1G3IA 2QM8A 3DM9B 4BPBA 1G19A 4IDNA 2G9NA 4B2LA 4DB2A 4QHYA 2PEYA 2FG5A 5CM9C 4X8LA 1R8SA 1F2UB 2C96A 4HB0A 2P6NA 3VR2A 5EE9A 1U98A 2CLSA 1ZIPA 1EFCA 5KSOA 4CGZA 3R7WB 1DO2A 2ZUBA 2KJQA 1QHHB 3VU9B 4M1TA 2O52A 4GPTA 1BYUA 2OHFA 1FFHA 3HPQA 3DZ8A 2KBEA 2F1JA 2JLWA 1RPZA 4A15A 1QZXA 2Z83A 3LX5A 5HR5A 1G17A 4C7OB 1II8B 2GAOA 2GJSA 2NZJA 2RGDA 2OT3B 1W47A 3KJHA 1TX4B 2OCBA 1T5IA 2ZRKA 2ZUDA 5AUQA 1PJRA 4XD7A 2NO7A 3B9PA 4PANA 4DLUA 1NVVR 4C0SA 4YXWD 4NDZA 3UWKA 4A0FA 4MKFA 4A6PA 3B85A 3KL4A 4JVLA 3UMSA 1K5DA 2GJAA 3GLGA 1A5TA 5F9FA 4PPGA 1YR9A 3THXA 1ZNXA 3U7FB 1GM5A 3NHBA 3L43A 2VLIA 3DZDA 1UADA 2PX3A 2D74A 3IQWA 4IVPA 1SVWA 3GLIB 2BM1A 2WIBA 3TW8B 1TQ2A 4JLNA 5IK2A 4GT1A 1UKEA 1FZQA 3VR3A 4QGAA 2F1RA 5FPTA 2XAUA 3NDBB 4QNMA 4UNRA 2QT0A 1E9BA 1W4BA 3TW4A 2UKDA 1IXZA 2WIAA 4D0LB 1Q20A 5J40A 4CT5A 5KHOC 4DSNA 2W6IA 1E6CA 2ZI5A 4MDFA 5FFMA 5JECA 4QJ5A 3THWA 2OO7A 2YJTD 2IXFA 3ZVNA 4ZCMA 4CEHB 3TR0A 4URYR 2AXNA 4N3NA 2QENA 5FH9A 2YNMA 3C4JA 4NBSA 3AUXA 2OE2A 3L82B 3RWOA 1K6MA 2JJ2D 4KXFB 4W5WA 4DBLC 4TLEA 4ASUA 3AF1A 1OYWA 1ZMXA 3KB1A 4Q7KA 3ZIAD 4CRWB 1N0UA 3QBVA 1U0LA 2HLDD 3NWJA 1SXJC 1IN4A 4Q1DA 2ZS7A 2GWHA 1ZC4A 2VO1A 1PLKA 1KKMA 4UNQA 1P9RA 1S96A 4I1VA 5JS7A 2VEDA 1VDZA 2R6FA 1HY3A 2DYKA 2DR3A 4LY6A 3ASYA 4PO9A 5FBVB 4MA4A 2LKCA 2G1KA 5DISB 5B57C 3RNLA 4MGZR 3QKUA 5DGXA 3A36A 4EPXA 5JJIA 3TUZC 2RHDA 3VAAA 3QBTA 4AG5A 1MH1A 3BAFA 4KVAA 3MD0A 2ZJ2A 4B2IA 2JLVA 1IBRA 4I81A 2J46A 2ZYWX 2QPAA 1NLFA 2V9PA 1HT2E 3FMIA 1XD2B 4PAMA 2Z5FA 4ESHA 3GLFE 2C77A 2CNWD 4LI0A 2OEPA 2ZJ8A 5FPSA 3ADCA 1OH6A 4B73A 5TMPA 1HUQA 4US1R 1U81A 3T06B 1G5TA 3LVRE 1TUIA 5TXGA 2GETA 3KKPA 2J0QA 4R2IA 1P2TA 3BB3A 5KSYA 4LYFA 2IWHA 2AL7A 4X8OA 3KQKA 1XPRA 4ZIRA 1GRRA 1DVRA 3SNHA 1KI3A 2P67A 3RS7A 3FGNA 4E22A 1CJKC 3I8SA 5FTJA 4N0EA 4NYJR 4E07A 4HAYA 2PZGA 4HLQB 1KK3A 1N6KA 3CZQA 4B48A 5AJYA 3RYTC 1UDWA 1DG1G 1BMFD 2KBFA 1X8JA 1FX0A 2NMVA 2ZRLA 4ZKDA 1GP2A 1Z6AA 4H1UA 1G4AE 4BZPA 3ZD7A 2IHYA 2VHUA 4DDUA 4MYTA 1N6LA 4IXNA 4DLWA 5EZ6B 1HV8A 2CK3D 3A4MA 2GCOB 2N1BA 4JMPA 2ZPTX 3I62A 3BRWD 3E70C 1T0JB 1IY1A 4F92B 2J7KA 2RGAA 2A78A 4HAVA 1OFUX 1HT1E 3HJNA 2D4HA 4P33A 3SYKA 2CCKA 5KDLA 1P5ZB 1RRCA 4OK5A 1R0YA 3U4QA 1YZNA 1W4AA 4ZCLA 4XWOA 3GLIE 4FI3C 3F5FA 3GP8A 4OJKA 1B23P 1J99A 3K09A 1GVNB 3B60A 3PR1A 1ZCBA 1T3SA 3KJEA 4M9XA 5TARA 1UDXA 4ERNA 1XTJA 4RKFA 1IONA 3W3AA 1GTVA 1E0AA 1JQLB 4LWZA 4GP6A 2J3EA 3IO3A 3NH9A 4TLBA 3IEUA 4PTLA 3ZDQA 3GJ5A 3C7KA 1US8A 4OI2A 4P4SB 4KAXA 1DE0A 1VYTA 4JT2A 3U5ZB 3TKLA 4XTRA 2QBYB 3VR6A 1NMXA 1FP7A 1SXJD 3PG5A 2QGNA 1HYQA 1SQ5A 4U5XA 5FI0B 4A0HA 4B43A 4R7ZA 5A4JA 5JCPA 1R10A 4BECA 3EPJA 2PT7A 4YLGA 2YVUA 4FMCB 3SQWA 3ICEA 2G88A 2G0TA 5GJWC 3IEVA 2I3BA 4Q00A 4NYMR 3LBHA 4V0ME 1R0ZA 2WWWA 5KYKA 3MMPA 3NG1A 2WWFA 3HP1A 2WHXA 4PPNA 4B3FX 1Z29A 2G1JA 4F38A 4JVNA 2O8FA 1HTWA 1N2CE 2NO9A 4HDOB 2DWOA 1NMYA 2MSCB 4C9BA 5DO9A 1FTNA 4TWZA 1CXZA 4PHHA 1QG4A 4B44A 1ZNYA 3Q9LA 1YR7A 5JMTA 5AJXA 3RC8A 2ZM5A 3UMFA 4EIWA 3TRFA 1HE1C 1XU4A 2EYUA 3SBEA 1XBTA 3WP1B 1UKYA 4LHZA 2ZRDA 3C15C 1ZC3A 3CR7A 3ZZ0A 1DG3A 1FNMA 1RJ9B 4V0LA 1GL9B 3BC1A 4JJZA 2GJ9A 3GQBA 3ZH9B 3TGPA 1D5CA 4JL6A 2ZE8A 1E99A 3X1WA 4LBWA 5KNBA 5GJVC 3AGPA 3K9GA 4ESVA 1ZNZA 3A6PC 1CR4A 3JZAA 4KHZA 4BFYA 4OI1A 1XEXB 4YMWA 1DAEA 1MV5A 2HT6A 2FSIA 3KUDA 4LK2A 4BLRA 3GEEA 1HURA 3GD7A 2Z4SA 1KI7A 4FWIB 1XZQA 5KDDA 1FMJA 3VMFA 1EFRA 1TAGA 4MH0R 4HAZA 1G1MA 3WRXC 2DHRA 2GEDA 2VSOA 1KJZA 1AKEA 3F8TA 3HU2A 1I4TD 3SJAA 2JATA 2AD1A 2VP4A 4TTPA 3FHOA 1P9WA 1GKIA 4WIAA 2MMGA 4Q7JB 5FUYA 1E2JA 4C2TA 1XNJA 4PQFA 5GVRA 4BLTA 1SZPA 1WB9A 2DCUA 1L2TA 3VHLB 5EXXA 2QE7D 2RAPA 4Q21A 2PMKA 4KFRA 3L0PA 1Q12A 1P3JA 3MFYA 2B7BA 1W5TA 2CMKA 1NVUQ 2ZSFA 3DOEA 3K9LA 1ZRHA 3ADKA 3SDZA 4UNPA 4MGYR 1U0JA 1M74A 1LNZA 4IRUB 1II9A 4MUBA 3OIWA 1OHHD 3E5HA 3W8RA 4A2WA 5C46F 1DEKA 4YXWA 3VR1A 5JEDA 3P27A 4KYIB 5G41A 4PHGA 2R6GA 4GNKA 5AR1A 3ZGXA 3U7GA 2QAJA 1OYYA 4AKEA 1QG2A 4QL3A 4JVSB 3KB2A 4AYWA 2JLYA 1KO8A 1KI9A 1X86B 5FOTA 1QHYA 3I61A 4Q03A 5LPNA 3SFZA 1N0WA 1QHXA 3U6BA 2ZRBA 2QRNA 4JZKA 3QG1A 1E2QA 2P6UA 3J81k 4HSEA 4IEIA 3PJRA 4QM7A 2ZITA 1UBEA 1ZINA 3RS0A 2LWIA 3ECCA 1TEXA 3FWYA 4LJYA 2ORIA 1N3BA 3RS2A 3U61B 5AWFC 4QOSA 2X2EA 1EX6A 5JSZA 4TMWA 1IY2A 1G8FA 3PFIA 4TSFD 5DLQC 3B1WA 3F3YA 3E2IA 2EW1A 3AP2A 3NEYA 3G0HA 2HUPA 3ND9A 1QVRA 2J0UB 3LH5A 5DI3A 4EDHA 2ZS9A 3AKCA 4RZ2A 3VHXA 1OJLA 4KFSA 5EE0A 2JJ2A 3BK7A 2QP9X 4TZ6A 2GRJA 3EC1A 2CEAA 4QBGB 5ANRB 4FWTA 2HLDA 1I2MA 2OLKA 4EUNA 1Q22A 3QOFA 1KY2A 4N1AA 3T34A 2ANBA 2FGJA 3PUYA 3EIHA 1T91A 2FWRA 1X8LA 1WA5A 4B6EA 1N6RA 2AHOA 2AD5A 3F0TA 4PC6A 3LNCA 2EFCB 2QMEA 3LW7A 1IJFA 4ZV4A 4BFTA 2O8BA 1E94E 5SZJA 2YV5A 4CYMA 1NVVQ 4IVQA 2WJGA 4IFBA 3QPWA 1S1MA 4GRAA 1V5WA 5L3QB 1Z5ZA 2GXUA 3X1DA 4A2QA 4MQBA 2OFWA 3WYGA 3IBGA 4BZQA 1AA9A 4RD6A 5TVKA 4N0DA 1UKZA 3RWMB 2OILA 4JS0A 5J47A 4US2R 3K09C 2GXAA 2O8EB 4DVGA 4O25A 4U7DA 4C30A 1VMAA 1P60A 3MJHA 2OAQ1 4FIDA 1MO3A 2Q9BA 3VNVA 1R5OA 5LB4A 2ZRCA 4EFLA 4B34A 2QNRA 1G3MA 4JKIA 2IS1A 2C2HA 2DPXA 1NSFA 5D3MB 2GCPA 2QEQA 3B7GA 4DB4A 2BCJQ 1D2NA 2GDJA 2FV8A 2ZRHA 1ODFA 2QAGB 1MO6A 4B35A 2I4IA 1XEFA 2H18A 1W7AA 1BMFA 2Q3HA 3SR0A 3E1SA 3KQHA 3SQXA 3CPJB 2BKEA 2GF0A 2WWGA 2QN6A 3LO5A 4MRVA 4HAUA 4TLCA 4C0QC 2CK3A 5K8IA 1N5KA 2Q3FA 5CB6A 2QY9A 3L0OA 5EQTA 2CCGA 4EQ6A 5FPKA 2C5LA 4W5JA 3D7MA 1VG8A 1NBMD 3RRMA 2ZVQX 4HUQA 4LZZA 2JIZA 4DXAA 2YOGA 4C0LA 1NP6A 4Z51A 1E98A 4RD3A 1ZD8A 2B8WA 2PZEA 4FCTA 3UXMA 2XITA 4KO8A 4LHVA 1YZKA 2K5UA 1S2MA 1UEIA 2AFIE 2I1QA 4LDJA 1OT3A 4NHOA 3WMFA 4DCSA 3CO5A 2A2ZA 3QNUA 3SYLA 1FTSA 1KK2A 4XWKA 1WBBA 5L8VA 2V7QD 5K8TA 2CJWB 4C0HA 1O3YA 1R6BX 4DCNA 5JFGA 4LC1A 1YRAA 5KPJA 4Q4JB 1Z0FA 1SXJA 4TQUS 3DKPA 4WZBE 4C4PA 1EXMA 3SHWA 4NP6A 3P1JA 1N6IA 4NL4H 1ZVQA 3U3OA 4BLOA 5EE5B 3FOZA 2O8DA 1VIYA 4MGIR 2ATXA 3PCRB 2YYZA 4I99A 5AK0A 2JLUA 1GZSA 4EAQA 2ZRNA 1JXOA 1N5JA 2DFNA 4Q9KA 1P2SA 1OIXA 3DVLA 3JVUA 4IKEA 4K46A 5E7IA 4NYJQ 1T0HB 4FMDF 1ANKA 3PITA 2ZANA 4Q4HA 3EASA 5CIWA 1YZTA 1WP9A 1D8TA 1Z8FA 5E4FA 1E3MA 2F6RA 4UXHA 1OPXA 2BBOA 4LJ6A 1KKLA 2SHKA 3TNFA 3TSZA 4LBZA 2P65A 2OLJA 5CYOA 1DAIA 5IDVA 5GVSA 3CRRA 3ZZTA 2A30A 3MUFA 1QRAA 1RC8A 1XTIA 3SFVA 4FN5A 621PA 4BLPA 1P2UA 1VCNA 1U94A 1XTKA 1FL9A 3BFKA 2R6CA 3D8BA 4L15A 4ZO4A 1JQJC 4M1OA 2F9LA 2CCJA 3AM1A 4UXIA 1BIFA 1AJEA 3X1YA 3GJ4A 4OKSA 1J8MF 4KJZA 5CDFE 2BKUA 3EZ9A 2O0JA 3C5HA 2DFTA 2QMOA 4IDHA 3S1AB 2WSSD 5EXSA 5KSZA 4AK9A 4PSVA 2ZREA 2WKPA 5HTKA 3CRW1 2G83A 221PA 1XJ0A 2V3CC 4A8JB 2FA9A 4M4SA 4TT3D 5CLQA 2BMFA 1G8HA 2A5GA 1Q1EA 1AKYA 4KFUA 4CIDA 4MRRA 3KFVA 4KLNA 3OF5A 4QXAA 1M7BA 2AK2A 2W2TA 1TF7A 2EYQA 1P73A 1XJCA 1VPLA 1RRPA 4RD2A 5HCIA 3N2EA 2Q6TA 3AH8A 3OEHD 4GSYA 1KI4A 2ZI3A 4CT4B 3DMDA 2CBZA 2XB4A 4OHYA 1KDPA 5J5CA 2QMUA 1ZW6A 2PLRA 3AP1A 3VX4A 2ZSEA 3NIBA 1KI1A 2ZEJA 4AI6A 4D25A 4NYMQ 1NMZA 1ZD9A 2QE7A 1XPUA 3NBYC 1QHIA 2ZYVX 2BHRA 3A1TA 4F93B 3R7WA 2NO0A 3G5UA 4L8GA 1F3OA 4PO1A 1WF3A 3C41J 4IEEA 3V00A 1ZYUA 5TB5A 4FMCF 1FMLA 5CJPA 1KDRA 3QI2A 4IOLA 3QXHA 3PUVA 1GAJA 3B1XA 1D2MA 4OQMA 5L3SB 1E2EA 1OHHA 4JIMA 2HT1A 1CR1A 4HAWA 1CULC 2QGZA 2HF9A 2XSZD 1II8A 3OFND 3Q3JB 3TMKA 2CL0X 1H65A 1OKKD 4JL8A 1K8RA 4LJAA 1W0JD 2JDID 1NL3A 3NBXX 1U0HC 2AFHE 2ZE6A 1IQPA 5L3VA 1T5LA 2J0VA 2QTVB 3QKTA 5FBRB 1SVIA 3O8DA 3RHFA 1GFIA 4A6XA 1TQ4A 1YVDA 2IK8A 4C0AC 4DIDA 3R8FA 1AN0A 4TL8A 2GXQA 4O3MA 2JA1A 3CNOA 3I72A 2O8CB 2B7CA 2VP0A 4PAQA 4KBGA 5FBQB 3QXXA 3MG9A 4CEIB 4C0KA 2YOHA 5JS8A 1GNQA 1QDEA 3X1ZA 3FKQA 3FMOB 3ZVMA 4Q47A 4BFVA 4NCHA 1YR8A 4LX0A 1AS2A 4KBFA 4PZYA 2XXAA 521PA 5CLLA 4TTQA 3D6TB 4TSFA 4V0OA 2Q0HA 1NI3A 3SEAA 3HU3A 4Q4AA 2GCNA 1TNDA 3ND8A 1PZNA 3CNLA 2FSHA 1E2DA 3OE7D 4JLVA 5KO2A 4OI0A 4CW7A 4MRPA 4DWJA 1G18A 4C0BA 1JR3D 1UFQA 3RS3A 1UEJA 4DSOA 1VCIA 1CBUA 1L8QA 1W5SA 2OUKA 3THYB 4BZXA 1VHLA 3PEUA 4MKHA 5TY0A 4TMVA 3CW2A 4GZLA 3KTAA 3EWAA 1KSJA 4M1WA 4EPRA 3EPHA 5G3ZA 4G5OA 4V0MA 2R6DA 2VHTA 4BE7B 1RVDA 3AEZA 4Q7LA 2QPOA 2RHMA 3AKYA 3R9IA 1JNYA 2R62A 3RSOA 2J41A 5CIQA 3FPAA 5FR2A 4HZUA 4B33A 4WOPA 3RAPR 3V4RA 4PC1A 1XXHA 3I8XA 2OBLA 2V54A 2CHGA 2BMEA 4M2LA 3ZS8A 5K8LA 1U2RA 4NCJA 2AR7A 3T1TA 4E5UA 4EPYA 1OXUA 4TN1A 2A5DA 1AS3A 4DLZA 1G8GA 4BLSA 3EZFA 1EFUA 3LQQA 1BKDR 4QHTA 1T6NA 5M04A 1G7SA 4LGMA 5JHGB 1WE2A 1J70A 1KI6B 2IYZA 1NKSA 2GEUA 2CL6X 1R7RA 4LOAA 4PZLA 1G9XA 1E2PA 3NH6A 5DHAA 2FEMA 3GCGA 2ZI4A 4D0NA 2Q9AA 3UPUA 1TPZA 1C9KA 2A5JA 1JB1A 1ZM2A 3AV0B 3SHFA 1XCPA 4ARZB 1Q3TA 1GILA 2XTNA 3GFOA 2MSEB 1HA3A 4DDTA 2KSQA 4AD8A 3T61A 3QPVA 5EP1A 1L7VC 3W6PA 4ZI2A 2FN4A 2WOJA 1GWNA 3IPXA 4A8JC 1ZUNB 3K9NA 1GDDA 2IS2A 4JSTA 4ITRC 421PA 3ADBA 2OG2A 2W00A 1VECA 3SE0A 1Z2AA 1P61B 2RGCA 2ZRIA 721PA 2ZYUX 4MYHA 2JLSA 1KK1A 1P75A 2BDTA 3CH5A 1VCMA 2CXXA 1YRBA 2ZVPX 3LX8A 1MRSA 4Q19A 2GESA 1NBMA 2BOVA 4V03A 4R2HA 3AVXA 1AGRA 1ETUA 4DT1B 2PEZA 1VG1A 2IYRA 4FMDB 3P20A 3A4LA 4URXR 1NF3A 4WZ6A 4YMTA 2XJ4A 1Z6XA 1ZAKA 2DFKB 4P4UA 1Z0AA 3HR7A 3NTUA 1E2NA 1LTQA 1F2TB 4LBYA 3U2QA 3GLHA 3THWB 4KYUA 2WJYA 3BFVA 2V7QA 4TLAA 1XB2A 1DAGA 2WOOA 4URWR 4RCZA 4LYHA 3RDPA 1B0UA 2J59A 4Q66C 1Q1BA 1VTKA 5JJLA 5DYGA 2E9SA 2V55B 1I2DA 1IN6A 1OE0A 3VNUA 3O8RA 3Q8XB 2O0KA 5JWHA 1IM2A 1XTSA 2DY1A 2QBYA 3HU1A 2V1UA 1DO0A 2C95A 3HYTA 1W1WA 2ASEA 3ZLJA 4X8HA 1CU1A 3K0AB 3GJ6A 1JXMA 3TK1A 4MKIA 2WJJA 3QKRA 5JEEA 4LSGA 2JAQA 1ZIOA 2QP4A 2FZ4A 2PJZA 2ZJ5A 4IFEA 4AC9A 2CL7X 1JAHA 3GMTA 1UF9A 5KPDA 1S8FA 2R65A 4GMXA 1R8QA 5DN6D 2JJ1D 3BXZA 1IAQA 4Q5IA 3MWKA 4Q7MB 3A1SA 3BBPA 1Z0IA 2ZRJA 4JYCA 1DOAA 2QSYA 5AJVB 2VIIA 2YKGA 2EWVA 3CONA 3TH5A 3KDSE 3KQUA 2BMJA 2PMDA 3K70B 1LVGA 2QPTA 3B13B 1KK0A 1PV4A 3AKDA 2OBNA 4IVRA 4YDSA 1E9AA 1E0JA 4MRSA 1XP8A 1RJ9A 2J1LA 1KHTA 1Z2CA 2QROA 3GEHA 3TIFA 1XPOA 4BEJA 2NTYC 1PLLA 4PZZA 3FE2A 4TT3A 4UQOA 4GOXA 1NN5A 3EA5A 2F7SA 2ZU0C 2FFBA 1A7JA 5FR1A 4DEXA 1J7KA 4M22A 1HQYE 3EAQA 4PX9A 4EJSB 4B47A 3BH6A 2GILA 4IXMA 1FX0B 1LFDB 1IN5A 1KMHB 5FOUA 1TU4A 5BQ5A 2FSFA 2NQ2C 3K1JA 1E69A 2W0SA 3CPHA 2X77A 2YHSA 3OEHA 3QF4A 3MWYW 3Q7PA 1C1YA 1FUKA 1DTSA 1GITA 3TR5A 2IT1A 1JEEA 4YQFA 1TU3A 1KSFX 5DH9A 2GTPA 5FPYA 3FHCB 1CR0A 3K0CC 1A82A 4JSYA 1G3QA 4P0TA 5P21A 2P6RA 1P62B 3U4QB 3RSLA 1NIPA 3EZ6A 1NY6A 1JJ7A 1LV7A 2RGBA 3DHWC 3OESA 4NCKA 2ODEA 4QBFA 1T3HA 4AYXA 1NG1A 2I1VB 3NEJA 1GNPA 3QY0A 3I5YA 1R5BA 2VL7A 2N46A 2ZE7A 4JJKA 3AQ4A 2QTFA 2GK6A 3B9QA 4A92A 1FOEB 1ZU5A 2XSZA 3K8YA 3C16C 3OFNA 3T5GA 1W0JA 2JDIA 3CUEF 1QVAA 2WKQA 4K8OA 3LRPA 1LS1A 5JZVA 4HDQB 1US8B 4Z8YA 2JEOA 4CF7A 1XCMA 1RE0A 5JWRA 5LD2B 1HE8B 2VHQA 3JZMA 1XMVA 1E0SA 3W34A 2XB2A 3TVDA 3I1FA 4OQLA 5TDHA 1OH8A 5BW8A 1I4LD 2PH1A 2IEYA 3BH7A 3B82A 3ADDA 1Z63A 1OXSC 4D82A 2X19A 1E32A 1GG2A 1OXTA 2F3TA 3PV0A 4I1OA 1SVOA 2H16A 2YWEA 4XWAA 8OHMA 5JCZA 2DB3A 1O87A 2J7PD 2EFDB 4NONA 4BRUA 3PIRA 2BCGY 1KGDA 1XMSA 1KSGA 2H8KA 1Q1QA 4A0RA 1ZUIA 4Y0VA 4XTCS 3K0FA 3WXMA 5C2JB 4HB3A 4JKYA 3EZ7A 4FW9A 5EE3A 3LLMA 2H1LA 4Q18A 1ESMA 1IY0A 2NO6A 3G82C 1WBDA 1JR3A 5FUWA 1CF4A 4DSUA 1N5LA 4G0NA 4DCTA 2ZE5A 1U9IC 3CX7A 4P31A 2J45A 1TADA 1Z22A 2G3YA 2W0MA 4FCVA 3LW8A 3KJGA 3HPRA 4QJ3A 2C8VA 2HJVA 2D2EA 1SGWA 4HB4A 5C18A 2R8RA 4Q9HA 1YZGA 5EP2A 4ZKEA 2QRZA 2GVDC 1YZLA 4OQNA 1MOZA 2ERXA 4RZUA 2YWHA 3KXKA 2ZJAA 2RGEA 4OHVA 2G6BA 3EARA 2V1XA 2W6JD 2WV9A 2WMOB 5JI3E 3B6EA 1XEWY 1TQ6A 5SZHB 1W0KD 3WYFA 1Z6GA 2ORWA 4HLDA 4UJ3A 3DPUA 1CKEA 2XEXA 1G7TA 2C9CA 4DEYA 2WZQA 1G3RA 3BH0A 3FYHA 3SJCA 4ZPXA 3AVVA 4IHQA 2BJWA 4B3BA 3ASZA 2NPIA 3TQFA 3OIYA 2PX0A 3A1VA 3WRYC 1E9EA 4JT4A 3WHLA 4AY2A 5UKDA 5CK4A 4B2PA 3LV8A 3W6OA 5L3QA 1YE8A 5SZIA 1E2HA 2OESA 2A5FA 3A4NA 3CF2A 3LBNA 4M9ZA 5ELXA 1GIAA 3AUYA 4V0NA 4OK6A 2FF7A 1AQUA 1IHUA 2O8EA 5J4VA 4RFSA 3ZIAA 4TMTA 3W5IA 1N6NA 1GUAA 2XTZA 1VKJA 3GEIA 1P9NA 1T3LA 4TZ0A 5G3YA 1AQYA 4M1KA 1NN3A 2BV3A 2REOA 5HE9A 4A9AA 3LAWA 4ZDWA 3VKWA 5HZHA 4M53A 5D3MA 5HPYB 2RGGA 5H70A 1YU9A 2IXGA 5C4GB 2ECKA 3TBKA 3AVTA 1SHZA 4NYIR 3H1TA 2WTUA 1M7GA 2QAGA 4L16A 2ZJBA 2ONKA 4J0QA 3ZJYA 4IW3B 3QKSB 5E7JA 3EWSA 1RW4A 4LYJA 3NXSA 1ZM3A 2FJUA 1ZCAA 1HEIA 5E3HA 4EJSC 2CVHA 3BD9A 3LBIA 3NDPA 1E2IA 2N42A 4TYYA 2CNWA 3LDAA 4HDCA 4DCVA 3VR4A 1NNEA 3CF6R 5KTYA 2CDNA 2HEIA 2GNOA 2AWNA 4OBEA 4AKIA 4L9WA 3UG7A 4EPTA 2WJIA 1IXSB 5KOYA 1VYUA 4A4DA 4KVGA 4Q48A 1VG9B 2ZRGA 2VP9A 3UMRA 3RVBA 4JL5A 2QA5A 5E7MA 1N25A 4JLJA 1RFLA 5JSZB 4GMDA 3U3MA 3EPKA 2VF8A 5IK2D 1E4VA 5IRCD 2GZAA 4O0MA 4KU4A 2IBMA 4KLZA 4POAA 2FDCA 1CP2A 1MABA 3SJZA 3IIMA 1Z0DA 4R9UC 3W5JA 4RD0A 1JALA 5FTKA 1NN0A 5DI3B 3FFAA 2WAYA 2IF2A 2W6ID 4WBSA 3VR5A 3M0EA 3R8CA 4WA7A 4IOJA 2CHVA 1CIPA 1N6OA 4Q1CA 3ZS9A 3KXLA 4GOJA 3WNBA 4S35A 2JLZA 1X6VA 4LJ7A 2C9YA 5F2EA 3ZYCA 3IO5A 1T4GA 4GI7A 1OB2A 2C98A 4DLRA 2RMKA 2W58A 3CRQA 5IT5A 3NC0C 3X2SA 3CWZA 4IJMA 4X8MA 3BIFA 3R9WA 4DLYA 3I32A 4PSKA 1T8TA 4DCUA 1QHSA 2MMCA 5AUPB 5B58C 1VHTA 1DPFA 1S0UA 1H8ED 2VH5R 2G0NA 5DN6A 5KNCA 2VBCA 1EFHA 2YINC 3SYNA 3OAAD 1QHNA 2IW3A 5HKKD 2ZR7A 4B71A 5JHHB 3RS4A 3PQCA 4M8NE 1GSIA 2NOAA 1KNXA 2XNDD 2QQEA 4PFSA 3DM5A 2YWGA 1E4YA 1W44A 3VKHA 4PC7A 1G291 1FUUA 5FL3A 4Q1BA 4QM6A 4G1UC 4DUGD 2W83A 4AWXA 3QJYA 4K81B 1Z3IX 5C1BA 3K70D 2ZR9A 2F43B 1A1VA 2REBA 5EZ5A 4DKXA 1IN8A 3S1AA 3K0EA 3LLUA 3CKLA 3EPLA 3VX3A 3PUXA 1E1QD 2W2XA 4A8JA 2FPKA 1NRJB 3GJ8A 1G5RA 2A9KA 4IOMA 2HXSA 3T5DA 2ZXUA 1Z0JA 2MSDB 5J4LA 1YHNA 3PXGA 4RFVA 3U60B 4BFSA 3NC1C 2IHBA 1YR6A 1PUIA 1ZJ6A 1WDTA 3TAHA 2BC9A 2RH5A 2Z4RA 3AB3A 1Y3AA 3T1QA 5TV2A 1G8PA 1GL7A 3CB4A 4CEJA 5JLJA 1G20E 3IGFA 2FFAA 1VG0B 4RD1A 3UANA 3L8ZA 4V0KA 4WW0A 2EQBA 3AVPA 1YZQA 2B21A 4A82A 4D26A 4JLAA 2BBTA 2FFHA 3IUYA 3EC2A 3L2OB 3MAAC 3I5XA 1JAIA 4A1FA 5DYIA 5FOSA 2LKDA 2CE2X 5FUVA 1Q1ZA 4M1YA 2IYTA 3QF7A 4F4JA 3GPLA 4LPSA 3CF0A 3Q5DA 1KYIA 3OIVA 3OEED 1NKTA 1XDBA 4KFTA 2YZ2A 1UBGA 2ZUCA 3U7HB 3HDTA 4BFZA 4AURA 2X8AA 5BXQC 3IIJA 4PC3A 4Q9LA 5CYPA 5DHFA 3BFXA 3EIQA 1Z06A 2H57A 1BYIA 4RJLA 5EXPA 1KO7A 1RYFA 5FTMA 1CJMA 5L3SA 3U44A 3BE4A 1W46A 1XTQA 3LWNA 4UXJA 1BS1A 4Q1AA 2R44A 1SXJB 3W3ZB 2G77B 4HYYA 3GJ3A 1XZPA 4D4JA 821PA 4B3CA 1VYVA 2O8DB 3TSOA 5JI2E 2J87A 2IA5A 2IYQA 2ZSDA 3GLFA 3IIKA 5EP4A 3C5CA 2BVNA 2QL6A 4DC9A 3WYAA 2IXEA 1OLOA 1KI2A 2J7PA 3QG5A 4UJ5A 4HATA 2VPPA 2UVQA 4Q4HB 2NO1A 1II0A 1F2UA 3CPEA 5FOXA 2V6IA 1KZGB 1Y63A 4BASA 2H17A 4CEIA 1E1RD 3B78A 3T35A 5JJKA 2ZAOA 4B3DA 2BBWA 4JLOA 1LW7A 4Q4LA 2WBLC 1QHHA 3VU9A 5FL7D 3MGCA 1CJTC 3D31A 2RGNC 3QEJA 4ZDKA 5F98A 4KSBA 2JJ8A 4PSAA 3I92A 2V4ZA 4L5BA 2QUZA 3B8HA 1OFIA 1G6OA 4G3XA 1R0XA 1KIMA 4D4MA 3WMEA 4C7OA 2BMDA 2PCJA 1DBSA 3QQ5A 4F4CA 2GBLC 4OQFA 1U8YA 2PBRA 1L4YA 2GA8A 3DL0A 5LDDC 2W6JA 3QXSA 2QAGC 1W0KA 5F3WB 1WMSA 4L9SA 4EPVA 4TYQA 3DEFA 3L0IB 1PUJA 4KSCA 3EG5A 5EE1A 4G5GA 1S4QA 4HI0E 3U3RA 1AZTA 4QHSA 5FBLB 1OXXK 1SVSA 4D4LA 1CEEA 3IQXA 3MRSA 2VP6A 3FVQA 2ZRFA 2CLDX 5HZKA 3GLIA 3CZPA 1NY5A 2GK7A 4P3YA 4B76A 5HE8A 3NKVA 2ZI9A 1NN1A 1F48A 1W2GA 3T15A 3CH4B 2L0XA 3ZZUA 4PXAA 2E87A 4LHXA 4TQAA 3T1VA 3QIAA 3QXCA 3TSWA 1SHKA 3I4LA 3KUCA 2J5XA 4G5QA 1WRBA 1R2QA 3K0CA 3GJXC 1P72A 1JPNA 3UKDA 2CLCX 1E2FA 3IBYA 4PR0A 3B2EA 4OYHA 1IN7A 1N6HA 2JASA 1ZD1A 3LA6A 1OXVA 1NVXQ 4MYUA 4UNSA 2C03A 2ZJYA 3AP3A 5C4MA 4C2UA 4CEHA 1J2JA 1KI6A 4XOIA 1G21E 1NLYA 1PLJA 2PZFA 4LRWA 1D2EA 1ZP6A 4BLQA 2B92A 2GAAA 1ZBDA 2AN9A 2ZSBA 4QRHA 4YONB 2ZI6A 5B2ZA 1UAAA 1JECA 3KXIA 4TQ9A 4QBIA 4LYAA 4DRZA 1F5NA 2ZRMA 2QM7A 3MWJA 2NG1A 3OZXA 2DFLA 4FCWA 4ARZA 2GZHA 4H1VA 2ONJA 2ANCA 4EFNA 4WXPA 2IUSA 1YKSA 4DLTA 4JLKA 4EFMA 1ELOA 4JBXA 3U3KA 4NTZA 2Z6VA 3AVQA 5BYJA 5B30A 4M21A 1PVOA 1XD8A 3RRNA 4NZYA 2B6HA 1SXJE 2FU5C 3N70A 3Q5EA 2GJKA 2X2FA 4NU0A 1RKBA 3AVOA 1XD2A 5L3RA 4RY2A 2XXAB 4MYCA 4DT1A 2V6JA 3AF4A 2IUTA 5BN4A 2DWPA 4Q4AB 1R4AA 2D2FA 3SJBA 3VQTA 3BERA 5LBIA 3X1XA 5FOVA 3V9PA 2XOKD 4O2LA 4H9GA 2Q3MA 1Q3HA 1U9IA 5FPHA 1ONBA 3RABA 3AVWA 3GFTA
chains in the Genus database with same CATH superfamily
1F2TA 2AB0A 4EEZA 4EUKA 1QGUA 3H0KA 1U8AA 1F20A 3KKQA 4D4HA 4B84A 1OB5A 2P5SA 2FMUA 1U0OC 2VJAA 4ZCUA 5LZ4A 4R3UC 2HA2A 4YCDA 1GTG1 4GPLB 2YOFA 2HR1A 4PFQA 3ZVLA 4GP7A 4PRYA 4P1ZA 4HRAA 3CYZA 3ZV5A 4EF5A 5ENVA 1A0OA 2NQ8A 1LGYA 4S05A 4NG4A 3K8QA 3L41A 2GN0A 2Z2JA 1GLGA 1ULTA 2QG6A 4KDCA 2OXCA 3R5HA 4RSHA 1L7PA 2X0NA 1GOTA 2PS3A 3PFCA 3EGXA 2OFOA 4MITA 1CF9A 3G8CA 3PJFA 3GAMA 3OEEA 4KYTA 2PYDA 4RTPA 1TW3A 3UHAA 2E1PA 3TSYA 2OPOA 4KWHA 4G1BA 3GLHB 2C7GA 3FYUC 3BBLA 1SU4A 1B00A 4CF3A 3VSEA 2FEAA 5BSMA 5EUCA 1Y1QA 2O60A 2D7CA 4DBVO 2AYZA 4IHJF 3VYRB 4EW1A 5GGYA 3FNRA 1PT6A 5FPQA 4ZT2A 2XGJA 1UBFA 4PVCA 1AVSA 4CQJA 4O63O 1DQYA 2M1UA 1XXHE 5BV8A 1TK2A 4MZXA 1L7EA 3NM6B 1DJMA 3AERA 4J76A 5F4BA 3BJIC 1QQ7A 3TRHA 3C8UA 4TMXA 5F5LA 4LUCA 3IILA 2FEOA 4QREA 2ILVA 4EO9A 3JTEA 5FI1B 2JC3A 1TGVA 1GQFA 3GPDG 1JSRA 3IEPA 4TTIA 2WYUA 3MUOA 4PLCA 3BS4A 5J2TB 3FWZA 3UUFA 4UE3S 1WKVA 2HJGA 4QC2A 1TT5A 4UM5A 3D6UA 4YI9A 2XUOA 3KK0A 4FD2A 1SB9A 4JY7A 2B8EA 5F33A 2HDOA 1F1JA 2ZB8A 3PGVA 3GJ7A 2Y92A 4YC7A 121PA 2D4AA 3V4ZA 1HE4A 4IJ6A 5CAEB 2D3WA 1UP7A 3ZGVA 4YYEA 2O54A 2WWIA 3DWGA 2HU7A 1TZJA 1S9HA 3ZD6A 5KYWB 1QPZA 2C7VA 1YB4A 3JPWA 1HZJA 3U62A 3T4UA 4IIUA 3FFBA 3K70C 3HKBA 4MW9A 1W4LA 1CZLA 1Y1PA 2XTAA 2QSZA 4RANA 2XZPA 5BR1A 2FCDA 2R2AA 3KJIA 3RYHA 3I4FA 3PC6A 1Y3DE 3KZ1E 4FWBA 3WHUB 1AM4D 2JGNA 1AQJA 2KLDA 3TL2A 3L5KA 4Z7NB 4Q24A 3EIEA 1TC1A 3VR3D 5FNVB 4YJ2A 3PEYA 1NXWA 3Q6IA 5K0BA 4RYLA 2PD4A 3G2KA 1NASA 5LUAA 2VFAA 3NV9A 1U11A 4MGKR 2WMNB 2R1TB 5T8KC 1T9CA 1MNAA 1P1HA 3EX7C 2YXLA 4JA2A 3G6KA 2JJ1A 4MUXA 3L7JA 1A27A 4NAUA 2GAIA 1RKVA 1JF8A 4PALA 4Z49A 3EEBA 1PFKA 4D3YA 3LK6A 4P4LA 2D0IA 3P4XA 5IM4F 4YRIA 3SN6A 1ZVJA 2QI9C 1GKUB 2PGXA 1WTCA 5AUOB 2X41A 4W8GA 5TS2A 1G8SA 3DE7X 3OB2B 5FYXA 1ZM9A 3PXXA 2RI6A 1D1TA 5TSDA 3ROPA 1SXIA 2PY6A 2ZJZA 4NG5A 1POWA 5JY6A 5BMVB 3WAKA 1G16A 4L8FA 1C5KA 4BNDA 1GDTA 3KAJA 1DF0A 4KR7A 3DFMA 1TVKA 4QG7A 4DF3A 3LL7A 5B1YA 1TM3E 5L3ZA 1Y4SA 4D9EA 5REQB 1W48A 3NBQA 3WBFA 3N8NA 2RCNA 1GO2A 3BA6A 5B6PA 1FP2A 4G8JA 3B86A 3ZDEA 5JXGA 2BPOA 1ZPDA 4QYMA 4BP3A 1QFSA 4YCAA 2JLRA 5AXIA 1CE8A 3L8GA 3R5TA 1SR6B 1SUSA 3UCFA 5J4YA 1NONA 4DSTA 4DJTA 1ITZA 4E13A 4DIRA 4QHYA 4DUZB 4W82A 5DYYA 4L51A 3IODA 3OM9A 2XKBA 2CMGA 4FCCA 1M34A 5HZGA 1NGSA 4ZO9A 4YHBA 3BMNA 1G55A 2RONA 3K73O 1II8B 1AZWA 2W9XA 4IDGA 3LHFA 2ZUDA 2VPXA 1J7PA 1QCDA 4A0FA 4MKFA 1K5DA 3CNQS 2D1TA 4C4OA 2E82A 2MRDA 1UJMA 2G28A 3B12A 3IERA 2H5IA 1HDGO 1SVWA 2HL6A 3NDBB 1SKBA 3M70A 4D0LB 4Q39A 5LP6F 3AR6A 1P4GA 3MJ4A 1R8XA 3SZUA 1ALWA 3AUXA 3LF2A 1Q0PA 1C9EA 3D2AA 3M6FA 2GWHA 4I5EA 3K9QO 1OOGA 4IUBS 3EVFA 3U1TA 1Y3BE 4QTXA 1UUSA 1FQOA 1LVHA 1Q16A 1B4CA 1HT2E 1OH6A 1B7TZ 2EKPA 1AB6A 1RFGE 3ZN2A 4IGFA 2P70A 1ZOSA 2VAPA 5DJ5A 2JGFA 4WKBA 4PGAA 1GRRA 3VDMA 3T52A 3SC4A 1GPJA 3U9TA 4B17A 2HF5A 1MBZA 1EDOA 2NU6A 5I7UA 1GHTA 3RLZA 2H4ZA 1XL0A 2EDAA 3HE3A 5ALYA 4JMLA 4BMZA 2NN3C 4RKFA 5FUBA 3O95A 4GP6A 4N49A 2J3EA 2CFSA 3IO3A 4A10A 2NTEA 4I9FA 3OB1B 2PMWB 3RYIB 3EFEA 2HADA 2FG7C 1JBEA 2CBGA 3IVRA 1WEKA 4B43A 1J1ZA 4II3A 1NT2A 2G0TA 4LWOA 4DUYB 2NX2A 4K0KB 4E2YA 1W76A 1F6DA 1F0PA 1RLOA 4DRWA 3DAFA 4DY6A 2WWTA 2PZMA 1CG6A 1L5NA 4H1TA 4RETA 3ZZ0A 2CDCA 4QUKA 5DCLA 5HK9A 2ZSUA 3PI7A 5BSVA 3NUZA 1JVSA 3GDHA 2FSIA 1FW4A 3O21A 3GD7A 1B8CA 1I5RA 1XZQA 4CV0A 5TT0A 2J9FB 3BUWB 2BTQA 3GO4A 5HRCA 5FUYA 1IMOA 2AQHA 3BTVA 2LC5A 3L8HA 4GOND 5GVRA 1AU9A 2QE7D 2RAPA 3D3WB 4FKBA 1PVVA 1SRRA 2WUWE 3SS7X 4PYMA 4MP3A 3FOCA 1JLLA 2RHJA 3AR8A 5G41A 1VKRA 2XMDA 1EXVA 3MWEA 3G89A 4Z7OB 3AT1A 1XRPA 2UXDB 5JCOC 3LL8B 3D7NA 1W1IA 3ESCA 3HEAA 1MG5A 3EVGA 1VPDA 5K4GA 4AY6A 3U7RA 2FJPA 2X5XA 1VFNA 4P5PA 2ANBA 4D98A 2L17A 1FU8A 3EJWA 2EXXA 3GU3A 2AHOA 4OXYA 2EFCB 2H2GA 3WHTB 1NVVQ 4AQ7A 3I9NA 2I71A 4KXQA 9ATCA 2HHAA 4EMSA 1YNOA 3H04A 4RQBA 1FFXA 4RD6A 1LLFA 4BU1A 3CLSD 1Q0RA 1A2XA 1EHIA 2I2BA 4OVKA 4WECA 1G3MA 2QIOA 3V4VB 2QEQA 3LCUA 2VNHA 2B4TO 4BJ5A 5DWVA 5KWVA 3NOOA 3ZDCA 4G0PA 1KS2A 5AVVA 2WVAA 4C0QC 2CK3A 2NVUA 2HKIA 4AVYA 2JIZA 4BHTA 3HL4A 4WESB 5CVEA 4G26A 1QNLA 2PYQA 1NQOA 2LAPA 1RYZA 4XWKA 3CH6A 1C7EA 4M2PA 3UOAB 5E1MA 5JFGA 3DTTA 4XRRA 4MGIR 3WA6A 2ATXA 4MV1A 4RTQA 1YMVA 2OP1A 9LDBA 4Q9KA 1P2SA 3PDCA 2FJYA 4XYNA 4IIJA 3PITA 1YZTA 2OXFA 4Q1VA 1P7PA 2SHKA 1T9BA 4P4NA 1KDVA 1DAIA 3MTBA 1H0KA 2BYTA 3MUFA 1CZOA 5EZQA 3KPVA 4Q4CA 1NX6A 3H5RA 4MW6A 4YO8A 4I14A 2ZREA 4M49A 4ID9A 4H3KB 5CLQA 2FP4A 2ZUSA 2AH5A 2CDRA 4JR1A 2EYQA 2A9RA 2HA4A 4ZRDA 4CT4B 5J5CA 3V7FA 1V7ZA 2ZSEA 5AVJA 1JMKC 4NYMQ 4D57A 2Y68A 3PFKA 1Z37A 3ZGLA 3NHWA 4FT2A 2QYOA 2PX8A 5H5JA 1S01A 1XP5A 4R1PA 2JI6A 5KX5F 3A9VA 2FRDA 2I78A 1LZKA 1RXSA 4MJ7A 2DJIA 2FWMX 4OQMA 2H1IA 4JIMA 4RPGA 4K1LA 5GQQC 1WSDA 4ZQEA 1QTIA 3F6RA 4UM9B 1N2BA 5IYZF 3QU4A 4A6XA 2NO5A 2WE7A 3D6MA 3G2PA 4PYJA 5FBQB 2Q99A 3DZKA 4DS3A 4C0KA 5JS8A 3X0DA 3ZVMA 2WUFA 4JDPA 3R0XA 1LVCD 2PGNA 4Q3NA 2ZGVA 4IG4A 4YN3A 1UXJA 1VCIA 2PS1A 1VHLA 3BOWA 1J7JA 2Q5FA 3O84A 4V0MA 4R9VA 3DV0A 1FF1A 3GA7A 1T2FA 4W8OA 3WLAA 2E4YA 4FHGA 2MR6A 3I8XA 4UPDA 4MARA 1K9VF 1DFHA 3CFYA 2EZ9A 5CPBA 2BE9A 4GX0A 4PZLA 5E6RB 3ZEIA 4HC4A 1OLSB 3BTSA 3OT4A 1BE0A 2O3SA 1C9KA 4Y2HA 1KDZA 4E4RA 4A8JC 3FWCA 4XUGB 2BEUB 2WWVD 5AXDA 4RGQA 2MIIA 3EVCA 3PFGA 5EEGA 1KJ8A 3PNQA 3RSGA 3R3VA 2CXTA 3JRXA 2MCFA 4W7HA 4JB3A 4G89A 3I45A 4ND7A 5AMXA 4KYUA 2WKWA 2V7QA 4HRGA 1ZLXA 2IP1A 3WQQA 1YQEA 3M4JA 1CT9A 5AW8A 1QX7A 5JD6A 3DOCA 3G1UA 4TXLA 4WV3A 3TOXA 1CZUA 1NA5A 3ZTYA 2ZT7A 2IYPA 1QF6A 5JEEA 1ZIOA 5AKIA 3F49S 4V24A 3HZZA 3F47A 1HE5A 1DBQA 3KBOA 3OZBA 3GRUA 2IPNA 4BP8A 3RC2A 5T64A 2NAPA 3MNFA 2QVCA 4GOXA 1XQ9A 1U7XA 4NOLA 2A9VA 4HFNA 2VDVE 4DG9A 1Z4PX 3BL8A 2O23A 2NQ2C 3DTVA 3QTBA 3R1PA 4OCIA 2YBEA 3CX4A 3F45A 5G1OA 4HG2A 5P21A 1P62B 3EZ6A 3C7TA 4B6SA 1JJ7A 1YRWA 3OESA 1K5HA 3DEAA 3IQHX 3AI1A 2CDAA 2XSZA 3COSA 4MUIA 2QZSA 3COZA 3Q0TA 1XCMA 1P1IA 1PEDA 1RE0A 3OA0A 4UHDA 3GL9A 3JZMA 2KLEA 4WEOA 3W34A 2GM4A 2CJFA 1I4LD 5CH5A 3OEWA 4I1OA 2YWEA 1NRIA 4NONA 4BRUA 1SNLA 1ZUIA 5IZCA 3VVMA 1CB0A 2X40A 1BEUB 1JR3A 1XTUA 4M0MA 1ZKMA 4GICA 1Z22A 2G3YA 1HOTA 4EZEA 1LQ2A 4P2BA 4ZKEA 2QRZA 2GVDC 4RWEA 3SZLA 2F8TA 3Q5GA 2ZJAA 1RKQA 1W0KD 4OM8A 1UBKS 1Z6GA 4ZVQA 4TKVB 3CJTA 1L5HB 4ZCSA 3UO8B 1UDBA 4N6NA 3PPXA 3GRZA 1EE9A 4R3NA 5A0TA 3R0IA 2QD4A 1VB5A 4XRGA 4KK3A 4DR4B 3NT2A 2O8EA 2AV6A 2WF9A 5DM70 1BX1A 5DLEA 3W5IA 1H94A 2V97A 3GEIA 1EWVA 5I7SA 2GN8A 2BKAA 1EVJA 3VKWA 5JATA 5HPYB 2AQ8A 3UMJA 2GH1A 1L5YA 4DR7B 2AOWA 4L16A 5D00A 2CD9A 3HR4A 4UE2A 3QJGA 1YU6A 4HZGA 1SQ0A 1GZVA 3LDAA 4DCVA 1U1GA 1QH8A 1CETA 4Q48A 3TUYC 1U7UA 1M1YA 1NQTA 4M0FA 5I47A 4RIGA 4A5OA 1Z0DA 3O7WA 1U3TA 4O4IB 1UZUA 2COUA 3KCNA 1M5UA 5JQGA 3KXLA 4G4SP 2MLEC 2YNMD 2Z1MA 5CT5A 4J75A 2HNBA 3DD4A 5BOSB 4DLRA 2X5NA 3STHA 1DMSA 3CWZA 1P80A 1H6AA 3AWDA 3FTCA 2JJMA 2R8YA 3VH3A 3TTXA 1S0UA 2NPOA 2G0NA 4BO7A 3LQ1A 4J1TA 4ZVTA 1CVRA 2VSQA 3GPCA 1U7ZA 1E4YA 1QPGA 3SC2A 1G291 3DP7A 2W83A 4IQ4A 1UFOA 3COYA 2D5IA 3BVPA 4K9MA 2FEXA 1ZGJA 3ETCA 1H2AS 4TROA 3AR9A 4AXBA 2BF4A 1YHNA 3TOSA 5FO1A 3SG4A 3QVGB 4UMEA 4BNYA 1I4OA 4EI2A 3LZ6A 4AQYB 2HN9A 4AZ3A 1NI4A 1ODTC 5ELLA 2EX4A 7MDHA 1JFKA 4ZYWA 2QR5A 3AR3A 5DHFA 3EIQA 1T34A 1Z06A 3SYRA 5FTMA 1DKMA 3M82A 3G17A 1XZPA 3MT0A 1DOHA 2PR2A 5DHRA 2Q28A 3LMKA 1BKSB 2KI6D 1Y1UA 1R0BA 3DUFB 2I65A 4DRXB 4L95C 3M1LA 4ZC1A 1FXWF 1Y63A 2NNLD 4NHEA 5CB0A 3T35A 1SL9A 3EYAA 4O4LA 2GUWA 2G7ZA 5HIMA 3FUWA 3QQ5A 3UF0A 1W5FA 4XYMA 4E31A 2GZSA 4XYEA 1AZTA 1R66A 1OXXK 3KV1A 1CEEA 2VP6A 4P3YA 2DTEA 2J4DA 4A2CA 4H0NA 5ECWA 4XOUA 4RVOA 2JJQA 5G2OA 3RUHA 5DU2A 1E2FA 4WLUA 4RS3A 2ZJYA 2VH2A 4LRWA 4MGHA 1TN4A 1UHJA 3RUAA 1X2EA 4QJ4B 4QBIA 1G8JA 1IPFA 1ISMA 4ALKA 4KXYA 4CLXA 2D8NA 3U3KA 2H9IA 3S70A 2P41A 2IU0A 2C94A 1JG6A 4NZZA 5J5VA 3OGNA 2OK7A 3H2HA 4Z4CA 5ICMA 1JN0A 1YUBA 2NACA 4G84A 1BH6A 1EZZA 5LBIA 3O4IA 3VZSA 1UEXC 1ONBA 1UOQA 2OCYC 3B5JA 4RDIA 5KMGB 3BQ9A 2ZRTA 4KQ2A 1T0IA 4XXHA 5MGBA 1IJEA 1ZMZA 3RTEA 3HY4A 3MT8A 3HKCB 2GCOA 2FE4A 1LF5A 3ZCVA 3V1NA 1OLUB 4ND1A 1T14A 1J1EA 5EJ5A 1WMAA 2X2OA 3KR9A 1E0DA 5K6RA 1N2GA 1YJ5A 4NFYA 5IKEA 3ASVA 1N9GB 1Y1SA 3BTOA 3DBOB 2ATVA 1H8BA 2WV7A 4BFWA 2E4VA 2VRCA 4NENA 4Y9RA 4ZI5A 2GD6A 2HY7A 4KIWA 3UC5A 3SXPA 2WPDD 4UCWA 5KYUB 2AF4C 1CUSA 1H2WA 3L0DA 3TAUA 3OCUA 3NASA 5HRAA 6GPBA 2KI5A 5E9QA 2JGEA 4DLXA 1FW6A 2PJDA 3HFJA 1G2IA 1W8DA 3O1JC 4WVFA 1COWD 3N7TA 2JCXA 3SM3A 2LMVA 2FLKA 3IQOA 3ABSB 4D56A 4Z3KA 4QE3A 2XCTB 3ADOA 4PXSA 2XZLA 3D59A 1PULA 1BQ4A 3IDQA 1SOUA 3ENVA 1C1XA 4H7PA 3N5KA 3ZD9A 4UASA 4Z99A 1RJDA 1OKKA 1Q2UA 1OWMA 1OV4A 2RAUA 4YAWA 4LVOA 1IHOA 1ZHFA 1GTZA 5C5CA 1PTJA 1Z6TA 2B1GA 1UR5A 2OBBA 2F17A 1ZS9A 3ZLBA 3GDGA 2CMDA 2AOXA 4G01B 2O8FB 3VC1A 2PUDA 2Q1WA 3D3QA 3V3KA 1XFAA 3IS3A 3MGGA 1K08A 1EGAA 2J30A 4U7JA 4MUMA 3L0ZA 4PWYA 1V8OA 2FMXA 2R6AA 3EGOA 2J0UA 3RHTA 4QPCA 3BHIA 2H85A 2HM7A 1LS6A 3QIVA 2IYLD 2H29A 2VJQA 5DP2A 2GPWA 2ZAMA 1T10A 1ENYA 2JI7A 5A7GA 2QSJA 3BF7A 3VTAA 3UWOA 4IDQA 1ZRMA 1E8MA 2B98A 4UMFA 1USGA 4D6PA 2D00A 3WLPA 5ENZA 1TXGA 5K6AC 3ICQB 3R09A 4D9JA 1DGQA 1SKYE 1RRFA 3I1YA 4GM4A 1ZU4A 4OFZA 5C31A 5AJWA 2VK1A 1HL7A 4C3ZA 5I2OA 2BY4A 3F9CA 2AFRA 3TZEA 4FTGA 3ZV6A 3H1BA 1ZACA 2HCJB 2GFIA 1FQJA 1G9TA 3ROZA 4H7DA 1J90A 4MIOA 5HYVA 2X0JA 5J63A 3DE0X 3RRZA 2XQGA 4L2IA 4FLEA 5A5GA 1DPGA 3H2IA 1ADGA 4EB8A 2G40A 4MPRA 2EFJA 4G81A 4MHSA 3GFPA 3D5QA 2MSKA 2Y05A 2R1VA 4OAPA 3MWLA 1J9ZA 3TDUA 2PSJA 4PQYA 3TJMA 2KYCA 1F60A 4BGEA 1JFTA 2QTHA 2B6NA 5DIFA 4EGFA 5CURA 4YGCB 1M6NA 3ZD8A 2F3PA 3SMVA 2Q21A 1G6HA 1XX6A 1FS6A 2WJVA 4NCIA 3CSUA 4QLOA 1PJ8A 1LY1A 2IY7A 3P45A 4JQZA 3QHPA 4F5DA 1TYBE 5JFTA 4KE7A 2FB9A 3LO8A 2I33A 3WNCA 2W2QA 4TRNA 4LFBB 3VRQA 4KNVA 2GKOA 4II7A 4KAAA 3AC0A 3TGLA 4BOYA 3SI7A 3LS2A 2YQ4A 2OA0A 3B1YA 5FWXB 1YS4A 2B69A 1R3DA 2YASA 3OIUA 4HDAA 3AM3A 4QLAA 1MJHA 4BKUA 4M1SA 2JNWA 5LA6A 3CLTC 3X2FA 4TMZA 2MINA 2XIQA 2NIPA 2DQ4A 2D13A 3EVNA 5KUTA 5EJGA 2OFXA 4IGIA 4KK4A 5JISA 3EVVA 4QGGA 3TOZA 1VCOA 2O8CA 4DTCA 1PR6A 4IDFA 1BO6A 5DYTA 5AOCA 2IWRA 4BCCA 4FW8A 3R3JA 1W8IA 3R3HA 2FX3A 4JUCA 3O1IC 4ZGWA 3FFWA 2MOKA 3HJTA 3IPLA 2HXYA 1O96A 4HQFA 3PA6A 2XNCA 2BM0A 1E1KA 2CB0A 1W73A 1NYQA 3K0SA 3L4KA 2ACVA 1Y7TA 1GQMA 4BX0A 1F8GA 4AP6A 5L53A 4MQ6A 5KNCH 2LTAA 5HF9A 1F55A 2I2XB 4E12A 1OTXA 3DD5A 3DLPX 1EFRD 1RWBA 2R1ZA 1QMGA 2JIRA 3R6WA 5J5AA 3LLSA 3KT6A 5DNCA 2Y9MB 4RHUA 3FG9A 4QEZA 1JDZA 3OCWA 3TXAA 1IEVA 5A0VA 1N8KA 3DZHA 2Z83A 2Y1WA 4N3CA 3QEBZ 1H3FA 3WSTA 1Z2DA 4J9VA 3MN1A 2ZUTA 5JVDB 3QOXA 1RBQA 5A5VA 4A6EA 2FZEA 4LY9A 1DB3A 1XDDA 2D74A 3OQJA 3T41A 1U2DC 4HFRA 3D0RA 5LSAA 3FNIA 5ALUA 3R3XA 1E6CA 3NGXA 3ZLTA 5G0WA 2EJBA 2YJTD 1B2RA 1EUDA 2NNWB 1Y48E 1M2VA 1S5PA 3WFJA 4WINA 1C3YA 1OYWA 3FRIA 3KYJB 3ROFA 5HF5A 1C2TA 4IHAA 1X1BA 3UA4A 4XLZA 3TX2A 3QKUA 5AVTA 4EPXA 5JJIA 5HXAA 3AO0B 3MD0A 1NLFA 5DTIA 4NJMB 5K3AA 5FPSA 1Q0QA 1KQNA 1K93D 4F6RA 2O7QA 2JFYA 3E84A 2VQFB 1IJ5A 1J2EA 2O8NA 4HN4B 2N75A 4FYWA 5LLTA 4R7TA 4JUBA 4WY5A 2VHUA 4CJXA 1N6LA 3IUSA 4JMPA 1OFGA 1ZGCA 4UUPA 1MB9A 3PXAA 2TN4A 4R8MA 3SSOA 1T0JB 1VP9A 4OHKA 4P6VF 4ROTA 3JWPA 1BOCA 2IIQA 3EB9A 2GN4A 3Q9UA 3L02A 2Z1NA 5BVGB 3KU4A 1Z5PA 4ZEMA 3G3EA 4CMIA 3JAWB 4XE5A 3GJ5A 3C7KA 3TMAA 1DE0A 1DWPA 4FHZA 5LQSA 4QG3A 5IS2A 2QGNA 3HH8A 4A0HA 2CNNA 3SQWA 2PT7A 2XYQA 2G88A 1DMRA 1OBCA 3S99A 2WYWA 1HTWA 1V1MA 3ORFA 2ZJ3A 4DAEA 1DT3A 5CUQA 1EPUA 2WNIA 1A2OA 4YVFA 3KM0A 4OLBA 4DR1B 3RFXA 4X5OA 4MW2A 5AJXA 5I9MA 3EGDB 2G4LA 1XBTA 1ISPA 4OA5A 4PNEA 1XOIA 1GL9B 4G4IA 2WTMA 2J6HA 1JBQA 4JL6A 1E99A 4ESVA 2K7FA 3R5FA 3KYCA 2GASA 3OC0A 2P4SA 1KL7A 4LK2A 2YVAA 1TKCA 1IBSA 1LI5A 3QNWA 3WRXC 1RQLA 3PE4A 3VPGA 1ZK3A 3AF6A 2JBWA 4MUHA 1XAJA 2ZDGA 1N2HA 3LCMA 1BXRA 3NHIA 4FQ7A 4XCVA 3L0PA 1OZHA 3OWOA 1W5TA 1L0BA 4FPXA 3N3BC 1QC5A 2B83A 2Q3BA 3HCBA 2Y71A 4E46A 1PR2A 5E1BA 2UUAB 2R6GA 4GBAA 3H17A 4GLBA 4HAOA 1UK9A 1DKQA 1JPUA 4RTNA 4RABA 2W2LD 1N7HA 4TSKA 3SYMA 3WLIA 4QM7A 4C2BA 1CWUA 3SE7A 3VRNA 5DLQC 1TM5E 4ZREA 5TEWA 2HHLA 3KZVA 3RVPA 2ZYHA 4MIYA 4KUHA 3CPSA 4ZVLA 2GRJA 2VYVD 2OLKA 4RLQA 1D09A 1VE7A 4JQCA 1UHIA 1OJ7A 1LZLA 3F0TA 3WWDA 3FWHA 4UM7A 1IRIA 3PDIA 2EJWA 5HKYA 3X1KA 4WZAA 1L7MA 4ZFNA 3QPWA 1MGPA 1Z5ZA 3OF3A 1I7QB 1Z13A 1B15A 4OZDA 3VH4A 1E3IA 4ZANA 1JHYA 4ETIA 4O6VA 2WU4A 2Q3HA 1K2VN 3GX1A 1C3EA 2H2FA 3TECE 4Q7QA 3HYCA 3L79A 3ZQKA 3HYLA 2HRBA 3T99A 4DJJA 3NJ4A 1VMIA 2Z8YM 1HYGA 4WBNA 1NBMD 3H2BA 3ELWA 3PGA1 1YIOA 2MBXA 1O5IA 4DCSA 3WMFA 5FLEX 2WWRA 4RC9A 1ZA2A 3PFHA 5A04A 2ON6A 2OXIA 1W5BA 2B4QA 2OGZA 2BFMA 1SIBE 1VHWA 4LVNA 4MEWA 4JLUA 4WZBE 3CXRA 3ETEA 5BNIA 1ZVQA 1DTWB 2P5UA 1LBIA 3B3JA 1A9OA 5C8YA 1PV2A 1V7QA 4NS4A 2WVGA 2ZANA 5E4FA 1E3MA 1RWQA 2EARA 3DF7A 4NRDA 2GPTA 5GAJA 2QXTA 4LAFA 4BY9E 1ZL0A 4ENQA 1JQ3A 4M1OA 2NV2B 2F9LA 2OGUA 2VKQA 1AJEA 1ZR2A 2GGZA 3X1YA 1IH8A 1VHDA 1M75A 1NQAO 4I4TF 2J3LA 1Q11A 1RPTA 2WIFA 1KU6A 1HSZA 1UBRS 2IPAB 3OF5A 2PH7A 2ZYDA 2FF5A 4YRAA 1ULBA 5KQGA 4JC5A 2BMAA 5FJIA 2H08A 2V7UA 4Z9AA 2WK1A 3EMDA 1UMBA 3DD1A 3ZWCA 3WGYA 2GM5A 3R7WA 3G5UA 4IEEA 1F8UA 3O82A 4OHUA 3F3KA 1OHHA 3QE4A 3OFND 1AA6A 1OQPA 1K75A 1K8RA 1XKLA 1NL3A 5DYNA 3ECAA 5A1JA 2J0VA 3GJZA 1HNWB 4PX2A 1LBEA 1C80A 1K2HA 4C05A 5FHQA 1E1CB 2BI8A 1X7YA 3CEMA 5T4BA 1LPPA 1NHWA 2PGLA 1G18A 2YYYA 1V4BA 1QANA 1CBUA 4LQ4A 3KT0A 4GZLA 3PD1A 4N18A 4G1VA 1Z62A 1RM5A 1RVDA 2XVXA 2LBPA 5JXIA 1XXHA 2W22A 4CN9A 3R0VA 2UXBB 5D5HA 4I66A 5A4FS 4KEAA 5IEBA 1Y5LA 2GYUA 4Y2XA 1MR8A 1RQ2A 3K1EA 3EIXA 4AD8A 2MYUA 4ZGGA 4P3OA 1M2KA 4D8WA 4DIFA 3K9NA 2JARA 4JOCA 4FOSA 2FQYA 3SE0A 3MOGA 3QNMA 2JLSA 5ICCA 3MCZA 5HP4A 2XDAA 4Y2VA 3QWBA 5ESXA 3SQNA 2Q49A 1Z0AA 5B7PA 2XUIA 4FYHA 3RUEA 3DNPA 1YRTB 1BWRA 4LYHA 2ZDQA 1B0UA 1VTKA 4ALJA 2WIDA 1I2DA 3H87A 3IMEA 4OJTA 3M89A 2ASEA 1C4KA 3KWLA 2QOEA 1P29A 4FOLA 3TK1A 4LSGA 5LQNA 2ZJ5A 4AC9A 1SKAA 1JAHA 4JKOA 1R8QA 4Q5IA 1Z0IA 2PN1A 1WDMA 2VIIA 3CONA 3OUZA 4WNAA 2BR4A 4IFTA 1PV4A 5CHEA 2HI0A 4MYRA 2RGYA 2P9FA 3HC7A 1ZX1A 1PZXA 5DGIA 3PJGA 5I7FA 5K4HA 4DCGA 1JIUA 9GPBA 2X77A 3W5AA 3JZFA 2Y66A 2IH4A 2P69A 3DGEC 5BQOA 2I3ZA 1CR0A 1KIFA 1CDDA 3RTGA 2Z58A 3O1LA 2ZIZA 1KCYA 1T6XA 3OMLA 4A92A 1ZU5A 1U0SY 2YJGA 2JDIA 2WKQA 1I32A 5CTAA 1YTZC 4BVFA 4OQLA 3UV6A 3AONB 2IEYA 3B82A 4UM9D 3SDBA 2IELA 2NXWA 2XCIA 2BCGY 4MWSA 1L1RA 4MR7A 1SL7A 4YREA 2V98A 4PY2A 3K2QA 1SBQA 2ZPAA 2P71A 2HRCA 1ESMA 5ICEA 2NO6A 3NKFA 2JFFA 1P81A 4MEBA 3RFVA 1RWMA 3CX7A 3E5MA 1SCDA 3IOCA 4HB4A 3MTQA 1TI7A 1YZLA 5CA1A 3F78A 1GFZA 1H66A 5A4MS 4N03A 4LF9B 3DPUA 4GRIA 2XD9A 1CFCA 4NY1A 1OR8A 3A2KA 3EWNA 2WM8A 2XDQA 4B3BA 3BE6A 1O1YA 1KS9A 3SVTA 4YDRA 5UKDA 1BODA 2R7MA 5SZIA 3A4NA 1H2HA 4FC6A 3JQ8B 1GGWA 2FF7A 4R31A 4MKRA 3V8VA 3VUEA 5AI5A 2YJ3A 3DE2X 5CB4F 4INXA 1AQYA 3N0VA 3NJ8A 3RV4A 4LSMA 2JGMA 3DZIA 4WXEA 3AVTA 1AV6A 3BXHA 3ROTA 1TTPB 2C8LA 3QLUC 4JX9A 5FAXA 3QKSB 3WZLA 2V7BA 1ZM3A 1HEIA 3MBOA 1W96A 5I7HA 1D1QA 4D0RA 3KTFA 3JQGA 2KOTA 3O3NB 1XTTA 5JY1A 2CDNA 1BD4A 2HEIA 4INZA 2I7TA 4OBEA 1JL3A 4FI3F 2ZCUA 4TRRA 3IQIX 4JLJA 4BX2A 4GMDA 4YIHA 1GGZA 3OBBA 3TN7A 3C6KA 3N86A 2CC2A 3W5JA 2RC6A 1RAAA 1I4WA 3FFAA 2W6ID 3TB6A 3VR5A 3GLTA 3WNBA 3D76A 3N8GA 3U3ZA 1F7VA 1PS0A 3EZXA 3KETA 3QELA 1V3UA 1VLVA 4X94A 2IP4A 2W90A 3I05A 5GONA 1RQPA 4HDMB 1DPFA 2VH5R 3NHTA 2H00A 1E64A 5I8WA 1IC6A 3E82A 1RHJA 1TAQA 4PVDA 5E0KB 3BWYA 1Z3IX 4E7PA 2REBA 1WULS 1IN8A 3K5WA 2ET6A 4A73A 1WMFA 5D3ZA 4N41A 4BCDA 2VTBA 1C8KA 3QLVA 2FK7A 1JTVA 1L4MA 3IURA 2YWRA 1G21B 2NXNA 2FFHA 3C70A 4A1FA 5GIOE 3WGKA 3ZNIA 3SR4A 4HX2A 6REQB 2GN1A 1U8TA 3Q2KA 1Q5PA 2X8AA 1SSEB 1JU4A 4UTOA 5ES3A 4HN2A 4RJLA 4PHNA 4FYKA 2JIBA 1XTQA 1KR5A 4Q1AA 2A0KA 4EGCB 4D4JA 4WCFC 1DI0A 2B2NA 3W79A 4DC9A 1FUIA 3EXHB 2OO5C 3GUUA 2BEWA 5KNDH 3B78A 4WCVA 3UQYS 3KG2A 1ZXLA 1NF2A 3IOEA 3DVJA 4M99A 1UPAA 1JG2A 2GA8A 1JFFA 3PATA 4WUVA 1SVUA 4BWVA 2DFPA 4CM4B 2VDPB 4LXIA 5K2OA 4FHCA 1GARA 2J31A 4B3RB 1TUBA 2BFCB 5ALTA 3U3RA 3E61A 1T1EA 3MRSA 1JAYA 3TW8A 2BL4A 1U9YA 1KEEA 4WKPA 4YAGA 4KG7A 5AQ1A 1WRBA 1JPNA 1ZOTB 5CFLA 4O4JF 4L4YA 2BE4A 2FPPB 1D2EA 1BD3A 3K2IA 3KOYA 4DRZA 2R6HA 4BJ1A 4ENTA 4R1OA 4GSKA 2LVVA 3UJ8A 1JRLA 1EQUA 4XGRA 2P79A 2A88A 1ELOA 2WHQA 3FWPA 4EKGA 1SAYA 1TA4A 5HKWA 1JBAA 1QLWA 3GJRA 1UINA 2NUPB 4MUEA 3B1JA 1DRKA 5FOVA 3EMKA 4ISCA 2B9VA 2P4EA 3GFTA 4CL8A 1AIPA 4H3HB 2D1SA 3ZBUA 4NFHA 2QZJA 4FDVA 2IYUA 3KTAB 2AMVA 5K7SA 4XPZA 1Q44A 3DKVA 5IZ4A 1DJNA 4B3TB 3GNQA 4JWTA 2HU2A 2DULA 4OKNA 1V48A 2IYSA 4HN9A 2JWWA 3GRAA 4MUYA 3CNEA 3AVYA 2RK6A 3QTTA 1NIJA 1W75A 4DMMA 3HB7A 4XSVA 4DGSA 3QITA 3PVZA 1D9ZA 1QH9A 5DM1A 2YMPA 5IVIA 1H8HD 3ZW7A 5EIOA 2PAFA 3CX6A 3S2YA 1EJBA 1WY9A 5DV9A 2XX3A 3CN9A 2BBNA 2VCYA 1W36B 2PU5A 4LDZA 4H6WA 5JJGA 3HXLA 4CKYA 1P7YA 2IX3A 3V2LA 2WI8A 1G3UA 4DQDA 3LLEA 3PLRA 3MPOA 5TVGA 4PBSA 1EBBA 4YRSA 3NR2A 3GLGE 2ES4A 4AIIA 2J48A 3DOOA 4LJ5A 5CGQB 2ZN8A 1J1DA 3BXOA 4X66B 2ZFDA 4MI6A 5JROA 4EH1A 3BHJA 2B8TA 2QUAA 4N3GA 4UDNA 3NBZC 5IJZA 4XJXA 1BXKA 3J7AC 5AW4A 1ZM7A 3SYTA 4NPHA 2MHHA 3LY5A 1EZ1A 2FR8C 4B3GA 2FDRA 1MEEA 2JL1A 3VGOA 2YW9A 1KY4A 5K6TA 5ERGB 3PFNA 4EKDA 4F2WA 4QDZA 4Q9JA 2R97A 1SMKA 1H3EA 2DUNA 3GJYA 1P18A 2C2YA 1QV0A 4X97A 4G0ZA 5K8VA 1E9RA 4B3MB 3D2LA 4YAFA 1L1EA 1XZDA 5CDUA 3JD3A 3BK1A 4JJFA 2A58A 4JLBA 2WZBA 3H2YA 4GYJA 3PIDA 5C53B 1T5DX 5DICA 1B93A 2YH2A 4JEIA 2ZRQA 3BJHA 5AM5A 1H42A 1PR9A 5DEIA 2G82A 1FFGA 3W1WA 3I9FA 3FPCA 4K5QA 2QB5A 1UK6A 1WCV1 2HOQA 3KJXA 1CUCA 3A8TA 4HLUA 2B36A 1O7JA 4K9PA 3ID6C 3VYSB 2FPOA 2Z3WA 4MB6A 3PEVA 3Q72A 1XEWX 5HCNA 2FPLA 3CLRC 1CDOA 1VP3A 4R1TA 3LHDA 2Y0BA 1UXOA 1BWPA 4RGYA 3FTQA 2E5WA 4Z0PA 4PAOA 4XGIA 3OX3A 5LD2C 3IE2A 1DELA 2CW5A 4ZJZA 3U4CA 2O8BB 1U2SA 3D74A 2CUKA 2FJUB 3DDUA 1QHGA 3RRFA 1EFDN 1G63A 1SXQA 1W1UA 5F9MA 4RM2A 4BMOB 1KE2A 3BFHA 2AMFA 2QUBA 2Q7DA 4HDRA 4FM9A 3PI6A 4MQ5A 2FW7A 3TTWA 3S6JA 3PEWA 4O2BA 4YJ3A 1A9PA 1G2OA 1T0PA 4KTTE 2VAVA 3ZE6A 5TNCA 3QVKA 3LI2A