1DEKA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
240
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
total genus 86
structure length 240
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1dekA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dekA01
1G291 2FZ4A 3TVDA 2H57A 1O87A 1W0JD 1N6NA 2GCPA 1KNXA 3H0KA 3EA0A 4KITB 2L0XA 2YWHA 1NL3A 1HTWA 1WA5A 1GTVA 2GAAA 4I1SA 5EZ6B 3QEJA 1XPRA 2NOAA 5CM8B 2PX3A 4CT4B 2OLKA 4EUNA 3RS7A 2OM2A 5J47A 4C3ZA 2GETA 4UXHA 4B2PA 2NZ8A 3GLFA 2ORWA 4LC1A 4BPBA 3AVUA 4ZI2A 3GQBA 1QG4A 4B73A 1R10A 1PJRA 3FMFA 3OAAA 5JI3E 1HY3A 4PPNA 4OHZA 4LY6A 1KSHA 2FX3A 1G5PA 3KQLA 1XX6A 2IXGA 2ZI7A 2A5YB 4TL6A 4KJZA 4BFXA 3GFPA 4NYMR 4BQSA 4DDVA 4MUBA 4FD2A 2R65A 2CK3D 4JJKA 4S2EA 3L2OB 5K8IA 2Y8EA 3REFA 2QRZA 1TPZA 3IQWA 2R6CA 4FMBB 3TH5A 5DIFA 1IXRC 4QGFA 3UXMA 2JLWA 2NO7A 1XEFA 4W7SA 4IVRA 2H17A 5HR5A 4BLSA 1W49A 3KKMA 1YU9A 3IO3A 1U8AA 4MGZR 2FG5A 1KKMA 1GNQA 2QTVB 4B48A 1X8LA 2WWIA 721PA 4KCGA 4C0QC 1AGPA 3H4MA 2JEOA 2G0TA 4GMXA 1YE8A 1I4LD 3BS4A 5HE9A 2RMKA 2AWOA 4CEIB 2FPKA 3DMDA 2R62A 2EYUA 2PCLA 4ITRC 4WBSA 2OLJA 3N2EA 1WCV1 4A8JC 5FL7A 3QENA 2NO0A 3THXB 3QPVA 5G3YA 4CT5A 4TMXA 3OHMA 5CLLA 2XTMA 3KJEA 2ZANA 2K5UA 3EZ6A 4AIIA 2VF7A 1HQCA 1KY2A 4M22A 3BFVA 2JATA 4JVNA 3E1SA 2IHBA 5FBLB 3F0TA 1D5CA 4UXJA 3WNDA 4BECA 3BFXA 4WXPA 1VIYA 2QE7D 1HV8A 2PLFA 1GL7A 1W36D 2FN4A 5KNBA 2O8EA 1HH4A 2GJSA 2W2VA 1P72A 3IBYA 4Q48A 1Q3TA 4LYAA 2VH5R 3K09A 2HCJB 1YZUA 1TF7A 3D8BA 1Z29A 1VECA 3KZ1E 5C1BA 4QJ3A 3U60B 3O8CA 1W0KD 2XGJA 1XEWY 1Z3IX 1SVLA 4YONB 1XXHB 3QXJA 1E79D 3H2YA 2N42A 4KYIB 4IDPA 1ZUNB 2J9RA 3KQNA 4A36A 4AKHA 1FZQA 2CLSA 5FBQB 5JCZA 1I2DA 2ORVA 4V0LA 1LFDB 2F1HA 4M9XA 1F48A 3CZPA 5AJYA 3GLIE 3MWKA 2RHDA 4MDFA 3IHWA 1E2GA 4QHTA 3IGFA 1T8UA 3B1YA 3Q5DA 2JLRA 1N6LA 4NYMQ 2XJ9A 3THXA 1V43A 1H8HD 1VYVA 1IOZA 2GZAA 4LX0A 1E9EA 1G3IA 3EW9A 3QKUA 2IYZA 2W0MA 2ZI5A 3O8RA 1E9DA 2VQSA 2HCBA 2JGNA 2ZROA 5J4HA 4HB0A 1H8ED 2XB4A 4JLOA 4X8HA 1MR3F 2QAJA 4A9AA 2ZI3A 2BJWA 2YC4C 1GL9B 4D4JA 2XOKD 3BH7A 1E9SA 4JSTA 4TT3D 3U3RA 2B21A 5L3VA 1Z07A 3U6BA 1T5LA 2GVDC 3VR4A 2VPPA 4JLNA 2EW1A 4DSNA 4M1TA 4DDWA 3L0SA 4RD2A 3ZJYA 1Q44A 4NYIR 1OFHA 2KE5A 1QVAA 5FBVB 3EARA 5G3ZA 4PZYA 3LVQE 3GJ8A 2R2AA 1KI6B 3FGNA 2YOGA 2BM0A 2YWEA 1XEXA 3FKSD 3GJ0A 1HA3A 2F7SA 4KHZA 1GILA 2ZRLA 3W5IA 2P5SA 4NCHA 2QQ0A 1KO1A 1CR2A 1ZVQA 2ZJOA 2OE2A 2PEYA 2QGZA 4M4SA 2IC5A 2WPDA 5LPNA 1LTQA 1NY5A 3I72A 5EJEA 1OXUA 1OXVA 2CHVA 2VYFA 5AJWA 3RVBA 2QSZA 2ZSAA 3HU2A 1ANKA 1DG1G 2A5DA 4IKEA 2P5TB 3NEYA 1S9HA 2IA5A 2HJVA 4RY2A 2ERXA 4FW9A 4LV6A 1L8QA 1F6BA 5EE5B 4C0BA 2DFLA 3VKHA 1S4QA 1UEJA 1UDWA 3E5HA 1NVXQ 1OB5A 1Z6XA 1JR3A 3CONA 2CHGA 4JSYA 5L3SA 3LBIA 4Q7JB 2QBYA 3U44B 2CE2X 2Z4RA 5C46F 4LHXA 4EJSC 3W90A 2WWGA 2KWIA 3C16C 1P6XA 4M0LA 5FTJA 2IXFA 4HATA 4MKFA 3VR3A 4B3FX 1N2CE 3P4YA 1SULA 4DXAA 2F43A 2GXSA 4QNRA 2XSZD 2PJZA 1OH6A 4ZCLA 2VEDA 1VCNA 4JL6A 4XOIA 2PMKA 2OSBA 2W6JA 1D2NA 4TQ9A 3O8BA 4JT4A 3SHWA 1KAOA 4M8NE 4BLQA 1KK3A 1ZD1A 2GF9A 4OL0A 3PIRA 1QHYA 1FMJA 3RC3A 4HUQA 4UJ3A 1IXSB 3SJBA 1XJ0A 1DS6A 1OHHA 3QQ5A 2QMUA 2KBFA 2CDNA 5FUVA 1M7HA 3QKSA 4B3BA 2MSCB 2NPIA 4RJLA 2QENA 4IVQA 3CNNA 1Q1EA 3AVYA 1T3LA 1SXJD 3KTAA 4AI6A 1U81A 1UKYA 2WTUA 1Z0JA 1T3HA 4LK2A 4Q66C 2AX4A 1R7RA 4OI0A 2FSHA 3B1ZA 821PA 5L3RA 1FTSA 4YMSA 2H7VA 3A58B 121PA 1GP2A 3R7WA 4RD4A 1SVKA 3O47A 3TJZA 1PZNA 4ARZB 1Z28A 3K0CC 3CKLA 4CF7A 2WWHA 1T0JB 4BLOA 1WBBA 1KDOA 3ZIAD 1D9ZA 5TDHA 2RGAA 3DM9B 4POAA 3NIBA 5SZIA 3MJRA 1P2SA 4JZKA 3VR6A 1M6NA 1LB1B 2XOKA 3C5HA 4LBVA 3SEAA 3RRZA 4RCZA 4KV9A 2B7BA 4OHVA 2VHUA 4LJ7A 3RYTC 1A4RA 3CH4B 1S3GA 5JEEA 2OFOA 1SVOA 3PEVA 3TQCA 1AJEA 4Q1FA 3QXCA 2AK3A 3TRFA 2QU8A 2WSSA 1GM5A 3TK1A 5JECA 3DMNA 2QMHA 3W9YA 3LXXA 1S96A 2A9KA 3PQCA 2ZE5A 3REGA 3R9IA 3WY9A 2IUTA 1DAMA 1P9NA 4X8LA 3FHCB 1SHZA 2EFDB 3MWYW 3DOEA 4PC2A 4HDQB 1OJLA 3DPUA 2YVUA 2NQ2C 3M6AA 1Z2AA 3TGPA 5CYPA 2J7PA 2FJUA 5A4JA 5FL3A 1KJYA 4ZI3A 5CITA 3ADBA 3U44A 2AN9A 3T35A 4C0JA 2W6ID 4NCJA 1E79A 4U7DA 5HZHA 1HUQA 4OYHA 4O2LA 5CIQA 4A1FA 5FPHA 4IXNA 2J0SA 2N1BA 4ZKDA 2QTHA 5EP2A 5DN6A 4HAWA 1FX0A 4QM6A 3ZGXA 4D2IA 4O25A 4TL9A 1PUJA 1E0AA 4XSHA 2IYVA 2P3SA 3VFDA 2Q3HA 3CR7A 1R0YA 1JALA 3VR2A 3SOPA 1VG9B 4Z8XA 4R71A 1T4GA 3GLHA 3MUFA 1CR4A 3FMOB 1N5KA 5JZVA 1KMQA 2QM7A 5GJCA 2JJ2A 2UVQA 3GFOA 3W8NA 1FFHA 5J4LA 3RLFA 2UZ3A 3LNCA 2H92A 3X1ZA 2HJGA 1SZPA 1KDPA 4PC3A 2C9CA 2HDNB 4EKDA 1ESMA 4QGAA 1EX7A 4M1SA 4Q4LA 4URYR 2RH5A 4URZR 2SHKA 5JI2E 3FVQA 3UMFA 3EZ2A 4LHWA 1HT1E 2H16A 4JYCA 3AF1A 4WVFA 5AJZA 4DUGA 2CMKA 5EE9A 5GVSA 4DUGD 4IOJA 2FZLA 1R2QA 2V7QD 2Z6VA 5F98A 4NMMA 8OHMA 1WMSA 2B7CA 3AVQA 1TEXA 2RGBA 1OKKD 4DB4A 3QPWA 5FTLA 2A2ZA 1GIAA 1QBKC 4TL8A 3RS5A 2BHRA 2HXSA 4BEJA 2BMDA 1AGRA 1K5GA 3SJZA 1WP9A 1NVUQ 3OFNA 2ZREA 2ZS7A 5FUXA 2EFCB 5IT5A 2LKDA 4BFTA 4W5HA 5JBQA 1E32A 4CEHA 1DPFA 1CTQA 1CEEA 1GDDA 5TVKA 4B33A 4ZCMA 5KNDA 2NO1A 1RJ9B 1E1QD 1GKYA 2C9OA 3A37A 4FN5A 1XNJA 3I8XA 2ZSBA 3K53A 4G5QA 4B74A 5AJVB 1XF9A 1L4UA 5LBIA 3UG7A 3GLIA 2RGCA 3HPQA 3F5FA 4RKFA 3A36A 1FUKA 3ZVNA 1BYUA 3D6TB 4QNMA 4Z51A 3PEUA 3U4QB 1Z5ZA 1MV5A 5AK0A 3IILA 1XJQA 2TMKA 4K81B 1R8SA 1KSJA 1FOEB 3U3MA 2GK7A 1Q1QA 1G20E 1P73A 4JLJA 4AWXA 2YV5A 3HP1A 5A5GA 5KOYA 3X2SA 3BH0A 5HZKA 2ZJAA 3KJGA 2JLYA 4HZIA 5KO2A 3BH6A 5TV2A 4V02A 4UNQA 4JBYA 2HXYA 2H1LA 2C99A 2HLDA 4Z1MA 5JFGA 1YQTA 2F9MA 1GUAA 3QJYA 2Q3FA 4XD7A 1EWQA 2Z5FA 2C77A 2AD1A 5JEDA 1E9FA 3IBGA 3AVWA 3PUVA 2BBSA 3FB4A 2G77B 1E9CA 2YOFA 1SQ5A 2C78A 5FPTA 4B3DA 2BM1A 1E3MA 2CNWD 3OEHA 4KFRA 3WMEA 2KSQA 4AKEA 4I1UA 2WBLC 4YMTA 4D0LB 3OZXA 1Q22A 3A1TA 4G0NA 3VNVA 2IWRA 5TXGA 3JZAA 4URVR 3GD7A 2FGJA 4KLNA 1KOFA 4PPGA 4UJ5A 3OIUA 2P2LA 3TNFA 1U0JA 3F8TA 2P6UA 1BMFA 1ZBDA 5FPSA 3TLXA 1ZM9A 4XVRA 4C4PA 2YZ2A 3R7WB 1CRQA 1A5TA 1C4OA 1NVVQ 4DLRA 4N0DA 1UADA 5FBWB 2GEVA 1G3RA 3IPXA 5EZ5A 1NBMA 2IYYA 4BZQA 1E2PA 3NC0C 2J3EA 3GLGE 1XB2A 1V5WA 4II7A 3U7HB 2A7QA 2ZTSA 4US0R 3X1YA 5CDFA 1ELOA 3ZS9A 5J40A 2IXEA 4R2HA 1DAGA 4E07A 1OHHD 1WE2A 1QHNA 2CCJA 4HAZA 2NTYC 3Q9LA 3QBTA 1G8HA 1KSFX 1OYWA 2ZRFA 3FYHA 5CIWA 1Q21A 2IEZA 3T1QA 2OESA 4FMCB 3U3KA 2XXAB 1Y3AA 4PO1A 3AF3A 2JIZA 4FMDF 3LWNA 1XTJA 3IEVA 1IN5A 4TQUS 5FR2A 3W6NA 1XTIA 3CX7A 1WRBA 3KL4A 4TTRA 1MABA 3SE0A 3FTQA 4AC9A 4QOSA 1OKKA 2WOJA 4EQ6A 1R5BA 1E4VA 4MH0R 4Q4JB 1ZUIA 2HT6A 2V7QA 2DY1A 2W2TA 3U3OA 1UEIA 3IIKA 2BBTA 3I8SA 5D3MA 2CLDX 4PANA 3TBKA 1MT0A 3CRW1 3EX7C 1R5OA 1E96A 2ANCA 4Q1BA 4YDHB 2QRNA 2W00A 2C8VA 3AB3A 1E9BA 4GRAA 4LYJA 2O8DA 4DBLC 3RC8A 1VDZA 1NBMD 3FWYA 1EK0A 1KI1A 2X8AA 2ZRKA 4IOMA 1RPZA 1XD8A 4KSBA 3CLVA 4Q9LA 2OEPA 3U4QA 1COWD 1ZM2A 2JJ2D 3DKVA 2H18A 2Q21A 3HR7A 3WYFA 1Z0DA 2IYWA 3DM5A 1ZJ6A 2PZGA 1G3QA 1NF3A 1DVRA 3BORA 1X86B 1FUUA 2AKYA 3AF0A 4Q1AA 4Q02A 1IM2A 3IPYA 3K09C 1XPOA 2BMFA 1AKEA 2CNWA 1XJCA 2G3YA 4OK6A 2ZIAA 2WVJA 4M1YA 4I1VA 4P4TA 1XD9A 4MQBA 4XVUA 1WQ1R 1UJ2A 1OXTA 2QPTA 1F5NA 3QVVA 2GK6A 4ZCIA 4GOXA 2J46A 2VP5A 2J7PD 4JBWA 2VSOA 5D3QA 4BZXA 1ZU4A 1ZNWA 2FNAA 3ASYA 4KLZA 4OK3A 3D7MA 4KU4A 2KI5A 2ZU6A 1KSGA 2HLDD 4Z1MD 2AFHE 3FKSA 2F3TA 2IF0A 1CRPA 3ETLA 2PT7A 2FH5B 4AD8A 2FGKA 5CK5A 521PA 3AVTA 1G4UR 2P0EA 1XMJA 4QC2A 1DAIA 1G21E 1NG1A 4EIWA 4PR0A 2GXUA 3EG5A 2G83A 1C9KA 1E1RA 1P7CA 1ZCBA 2PZFA 4L9WA 1Z6GA 1MOZA 2ZAOA 4NCNA 2IYRA 3K0EA 2D62A 3QF4B 4N0EA 4NU0A 2QPOA 5FH9A 2WJGA 4HLDA 1H8EA 1SVWA 1W48A 1Z06A 2ZUCA 2G88A 4LJ6A 4UNPA 4EPWA 2HUPA 2O5VA 4A0HA 2CVFA 4MYTA 3GP8A 1SXJC 1TF2A 2BBOA 4LI0A 3AP3A 2XZLA 2XNDA 4HAYA 4P32A 3EA5A 3QG1A 1G4AE 2X2EA 3QKRA 3UKDA 1ZIPA 2VSFA 3B1XA 4B32A 4L4UA 4JLPA 4Q9IA 4LOAA 1P2TA 1E94E 1I4DD 4GI7A 4Q7MB 1FMLA 3DEFA 3LH5A 1J99A 2ZS8A 4MKHA 4HYYA 5F9FA 4Q03A 2P6RA 2QORA 4RCYA 4DCTA 1UDXA 2WWFA 2DWPA 1DTSA 4TN1A 2N46A 4RD6A 4OHWA 1CP2A 1VMAA 1W46A 4LBZA 4QJ5A 1RE0A 3CH5A 1SXJA 3SJCA 1F60A 3BB1A 2ODNA 4A8JA 3Q7QA 5AUPB 4PC7A 4JVMA 4F92B 3SR0A 2FSIA 5LB4A 1HYQA 1XZPA 4HLUA 5EE0A 4B35A 4DZZA 4ESVA 2O8DB 3EPLA 4PO9A 1SVSA 3I5YA 2FFHA 1TU3A 4TMTA 1TUIA 2CJWA 1GL6A 2JJ1A 1ZUHA 2XTNA 4NCIA 3ICQB 2CVHA 3G5UA 3P1JA 1FTNA 2OCPA 4EDHA 2OCYC 1OH8A 1LF5A 5FOWA 3K9HA 1OXSC 4Q00A 5TARA 1IAQA 2B8WA 4FIDA 1NMZA 4XWAA 1LY1A 3Q8XB 3C5CA 4GSYA 4PC1A 3VX3A 4A8JB 4AYWA 5KU1A 5FL7D 4U00A 1W36C 3FFAA 4BUJA 1YR6A 1EFRD 4JT2A 5EQTA 3SJAA 4EPVA 3GPLA 3KDSE 4OBEA 1E69A 2O8CA 4ZKEA 1VG0B 2WKPA 2GAOA 5GVRA 1E6CA 1U9IA 4G3XA 4Q5IA 4BRWA 1IQPA 3CIOA 1J70A 2FE4A 2ZI9A 1CJTC 4MYCA 3L82B 1N6IA 4B6EA 2RHMA 3W6OA 4TMWA 5JHHB 1AIPA 1G8GA 4MKIA 4OKSA 4ERNA 5A0FA 2ZJ2A 5E95A 2ONKA 3KQUA 1MO5A 2WWYA 1E4YA 3EZ7A 2CK3A 2AFIE 5C18A 1P75A 2AD5A 3ZYCA 3GLGA 1J90A 4Y0AA 4QHYA 1W47A 2J0UB 4ZIRA 3UPUA 1GKIA 4V0NA 4YDSA 2DFTA 2F6RA 3OEEA 2ZJZA 5E4FA 2WIAA 3R20A 1NI3A 3QPUA 4AG5A 5FOSA 2ZRIA 1II8A 4LDJA 4C7OB 3SC3A 3KB2A 5SZKB 1VHTA 3ZVRA 1TTTA 2FF7A 1HE8B 2G1KA 3RS3A 3WP0A 3P26A 4UNRA 4A2WA 1M74A 1IY1A 4WIAA 4IEEA 5FTNA 4BFSA 1GAJA 4BLTA 4R7ZA 1W4AA 4DHEA 4BGDA 3TUZC 4RD1A 2OBNA 3SBEA 3HR8A 3ZVMA 1SKYE 1Z0IA 3KX2A 3WYGA 3SHFA 3ZIAA 4PQRA 4Z8YA 1VG1A 2OHFA 1QVRA 1SHKA 2J59A 2XEXA 3EWSA 3MGCA 4AK9A 5HCIA 3UWOA 4MUAA 2NGRA 1A1VA 5K8UA 2EQBA 3JVVA 1JJVA 1U90A 3DKPA 1QHHB 4KBFA 2QNRA 3TMKA 4CVNA 3BOSA 4V0KA 1DAKA 2GXQA 5DH9A 3KUCA 1G3UA 4BFZA 3RABA 4DDUA 4N3NA 5C4GB 2JLZA 4NCKA 2VP0A 1J8MF 5EE3A 3NTUA 4LZZA 1F2TB 4A0RA 4IDOA 1QRAA 1G64A 1CJKC 3QXSA 5P21A 1Q20A 3ND9A 4TLBA 1CJMA 4JLBA 3RRNA 6Q21A 5DNYB 5K8TA 4ZIRB 1OPXA 3W8RA 4RFSB 2YYZA 1YVDA 5KSOA 1Z0FA 1TL7C 2OXRA 5BQ5A 3GLHB 3R8CA 2GNOA 2ZAMA 3N70A 1II9A 3RDPA 4JVSB 2WHXA 1QG2A 4FCVA 1YJ5A 2CBZA 4JLDA 4I4LA 1BKDR 3DZDA 2OFWA 1A7JA 1W0KA 4F93B 2OUKA 2C98A 5DI9A 1IBRA 1IONA 1G7CA 3FHOA 3RHFA 3PVSA 4MKGA 3IEUA 5AJXA 1EG7A 1T6NA 1NKTA 2QTFA 4RFVA 4D0GA 3TR5A 4DJTA 4QM7A 1XCGB 5IK2D 1UFQA 3K9NA 1UBGA 2RGDA 4V0OA 4AG6A 2ODEA 3VAAA 3CRVA 1VYUA 4QJ4A 2ASEA 1JR3D 1M7GA 2NO9A 2ZJ5A 4PSVA 1NSFA 1DARA 3GJ4A 1W5SA 2DFKB 2JJ1D 1N6RA 1KMHA 1UBCA 2EFGA 2G1JA 2JA1A 1ZM7A 3TQFA 3VNUA 3NC1C 1EGAA 2QEQA 3RSOA 2Q9BA 4XSGA 4JLAA 1T9HA 4PSKA 4URXR 4BASA 4NHOA 4PPFA 5DYGA 1R5NA 3I1FA 1N6HA 1N6KA 4YQFA 5JWOA 3IO5A 1BS1A 3PITA 4F91B 4BFVA 1Y63A 2OCBA 2V8OA 4Q9JA 1WBDA 4GL2A 2EYQA 1XTSA 1EFCA 3MCAA 3I62A 1P60A 3KUDA 1YZNA 3Q5EA 2X19A 1GNPA 2IL1A 1RFLA 3G82C 1TMKA 5CM9C 1GRNA 4TQAA 3A1UA 3MMPA 3BB4A 4GFDA 4LYHA 1KO7A 2MSEB 4D26A 5F3WB 1SXJB 4LJAA 4Y0VA 4EPYA 1KMHB 4V03A 5KHOC 5J4VA 4WZ6A 3CF0A 1R8QA 3N2IA 3EPHA 1GKUB 1LNZA 1FQJA 2ZRHA 4URWR 4TSFD 3PUZA 3SZRA 1XTKA 1SKYB 1PV4A 5F9HA 3C14C 2EVWX 1L7VC 2GA8A 4PO8A 3L0OA 5BW8A 5EXPA 3KFXA 2QMEA 2V54A 4IDNA 1JB1A 5BYKA 5IDVA 4PFSA 1WXQA 1J2JA 2I4IA 3TUJC 2XJ4A 4O2RA 4P31A 1TNDA 4DB2A 4IVPA 1NKSA 2FFBA 3CRQA 3TR0A 4E03A 3PUWA 4DLSA 3ZH9B 3SQXA 5CB6A 2QP4A 4ASUD 4JLVA 3JZMA 4JBXA 1LVGA 2BEKA 2Q3MA 3K70C 4MITA 3BE4A 1TQDA 1H8HA 1E2IA 1RJ9A 1TU4A 2HV8A 5AWFC 5G40A 2GXAA 1YZKA 4OQNA 3P20A 1U99A 4D4MA 5ANRB 3K70B 4CEIA 1YZQA 2ZE8A 1D9XA 3AQ4A 5AUQA 5FOUA 5KPJA 5EUMA 1OT3A 3DOFA 4FWTA 2LWIA 4I81A 5FUWA 3ONWA 1ZIOA 2FSFA 4B71A 5B58C 2ZYUX 3MFYA 3CRMA 3IDQA 3MLEA 2P6NA 3OE7D 3ZVLA 2IS1A 5FPKA 4LHVA 3WMFA 4LYFA 4PAMA 2F1JA 3WXMA 2IYLD 3GEEA 1F2UA 4PAOA 5CJ2A 5EXTA 2IX3A 3CB4A 2VSXA 4UQOA 1US8A 4LHYA 2HEIA 1KKLA 1VPLA 2IBMA 2OV2A 2VP9A 3W6PA 2FA9A 4HAVA 5JWHA 3T1TA 2WWWA 2CL0X 3CM0A 1EFRA 2O0KA 5KDDA 1U98A 4P4SA 1ESNA 1TQ6A 3VX4A 4YXWA 1E9AA 3B1VA 1OF1A 3A4NA 4B3XA 1G18A 4RD3A 1II8B 4HLCA 4C7OA 2GVZC 2ZSFA 1GVNB 4G5SA 4Q01A 4G01B 1Q1ZA 3PFIA 4D81A 5FUYA 1N0UA 1KDRA 3LX8A 3LFUA 3EAQA 4PHTA 3ADDA 1GWNA 1RZ3A 3T34A 3KKPA 4E22A 3QKSB 2A5GA 2BVNA 1OIXA 2AXPA 4XJXA 2A30A 2F1RA 4NH0A 2GJ8A 3ZQ6A 4AY2A 2C2HA 1NRJB 3MSXA 3TVTA 4LV5B 4Q4HB 1OV4A 3MD0A 3RRYA 1UKZA 2J0VA 2CE7A 3GJ3A 4D6PA 1KIMA 4LPKA 1IJFA 4W5WA 2O8BA 1AZTA 4JIMA 3LAWA 4YMVA 1E2DA 4MRRA 1NBME 2PEZA 1YR8A 2FPLA 3ND8A 2JJ8A 5FOTA 2UZIR 1NN3A 1S3SA 4DEYA 3GJ5A 2V3CC 2PH1A 1ZRHA 1ZAKA 2RGNC 4TMZA 2BOVA 4MRVA 5CYOA 2O8CB 3UMRA 1NVVR 3HYRA 5JS7A 1NJFA 2Q9CA 2NO6A 4WW0A 2B6HA 2QL6A 3KJIA 4OJKA 1FPMA 4DLTA 4IDHA 3CWZA 1SVIA 1ZNZA 4ZO4A 4B43A 2P67A 3AGQA 4PQFA 3T12A 2O8FB 1E0SA 1G16A 2KJQA 1JPJA 4KFUA 1KGDA 2XNDD 4Q7LA 5AUOB 1P61B 3GLFB 3HU3A 2GKSA 1KTVA 3RS2A 1DBSA 4US2R 5H68A 2V4ZA 3QSYA 1YKSA 3M0EA 4QBFA 1JJ7A 2ZVPX 1DOAA 5FR1A 3AVVA 3E2IA 1E2MA 4F4JA 1CKEA 2O0HA 2R6DA 2GDJA 2BIFA 2GJ9A 3MJHA 3RWMB 3NKVA 4TLDA 3TSZA 1K5DA 3B82A 3IIMA 1YHNA 1ZC4A 4FI3C 2WJJA 1CS4C 3E70C 1PLJA 4H1VA 3UG6A 2ZRBA 5BN4A 5KTYA 4DLVA 1NG9A 1Z6AA 2CCKA 2QT1A 3ECCA 3UK6A 2ZRGA 3VHXA 4O3MA 4AURA 4BFYA 2VHJA 2W83A 3EC1A 4WXRA 3VTKA 4GOKA 1JNYA 4LUCA 1NNEA 1FP7A 4TYWA 4DSTA 3C8UA 4KSCA 1QDEA 1T3SA 2A78A 4LWZA 3ZZ0A 4DLYA 1OFIA 5E7JA 1FW6A 4G5GA 1N5LA 3B9PA 4OQFA 4XH9B 2FU5C 2CL6X 3CZQA 4PHHA 4TYNA 3FHTA 4PAQA 5JJLA 3SYLA 1UKVY 3AVOA 4EQ6B 3FFBA 4H9GA 2WKRA 2PMDA 2QM8A 4LSGA 1XRJA 1XTRA 3NH9A 1LV7A 2XZPA 2QBYB 1JEEA 5DHFA 2AL7A 3DO6A 3TW4A 2GZHA 2QGNA 1A2KC 3V4FA 4Z54A 2QP3A 2WV9A 2JLQA 4LJ8A 3T5GA 3O8DA 5DI3B 1DE0A 1RVDA 4JL5A 3SBDA 3B78A 2W2XA 4B6FA 3HWSA 3IHLA 3EPKA 2ZPTX 1KHTA 5J4KA 5JS8A 1XTQA 2GJKA 1P2VA 1OB2A 4DSUA 3L43A 4RZ3A 2LKCA 2C5LA 4XVQA 3PEWA 1B0UA 1N3BA 5E7IA 1GSIA 4R98A 2YNMA 1E1QA 2ZM5A 4KXFB 1G5RA 1M7BA 1XXHE 2EU8A 4QGHA 4TLAA 3TAUA 4D4LA 2W0SA 1W36B 3GEHA 3GJ6A 4O0MA 4OI1A 4KO8A 4GDFA 1KI6A 3PUYA 4ON9A 3C4JA 4HI0E 3GFTA 3THWA 3B9QA 4I1OA 2CJWB 3I3SR 5TY0A 4BEBA 3GLFE 1OSNA 3R9WA 4QGGA 5EE1A 4TMKA 3THYB 1CR1A 1QHXA 4CEHB 2NMVA 3CX8A 4LHZA 3BFKA 2JLXA 4DLWA 4GOJA 1JI0A 4NL4H 1KNQA 2RKOA 3AP1A 2ZUBA 1KJWA 4QFMA 4TLCA 2D74A 1RRCA 1OH5A 3BK7A 2FMXA 1GITA 1G6OA 3AUXA 3QF7A 4JYBA 1NIJA 1NMXA 4LCBA 3L0IB 4P4UA 3KXKA 4NYJQ 5E7MA 2FOLA 1G3MA 4ACBA 3T06B 1AN0A 1XXHA 1OYYA 1S9DA 1XEWX 3L8YA 1YRAA 3EC2A 1CU1A 4IXMA 5L3QA 1U94A 1E2EA 2ZYVX 4OJQA 4OHYA 1DO2A 1D2EA 1J8YF 1NSTA 3I92A 2YOHA 1GRRA 1M1YE 2O52A 2QQEA 2VHCA 5JCPA 3ZD7A 2IT1A 1VTKA 2JDIA 3CR8A 4L15A 1NP6A 1JXOA 5HKKA 5GJVC 4BZPA 4FCWA 2DBYA 3M4YA 2WZQA 1N0WA 4KFSA 3QNUA 4FXPA 4UNNA 1ZW6A 5DN6D 3K0CA 3B6EA 3BGWA 4M1KA 5KNCA 3OEHD 2F43B 4DSOA 1JECA 3LLUA 1KK0A 3HDTA 2GEUA 2YINC 5LD2C 2YWFA 2C95A 4C0KA 3K0FA 4B47A 1II0A 1P3JA 2WKQA 2ZVQX 5GJBA 3IQXA 2D3WA 1Z2CA 1SKQA 1MH1A 1ZM4A 3TW8B 3PENA 2XNSA 2O8EB 2ZRMA 2LCFA 1MO4A 5IF9A 3PV0A 3AGPA 2BMEA 4EPXA 3ZS8A 3QEOA 2IW3A 2WWXA 1Z8FA 3LLMA 2VL7A 5CLQA 2QA5A 4F7WA 1JBKA 1N6OA 5KUTA 3X1WA 3NDPA 4M1MA 4EAQA 2UKDA 2ZETA 5E3HA 1CIPA 3BXZA 1JAIA 5JJIA 1KI2A 3B7GA 3DHWC 5H1YA 1KZGB 2NPFA 2OAP1 4IDQA 4X8MA 1LS6A 4JVLA 5EXSA 3SS8A 3CUEF 1CJUC 1G6HA 1HE1C 3PXGA 4DCVA 2BKEA 5DGXA 3ASZA 1JR6A 3U2QA 2GBLA 2Z0MA 2X1VA 4NE2A 1ZMXA 1DG3A 3H86A 3NVAA 1AS3A 4LJ9A 2DFNA 3WYAA 4GNKA 3I73A 2R6GA 2ZYWX 3C15C 3BIFA 4L8GA 1QF9A 2WAYA 5FPYA 3HU1A 1XFAA 3RWOA 2B8TA 4OK5A 3SN6A 4LBYA 3THOA 4CZ2A 4KVAA 4RFSA 4NONA 4BLRA 3LBHA 4TZ6A 4NYJR 1MABB 2CHQA 1GZSA 1MO3A 2IEYA 2FWRA 3TUIC 1X1SA 2GESA 3LY5A 1P9RA 1CULC 1G19A 1VYTA 4G1UC 3RS4A 1AA9A 1R0WA 4LC0A 3KQKA 1KK2A 1G41A 3S1AB 5DE3A 3H1TA 1P2UA 4KAXA 4BWYA 4BRUA 1LW7A 2RGNA 2HYDA 2QI9C 4MGIR 1Q0UA 1RRPA 2OG2A 1D6JA 3I4LA 2J7KA 1CBUA 1X8JA 4QG7A 1BYIA 5L3QB 3AUYA 3NDBB 3VQTA 2ZE7A 3NH6A 3B60A 2GILA 1LS1A 2R8RA 3GLIB 4EFMA 4U5XA 4Q9HA 3CX6A 2WIBA 4EJSA 4PHFA 3QF4A 5SZJA 4RZUA 1K8RA 5CK4A 5TB5A 2GF0A 2IYUA 3AF2A 1JPNA 2H8KA 1G9XA 3X1XA 3U3JA 2G0NA 2BBWA 4B2LA 4Q4AB 1OXXK 3Q85A 2BWJA 3TAHA 1RIFA 1NLFA 2OAQ1 2J87A 1VG8A 3ZZUA 5B30A 3KB1A 1TX4B 5IRCD 2ZEJA 1UBEA 2JLUA 1U0HC 2REXB 5KSYA 2F9LA 2VF8A 3SDZA 1OIVA 5KYKA 2VP6A 3CWQA 1CF4A 1QHHA 1IXZA 2QG6A 2W6IA 3LA6A 2D06A 3I32A 1N0VC 2AWNA 1MRNA 4Q1CA 3T1OA 4ZV4A 1BMFD 5AUNB 1XP8A 2PZEA 2V6JA 2C03A 2QAGC 3RNLA 3ADKA 3KKQA 1TF5A 2A5JA 1XU4A 3QY0A 3WNBA 4B3GA 4Q1EA 1DEKA 3A1SA 3DVLA 2I3BA 2VBCA 3F3YA 5C4MA 2QSYA 3TIFA 1G8YA 3MRSA 2Q0HA 4OQLA 1N5JA 1E2HA 2O0JA 2RB4A 2V55B 2I1VB 4L5BA 1OW3B 5DI3A 2WMNB 4M1WA 4A15A 4P0TA 3CPHA 4XD7D 5DISB 1ODFA 2Z4SA 4DRZA 5GJWC 4TYYA 1E0JA 2I1QA 5DSZA 1OFUX 1R6BX 1S1CA 3KKNA 2OILA 1XMSA 1W2HA 2D4HA 2OFXA 1XMVA 4C2TA 1Z83A 5BN5A 1RW4A 3IIJA 3RANA 1XEXB 2ZSEA 4FMCF 5AR1A 4URUR 2BCGY 4ZDJA 1KO5A 3DZ8A 1VKJA 2ZU0C 4F4IA 5JHGB 2GEDA 5KDOA 1L4YA 2WJIA 2O8FA 4DC9A 4A0GA 1FNMA 4IEIA 5JRZA 2JASA 2RGGA 5DO9A 2IYXA 4M21A 2QAGB 4HEJA 3RRMA 3FMPB 3U7FB 3SI7A 1NLZA 4GBMA 3U5ZB 3W3ZB 4HUQB 4CDGA 3THYA 3WBJA 5JWRA 3ZQJA 2QZ4A 1G17A 4JLKA 1E2NA 4GZMA 4CRWB 1AQYA 2NIPA 4A92A 2ZR7A 3U7GA 1JQLB 3Q7PA 5B57C 1KK1A 5B64A 1SGWA 2O8BB 1XD2A 4IRUB 5FFMA 4GZLA 1W7AA 4HZUB 3MAAC 5DHAA 5BN3A 1GRQA 4AYTA 4EPRA 1J7KA 4BFWA 4JS0A 3K9GA 4DIDA 4LBWA 4Q21A 1W44A 1UM8A 3M1IA 3AF4A 5HE8A 1I4TD 2PX0A 2E9SA 4ARZA 1QHGA 4D4KA 4U02A 3EZFA 2WICA 2XSZA 5L8VA 1RKBA 3K70D 4TYPA 1X8KA 1M34E 3N5CA 1T5IA 2WOOA 2PT5A 4PZZA 4ZDWA 5JRJA 2FPMA 1D2MA 4HZUA 2QE7A 1AS2A 3AKYA 3R9XA 2C96A 5HCNA 1TEVA 3JVUA 4UNSA 4IFBA 3PJRA 5BXQC 5JSZA 3NBFA 1O3YA 1IN8A 3LDAA 4ESHA 5G41A 1KAGA 1Z0AA 1IN6A 2C9YA 1RRGA 4DVGA 1JQJC 1FX0B 2QROA 1UF9A 1WDTA 4AKGA 1JR3E 1PVOA 3AP2A 1IJEA 3DL0A 1FQKA 2GCOB 4Q19A 1E2FA 1X6VA 5BWMA 2DB3A 3EASA 2ZI6A 3QKRB 4UXIA 2YJTD 4TLEA 2J5XA 4C0LA 4BE7B 1YRBA 2FEOA 2QY9A 1U8ZA 3W5JA 1S1MA 1JXMA 5KDLA 4DKXA 4NBSA 4DCNA 1E9RA 1R4AA 3B2EA 4ZDKA 1BOFA 4Q7KA 2PJRA 4PX9A 3T15A 4LPSA 1G7SA 3P27A 4B34A 1AKYA 1AM4D 3AKDA 3BD9A 4QBGB 4PQYA 2VLIA 2AKAB 3FMIA 1E2JA 1US8B 4MRPA 1A82A 1XCMA 2BEJA 2IF2A 2J0QA 1S0UA 4JKYA 3K1JA 2ZYTX 4PXAA 3MWJA 5FTKA 1EFHA 4MA4A 3B13B 3UIEA 2FFAA 4PTLA 3FKQA 3LO5A 4B76A 2W58A 3RSLA 2WSSD 2QAGA 4GMDA 2D7DA 1RC8A 5FI0B 1N5IA 2R9VA 4A6XA 5JJKA 4AYXA 5B2ZA 5KSPA 2NG1A 5M04A 1N25A 4E5UA 1LF0A 3D3QA 4B3CA 3PEYA 1SXJE 5KPDA 2J1LA 3CPJB 1E1RD 4GPTA 3NEJA 2ODBA 3CF6R 4H1UA 2C04A 3KJHA 421PA 3K0SA 1Q1BA 3NHAA 3CNOA 4M9QA 3T5DA 2REOA 3KXIA 3NHBA 1BO6A 5DYIA 3VKWA 5C2JB 5KSZA 4TSFA 1KI4A 1W0JA 1P9WA 1Z08A 1ZM3A 2BMJA 5FOXA 1KI7A 3IKJA 3WRXC 3QXHA 4TZ0A 2AK2A 2OBLA 1EFUA 1OIWA 4ACAA 3LD9A 1C1YA 2ZRPA 1NMYA 1Z47A 4YC7A 2PLRA 4WAUA 1GNRA 2ZR9A 3CNLA 5LD2B 1VCMA 2DPXA 3GMTA 1OE0A 4HAUA 4TL7A 2JAQA 3V00A 4M9SA 3TE6A 1U8YA 4CW7A 4IJMA 4C0SA 3U6KA 3BC1A 3QOFA 3VHLB 3PG5A 4NYIQ 2A5FA 4HSEA 2VA8A 3WRYC 1AQUA 1NN1A 1F2TA 1TADA 4M1OA 4TTQA 3B85A 1VCOA 3L8ZA 3KKOA 2BDTA 2CLCX 2PBRA 2ZRJA 3PR1A 2BKUA 3W34A 1P4SA 1P5ZB 2IK8A 3VR1A 1FNNA 2P65A 2REBA 4WOPA 4C0HA 1OH7A 2ATVA 221PA 1UAAA 1AZSC 2W6JD 2YKGA 1G7RA 2X77A 1F3OA 4QXAA 3UWKA 1MO6A 2QT0A 2VRWA 2ZSDA 1Z0KA 2Z43A 4LGMA 3RAPR 3A1WA 4OQMA 3FOZA 2ZXUA 2XZOA 1X1RA 2QUZA 2EFHB 2R6AA 3UANA 4B44A 3VKGA 1W4CA 4XTCS 1XDBA 2ZRAA 1DAEA 3FPAA 1L2TA 3H84A 4A82A 5FBRB 5BYJA 4EJSB 4HLUC 1ZD8A 1TUEA 4F38A 4GT1A 4RZXA 4TTPA 2EWVA 2Q9AA 3QUSA 4TWZA 2WJVA 1R0ZA 1XMIA 2JIZD 2VHTA 4KODA 2E1RA 4PSAA 2PCJA 3BWDD 3CF2A 3OIVA 2EWWA 2D2EA 4E09A 3BJIC 1A2BA 3A8TA 3LW8A 5IHPA 2IS6A 1TQ2A 3ZDQA 4HAXA 1B23P 1N6PA 3FDIA 4FWIB 4M9ZA 4CGZA 3TKLA 4CYMA 4PPQA 3QE0A 4G5OA 1I2MA 2R44A 2OT3B 1WB9A 5ELXA 3AH8A 2AHOA 4HLQB 5EXXA 3QI2A 4QL3A 3J81k 3AV0B 1OFTA 2RCNA 2ZQ5A 4DCSA 4QKQA 3OF5A 2XXAA 4W9MC 3B8HA 2ONJA 4L16A 3SFVA 3K0FB 3OAAD 4B2IA 1M8PA 1XZQA 4RKEA 1E2LA 1CXZA 2DWQA 4WA7A 3X1DA 4ZDIA 4EFNA 4MRNA 3SYNA 4QRHA 3CW2A 2RGXA 4IFEA 4YLGA 3V9PA 1PLLA 5FI1B 2IUUA 1IN4A 4FMDB 1DADA 4JMPA 4WZAE 2ZE6A 1KY3A 3GLHE 4J0QA 1Z22A 1GFIA 3GCGA 4NZYA 3C7KA 4LJYA 3BAFA 1IN7A 3K0AA 4R9UC 1U0LA 4F4CA 5TMPA 2ZJBA 2YHSA 1MRSA 5G53C 2FDCA 4TT3A 1H65A 3P32A 4IW3B 4XWKA 4D25A 3MWLA 2WJHA 3CRRA 3EIEA 5JMTA 3A4MA 3KFVA 4M2LA 2JCSA 4D0NA 1Z63A 3U7EB 5CDFE 4C2UA 4C30A 3ZD6A 2DHRA 3AKEA 1XCPA 1Z6YA 3OEED 3NG1A 5H8WA 1WF3A 1IY0A 3QG5A 1ZNXA 3SNHA 1SVMA 3NBZC 1ZINA 4P4SB 4RSGA 1RYFA 1UPTA 2KBEA 2V6IA 3RS0A 2HF9A 2V9PA 1EXMA 4MDEA 1XBTA 5UKDA 1MKYA 2QP9X 3LBNA 1JAHA 2PL3A 1ETUA 1TQ4A 3QKTA 4MRSA 3A6PC 1W5TA 4JLMA 4JL8A 2EFEB 3GEIA 3QBVA 3WMGA 1Q3HA 1Q12A 1RYHA 5H70A 1Z6TA 3D31A 4LJ4A 1U9IC 3OIWA 5J5CA 3LX5A 2IYQA 1M2OB 3CO5A 3LQQA 4MGKR 2DCUA 4Q1DA 2J41A 3NXSA 4P33A 3WBKA 4NTZA 2HYIC 3Q72A 2F1IA 2IUSA 2FFQA 2V1UA 2OBMA 3OIYA 4LV8B 3UATA 5GADl 2GCNA 3QXXA 3UMSA 3THWB 2R6FA 4Q47A 4QBIA 2JDID 2CL7X 1P62B 4K8OA 1KZ7B 5SZHB 3AM1A 1T91A 2BJVA 5EP3A 3LXRA 3SQWA 3A1VA 3MG9A 4OI4A 2Z83A 3OFND 4MYUA 4C9BA 1YZTA 2IWHA 3VU9B 4MYHA 2WSMA 5FTMA 3P4XA 3EPJA 2H5EA 4NP6A 4XWOA 4DCUA 2FEMA 5LDDC 4ILEA 3LQRA 2ZRNA 3AEZA 1TAGA 2B92A 1EX6A 4DLXA 1QHSA 3I61A 4A0FA 1CJVC 1UKEA 2ZITA 3TSWA 4US1R 1KI9A 1QZXA 2HT1A 1G7TA 2GRJA 1AS0A 1KO8A 2XAUA 4OQXA 4HDOB 4WZBE 1EWRA 1GG2A 4RD0A 2GBLC 3GJ7A 2YC2C 2GTPA 1W4RA 1DAFA 4X8OA 4KI0A 1KO4A 4FINA 1PLKA 2OXCA 2XTZA 1W1WA 3OESA 4N1AA 5EP4A 1DO0A 2BC9A 4TYQA 4D82A 2VIIA 3KQHA 2AR7A 2IS4A 4NDZA 1KYIA 3VR5A 4KVGA 4A2PA 2G6BA 2DR3A 4P3YA 5CJPA 2VO1A 1EFTA 1DAHA 4AKIA 2ORIA 1IY2A 3WP1B 2J0UA 4HUTA 4IOKA 4FCTA 1E0KA 2ERYA 5K8LA 5J4YA 2ZS9A 2CXXA 1Q57A 1VIAA 1HURA 3GJXC 3V4RA 2MSDB 4A4DA 3LVRE 2QPAA 3PUXA 1ZYUA 2MMCA 1S2MA 3EZ9A 2G9NA 4A6PA 2Q6TA 1DELA 1T8TA 3Q3JB 4V0ME 4YMUA 1HQYE 4DWJA 2GJAA 1YZGA 2ANBA 1G1MA 2MMGA 3CPEA 2WMOB 4CEJA 2ECKA 621PA 2JLSA 3SYKA 3AKCA 5JLJA 1OLOA 2HF8A 3CBQA 2IHYA 3BERA 4BLPA 1VHLA 4K46A 4L9SA 3B1WA 4PHGA 5F2EA 2XB2A 2GWHA 4ASUA 1NVWQ 2AXNA 3LRPA 3ICEA 4MGYR 1KI8A 2VP4A 4NPHA 2A3RA 1K6MA 2ATXA 3EIQA 3EXAA 4XTRA 1NIPA 3C41J 4HB4A 3I5XA 4RVCA 4D80A 3GLGB 2XX3A 4EFLA 1CLUA 2CEAA 2ZRDA 3BBPA 2XITA 2JLVA 5HTKA 1BH2A 1BIFA 2ZI4A 1ZU5A 4HDCA 4KFTA 4LJ5A 4CIDA 4TMVA 4IOLA 4G5RA 4Q18A 4C0AC 4PZLA 4Q4HA 5HKKD 3LW7A 4IHQA 4I99A 2GCOA 2D7CA 4DLUA 4YMWA 2QMOA 2ODWA 1XD2B 3VU9A 3WNCA 1HT2E 1G8FA 3KXLA 3G0HA 3ZZTA 1NLYA 5JSZB 3A4LA 2ZUDA 3NBXX 3HPRA 4NKRA 3BRWD 1COWA 3VMFA 2IYTA 1S8FA 4JJZA 5EUQB 3R8FA 4S35A 1T0HB 1ZCAA 1NJGA 2GZDA 4GP6A 4A2QA 4M53A 4DT1B 5HPYB 1ZD9A 4CEJB 5LB2A 3K8YA 2F3RA 2CCGA 1NN0A 2OO7A 2D2FA 3U61B 4EPTA 2RGEA 1RRFA 2VHQA 1QHIA 3TSOA 2WJYA 1KJZA 1UBFA 1W4BA 5L3SB 1NY6A 2QN6A 1FP6A 4KBGA 2IYSA 3QVUA 3NBYC 1XPUA 4OI2A 2ZRCA 3NWJA 3T1VA 4B75A 3B5JA 3EIHA 1G8PA 3IUYA 1E99A 2ZJYA 1U2RA 2OCAA 5IK2A 1E2QA 1W2GA 4RZ2A 1F2UB 3T61A 4DT1A 1ONBA 4XIGS 3DDCA 2DYKA 1D8TA 1ZC3A 1CR0A 4DEXA 2J45A 4QHSA 3QIAA 3ZLJA 3BB3A 4Q9KA 1VCIA 1XWIA 2FV8A 3W3AA 4KYUA 1G5TA 1IHUA 2ZR0A 3AVPA 4QBHA 2KB0A 1JEDA 2V1XA 4LRWA 5DLQC 4R2IA 2BV3A 4DDTA 1YZLA 2NZJA 3HYTA 5FOVA 4OHXA 2F55A 4DLZA 4HB3A 3ADCA 2VTKA 1E98A 5CB8A 3EWAA 3L0PA 5EP1A 1YR7A 1E2KA 1X3SA 2X2FA 1FL9A 2RAPA 4YXWD 4Q4JA 2FSGA 4V0MA 3SU8A 2VP2A 1GOTA 4Q4AA 3KTAB 4UKDA 3SFZA 5D3MB 2GHIA 4ABYA 2WM9B 1EESA 2BCJQ 4BFUA 3LV8A 4PC6A 3FE2A 3WHLA 4W5JA 2OZEA 1ZP6A 2DWOA 1YR9A 3S1AA 4JKIA 2IS2A 3WHKA 4HB2A 1AK2A 1PUIA 1R0XA 1HEIA 2WPDD 2E87A 3HJNA 4GP7A 1NN5A 2ZJ8A 3K0AB 3AVXA 1KDTA 3K9LA 4DIEA 1KI3A 1ZNYA 2YWGA 3OE7A 3PCRB 2WAXA 4ZPXA
chains in the Genus database with same CATH superfamily
3I01A 2VRCD 1C3OB 4BE9A 5KOIA 5KKAA 4C3VA 5JTTA 3FPHA 1PFVA 3GRAA 2NU7B 2W2KA 1Z74A 2FSVA 2PFGA 4J1TC 1TQHA 2YWHA 2E7ZA 3BUSA 4G0XA 1HTWA 3VJKA 3GMIA 3RIMA 3V4PB 3UK6A 3OP4A 1SHLA 1AQJA 4P4NA 5CM8B 1S6JA 4L9MA 2D1SA 5DKNA 1QIFA 1UL1X 1XMQB 2D4AA 3MK31 1QIMA 3FI0A 3IMCA 3FKJA 1JQ3A 4BPBA 3R5FA 2ORWA 3N2NA 3PCTA 4LC1A 4RF3A 4WXEA 2NU8B 4LDQA 3TLMA 1OOHA 4PNEA 1S5PA 4YASA 3AVUA 3V6LA 4D8YA 5IZCA 1VPDA 3ESQA 1CX9B 4LNUA 3UKOA 3JCZA 3MWDA 2PRUA 3NIFB 3ZDEA 2CEKA 3EA4A 4PPNA 1PJQA 3PWTA 1YRUB 4NARA 1DEXA 3ZY4A 4QQKA 4CKEA 2C1XA 3NJ8A 1KSHA 2FX3A 7MDHA 5CA1A 5D3OA 3SG6A 4PZCA 1O95A 1XX6A 2FMKA 1GQFA 1JQKA 2GNAA 3LLSA 4TL6A 3ZI7A 4I5JA 4ENTA 4NYMR 4DDVA 2G67A 1FP4A 3BWXA 3GPBA 4BNDA 2R65A 1C3JA 1RAEA 1A9YA 3L2OB 4PZAA 1QS7A 5CSFA 1LBHA 5TVGA 1JJIA 1MHPA 1UBUS 2PBZA 4OGLA 4YROA 4DV0B 1CQJB 2XODA 3TH5A 5DASA 1IXRC 2JLWA 1WMFA 3IJRA 1SBQA 3LBFA 4X97A 1XEFA 1VE9A 4C4OA 1ID1A 3KSBC 4BJ1A 2C2MA 4AZVA 4WJLA 2Q6OA 5HR5A 3PXAA 4BLSA 2GBGA 1YU9A 4HQKA 3HKDB 4Q3LA 1O96A 1AGPA 3CU5A 2AJDA 3H4MA 2YZGA 1I4LD 3PFCA 4H3HB 1A75A 4PCLA 1SY7A 3OA0A 4ZOEA 4I6JA 2EKBA 2CUKA 3CURA 2EYUA 4WK4B 3WWEA 1G21B 1LLFA 1J09A 4ZAXA 2OLJA 4QLOA 1OD6A 4NXMB 3FZYA 2GDZA 3SDBA 2OCKA 1DCKA 1ZL2A 1GFWA 2FMHA 2NO0A 2X6QA 4ISCA 4J2HA 2QKYA 4RF5A 1TJYA 4BZWA 3EKHA 4CT5A 3WVNA 5I7EA 1E6MA 3LRTA 4WKBA 3UY4A 1R16A 4NZZA 2VF7A 4L7VA 3GG9A 1MIOB 1QTIA 1IVYA 1ZJWA 3HLYA 1OZOA 1FYVA 3FZGA 2YJ6A 1DKOA 2QK4A 1D5CA 1FRZA 3FPCA 3PUKA 3LDGA 4NOJA 3GAZA 1Z7BA 1VIYA 2A0YA 4JP1A 2FUG6 2MLEC 1DMRA 2FZWA 1SIBE 4Q04A 2G8NA 2CLEB 2QTBA 2XMDA 3JRXA 4GW3A 5KNBA 1YONA 3VA7A 2GJSA 2W2VA 3OWOA 5ES4B 3SIAA 1KERA 4AZ0A 1QDLB 1IZ9A 2VH5R 1ZK4A 2JZIA 2HCJB 4F2WA 4RVGA 5F76A 1EFVA 4NEQA 1WAMA 3MNFA 2QN8A 1TF7A 4XYGA 2PX4A 5A05A 4RTSA 2MSNA 1VECA 3AG5A 1PL8A 4GRIA 2YICA 4R8RA 5EHGA 1B76A 3KZ1E 4RA9A 2ZJ6A 4WNYA 2ET6A 3H2BA 1RVV1 1NVEA 5AH0A 4F4UA 1VSVA 4DSAA 2O3UA 4YONB 3PHCA 3VYSB 3WLSA 3E27A 3SK0A 1A8HA 3QXJA 1E79D 2Y68A 5FDFA 4YRIA 4YRSA 4NULA 4MDHA 3PD0A 4G9GA 4KYIB 4HX2A 1M1XB 3FJYA 3HMKA 3EIUA 2O2YA 5FBQB 2C3PA 4A8PA 3LFHA 5JCZA 1BHQ1 2ORVA 1LFDB 2BKVA 4UU7A 2Y0EA 4ZICA 4QU8A 1F48A 2R60A 3CZPA 2PGDA 2V3VA 4GPIB 5A4IS 1QHEA 2M1UA 5DYNA 2QUHA 1LLDA 2RHDA 2SNIE 3OT5A 4RDHA 4ESEA 3KQWA 2XVXA 3RLZA 1AHRA 3IHWA 3IR7A 1PD0A 5JYBA 4QHTA 5HQJA 3SCZA 4G8CA 5F3RA 1CDNA 2CWDA 3B1YA 3OM1A 3QV1A 3QKIA 4Q3KA 4WMLA 1BCSA 5DCUA 3WE7A 4AJIA 2G80A 4CLOB 2PUBA 3D75A 2XJ9A 5BQPA 1V43A 1VYVA 4M0EA 4YUZA 2GZAA 4LX0A 5CNMA 3FDJA 4Q9NA 4G0UA 2H2KA 3QKUA 2GCEA 4OMFG 2W0MA 3O8RA 5D6OA 2HCBA 3AKAA 5EWLB 3AW8A 3MTBA 3BBLA 3OLYA 1KEPA 4JLOA 2H1WA 2R00C 2QAJA 4JQSA 5CLGA 3WDSA 3KWJA 4UM9D 1ORDA 2YC4C 4D4JA 3ABIA 2BRUC 4YT2A 2X2OA 2XOKD 2ASVA 3BH7A 4JSTA 2JHCA 2W2MA 2B4RO 4XB2A 5K0EA 1T5LA 2GVDC 3DVSX 2VPPA 4JLNA 4ER0A 1H05A 1TOPA 4DSNA 4M1TA 4JV5B 5AI4A 1PNTA 2JZCA 1U02A 5KINB 4CFQA 4H1HA 1OFHA 2UUOA 1I1NA 3AEKA 4NYIR 4YP9A 4BNLA 1E2BA 3EARA 5EIOA 5G3ZA 4I5NB 4PZYA 1HR0B 3SNKA 2DUMA 3DD4A 3JWJA 1E7QA 1GTMA 2YWEA 3EHDA 1UANA 1DX9A 2CXNA 1CDZA 3IE0A 3S44A 3K4PA 4CFZA 3O8QA 4AP5A 1ZHFA 4K9KA 1GILA 2BNXA 1X1QA 3WX0A 1XZMA 1KXJA 4NCHA 2PKWA 1S3FA 3VAZA 3AEXA 1ZVQA 1F2DA 1FDIA 3BHJA 4BVKA 1F06A 3D6AA 3O8NA 4OSPA 4QEZA 5GONA 5HKBA 2IC5A 2WPDA 3HL4A 3A4TA 2Y3IA 3A6HA 4WTOA 3HRHA 1X19A 1NY5A 4NIMA 4AD8A 3C85A 5EJEA 2H4WA 4PTYA 4LMRA 3BFAA 2X4LA 5AJWA 3RG2A 2QSZA 4J91A 5ADUS 1BDIA 2PR7A 1KEEB 2EC5A 2YW2A 5L7YA 4DR2B 5ER4X 3Q7RA 1LU9A 1B7TZ 1T5DX 1CP3A 1MDBA 2E37A 4GLFA 3CKMA 4E32A 3KBBA 2EWMA 5FEMA 4IZOA 2GPWA 5H59A 1S9HA 3S27A 2HJVA 1F6BA 4INJA 4CFSA 5HX7A 2P4QA 4MLPA 3QTTA 4WHMA 1GL3A 4XUEA 1DNPA 1KYXA 1NIWA 1ENPA 3UXHA 3B2NA 4BMXA 1H93A 3QVTA 2J6BA 2XV1A 3AR4A 3PGVA 2Z3ZA 3FNFA 3GU3A 3PYLA 4I9GA 5B1EA 3IDAA 4YRRA 3RJ5A 5L3SA 4HFRA 4LA4A 1JDUA 1HKHA 2GBFA 2WJAA 3MILA 1X13A 5B37A 3S68A 3HJFA 1EMDA 4U2BA 5C46F 5BNZA 1T1GA 5EYPB 1DP4A 2ROQA 3GFBA 3PHBE 1EWKA 1MXHA 2VJYA 4FQ8A 4HATA 3NIDB 4MKFA 4YLEA 2EDAA 4B3FX 5IS2A 1N2CE 2FAXA 3EJWA 3P4YA 5CBPA 2I2CA 5I3CA 1CUDA 3G2LA 2I2RE 1N4DA 1EJ3A 4JEUA 3O5AA 2PMKA 4YIHA 5CYFA 2XVMA 3ROQA 4EFDA 2HK9A 1KPIA 5C37A 1TO6A 2ZWAA 1BX3A 3KQYA 4IIGA 4M8NE 4NQZA 1ITZA 4BLQA 1KK3A 2X0NA 2AMYA 3L02A 3WLFA 4CCWA 2QRKA 3EMVA 1C3ZA 1X39A 2AH5A 2EJVA 3A10A 4UJ3A 1DS6A 3E3MA 4DCOA 1ZD4A 3I30X 3PA6A 1ZSYA 3PATA 5ALZA 3W7VA 2MSCB 2AYYA 2NPIA 1V1MB 4UM8B 3U9TA 2OV3A 4IVQA 5DTRA 3AVYA 1W34A 1T2NA 1SXJD 3KTAA 4PAWA 4AI6A 1PV1A 1UKYA 2WHYA 2Q4DA 2JFWA 1BG6A 1ZGCA 4N8EA 4RHTA 2AX4A 2WG0A 5A3SA 4X1YB 4GPD1 1RHMA 4FHGA 3UB2A 4QSHA 3GUZA 1PFWA 3VYWA 3ORQA 2FPPB 4ZQEA 3A58B 3TPFA 1YR3A 2MT9A 4AXXA 5IN5A 4B8ZA 3IPCA 1GP2A 3R7WA 4E4RA 1SVKA 3PA8A 3GP5A 1KEZA 1PZNA 1Z28A 3TJZA 4FEYA 3BRCA 4IXWA 3LHDA 1CETA 5KOHA 1KDOA 1XZFA 2LCPA 1EZZA 1D9ZA 3S2ZA 2XA1A 3EBLA 3WWPA 4C4AA 4YAGA 5IEJA 4B4WA 2WTNA 2KGRA 3NIBA 1Z8HA 3MJRA 2W4IA 4WH0A 1RAAA 3CWGA 3DL7A 5DLYA 4JZKA 2QD4A 4U0KA 5DJ5A 1UQRA 1E7MA 4IILA 4NBTA 3O7WA 2XOKA 4FFDA 1ODSA 3F73A 1QLKA 1VB3A 2AMLA 1PJ2A 2ZZKA 3ICPA 4OH7A 1DEOA 3KZKA 1AKWA 3AJRA 3RYTC 1V48A 3E6AA 2C1EA 3RC2A 1SUPA 3CH4B 3DE4X 3HZZA 5TQVA 3UBTA 4KHPB 1YHZA 1CZUA 3QXCA 4FR2A 2Y9MB 2WSSA 2SKCA 3IJ5A 2GPSA 3FGOA 1TA9A 2RARA 5AEQA 4MEJA 5FNVF 3F67A 3MS7A 3TK1A 4MWSA 5K6RA 1GM5A 2C5FA 4WEOA 1GQMA 3G0OA 4OCZA 3C3DA 3W9YA 4YT4A 1S96A 2A9KA 1QJ4A 3REGA 4TUYA 1DCFA 3R9IA 3ONDA 5K03A 7ABPA 4PXYA 3UJDA 4LYYA 2HRBA 4X8LA 5C32A 4QQ8A 4RHFA 3TTVA 1UFVA 5LA6A 1T8RA 3IEPA 1W76A 2DHCA 1OC2A 2O7SA 1QFYA 4RK4A 2LUOA 3M6AA 4IIBA 5BO5A 1Z2AA 2SKEA 2DSTA 5GV8A 4X7MA 3ULKA 1SD5A 2J7PA 3T3MB 1KJYA 1Z4IA 1GPBA 2ZB7A 2AN9A 3AHJA 3P0HA 3HHPA 3EB9A 3T35A 1PZFA 1EFAA 5U1PA 5EZYF 2WT4A 2RG7A 1W7IB 4A1FA 3PLAE 1ULTA 2GSDA 4IXNA 3U4CA 3LUBA 5FI6A 2QTHA 3CMCO 5FXMA 4F2DA 1YR1A 3G49A 3NHYA 5HZGA 4G86A 5LOVA 4N03A 4QM6A 1PUJA 1E0AA 2JFGA 1XNRB 4DLBA 1UDRA 3R75A 3GRKA 4BVBA 2A0UA 4DNOA 4EY4A 3CR7A 1MT3A 2WU8A 1K66A 5KYNA 2ZTLA 2QLJA 1U2DA 3K72B 2BHSA 3RRBA 3SOPA 2DFVA 5BUZA 3KQOA 1ML4A 4OYLA 5JZVA 2QM7A 4MVJA 5GJCA 1JBAA 4L8FA 3ZHRA 5HUQA 1I7DA 2FMTA 2JH9A 5B58T 3MT7A 2C2WA 2MHCA 1WCIA 2Q49A 5J4LA 4CQNA 2UZ3A 4GX2A 1SELA 2H92A 4KQJA 4XIJA 3ZXYA 2C9CA 2VJMB 1KC1A 4QGAA 5LU8A 1ZONA 5JPIA 3RSSA 1WXFA 3DOCA 4FHZA 2RH5A 3QYFA 1UM9B 3CGWA 1AO0A 1ZRMA 3JARB 1HOXA 2JNWA 4L5CA 3FWKA 4JYCA 3AF1A 3FN4A 4DUGA 2CMKA 5GVSA 2A1TS 4F3NA 4FGUA 4KQEA 3K1ZA 4AZSA 3UNWA 3ZZMA 1R2QA 1W5FA 2GJ4A 2I2WA 2Z6VA 5BW5A 5F98A 1M45A 1UIRA 2B7CA 3AVQA 1XLTA 1YK1A 2RGBA 4XUCA 4ZAYA 1KOGA 1YD7A 2CJYA 1KEWA 4FT2A 4H31A 4EYKA 5FTLA 3F6BX 1X1EA 3F6CA 5CP8A 2VTVA 2BMDA 2F17A 4DG9A 1K5GA 2WTAA 3SJZA 4CL8A 3OFNA 2XUHA 4IH4A 3K1TA 1P1FA 1NW7A 4C7JA 2EFCB 2IQIA 5KNDH 5AK5A 4F1JA 1V5GA 5H82A 3NP9A 5JBQA 2KI4B 4BVAA 2YRFA 2JNFA 4J0DA 4AO6A 4XEHA 2RIPA 4J1NA 3CHYA 3O83A 4WINA 1LPMA 2POQX 4UTVA 4ZCMA 3WLKX 1KIAA 4HVLA 2NO1A 3R24A 1L7OA 4UM7A 4XQ9A 4N0QA 4TM7A 5CH5A 2C9OA 3A7EA 4Q7QA 3OMLA 5EHXA 3RBZA 2NV6A 2F3QA 5FWXB 5BNTA 4D7AA 4LTNA 1T6ZA 4V39A 5AJHA 2Q45A 5LQKA 3UJPA 5K0TA 3F46A 5E9JA 2FOTA 4ENSA 5F6TA 1MX3A 5DBIA 3HPQA 4QREA 3A36A 4LZWA 4GBED 3ZVNA 1YWGO 5LN1A 1PZHA 2UVDA 4RV9A 2AAOA 1NBHA 2R8BA 3D6TB 3FCYA 3N0XA 4Z51A 2IHKA 1YQ9A 2QJTA 4Q3BA 3ZLUA 3D3WA 1Y9JA 4J4TA 4IO0A 3JYNA 5I8ZA 2CD9A 1KSJA 3LVBA 3N2LA 1FOEB 2GK7A 1LJ8A 5KOYA 5A3JA 3HKDA 1OFGA 1VL0A 3X2SA 1PSRA 4I4TB 1YKGA 4QTXA 2XXBA 2ZJAA 4ZRNA 3TRIA 3UCEA 3EVVA 1UP6A 2FPRA 3EEYA 1C50A 1MA0A 2FZGA 2NYAA 2WDPA 3R0JA 4I36A 4M49A 4WKPA 4JI3B 4WNCA 3BT7A 5TV2A 2FEWB 5ALEA 5CLHA 3MC1A 4DIMA 5E6UB 1PULA 2JHPA 1WUJS 3PFHA 1VJGA 4U7PB 2Q6VA 1N3IA 2G9UA 2QV7A 1DXOA 2Y1GA 3C3CA 3CH7A 2AX3A 2LC5A 2VJNA 1EDEA 3OOWA 4FU0A 2Q3FA 2VT6A 4HNSA 4K88A 1XQYA 4F85A 2Z5FA 4AFNA 1EWQA 2B8EA 3M33A 3AVWA 1UT6A 4PBTA 1QXSA 1PR0A 1UPBA 2LXNA 4G67A 4X90A 5AKGA 1E9CA 4QG3A 4JJFA 4B3DA 2BJHA 2BGWA 1E3MA 2CNWD 4XYNA 2OHGA 3AJAA 3OEHA 4AKEA 1RWVA 3DXFA 1M2WA 1O03A 1WNTA 2EGDA 2AOUA 2BAGA 3DQZA 4IGAA 1QZ3A 3REQA 3PHLA 3WQSB 4JR1A 3A1TA 1JA9A 3VH4A 2VSNA 1S6IA 3QA9A 3VHXB 5HHTA 4OHFA 5TXGA 3DOHA 1X0XA 3JZAA 4TNCA 3OBIA 4AWBA 4NAHA 2R5WA 1OGYA 4PPGA 4BP3A 5CFLA 5BW4A 3OIUA 1Z16A 3ITNA 2XLCA 2CDCA 2HBQA 2P6UA 2IE0A 3ZTTA 1T2EA 4MVJG 5FPSA 4QPJC 1DT3A 3JQ7B 3C0KA 2HA7A 1A5TA 3TX6A 2FLVA 1Y5RA 3TECE 3OQJA 2KMLA 1UADA 3DH0A 4ZVNA 1A8PA 1P1CA 3D2BA 1CDPA 3CZMA 3IPXA 1C7IA 1NBMA 2H48A 4BZQA 1Q11A 3NC0C 3T41A 3OFKA 4OBWA 1A29A 1XB2A 3PYXA 4HRHA 1KP9A 3HN6A 4US0R 1MFPA 2I6XA 1ELOA 5CDFA 4BVLA 1RP1A 3PEFA 1CQIA 2IXEA 4L6IA 4R2HA 3ZHCA 2J5RA 1F54A 3FYUC 3NJRA 2O2ZA 1K2HA 4G09A 1OY1A 3TTSA 3X0DA 1BD3A 2QB5A 5A7GA 2ZNDA 1IWQA 4HAZA 4B84A 1GQYA 2JT3A 3HUTA 3Q9LA 1WW2A 1EH5A 2Q3LA 2H1OA 1OYWA 3T1QA 5JCOC 1OFUA 5JO9A 2PZAA 3U3KA 4B4DA 1BE6A 1W9HA 2GARA 3BJHA 4FMDF 1XTJA 1A7UA 2W4QA 2Z56A 1IN5A 5AFPA 3E8SA 5I01A 5LL6P 4TTRA 2XCRB 1BN6A 2X3FA 1MABA 4E1VA 1GQOA 2MHHA 2NSDA 3SS4A 1NC1A 4B7UA 1R5BA 1S01A 2WFLA 4R40A 4EQ6A 1ZUIA 2W2TA 2DY1A 4WK6A 1AHNA 3IIKA 1YRYE 3I8SA 3D0OA 3MQ4A 4PANA 5D3MA 3UMGA 3OCXA 3A9RA 2DG2A 4YDHB 4QD3A 1A88A 2YV3A 2EGUA 1EGVB 3P2YA 2C8VA 4LYJA 1E9BA 2YWJA 3RC8A 1VDZA 3A32A 3QWHA 5EJMA 1IWPB 2X8AA 4G25A 3RG8A 3A9CA 1SR8A 1VB5A 3OCZA 3GQBB 5EVJA 1Q16A 2OEPA 5REQB 4BKUA 4BX3A 3U4QA 4BY9E 2ACKA 5LKRA 1HSOA 2YHAA 2JJ2D 3PSRA 4EW6A 2H18A 2I7VA 2D0OB 4LG1A 1WPGA 3T9DA 1PWZA 1H2YA 5LBTA 1U0BB 3FYUB 2O5GA 3DM5A 2J3KA 2KOTA 1ZJ6A 5CAEB 1U5AA 3IESA 1NF3A 3BORA 4IIXA 2AKYA 4HRVA 2DJIA 2ZXEA 5FLYA 3ZYZA 1XC7A 3HG7A 5CEJA 3TNLA 3PNMA 2C84A 1TZCA 1Y8RA 3QEMB 4H2DA 3IPYA 3WSWA 1XVVA 1BH6A 2BMFA 2B3TA 1XPOA 3G0BA 3R7LA 1FMCA 1E58A 2ZIAA 4FFRA 1G6KA 1ULUA 4OXNA 3ZJ4A 1XU7A 1QV9A 1TRKA 1XD9A 1QNLA 3GJQA 2JXCA 3L7KA 4XVUA 4WECA 2LLTA 5KYWA 1F5NA 1VIDA 3DZFA 1JNXX 2GK6A 4L4XA 4N6OA 1L0BA 2J46A 2X1LA 3DHNA 5CGQB 2VP5A 1JAXA 2J7PD 2VSOA 3GPCA 3FVWA 3NJ4A 4K6OA 2V7EA 3WV5A 2FNAA 1BQ4A 1ZNWA 3ASYA 3KLBA 4KLZA 4OK3A 4YCBA 4KU4A 1TGVA 3LNTA 4MB2A 2D7JA 2ZU6A 3Q6NA 1DMOA 3KXDA 5AW2A 4IM7A 1LK0A 1M6YA 1TK3A 2BI8A 2FH5B 3B52X 4IIJB 4QC2A 3AR5A 4LC9A 1PK7A 3C45A 3KO0A 2QAIA 4XJSA 2OXTA 1G21E 3EQ2A 5K0GA 3CV3A 3SF8A 1DFIA 1QFZA 2G83A 3EG5A 4X85A 1C9KA 1E1RA 3RIHA 4GOND 3AV3A 3QVJA 1Z6GA 1MOZA 2CMGA 4NCNA 2IOFK 2IYRA 5NLLA 5CRIA 3QF4B 4N0EA 2QPOA 5ER9A 3PRKE 1DBIA 4DC1A 1DQSA 1QVIY 1XWWA 3UQYS 1SVWA 1W48A 3DYIA 2CUZA 4LJ6A 2BR3A 3JR3A 1REQA 2G04A 2IZ5A 2CVFA 2ZATA 3GRVA 4ZQHA 3ZDYB 1TF2A 2BBOA 4HDKB 4CCSA 5AVQA 1QPBA 3AP3A 1EQAA 1DQRA 2XNDA 3IH5A 4FR0A 2RH9B 2NVOA 2R2IA 3GFVA 5D7BA 5CA1F 2YYAA 3ZDFA 1U3DA 3A6JA 2WHEA 4GL4A 4YJ2F 3ZI4A 2NLOA 5KNBH 4YRZA 1LVUA 3QG1A 1IN1A 2X2EA 4QVIA 1Z36A 4FQ5A 4QXPA 2M29A 1L6RA 1ZIPA 3UKDA 4B32A 4L4UA 4RYDA 3X2EA 4FZRA 1JWLA 4WXYB 3PR2B 1BQEA 1I4DD 1PEDA 1FMLA 3NWEA 1DJQA 4ZVKA 2ZS8A 4MKHA 1RPNA 4HYYA 4Q3CA 3AR2A 2YZ7A 5F9FA 3IKVA 2Q91A 5E4YA 5K51A 3E9CA 2H2IA 4PLGA 3S7TA 4DCTA 3HXLA 3ZEIA 1UDXA 3T5BA 1SM4A 4U39A 1H8BA 2ZB2A 4QT0A 4XR4A 1MAHA 3HVKA 3UUWA 5JD4A 3BF8A 2FRDC 1VMAA 1ILEA 1RE0A 3LCMA 3SJCA 1F60A 2RJ3A 4TMYA 3BB1A 1VKZA 2ODNA 4A8JA 3O1HB 3HUUA 3VKFA 2G25A 3OF2A 1LRKA 3SR0A 4ZOAA 4ZEXA 3IP7A 1ZH2A 4FQ7A 4RVSA 3PXXA 4ESVA 3AOEA 3UPTA 4X00A 3C1UA 4GKBA 1SVSA 4MUHA 4WERA 1EGHA 4ITVA 4QGBA 4RPLA 1ISJA 1SL9A 1D2CA 1OOJA 2LIPA 4FE7A 1GL6A 3DDOA 2HNBA 3C3YA 1X87A 2G8LA 3ROZA 4IIHA 3ZWDA 4E88A 3ASUA 1M2GA 3G5UA 1QBGA 3HBMA 4YPFA 1DC4A 1YK0A 1R0CA 3UFBA 4Y8VA 1NULA 1NT4A 3RVSA 5E1DA 5TARA 4MR7B 2B8WA 1PYDA 1NMZA 2JJYA 3LSYA 3OOEA 4PRZA 1LY1A 4N39A 4GSYA 1DX4A 4M1QA 4PC1A 3SP1A 1KVUA 4HAOA 3K6JA 1W36C 3SIWA 3A25A 4ZI7F 1JLMA 3TZEA 4EPVA 3GPLA 3DAHA 4OBEA 3UM9A 1NOKA 1TYCA 1VG0B 2WKPA 2YWXA 3COSA 2GAIA 3GLQA 3O93A 4G0QA 4CMCA 2BGLA 4H17A 3F7TA 4Q5IA 4NESA 4EO7A 1KFUL 1TK2A 4TKUA 2ZI9A 2JL1A 1QG6A 3C2QA 3WJ2A 3V4ZA 1RBMA 5C5DA 3ICWA 3PFFA 3JQFC 4TMWA 3R23A 2I94A 3OT1B 3H2JA 4IWNA 3FNRA 4OKSA 2AGVA 3GLKA 3SKXA 5A0FA 2ZJ2A 5HTOA 2VAWA 3FDZA 3KQUA 1OLSB 2DERA 4R1QA 3EZ7A 2W6NA 4NRDA 2P4EA 2VWGA 3ZYCA 3GLGA 1J90A 4EWLA 3BGOS 1EA5A 1O08A 1QORA 3GUHA 4QHYA 2FP3A 3T7CA 3I09A 4RE5A 1W47A 4UZEA 4PE1A 2ETXA 5T8KA 4AF8A 3OIFA 5JDCC 3UPUA 1NVFA 3CX3A 4V0NA 3WHUB 1FFYA 2DFTA 2F6RA 5ALLA 4ARAA 5ALFA 3WR5A 1XDUA 2VATA 1GUFA 3ZCXA 4KVFA 1TMGE 1Y3CE 2WIAA 1NI3A 2G9QA 3ENQA 5FOSA 2OPOA 1P6UA 1T26A 4O4LB 2BZSA 3KB2A 4YGAA 1K3TA 1TTTA 2FF7A 2JIOA 1P0PA 2HJWA 2V7WA 5I7RA 1K08A 3TNJA 5KOJA 5BNIA 4YCNA 2BF7A 4MV9A 1H2HA 3FBWA 3UJ9A 1LVHA 1Y4DE 1S8NA 4G1FA 2C5EA 4NOLA 4P7FA 3AEKB 4IEEA 5EYPA 4BLTA 4ZYWA 4DAEA 1L7QA 4BGDA 2GN4A 3AJ8A 1EE9A 3FOWA 5DGHA 2QZSA 2NAPA 5CTJA 5DKFA 5KQMA 2XMSA 1SN7A 3HR8A 1IIRA 1Z0IA 2NUBA 3KX2A 5B1IA 3ZVMA 4Z8YA 2YXLA 1U2GA 3KIPA 4R16A 5ALYA 5TMDA 3L92A 3L6CA 3FPEA 1ZN2A 1XZBA 4MUAA 4R2LA 1PO7A 2D1YA 4EATA 1DAKA 1J20A 2GXQA 4L75A 2Z57A 4ZOQI 4UZSA 3VJLA 5HXAA 1IG5A 1NJ8A 1TI7A 1T8YA 2ENWA 4CKZA 2VP0A 5SYMA 3GF4A 3NFRA 1HDIA 2FX2A 3OZGA 3QPBA 3RUEA 4H6PA 3TLJA 4QUAA 3CVWA 4FX5A 3SM9A 4A0RA 5IABA 3OKCA 1UPUA 3F3SA 4IV0A 4YJDA 1HDXA 3V33A 4AAYA 1GA6A 2YUIA 3A6LA 4F9EA 3Q3IA 2HC9A 4ZMBA 4LRYA 4HNAB 3PE4A 1HF3A 3W8RA 5B3JC 1FP1D 2EBFX 4MIOA 4BO5A 5KSOA 1EIZA 2ZJFA 1GG8A 2OGWA 1YKFA 4L76A 2OXRA 1B7GO 5FB3A 3PTLA 3WNXB 4JP8A 3KF9A 3FLMA 1CUSA 1E59A 3KUKA 4M60A 5D00A 3WLOA 4ZHQB 1BKDR 1N9GA 2WMYA 2AQKA 1WNFA 4OHPA 4CV0A 5BV0A 1A7JA 2GTHA 3F96A 4MJXA 3U7QA 2HA3A 1IBRA 1TIPA 2ARKA 2ZIZA 3RHFA 3WB2A 3PVSA 1T1SA 5CU7A 2ES4A 3OJLA 3HZRA 4E46A 1RWYA 2PWAA 3IEUA 1L7MA 1L1FA 3NB0A 5AJXA 4RZQA 1VSQA 1AV7A 4RFVA 2OMEA 3L41A 5G0UA 5HW0A 3EXG2 5E0KB 2ZUFA 1OVMA 1UXHA 4V38A 3Q0EA 4QM7A 2WHQA 4K9OA 3UPDA 1UFQA 4KQHA 4BAZA 2UDPA 4ZT6A 5AW4A 5JH7B 1BFUA 2XLBA 1AB5A 2ONCA 2QTNA 2XRFA 3LG2A 4I66A 2ZJ5A 3GB9A 1NSFA 2JIRA 4J2TA 1QIKA 2RHRA 3GJ4A 1KVRA 1QZUA 4JI5B 1W5SA 2JJ1D 4ZVVA 1GRCA 1KMHA 3VNQA 4CFRA 3EXEB 5HYDA 2K61A 2QX8A 4YK7A 6REQA 4S05A 3VNUA 5BRNA 1D2AA 2Q9BA 4BYMA 6AT1A 1XQVA 1M8GA 2DKOA 4PPFA 5DYGA 3SS7X 1OQPA 3I34X 2M7NA 1ONNA 3IO5A 3PCXA 5K4HA 1EL4A 3KOXA 3K94A 4BFVA 1C3YA 5CEEA 1Y8QB 5HWSA 2V8OA 3HZOA 4J76A 5GZ3A 1XTSA 2AOUB 4TLLB 2KHZA 3FLEA 3NTOA 4HD8A 2IV2X 3PPIA 5B6JA 4WUTA 2GLXA 3I2IA 2HU5A 3IDOA 5BMVB 5DHPA 1GRNA 3ZJUA 3A1UA 3MMPA 3BB4A 3OLQA 4LYHA 1P5HA 1KO7A 1T5OA 2H0RA 1T0UA 1N57A 4P93A 3B1FA 3DVAB 4D26A 5F3WB 3Q3VA 3OM0A 3RIYA 1UWVA 4K28A 1I3OA 2VAMA 3CF0A 3GN2A 4UPDA 2I4LA 4MWBA 3E03A 1GKUB 1M10A 2P69A 3EPHA 4G56A 4UTZA 2ZRHA 3HDHA 2JFFA 1DAOA 4ZEWA 2WJ6A 4FZVA 3HWRA 5LOVB 4RTKA 1WDKA 2I2XB 3MGAA 4JJIA 1PV4A 2FSVC 2IP1A 1V0JA 3EE6A 2GA8A 1L7VC 3D0YB 1Z4OA 1LSOA 4GI1A 4PEVA 1JB1A 2BMWA 2IOYA 4LRQA 4D4HA 4QGSA 4PFSA 1J2JA 2I4IA 2QRJA 4QECA 2G4CA 2XJ4A 1P2FA 3A31A 1JWDA 4IVPA 4RH0A 4E7OA 3ABOB 3NAZA 5GQSA 3WIBA 1SBYA 1E61A 3CRQA 2F8SA 1SD2A 2JFVA 3SHOA 4PYQA 1A2QA 4DLSA 4W5RA 1Y1XA 1T9CA 2OGUA 2NZXA 8MHTA 3JQAA 4PRLA 3O6VA 1B4DA 5M29A 4FC7A 4N49A 4JLVA 3A9VA 2P40A 3JZMA 2RCYA 2A58A 2Q3MA 2HREA 3B3QA 1AT1A 4MITA 4DCMA 1ZW1A 4EG3A 5CBPB 1K4KA 4RQTA 2WG1A 4XX1A 1H8HA 2L19A 2HV8A 1Y89A 2QTWB 2K2QB 2W5UA 3H9GA 3MFQA 4PLCA 5FBKA 4E31A 1M39A 1Z0ZA 1JH8A 4H7FA 1YZKA 1N3LA 2HDHA 4IKPA 3K70B 1ZIXA 2ZE8A 3HHEA 5FOUA 2YJ5A 2O3QA 3ZWKA 2VWQA 3I1YA 1WKBA 5BMVF 4FWTA 2K6GA 1E6LA 3OI7A 3ZBTA 2WP0A 4B71A 2FSFA 5JPDA 2IHUA 3AFGA 1XAIA 3L8FA 4ED9A 2G08A 3I39X 4U7FA 2X9GA 2ZFDA 3OE7D 4N65A 1XK6A 1UODA 3WMFA 1GPAA 5FPKA 1ADBA 2JPOA 2YZMA 4C5CA 4KX5A 4EY5A 2HLHA 4IZHA 1RXWA 1F2UA 3Q4GA 2J48A 5A62A 1DIHA 1UC9A 3EZGA 1FSSA 1YVEI 2PU5A 4EABA 4ETIA 4EUHA 2VSXA 3P5SA 4F9TA 4LDZA 3DW3X 2HEIA 5ALPA 1UXGA 1H3EA 2R4TA 3W6PA 2CZCA 3T1TA 1F4VA 1KEKA 1XL1A 2CL0X 2AZTA 1CG6A 5KDDA 4XGKA 3G2HA 1L5FA 3R7BA 2HPZA 13PKA 1ISMA 1JSZA 3A4NA 2M49B 1VI6A 4PIPA 1G18A 3CVOA 3PFWO 1II8B 1EBFA 2YN2A 5EHIA 4BO3A 4C7OA 5FADA 3TRDA 3ZU5A 3KLPX 1NM5C 1FJ2A 2X5KO 3LC7O 5CMLA 7GPBA 3DZJA 2YFHA 1WMEA 3LY7A 5DTEA 1BRTA 1N0UA 3ORYA 5ECWA 5EZYB 1KDRA 1MJGA 2CNBA 4JGIA 4PS0A 3GPDG 5G0VA 1RZ3A 3D43A 2I5PO 3CLTC 1N2SA 1PR6A 3UNXA 3KKPA 1FBVA 5F2OA 4EDFA 1DQZA 3D0QA 4NU8X 3DTNA 2A5LA 3BIXA 4GEGA 5F35A 5FO1A 5I8WA 4TV9B 4GGFA 1L7XA 2EJBA 3EXHA 2V6FA 4R3WA 4AY2A 2C2HA 1NRJB 3HXQA 3OA2A 1UKZA 3IULA 1L7DA 1C0EA 2J0VA 4CIXA 2CE7A 1VL8A 3AK4A 1DC6A 4WXHA 5DT2A 3UW1A 2UZ1B 1KIMA 2XY4A 2XCUA 5GWXA 3PFGA 1YTLA 4LPKA 2O8BA 3DLCA 4Y9RA 3TE7A 3LAWA 3IDSA 5JS2A 1VE3A 2VJOA 4MAMA 2PEZA 2Q4EA 4MRRA 2FPLA 4IAOA 3PL5A 4XQ0A 1Q0SA 1N7HA 2ZB8A 4OLHA 1NN3A 3E3OA 3DFUA 3FBTA 3QU7A 1E3JA 721PA 4F3KA 4ERXA 2HJSA 5F5LA 4TVBA 1SL7A 2LMUA 3YASA 3ZHVA 1JHPA 4FNAA 4MRVA 3PBKA 4TMZA 4UMFA 3HYRA 5JS7A 4YUYA 2NO6A 1Y3HA 3BMXA 2ZBDA 1U5CA 4GI2A 4AG3A 3I52A 4BN4A 1FPMA 1I2CA 1XCLA 1XGKA 2ESRA 4IDHA 3CWZA 4JPZB 2BL4A 2B69A 4B43A 5BSHA 1QIGA 5HIKA 2P67A 4YIKA 3I5HB 1OLXA 3B89A 3ZZNA 3WGOA 5BSEA 4JC0A 4UPGA 3ROPA 2A35A 4KFUA 2XNDD 1GLNA 3GLFB 3AR6A 1A3CA 1XDDA 2HTFA 2YMPA 3H5AA 4O33A 4CQMD 1V95A 3JQCA 3QOXA 3RFVA 4ZT2A 4QBFA 1NVDA 1AHIA 3ROFA 3AVVA 1Y1PA 3ZIDA 1E2MA 2X13A 4OTZA 2O0HA 3U26A 3D6VA 2BCAA 3T0GA 4BV8A 3R4CA 4U9IS 5EWJB 2QF7A 2O54A 1IBSA 4HDSA 3TSZA 4AO8A 3NYIA 3QMEA 2GVNA 5CT9A 1ZC4A 3I4FA 4ZHSA 5LDHA 1RHKA 3GGOA 6GPBA 1CS4C 1Z5WA 3E70C 1CUHA 3PD7A 4H1VA 4AZ0B 4CUJA 4BMOB 5KTYA 5FLXA 3BXXA 3ECCA 2UUPA 4K9NA 2KFHA 4AURA 3QX9A 4UTOA 4LYDA 3E4DA 3IUQA 4O29A 4O3FA 4WXRA 3VTKA 5EKXA 1T1EA 2B99A 2HO4A 4KWCA 1NNEA 4TYWA 4DSTA 1BU3A 4KSCA 3KZMA 2JFPA 4H4EA 4K6FA 4LWZA 4XDYA 3FCEA 1YQUA 4G5GA 5E7JA 2V0CA 2FW7A 4U2CA 2QL9A 1ULHA 2I33A 2ZP1A 3CZQA 4PHHA 4I50B 1JJFA 3STWA 1UKVY 2N0SA 5L6MB 1C9DB 5ENZA 4HXEB 2VT2A 5JD5A 4NV1A 4B3JA 1PX2A 1J8QA 2XMPA 3EFEA 3U1VA 4AULA 4CLRB 1NFQA 3IXLA 3VM6A 3EGVA 2QBYB 1V16B 3W77A 1J97A 2KM1A 1ATZA 1H1LB 1RLJA 3C74A 3EUAA 3LU1A 4YTEA 1GD1O 4KOEC 2QGNA 4WKGA 3TOZA 4I4CA 4NNOA 4BRZA 4Q3NA 4Z54A 2VYCA 1BWQA 2JLQA 2XE7A 3T5GA 4G1CA 3H0CA 4NOKA 1KQGA 2YDYA 3E9RA 2BE6A 2PS9A 4H27A 3C4QA 5JVDB 2HK8A 1EG4A 3AUFA 3U16A 3HWSA 3EPRA</