1DEKA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
241
structure length
240
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
total genus 86
structure length 240
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1dekA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dekA01
1XXHA 2GXAA 3K9NA 2ZQ5A 4MRSA 2Q3HA 1UFQA 2A78A 3OFND 2EU8A 4ESHA 2BDTA 4L4UA 1SVWA 4KFRA 2BKEA 1RYFA 1CU1A 1KJZA 1ZIPA 3AP3A 1Z6TA 2B8WA 1A4RA 3NH6A 4PSAA 1RRCA 6Q21A 1D5CA 3Q9LA 4R2IA 4W7SA 2YWFA 3K70B 4D25A 2OHFA 5CB8A 3EW9A 3I5XA 3KQKA 5FOVA 4MDEA 1Q0UA 3BC1A 5CDFE 4FI3C 3T61A 1GDDA 1E6CA 3KKNA 3GLIA 1FTSA 2GXUA 5J4HA 1QZXA 1UAAA 2VH5R 4R7ZA 1II9A 4E22A 3A4LA 3B1ZA 2GZHA 1E1QD 1XNJA 1IY1A 2CDNA 2IT1A 1NP6A 3TAUA 4EPTA 4M1OA 4BFWA 4TLDA 3DZ8A 4QJ5A 3KUCA 3AF2A 2W0MA 1Q12A 4BLOA 1V43A 4BFZA 4A8JC 5DE3A 4XIGS 4DB2A 2J59A 2ASEA 4GMXA 4DJTA 2XXAB 2GILA 2OM2A 2HV8A 2WIAA 2J0SA 2ZSAA 2ZJOA 3ZZTA 2ZUBA 2OFWA 4JT4A 1IQPA 1E98A 1B0UA 1OHHD 1XPUA 1ZJ6A 5FUWA 5FPTA 2D7CA 3IIMA 3NBXX 5E7IA 3TVDA 4G3XA 1WXQA 4GNKA 2QZ4A 2VSFA 1D8TA 4X8LA 2DB3A 2GAAA 2HEIA 3UXMA 1KI8A 2WICA 4JSTA 2WWIA 5JRJA 2QG6A 1Z0FA 2F43A 1TAGA 2FMXA 4FMDF 4HSEA 1QVAA 3C16C 4H1UA 4MQBA 2ANBA 2VO1A 1H8EA 1I2MA 3FE2A 3G0HA 5FH9A 2B92A 5KNBA 3IHWA 1FZQA 2RGNC 1NBMA 4JYCA 1TUEA 1FFHA 4HB3A 1X8KA 4DLWA 4TYPA 3WBKA 4TSFA 4B3BA 1GNQA 1J8MF 1VIAA 2OCBA 1JPJA 2XJ4A 2GXSA 1LB1B 3Q7QA 2K5UA 4P4UA 2I3BA 2QT0A 1G16A 4US2R 3A8TA 3AF4A 3U7HB 2CBZA 2JLRA 2VSOA 2QENA 2A2ZA 1Z5ZA 1Q22A 4IFBA 4EPYA 5KSZA 3CF0A 1HURA 4Q9HA 1SVKA 5E4FA 2F43B 3LLMA 3TKLA 3A37A 2WAXA 3SYLA 4L5BA 4YDSA 4MH0R 1XJ0A 2DWQA 5DHFA 2QPOA 1G7TA 2GXQA 2JAQA 2IF0A 2ODBA 1WF3A 2VF7A 1E0SA 3BH7A 1MOZA 3MD0A 1NF3A 1KK1A 3M1IA 4P32A 4TYWA 3DOEA 3QNUA 2CJWA 5H1YA 3FFBA 4BZQA 2N46A 2ZJYA 1E79A 2ZSEA 1X6VA 2FFQA 3LBNA 2X2EA 4GSYA 621PA 2GEUA 4TL7A 5A4JA 3CKLA 1O3YA 2FDCA 3C5HA 2A3RA 3BERA 3PFIA 4ABYA 2OESA 1P6XA 2ORIA 3DKPA 2ZRDA 1S3GA 4PC2A 3MCAA 2G9NA 1L4YA 4PHFA 1KMHB 2R6AA 2FPKA 1E2IA 4M0LA 4Q19A 4P3YA 4U5XA 5FBLB 2XB2A 1KZGB 1P2UA 2DBYA 1ZC4A 4ZCIA 3IIKA 1N0WA 1NI3A 221PA 4KCGA 2HXSA 1OW3B 4ERNA 1UBFA 3PJRA 3U61B 4LY6A 2H7VA 4GOJA 5FBQB 2GCOB 5FL7D 1F3OA 3SU8A 3AUXA 2ZEJA 5CIWA 2D4HA 2OBLA 2ZJZA 4IFEA 3TAHA 3KJGA 1R0YA 2CJWB 4KYUA 3LW7A 4Z54A 2WBLC 2ZRGA 4Q1CA 3SI7A 4Q4AB 2VEDA 3DVLA 2QMUA 2IUTA 3AKCA 4QJ3A 3U7FB 1T5LA 1UBEA 4B35A 1G8PA 4V0NA 4HLDA 2BEJA 4C0SA 1R0XA 4TMZA 4EAQA 1YRBA 1KMHA 1S9DA 2R62A 2ZREA 4C9BA 1YZGA 3HU3A 2GEVA 4K8OA 5LB4A 1G19A 1G41A 1S1MA 3OE7D 2BIFA 4D80A 4A4DA 2QM7A 3FMPB 4F7WA 4P33A 3PIRA 4N0EA 1E2GA 1Q1EA 1II8A 4OHZA 3ZQJA 2W2VA 1EG7A 1N6OA 2VQSA 1IM2A 1F2UB 3EA0A 1YZTA 1VKJA 1NL3A 1UEJA 4QOSA 3VX4A 4U00A 3VTKA 2KI5A 1RIFA 5HZHA 2WOJA 3T06B 3AVUA 5CK4A 3FMOB 4DDUA 2IYUA 2UZ3A 2W83A 3GLHE 1Z0KA 4W5JA 4BEBA 2GJKA 1DARA 1G8FA 2FA9A 1L4UA 3OZXA 5JS7A 1GTVA 2ZJ2A 3IILA 1GNPA 2WWXA 4B2PA 1DVRA 3SYKA 4LSGA 4FD2A 2ZE8A 2N1BA 3BIFA 4KAXA 2HF9A 1E2NA 2P0EA 1OJLA 4Q48A 2OILA 3VAAA 2OEPA 4PZYA 1KI7A 1U8YA 3HYRA 4EPWA 2VF8A 5HKKD 1VIYA 2JLQA 2GBLC 4PC1A 4Q03A 3SFZA 1ZVQA 4B3FX 1G6OA 5KOYA 2WSSD 5TB5A 3QPWA 2YC2C 3GEIA 2BMEA 2NGRA 2VIIA 4Q47A 4KLZA 3TJZA 3TR5A 1JR6A 1SXJA 1NG9A 1ZYUA 2GDJA 1IN4A 2Q3FA 3SJCA 1XMSA 5AUNB 2OXRA 1KSGA 1TL7C 3C41J 3RAPR 4DDWA 4IKEA 2AHOA 1X1SA 3W9YA 1MV5A 4AKGA 2J0VA 1E2JA 2IW3A 2AWNA 4D82A 1JECA 3KXKA 5KSPA 2LKCA 3U2QA 2XITA 2F1JA 4B48A 1NY6A 2QAGB 5C46F 4IDQA 4L8GA 4BLQA 2B7CA 2EFCB 3L82B 2BCJQ 4MUBA 5FTMA 1L7VC 5FFMA 1ZAKA 2WKQA 1FL9A 1RE0A 4FMDB 1WA5A 4HDOB 3SE0A 5DH9A 3D8BA 1E9EA 4WXRA 3TE6A 3VKGA 3D3QA 1SXJB 2D2EA 1FOEB 4Q9JA 5AJYA 4DSTA 2ZI3A 2X19A 2X1VA 2IYQA 4JLAA 1NIJA 3NC1C 1PJRA 4NKRA 3A58B 3OIWA 4ZKDA 2ZYVX 5CITA 3BH0A 1OXXK 1GITA 2WJJA 2DFNA 3NC0C 1KDPA 2IUUA 4ITRC 3BXZA 1IXZA 2AKAB 2NG1A 1N6HA 4CVNA 2ZITA 2Y8EA 1WE2A 5JBQA 1M7BA 2NO6A 4HAXA 4NPHA 3GJ7A 2N42A 4ZIRA 3CX8A 4LV5B 4Q66C 3SJZA 3ZDQA 2GCPA 2GZAA 2JDIA 4M1TA 3UANA 4BLRA 1EX6A 1NJGA 1ZNWA 1A1VA 4Q9KA 3I1FA 2IYSA 1K5GA 3KB1A 3MSXA 4JVLA 4PXAA 4UXIA 5TDHA 5K8IA 4C2TA 3LXXA 3CWQA 1VG8A 5BQ5A 2C9YA 4E09A 5C1BA 1XPRA 1EFTA 4QHSA 1W46A 4O25A 5FL7A 3SR0A 2WWHA 3SEAA 3WHKA 5SZKB 5AK0A 5JZVA 2G88A 2QSZA 3AKDA 2RMKA 2CL7X 3U6BA 2C04A 1LS1A 4EFLA 4A6XA 2ORVA 4QL3A 4C0LA 2QMEA 4D0LB 3KQLA 2VL7A 4GT1A 3NKVA 3PUWA 1T3HA 2PCLA 2ZE5A 2PEZA 5CLQA 1E9SA 4UJ5A 1AZSC 3K0FB 4GZMA 5TV2A 3EX7C 2CE2X 3W8RA 4CF7A 3T34A 4IJMA 4KSCA 4MGKR 3VNUA 2DR3A 3CR7A 3X1YA 1U99A 3OE7A 5DGXA 3U44B 3ZZ0A 3T1TA 1GM5A 1ZW6A 3CH4B 3TH5A 2WIBA 1KJYA 4PPNA 3G5UA 2X2FA 4C0BA 2ZS8A 1G8HA 1LVGA 4GOXA 4QKQA 4HYYA 2ZYWX 3N2EA 4A1FA 4FXPA 1X8LA 3AVYA 2IYRA 3AKEA 4XWKA 4EPRA 4LWZA 2RGGA 3OAAA 5AWFC 1JXOA 1G7CA 1P2SA 1U8ZA 2VHUA 3TK1A 1GP2A 4XVRA 3ETLA 2CHGA 5JEEA 1RJ9B 5G3YA 2XOKD 2J7PA 1U0HC 3ZGXA 4RD3A 3RS0A 5FOTA 3U44A 5BW8A 1GZSA 1IXSB 5AUQA 4HUTA 2IX3A 1DBSA 1HTWA 3RWMB 3TRFA 4RD2A 2O8CB 3CO5A 3S1AA 2IS6A 2C78A 3BE4A 5CJPA 1P62B 5TMPA 1ZD8A 2F3RA 3CRRA 2R44A 1OE0A 2DY1A 4C0QC 1JAIA 1AIPA 3X2SA 2CNWA 2A30A 3VR6A 2PJRA 3O8CA 1NSTA 3DHWC 3Q8XB 3QXJA 1XD2A 4Q4LA 3ZIAA 2QORA 4DEXA 4LJ8A 5JMTA 3EA5A 3SN6A 1ZM7A 2WOOA 1KOFA 3AVWA 4RFSA 3FHTA 4PX9A 3C4JA 1JALA 2R6GA 2JJ1D 5L3RA 3QEJA 3OESA 1YRAA 1DS6A 2WM9B 2ZI4A 4ASUA 4DUGD 2GEDA 4II7A 3ZVNA 4K46A 1BOFA 1G3RA 4LHZA 2WZQA 2CHQA 4YDHB 1YZLA 3C8UA 3ZLJA 3QUSA 4Z8YA 3R8FA 1XMIA 4TZ0A 3CRQA 4S35A 4URUR 3GLFA 4HZUA 1X1RA 1N5KA 3IBGA 4IDPA 1YR6A 1W2GA 1DTSA 1O87A 2ZRLA 4LHWA 5DHAA 3LVQE 5DSZA 2DFKB 1UEIA 3OIVA 5JLJA 2GJSA 3PEVA 5EQTA 2QMHA 1G4UR 2FGJA 4M22A 1M2OB 3QOFA 3LXRA 2VP5A 1AM4D 3WRXC 3RHFA 5FUVA 2WKRA 5K8TA 4C3ZA 2Z6VA 1OXSC 3EPHA 1C4OA 4CT4B 4MKFA 1KI2A 4JLKA 1JAHA 3MWYW 4WZBE 5BN3A 2JIZD 3NTUA 4JKYA 2FWRA 2EFHB 3B60A 3C15C 3CM0A 3QKRB 3CNOA 2J7PD 4PHTA 4PO1A 3RS4A 1Q1ZA 3AUYA 3FKQA 1ZNYA 1PZNA 5J5CA 1E1RD 1Z07A 1R5BA 2YKGA 2ODEA 3PEUA 3N5CA 2H16A 2Q3MA 2ZJAA 5FUYA 1TQDA 4A15A 2NTYC 1XPOA 1FPMA 5KNDA 1XRJA 1OPXA 2C2HA 3BJIC 4B47A 1XJQA 1Q21A 4CEHA 1EWRA 1XB2A 2CXXA 5SZIA 4D4MA 2KE5A 1WRBA 1FW6A 1XD9A 4JLMA 4WXPA 2CCJA 2ZRMA 3KB2A 4OK5A 4O0MA 1Z8FA 3QKRA 5TXGA 2IYZA 3KFXA 4P4SB 3BD9A 3EZ2A 3QIAA 4PSKA 3RYTC 1HY3A 2CHVA 1IJEA 2RGEA 2IS4A 5JJIA 3U3JA 2R9VA 2JDID 4QGFA 3WHLA 3EZ6A 1P73A 1CJKC 4KVGA 4FCWA 4AD8A 1NKSA 3K0EA 5EE5B 3D7MA 3QPUA 1D9XA 2JATA 5IRCD 3I62A 1SXJC 5KPJA 2G3YA 2GA8A 1ZM9A 3A4MA 4P0TA 1DAKA 3PCRB 2HT6A 3NDBB 3GPLA 2IYVA 4HLUC 3FPAA 4B43A 3VU9A 2PBRA 2YV5A 3ADKA 2ONKA 4XOIA 4TYYA 3IKJA 3HPRA 4HEJA 1OFTA 2VP4A 4G5QA 1COWD 3BH6A 1SGWA 1NRJB 2WJGA 2CE7A 4JZKA 3VR4A 1Z6XA 2ZTSA 2XOKA 2QA5A 4JT2A 1OXTA 3KZ1E 4LJ9A 1OSNA 3U4QB 4JYBA 4M9XA 4B34A 3T5GA 1KTVA 1SVMA 1ZU4A 1G20E 2VHCA 1G8GA 4WZ6A 4ZDWA 1GILA 3L8ZA 5JCPA 4B32A 1PLLA 1KSFX 2PX0A 4PFSA 4XTRA 1WQ1R 2ZS7A 1T9HA 3WYGA 1VPLA 3OIYA 1DAEA 4NMMA 4WOPA 3VU9B 4F38A 4I1VA 4BWYA 3T15A 2W2TA 5F98A 1OKKD 2JLVA 2W6JD 2L0XA 4ZDJA 4FIDA 3I8SA 2PZEA 4LJAA 3GLFE 3SJAA 1VG0B 3TBKA 1J99A 4LJYA 4QHYA 2F3TA 1DOAA 4CEIB 1QHYA 4DCVA 3U3KA 3REFA 4US1R 1Z0IA 2G0NA 3LY5A 1ZCBA 2Q9BA 3HU2A 2BCGY 4Q9IA 4OK6A 4KV9A 3AKYA 4JLOA 4NDZA 3P20A 1N6IA 2O8DA 2QN6A 3EZ9A 2G1KA 1KY2A 2PZGA 3LX8A 4NCKA 2G77B 1AS3A 3LAWA 1AZTA 1RW4A 3CR8A 5JHHB 1Z2CA 5F9HA 3DPUA 3BWDD 5AUOB 4EKDA 3DDCA 3AM1A 4AY2A 4XJXA 2ZRNA 4ZCMA 1IHUA 1H8HA 4CEIA 2B7BA 1GFIA 2QEQA 1T8TA 2FOLA 3LLUA 1OYYA 1ELOA 1M34E 4Q5IA 1MRSA 5G53C 4NYJR 1TEXA 3LX5A 1ZNXA 3QY0A 4GDFA 1XEWY 4LX0A 1E2DA 1U0LA 4HAUA 4L15A 1OXVA 2H57A 1YQTA 5A5GA 3GLGB 1OF1A 3OFNA 4RZXA 2VBCA 2OFOA 2FEMA 4PANA 2V6IA 1YZKA 2DFLA 1JR3A 3TW8B 4G0NA 5J4VA 2GJ9A 4KXFB 4FWIB 3UKDA 3BFXA 3QBVA 2JIZA 1BS1A 3LO5A 4LCBA 4Q7LA 5HR5A 2WKPA 2CLCX 4C2UA 2J0QA 2FNAA 3MAAC 2G1JA 2VSXA 5BXQC 5BN4A 3L43A 1MABB 4C0HA 3U6KA 4OJQA 4DHEA 3NWJA 3B9QA 4OI0A 1HV8A 3UIEA 1A2BA 1E2LA 4DBLC 1ZUHA 3GFTA 4YMUA 4DCSA 3AVTA 3BOSA 3FVQA 5LD2B 3ZJYA 4ZV4A 1KI9A 2YWHA 3PXGA 4LGMA 3BK7A 1TF2A 3MJRA 4BEJA 3NH9A 2Q9AA 2UKDA 3A1VA 3SBDA 3EPKA 5HCIA 4F4CA 3I72A 5EXPA 3BB4A 3ZQ6A 5HE9A 2IF2A 2PLRA 4GFDA 5UKDA 4TL8A 3PV0A 1KGDA 3FFAA 1ANKA 1YR7A 1R4AA 1E32A 1D9ZA 4UNRA 2IWRA 4M53A 1VCNA 3UK6A 1CF4A 4JLDA 4DCTA 3U3RA 3AF0A 1G291 3ZIAD 3I3SR 3HWSA 2V3CC 4PQRA 4PHHA 1WB9A 1NY5A 3H84A 1RPZA 1XCMA 2XSZD 3ZVMA 4IHQA 2RGDA 4M9QA 4DSUA 5LPNA 2IXGA 2DCUA 2ZYTX 1NKTA 3VFDA 4GRAA 1E99A 4OI2A 3IBYA 2BJVA 3DM9B 1KHTA 1LF5A 4UXJA 2JLSA 4HDQB 5SZJA 4B6FA 1DAIA 4EIWA 2BOVA 4LK2A 4G5SA 4XVQA 3KXIA 2ZM5A 3LV8A 2IL1A 3K1JA 1YVDA 2BMFA 4TYNA 2AXPA 5J4KA 1XEWX 4Q4HB 1H8HD 3WNDA 2ZANA 2FEOA 2I4IA 3PR1A 1XCPA 4PR0A 2OBNA 1S9HA 5L3SB 2ZRKA 4HAZA 1H8ED 4Q4JA 4HATA 2QRZA 3EAQA 1RYHA 2FZ4A 5LDDC 2H17A 5J4LA 4DLYA 2F6RA 3LWNA 2IYTA 4BASA 2WSMA 3F0TA 3P4YA 3AGQA 2BVNA 3UPUA 2HYDA 1VHLA 1CIPA 1I4DD 2IK8A 1W4BA 3B8HA 3QXXA 4V0KA 1UKZA 4NONA 2ZRBA 3MGCA 2G0TA 4TYQA 1IAQA 1NNEA 1T3LA 3THYA 1MO6A 5L3QA 4DLZA 1OH6A 2JLWA 4IXMA 2G6BA 4ZKEA 1GRQA 4G5OA 4RZ3A 2HXYA 2R6FA 3BORA 5GVSA 3QF4A 2ODWA 2HUPA 4P31A 5HCNA 2WJHA 2W2XA 5KNCA 3H1TA 3R9WA 2D62A 3VNVA 1KO4A 2IEYA 1JNYA 5GADl 1AKEA 3MFYA 1D2EA 1M1YE 2JGNA 2QMOA 1F2TB 2CL0X 4QGGA 3OEEA 4HAVA 4LYJA 3Q72A 3THWA 5GJVC 4M8NE 1T8UA 4GI7A 1Z63A 3UMSA 1G1MA 1KAOA 1XX6A 2AFHE 3QKSB 4D26A 1N0VC 4MKGA 4NTZA 2OT3B 2REBA 2PLFA 3A1WA 5L3QB 4A0GA 4MKHA 2IXFA 5BYJA 2G83A 3DMNA 4IDHA 4BFVA 4BGDA 4RKEA 4QM7A 2WSSA 1PVOA 4J0QA 3U3MA 1S8FA 2F1RA 2Z83A 2QAGC 3QF4B 3VQTA 3TGPA 5ANRB 4FWTA 3HR8A 3ZS8A 4HB4A 1A5TA 2IXEA 1QG4A 1SVLA 2NO9A 4PPGA 4JL8A 4LHVA 1Z3IX 4LI0A 4XSHA 521PA 3OHMA 4WIAA 1Y63A 2KBFA 3ZZUA 1BMFD 2WWWA 3CB4A 5LB2A 1KO7A 1SXJE 3QENA 3SHFA 4BFTA 4BLSA 4JLPA 3PITA 3QKSA 2V54A 4WA7A 4A36A 1JB1A 3W8NA 1PLKA 1CKEA 1FUUA 3CLVA 4TQUS 1SULA 4NHOA 1ZMXA 3ZYCA 1AS2A 4KLNA 5CK5A 4DT1A 1N5JA 4N0DA 4WAUA 4G01B 4M1YA 1W49A 2MMGA 4B74A 2WHXA 4B6EA 4AYWA 1VECA 2RH5A 3B7GA 3B13B 1MO3A 1M7GA 3ECCA 5FPKA 3U5ZB 2KB0A 3QI2A 2JCSA 4OBEA 3EG5A 5E95A 1AGPA 5EE1A 4RCYA 4B71A 1SQ5A 5FOUA 2EFGA 1KZ7B 3KKOA 4TQ9A 4US0R 4FCTA 5JWOA 2IYYA 4ON9A 4L9WA 2XXAA 5C18A 3A1UA 1YHNA 2ZAOA 3K70C 1FUKA 2HF8A 1SZPA 1UADA 4PC6A 4Q7MB 3L0PA 4D4LA 4FMCB 3I92A 2RGBA 2YOGA 2R65A 2E87A 3RANA 2R2AA 2ZIAA 5BWMA 2WPDA 1MR3F 2BBWA 1SVOA 2WTUA 5KDDA 1SXJD 4LPSA 2E9SA 1Z6AA 4PTLA 4RD0A 1GKUB 2O0KA 3AB3A 4BZXA 2FZLA 4AKIA 2QNRA 2RCNA 2ZRJA 2CK3A 1YE8A 1QVRA 5JHGB 1E2QA 1C1YA 1UDWA 2WWYA 1EFCA 4JBWA 721PA 3RS3A 4N1AA 1R2QA 1KK3A 3KX2A 1ZC3A 3WXMA 2QU8A 5CYOA 1KO1A 2V1UA 3B2EA 4OQNA 2WJVA 1XP8A 1IOZA 1NLYA 4YLGA 4G5RA 4LYAA 1RRPA 5AJZA 3THXB 1S4QA 1UKYA 2VHQA 2A5FA 3IUYA 3DZDA 821PA 1PV4A 2CL6X 5LD2C 1BMFA 1VYVA 1Q57A 2P3SA 4B75A 4RCZA 4C0AC 4Q02A 1U81A 2WMOB 3GCGA 1G6HA 1HQYE 4C0JA 2W0SA 5IF9A 2GWHA 4ARZA 3KUDA 2X8AA 4IOMA 3E5HA 2AKYA 4LBZA 2XB4A 2RGAA 5GJWC 1P9RA 2KSQA 1CTQA 4YQFA 3QKUA 3HPQA 4PZLA 4ZDKA 3W3ZB 2VA8A 1E69A 4POAA 1U2RA 4Q1AA 2NZ8A 2PJZA 4D0GA 4UNQA 4JBXA 2H18A 3IPXA 5EZ6B 2NZJA 4R71A 2V7QA 2XNDA 3P27A 2AWOA 4DB4A 2C5LA 4L9SA 2IS2A 3MWJA 3CNLA 5D3MA 2NPFA 1QHSA 2AK3A 2GF9A 1EFUA 4X8MA 3BAFA 2Z4RA 3NHBA 1KSHA 1P61B 2DHRA 2HCJB 3NG1A 3ONWA 3KQNA 4OHYA 2QSYA 4ARZB 3OAAD 3D6TB 2QTVB 4MGZR 3I32A 1GNRA 2GCOA 4CW7A 3DM5A 4V0LA 3E2IA 1KIMA 5JS8A 3KL4A 2ZR7A 1NVWQ 4NYJQ 3ZS9A 3ZH9B 4Z1MA 4EFNA 2FSFA 3EIEA 4GZLA 4AYTA 5KPDA 2XZLA 2PZFA 4DLXA 3AF3A 2GNOA 2FPMA 1ONBA 2JJ1A 5D3MB 4Q1BA 3AVVA 1NBME 4TLCA 2F9MA 5A0FA 4Z51A 2DWPA 2CNWD 3HYTA 3V4FA 1E79D 2BC9A 2V55B 4BRWA 1D2MA 2XTMA 2Q9CA 5FOXA 3J81k 1E2EA 4OYHA 3RRYA 2XSZA 4TL9A 4IOLA 1F6BA 1MKYA 4F4JA 3LQRA 3GJ8A 1E9BA 4KFSA 2QGNA 3LD9A 1R5NA 4NU0A 3SC3A 1HEIA 4FW9A 2QPAA 1FMJA 1KDTA 1UBCA 2V8OA 1ZD9A 1F2UA 1KMQA 5TARA 2IWHA 2H8KA 2DFTA 4Q1FA 3JZAA 4NCJA 2Q21A 4URYR 5DO9A 4IVRA 4DUGA 1GVNB 4DEYA 4PC3A 3DL0A 1KKMA 2OV2A 4FINA 4RZUA 4TSFD 1AQYA 1UJ2A 1U90A 3CUEF 3RS2A 4MYTA 1J8YF 2D06A 1Y3AA 3SHWA 4DCNA 1XF9A 3CRVA 3PUYA 4OHVA 3B6EA 4D81A 1P75A 3UG7A 1OFIA 3KXLA 4TMTA 3FMIA 5EE0A 2ZJ5A 3UMFA 2GK6A 1QHGA 4DIDA 1K5DA 1US8B 1NBMD 1RVDA 1YR9A 2E1RA 3RABA 4NCIA 1XZPA 1XTIA 4MYUA 1LF0A 1LFDB 1A2KC 1NVVQ 3MUFA 2W00A 4KBFA 4Q21A 3VKHA 4ACAA 4ESVA 2H1LA 3BFVA 4TLBA 1Z29A 4LRWA 4DLSA 2YVUA 3CRW1 2IBMA 1KDRA 2AN9A 3KDSE 4YMWA 1NMXA 1NLFA 2IC5A 3FYHA 2ORWA 2GJAA 2NPIA 3CRMA 2YWEA 3B1XA 3H2YA 4ZPXA 2BWJA 2OE2A 4JL6A 4DDVA 1AS0A 4Y0AA 1CRPA 3FMFA 3B1WA 1Q44A 4LBWA 5AJXA 4TWZA 3PUZA 1DADA 1N6PA 2OLKA 3WP1B 4QNMA 1LNZA 4PC7A 2ERXA 3GQBA 1E0JA 1ZUNB 3MJHA 1ZM2A 1WBBA 2XZPA 4B3DA 5FI0B 3IDQA 5C4MA 3KJHA 2XJ9A 4RFVA 5B2ZA 2Z5FA 1A7JA 3SS8A 2VHTA 4DC9A 1GIAA 1E9AA 2YJTD 3CW2A 1OH7A 3I73A 1WDTA 2GHIA 2F1HA 3OIUA 1QHNA 1SKQA 1UM8A 3Q5DA 2JLUA 1ESNA 5KSOA 3K09C 3DMDA 5DI3A 3BRWD 2FN4A 2ZVPX 1R7RA 3KTAA 5FI1B 2NMVA 3BS4A 3VX3A 1E4VA 5J4YA 4ZIRB 2AFIE 2ZJBA 3WYAA 1S3SA 4QBIA 4JS0A 1W4CA 1ZM3A 1QDEA 4RKFA 1BIFA 1BYUA 1W4AA 4URXR 3B1VA 3LRPA 3IO5A 3Q5EA 4UXHA 4DSOA 5FTNA 3WBJA 3KJIA 4HAWA 1M6NA 3AP1A 3R20A 3K0CA 1Q1QA 1UDXA 4M1WA 1DG1G 4OI4A 1RFLA 5KSYA 2ZSFA 3FOZA 5B57C 3AH8A 5FTKA 1N2CE 4AI6A 3KJEA 2W6ID 2JASA 1VG9B 2HJGA 2OSBA 1NMYA 5CLLA 3KQUA 3PEYA 2EFEB 2P67A 2W6JA 3NIBA 4GOKA 1W48A 3GEEA 1XD8A 2B21A 4NYIR 2QPTA 3DOFA 2C95A 4X8OA 1ESMA 5H68A 3PEWA 1VYUA 2P6NA 3L0OA 5FR2A 4RD4A 5E7JA 3EIHA 1T0HB 1SHZA 1FTNA 2J46A 3K0FA 1XJCA 2IHYA 1T91A 5FOWA 4CEJA 2ZI5A 3EARA 4AIIA 4DIEA 2HJVA 3K0SA 2JLXA 2ZUDA 4FCVA 5F9FA 2ZI9A 1XZQA 1NN0A 3DEFA 3O47A 3K9LA 1GSIA 4MITA 4QJ4A 1VCOA 1YKSA 2XX3A 5JFGA 4A0FA 4LYHA 1JBKA 1W36D 1R0ZA 4ACBA 4IVQA 1KI3A 1G64A 4A8JB 3L8YA 3WNCA 3UG6A 4B3GA 1WMSA 1FP6A 2WV9A 3EC1A 4V02A 4TLAA 3P26A 4JLBA 1XXHB 4RY2A 1BKDR 1Z0AA 4IVPA 2ZI7A 3K0AB 1A82A 1V5WA 3AV0B 2CMKA 3LBIA 1AK2A 2ZR0A 2XNSA 3EWSA 4CEJB 3W90A 2A7QA 1G5TA 4XH9B 4JJKA 1U9IA 4AWXA 1R10A 1CR1A 3B85A 1MO5A 4OQXA 3LH5A 3SDZA 4AKEA 2KWIA 2ZETA 3GLHA 1COWA 2O8BB 2OG2A 4MYCA 1I4LD 3FWYA 1JEEA 2CLSA 2AD5A 3KFVA 3R7WB 4AKHA 1G7RA 2RGCA 3KKQA 5DLQC 421PA 4E07A 4A8JA 2F1IA 4S2EA 1ZM4A 3SYNA 2ZU6A 4F92B 3CPHA 4MRVA 4DLRA 3GLIB 5JI2E 4JLVA 1I4TD 1VCIA 5FTJA 2BKUA 2OCAA 1XD2B 3SBEA 4CDGA 5G40A 2R6CA 3K0AA 4XVUA 1ODFA 2B6HA 5L8VA 5ELXA 5E7MA 2HLDA 3M4YA 4XD7A 3AP2A 4RFSB 2JLZA 4B44A 2ZE6A 1Z6GA 5JJKA 5C2JB 4JBYA 4QBGB 1KNQA 1W0KA 4A0HA 3GLHB 1NSFA 3AVXA 2O8BA 1SKYB 1Z2AA 3ND8A 3LQQA 2GETA 3R7WA 3E70C 5AR1A 3VHLB 1TEVA 4YC7A 1GG2A 4LJ4A 1ZIOA 5E3HA 3ADCA 1XU4A 2UVQA 1DG3A 4LC0A 5JRZA 3CONA 2EWWA 1E2MA 4QXAA 3MWLA 2GCNA 1JXMA 4F93B 1GAJA 5CB6A 3TUZC 1XFAA 3GJ3A 5EP4A 3FDIA 3VR1A 2J7KA 4TT3D 5DN6D 1S0UA 4PO8A 4NP6A 2P5SA 4B73A 1RKBA 3GJ4A 4P4TA 1G18A 1GL9B 2YWGA 3RDPA 4F4IA 2WWGA 4TMXA 1EWQA 5DI9A 5M04A 3RWOA 121PA 4DWJA 4G5GA 3UATA 5KDOA 5C4GB 1VYTA 3SJBA 4U7DA 2C9CA 1JEDA 4UQOA 1KI1A 3SNHA 1R5OA 4E03A 3IGFA 1W47A 1NG1A 4B3XA 4QG7A 3NBZC 3NDPA 5JEDA 1J2JA 2VP9A 3LBHA 1F48A 4OHXA 4B3CA 4JVNA 4EPVA 3VR3A 3A6PC 2BM0A 4FN5A 3RC8A 2VTKA 4CEHB 4NH0A 1ZRHA 5FBVB 1P5ZB 2QQEA 5H8WA 1OIWA 3EXAA 3ICQB 1II0A 4PQYA 5P21A 5FR1A 4KFUA 3PG5A 3JZMA 5KO2A 1U98A 2GKSA 5TY0A 2QTFA 3RSLA 2NIPA 3RLFA 5J40A 3FKSD 2YOFA 4LPKA 1JQLB 3BGWA 3TW4A 2IUSA 5CM8B 3ZVRA 4W5HA 5KU1A 2C96A 4RZ2A 3B1YA 1S2MA 5EUQB 1IXRC 1N0UA 2C99A 4QM6A 1Z0JA 2J5XA 1UF9A 3QE0A 2W6IA 2FFAA 4M2LA 2O8EB 4TLEA 1NN3A 2QE7A 4JMPA 3GFOA 2ZPTX 1J70A 1M7HA 3QBTA 3QVVA 3U7GA 3ADDA 4BFYA 3GD7A 1JJVA 4Q7KA 5AJWA 2IYXA 4TMKA 3E1SA 3W6PA 2EYQA 4DKXA 3GP8A 4DLTA 1Z6YA 1P72A 4V0MA 1XWIA 3U4QA 2EWVA 4QFMA 2ZVQX 2YOHA 4Q4AA 1IY0A 2Z0MA 2C77A 4OQLA 4V03A 1N5IA 2Q6TA 2PH1A 1Z08A 2D74A 2XTNA 3CWZA 3K09A 3NBYC 1NN5A 4WVFA 4D2IA 1AA9A 3REGA 1CR2A 1E0KA 1F5NA 2EVWX 3MWKA 1U0JA 4MUAA 3THOA 2ZJ8A 1K6MA 1TTTA 4YONB 5JJLA 1YZQA 2O8EA 2C9OA 3WYFA 5DIFA 1BYIA 3RVBA 4LJ6A 1II8B 1M74A 3LW8A 1HT1E 4JLNA 4LBYA 1R6BX 2H5EA 1GOTA 2IYWA 2CLDX 5FUXA 1AGRA 4IW3B 5AUPB 4HB0A 3FTQA 3PUVA 4IDNA 1W0KD 2I1VB 2GBLA 3CNNA 3VR5A 4DVGA 5HPYB 3VMFA 1HE1C 1P9NA 1TX4B 1G3IA 5CYPA 2Q0HA 1GL7A 2ZAMA 3NEJA 4GPTA 4URVR 3FKSA 2PCJA 4DXAA 3F5FA 3L0IB 1IBRA 2O8DB 4AYXA 1Z0DA 4AG6A 4IOKA 4PO9A 3K70D 1H65A 2JJ8A 1FMLA 2RGXA 4IEIA 1N6LA 2I1QA 2DYKA 2VPPA 5B58C 2WMNB 1GRNA 1KKLA 3O8DA 2ATXA 2GVZC 4XTCS 1RC8A 1W1WA 4CGZA 1W44A 5FPYA 1SVSA 3H0KA 2CCGA 1E0AA 4C30A 2BV3A 4BRUA 4MRNA 1HA3A 4KBGA 5B64A 1DEKA 4Q1EA 3F3YA 5GVRA 3PUXA 4HDCA 3VKWA 1CS4C 2CEAA 3QF7A 2FX3A 4PHGA 1TUIA 3TR0A 2FSGA 4BFXA 1OKKA 4EQ6A 5AJVB 1AN0A 3TVTA 3CZQA 1HUQA 4QNRA 4IRUB 2ANCA 2PT7A 3SOPA 2OFXA 4JLJA 1CBUA 3T12A 5K8LA 2Z4SA 3Q7PA 4LC1A 5EP1A 1G7SA 2XEXA 3CPJB 2BEKA 3B82A 1KO8A 3EWAA 1E94E 2JEOA 5F2EA 1XMVA 1Q1BA 2QAGA 3QXSA 4HUQB 1IN7A 4E5UA 1U9IC 1LTQA 4DZZA 2LWIA 3G82C 4Q00A 5KYKA 3WRYC 1KDOA 3R8CA 4KU4A 2ZRHA 3CX6A 4EDHA 4QRHA 5FPSA 1ZD1A 3ASYA 4LDJA 3B9PA 1G3QA 4YXWD 2QRNA 1MABA 3QXCA 1KSJA 1KJWA 3IHLA 5EJEA 1IY2A 2QP4A 4QBHA 3RSOA 1XEXA 4EQ6B 2ZRAA 4Q18A 1OFHA 2NO1A 1XEFA 4FMBB 2CCKA 1E9FA 4YMVA 1LW7A 3SFVA 2ZRFA 1NMZA 1OT3A 1ZBDA 5IDVA 2DWOA 2ERYA 2AL7A 2BMJA 2ZU0C 3AF1A 2VYFA 2ZSDA 2EFDB 2OZEA 1BH2A 1VG1A 3BB1A 5DISB 1Z47A 3ZD7A 2V7QD 2XNDD 4HUQA 3EZFA 2D7DA 3HDTA 5KDLA 1E1QA 4LOAA 2O5VA 4KJZA 4O2LA 4ZCLA 1KK2A 1N25A 2X77A 4JL5A 2RGNA 3O8RA 1T6NA 5EZ5A 4KITB 4OQFA 5IK2D 3QJYA 3GJXC 3T1OA 4B2IA 4NE2A 4M9SA 1SVIA 1T0JB 3PENA 4V0OA 1XEXB 2ZRPA 3GJ0A 3FHOA 4A6PA 1P7CA 2VLIA 3FGNA 1DAHA 3AQ4A 3I8XA 4UKDA 1TNDA 2HLDD 1N6RA 4XD7D 1OH5A 1TPZA 1SKYE 4UNPA 1EK0A 1OYWA 3CH5A 2A5JA 1OB2A 5HTKA 4QHTA 2YZ2A 2TMKA 3QQ5A 5B30A 1E9RA 1U8AA 4I4LA 3ICEA 5EE3A 4GL2A 5F3WB 2V6JA 2ZRCA 1EX7A 4A0RA 2QUZA 4H1VA 3TIFA 1KNXA 2AXNA 2RAPA 2ZI6A 3OEHD 4NYIQ 4DSNA 3TSWA 2WWFA 3NXSA 2CVHA 2MSCB 3AVQA 4OK3A 1E1RA 4R98A 5DYIA 3WMFA 3X1WA 3GLIE 1N6NA 1RRGA 5JSZA 3HU1A 4MRRA 4URZR 2FE4A 1JR3E 1N5LA 4B2LA 5L3SA 3EZ7A 1CRQA 1DE0A 2NOAA 3JVUA 1UBGA 2RB4A 4NBSA 2MSEB 3W34A 3AGPA 4OKSA 1CJMA 1EXMA 2D2FA 4I81A 2WAYA 3C7KA 3X1DA 2QQ0A 2VP6A 1ZCAA 4JIMA 3T35A 1P9WA 1TQ2A 2QT1A 1PUJA 1GWNA 3LVRE 3DKVA 2OCYC 4WBSA 4AC9A 3TUIC 1QRAA 4EUNA 1FNNA 2WJIA 3THYB 1RJ9A 1JJ7A 4G1UC 3CZPA 1I2DA 4JSYA 2FU5C 5FL3A 2P6RA 1QHXA 1X3SA 1CJUC 5EP2A 2FFBA 3A1SA 4KI0A 4UNSA 3IIJA 1W5TA 3GJ5A 2PMDA 3RNLA 5JSZB 1S96A 2O8CA 3U7EB 1IONA 4QC2A 3S1AB 4O2RA 1NLZA 4D6PA 5KTYA 4LJ5A 3TUJC 2OAP1 1OV4A 1TADA 1F2TA 1ZP6A 3THWB 2Z43A 4DLVA 4URWR 2F9LA 1B23P 1GUAA 2MSDB 3Q85A 3U3OA 1L8QA 1JR3D 5FPHA 2OUKA 4TMWA 1HT2E 3IPYA 4MGYR 2VHJA 2OCPA 1N6KA 4A2QA 4M1MA 3WNBA 1CJVC 1C9KA 1LY1A 1KYIA 2NQ2C 3GLGE 1VHTA 3W5JA 2IEZA 3T1QA 4ZO4A 1PUIA 2REOA 1IN5A 1AJEA 2QTHA 3V9PA 3GLFB 3CF2A 4OQMA 3OEHA 4HZUB 4YXWA 4ZDIA 1QBKC 3FB4A 1G3MA 3KKPA 4M9ZA 1KI4A 1FQKA 5EUMA 1IJFA 4K81B 5JI3E 3N2IA 1D6JA 5JWHA 1U94A 4LZZA 1P2VA 4UJ3A 2AR7A 3OF5A 3X1ZA 5GJCA 3H86A 3FHCB 5DYGA 4D4JA 1G17A 1E96A 4MKIA 5EXTA 1HH4A 3GMTA 2ONJA 1LS6A 4DT1B 5DNYB 1VMAA 2KBEA 1GL6A 5TVKA 4D4KA 4PAOA 4BQSA 4YMSA 4A9AA 1NN1A 2OLJA 3M6AA 4KODA 3IQWA 2RHMA 3NBFA 4GBMA 4A82A 1E2FA 4HI0E 2O0JA 4JVSB 4LHYA 5EP3A 1XTRA 4QGHA 2FFHA 2VP0A 2NO0A 2F55A 1P2TA 1RRFA 1PLJA 2XAUA 4BE7B 4Z8XA 5HZKA 5FBRB 1XBTA 4IEEA 2PT5A 1OIXA 2J0UB 3RRZA 2RKOA 1AKYA 4GP6A 4LBVA 2V4ZA 3KQHA 1J90A 4EJSB 2CVFA 3NVAA 3QG5A 3MLEA 3W6OA 1T5IA 4L16A 3SZRA 1J7KA 3TQFA 3O8BA 1E2HA 3GFPA 1NVXQ 1X86B 2GESA 1P3JA 3IEUA 3B78A 2HYIC 4CYMA 1EESA 1E2KA 2YNMA 1UKVY 4NYMQ 4I1UA 2R8RA 2A5GA 1G8YA 4HLUA 4R9UC 5HKKA 4TTRA 2EYUA 2HCBA 2HDNB 3K0CC 2P5TB 1AQUA 3GEHA 1CEEA 5K8UA 4TTQA 1M8PA 3EC2A 2ZRIA 4LUCA 4P4SA 2BJWA 2J41A 3K53A 5JECA 1NVUQ 2J0UA 5KUTA 3W5IA 3LA6A 1CLUA 2FSIA 2RHDA 3AEZA 2QROA 4IXNA 4EJSA 5J47A 4BPBA 1CR4A 1R0WA 2GF0A 2WVJA 4BLTA 3ZVLA 4RSGA 5L3VA 4DCUA 1YU9A 1DAGA 1KO5A 5LBIA 3THXA 2QP3A 4IOJA 4EJSC 2OAQ1 2VRWA 3MMPA 2GAOA 2O52A 2W58A 4NCNA 5JWRA 2IHBA 4NCHA 3QXHA 2VP2A 3UWOA 3VHXA 2ZE7A 3AVOA 4M21A 1D2NA 1ETUA 4W9MC 3RC3A 2J87A 3IO3A 2SHKA 1QG2A 5FBWB 4AG5A 3NHAA 1G9XA 3RRNA 2WPDD 1BO6A 4PSVA 1EFRD 1KY3A 3OEED 4HLQB 3CPEA 1YR8A 2WJYA 3MG9A 1IN8A 3BFKA 2EQBA 2V1XA 3A1TA 3LFUA 3I4LA 5CM9C 1MH1A 4PZZA 4HZIA 3QG1A 4I1OA 4KVAA 1K8RA 3K8YA 4MRPA 1UPTA 4GP7A 1XCGB 1G3UA 5D3QA 1P60A 1DO2A 2A5DA 2J1LA 1DO0A 3HR7A 2JJ2A 1CR0A 1DPFA 1CXZA 4DLUA 1SHKA 5BN5A 3F8TA 2ZUCA 3QKTA 3RS7A 2A5YB 1VDZA 3K9HA 2IYLD 1XTSA 1Q20A 1ZINA 3P1JA 3JVVA 3SQWA 2GRJA 2FPLA 2YYZA 1JPNA 3P4XA 2AX4A 4M4SA 3Q3JB 4EFMA 3I61A 5FOSA 5EXSA 1W0JD 2BHRA 2PX3A 4CT5A 2PL3A 2ZSBA 1W4RA 1XTJA 3N70A 4TZ6A 3QEOA 4PPQA 4BFSA 2YINC 3B5JA 3DO6A 4H9GA 4X8HA 2ZROA 3A36A 3PVSA 5IHPA 1OH8A 1E3MA 4NYMR 2J3EA 5IK2A 2XTZA 1ZU5A 4A2PA 1Z22A 1CULC 5KHOC 5SZHB 1TQ6A 5BYKA 2A9KA 5H70A 4C7OA 1OFUX 2FGKA 5EXXA 1VTKA 1XDBA 2O8FB 2GTPA 2J45A 4KYIB 3TQCA 4BZPA 1HYQA 2QGZA 1JQJC 1HE8B 1CP2A 1N3BA 2V9PA 4MGIR 3RS5A 1S1CA 4TL6A 2IS1A 1XTQA 1W2HA 4MYHA 1E2PA 3W6NA 1TF5A 2F7SA 4HB2A 3R9XA 3TNFA 4YMTA 1E9DA 3UMRA 4QGAA 4R2HA 3L0SA 2BMDA 2BBSA 4ASUD 1T4GA 3NEYA 1W36B 3WMGA 1DAMA 4A2WA 3D31A 1ZUIA 4LV6A 4AK9A 1FP7A 1QHIA 3ND9A 3EPJA 3V00A 3P32A 3GLGA 3GJ6A 1E9CA 4HLCA 3VR2A 3K9GA 4M1KA 2ZR9A 2P65A 8OHMA 4C7OB 3QSYA 1P4SA 2O8FA 4XWAA 1JI0A 1KI6B 2AD1A 4TN1A 3TMKA 2QAJA 1Z06A 2PMKA 1HQCA 4CZ2A 1EGAA 4DRZA 3L2OB 1TQ4A 4CRWB 1W7AA 4KHZA 2B8TA 2QY9A 1WBDA 4MDFA 4PPFA 1OB5A 1TF7A 2CK3D 2LKDA 1W36C 2JLYA 1US8A 4JVMA 1OHHA 1G5PA 1R8QA 2AK2A 2ZYUX 4LHXA 4LYFA 4PAQA 4WW0A 1WP9A 2OXCA 2FV8A 4W5WA 1FNMA 2PEYA 2BM1A 1T3SA 2J9RA 3QPVA 1DELA 1FQJA 4B76A 1UKEA 2FJUA 3BBPA 3PQCA 4IDOA 4UNNA 4LV8B 4EPXA 4TTPA 5FTLA 4FMCF 1L2TA 1KI6A 1YJ5A 2C03A 2QI9C 3M0EA 4D0NA 2FH5B 3TSOA 1GKIA 1YZNA 4GMDA 4XSGA 5EE9A 3HJNA 3R9IA 1YZUA 3BB3A 2XGJA 1Q3HA 4C4PA 4NZYA 2BBTA 3V4RA 4PQFA 2QE7D 2GJ8A 4F91B 2FF7A 4PAMA 1FX0A 3EPLA 3C14C 3WP0A 5IT5A 1RZ3A 2XZOA 1KK0A 2BBOA 5HE8A 3SQXA 1R8SA 2P6UA 3T5DA 3LDAA 2QP9X 1G21E 3AVPA 4LJ7A 2DPXA 2OBMA 1QF9A 1VCMA 4NL4H 1IN6A 5G41A 1EFHA 3RRMA 3KKMA 2C8VA 2HT1A 4ZI3A 4TT3A 1NVVR 1OLOA 5DN6A 3U60B 1EFRA 4KO8A 5CIQA 2O0HA 3T1VA 2LCFA 2ATVA 1XTKA 4KFTA 2GK7A 1Z28A 4WZAE 1NJFA 3CIOA 3CX7A 3WMEA 4O3MA 3LNCA 4BUJA 5DI3B 2R6DA 3W3AA 1Z83A 3QVUA 3KTAB 4I99A 4RJLA 4C0KA 4OJKA 4BLPA 3X1XA 4Q4HA 2P2LA 4CIDA 4AURA 4OI1A 2YHSA 3ADBA 4OHWA 1OXUA 1CJTC 1GRRA 1FX0B 3I5YA 1KAGA 2JA1A 3ASZA 4A92A 4BECA 1TU4A 3EIQA 4Q4JB 4TMVA 1F60A 3TSZA 2QL6A 3IEVA 1XMJA 2REXB 1MO4A 5CDFA 4Z1MD 1DAFA 1TU3A 2QM8A 4RVCA 4ZI2A 4QBFA 3IQXA 4HAYA 4OL0A 1QHHB 3WY9A 1OIVA 4M1SA 1TMKA 4Q1DA 2QBYA 2ODNA 1G5RA 4ILEA 1NIPA 2GZDA 4MA4A 1Q3TA 4B33A 1X8JA 1MRNA 1WCV1 3EASA 4JJZA 3HP1A 2MMCA 4Q9LA 4N3NA 1W0JA 2ZXUA 1MT0A 3TLXA 1XXHE 5G3ZA 4TQAA 2YC4C 4KSBA 2JJ2D 4I1SA 5CJ2A 2C98A 2UZIR 1G4AE 2GVDC 2H92A 3CBQA 2NO7A 3ZD6A 4RD6A 4BFUA 2OO7A 3H4MA 2ECKA 2ZS9A 2D3WA 1QHHA 2FG5A 4Y0VA 1GKYA 2FSHA 2QBYB 5JCZA 4JKIA 3CF6R 1E4YA 4RD1A 1LV7A 1ZNZA 5GJBA 4V0ME 2IA5A 2KJQA 4Q01A 4Q7JB 4U02A 3MRSA 1W5SA 3UWKA 4DDTA 2EW1A 4XWOA 3C5CA 3A4NA
chains in the Genus database with same CATH superfamily
4MRSA 3FDZB 2J3LA 3O9ZA 1Q6ZA 1Z5OA 1R4NB 1KZ1A 2G5PA 2O48X 3BCHA 2EU8A 4YUZA 5ITVA 2BDTA 1TQ8A 2HREA 1ADCA 1QPBA 3L0CA 3EEYA 2C7GA 2QW1A 4ZIRB 4JV5B 2VNKA 3O91A 3PHCA 5BP7A 1KJZA 4ZCQA 5JY6A 2UAGA 1Z6TA 3NH6A 3DAGA 3LY7A 4C08A 1D5CA 4UTXA 4XB1A 4PYKA 1UFOA 3I2YX 3I5XA 3KQKA 1X1TA 1Q0UA 2AQIA 3BC1A 3DXYA 4MDEA 4K88A 4BHTA 1NX0A 4INWA 2Q6IA 5PNTA 1E6CA 3VPSA 3WG9A 2BYTA 2IJGX 1AMOA 5I9LA 2I76A 4ZAWA 1Z8DA 4GNKB 4JIGA 5IEJA 3ZNIA 3F47A 2IHKA 2RBEA 4E30A 2KHNA 3GR6A 1KQNA 4EHNA 3U7QB 1Z4IA 3WYNA 2H7XA 2P9GA 1AGNA 1FMTA 1MGPA 4BFWA 1I32A 3FLBA 4GBGA 4WN3A 1VMKA 2PUCA 1SPXA 1MU0A 5EJ4A 5EC8A 2V7TA 3LWZA 2B5WA 2W0MA 4JMLA 4KLRA 5DCYA 2WK1A 3H4VA 1V43A 3EBPA 3OCXA 3UB3A 3OM0A 3T1TA 4DLNA 2C9DA 5C9ZA 3ZZNA 2COEA 5JCOA 2ASEA 1GQRA 4GMXA 3T3EA 1XA0A 2B78A 5K0FA 3BSFA 2ZUBA 5JT1A 1DFIA 1BQEA 1IQPA 1I01A 1P7YA 4JT4A 1HXHA 2E89A 3NUQA 1XPUA 2ST1A 3KO8A 3IURA 1QVZA 2YN0A 5DRTA 1W34A 2OP0A 3AHGA 3PJFA 4O8CA 3TVDA 4FONA 1WXQA 4GNKA 1LS8A 5IBPA 4X8LA 4EB0A 3T6KA 3UXMA 1KI8A 1XQYA 2WICA 4CLNA 2VPIA 1QG0A 4FW8A 1AK9A 4Q82A 4XDHA 2FMXA 1ESCA 3C16C 3DLIA 4MI9A 2ANBA 1FDUA 3GG9A 2BFMA 3IHWA 5JO9A 3VNQA 1M6YA 4YT4A 2HQOA 3CLRC 1NBMA 5TNCA 3F9IA 1XKQA 3KHTA 3G8CA 4MUFA 1FFHA 4DLBA 4HB3A 5C8YB 4W5NA 4CTMA 4BCCA 3OIFA 2I6UA 1VIMA 4LQ4A 1BWRA 2ZGVA 5F4ZA 2OCBA 1V4NA 1YCFA 4GVLA 4HRVA 4I66A 4P08A 4R2XA 2XJ4A 1MAVA 2GXSA 1FTYA 4JQYA 4NDNE 2I3BA 2R8PA 5EMMA 1JJAA 2RHHA 1BRTA 4FS8A 1I4OA 3MAJA 3KTFA 3H2KA 3O0TA 2VSQA 3DZCA 1ZXBA 4ZYVA 1GAXA 3U1BA 1QNFA 1AHIA 2JLRA 1E8MA 1P0MA 3G49A 2CT8A 3RW9A 4D9MA 4Q3EA 4PG6A 2HL6A 4UOQA 3S2GA 3A37A 2WAXA 4NIMA 5TX7A 3SYLA 4MH0R 1XJ0A 2X86A 1L7EA 4N76A 4CKBB 4BV3A 1ZFNA 3O4JA 1RABA 3THRA 2GXQA 1NV9A 2ODBA 2E6UX 3E35A 3RYIA 5LJIA 3VA7A 1DX4A 2WLTA 5LFAA 3TLMA 3M3HA 2A0KA 2MHHA 4TRRA 2WQ6A 3B7PA 4QXOA 2R3SA 1EJ6A 4DMLA 3QNUA 4EVSA 4EJMA 4LXGA 3FFBA 3S55A 2H2DA 4MRMB 3H9UA 1E79A 2WCMA 1QQ5A 4GSYA 1DV2A 1VPVA 2X2EA 2GEUA 5HMLA 3ZN2A 1BJKA 2REQA 3CKLA 3FD8A 3W5BA 4H60A 1BVUA 3BERA 3CCFA 1HFKA 4JYPA 4ABYA 1JBQA 1N1EA 2ORIA 4PC2A 5CA1F 4IO0A 1E66A 4OGLA 1L4YA 1X3LA 2G9NA 4EZEA 4GYYA 1V7CA 2I3AA 3KLNA 3OJWA 4HYTA 1KZGB 3DEHA 3V42A 4KCGA 4OFZA 2G06A 4L4ZA 4LFCB 3ROPA 1P0CA 1L3CA 1UBFA 1YS4A 3HCOA 2D13A 1SB8A 2WJ3A 3KOWA 4GSKA 1GAEO 4F2WA 2HUNA 2OM6A 3SU8A 5ESXA 5K0SA 4AN4A 4WGFA 5FUQA 3U3DA 2D4HA 3Q2OA 2W2LD 4AS3A 3TAHA 4R83A 5SY9A 1NCXA 4C0WA 1GA4A 4KYUA 5AVVA 1V3TA 4G5YA 5C7OO 1SBNE 2MR5A 2ZRGA 3HP7A 4JD5A 1XA4A 2VEDA 2E5WA 3A25A 3AKCA 1X80A 3U7FB 3RC2A 2V7XA 1KCYA 5DB4A 2GYVA 5CH3A 4AX8A 4YV2A 4HLDA 5IAOA 3O2JA 3K1AB 4QUHA 3GGJA 4OIFA 1TZ2A 4BNVA 3KUUA 3ZW8A 4B8YA 3PHIA 2ZREA 4WFJA 4C9BA 1YZGA 3SVLA 4P3XA 5LB4A 5T4EA 1G19A 1NYQA 2VRNA 3V2GA 1G41A 1LRJA 2VCHA 3JR7A 5LWHA 3I8OA 2AAOA 3QW2A 1JI3A 3T7KA 3N2ZB 1MF8B 5IDQA 1SL9A 1B73A 1IG3A 1II8A 1Q1EA 4UASA 2YFHA 2PD4A 3K0HA 1N6OA 2VQSA 4H7JA 3WYCA 3EA0A 1F2UB 3DXLA 3IULA 1JEYB 2EOAA 3LCJA 2QRPA 1C3VA 3ZV4A 1HE4A 3KJNA 3KZKA 4A5OA 2QYHA 1V1FA 4PIPA 3E5MA 5D7NA 2NAFA 1RJVA 3HWX1 3GNSA 4U00A 3RSQA 1RXSA 3VTKA 4F5EA 5CFRA 1OOJA 4AT1A 4IV8A 4N3GA 4YCBA 3K1AA 3KOOA 1IY9A 3SLKA 3T06B 1JDNA 3GWGA 3FMOB 2IYUA 5ALKA 3LCPC 4W5JA 1M34A 1RLJA 2D5IA 3HKCB 2GJKA 1N2GA 3I1YA 3WQRA 1ZOSA 4RJJA 2HPSA 4C7VA 3I9V6 4POOA 1GNPA 1TIPA 4KQWA 4CU5A 1Y89A 2N1BA 1SNLA 3HJBA 1GN9A 3UV6A 1H5QA 5JAQA 3BXGA 3ZH2A 5GONA 1P6UA 3MSEB 3X3HA 3ZE8A 1ODKA 1U8YA 3BVPA 4OATA 1RQLA 4MW9A 3GVHA 1XZCA 4Q03A 4MDHA 2J31A 3QPWA 4G0ZA 2BMEA 3SJSA 2VIIA 5CH5A 3ZJ5A 4AN0A 4BQIA 2AB0A 4Z4GA 2W6OA 3KPJA 4I5GA 4JC8A 1RYDA 2IZOA 2GDJA 2PQLA 2YR0A 5DW3A 3SJCA 2PIAA 1KSGA 3L02A 4G0UA 3V4OA 2AT1A 3RWBA 2HRCA 5CCEA 2BHNA 4QECA 1W52X 1TIBA 3O83A 4UCFA 2IW3A 3AFHA 3F3SA 3I5GB 3LHFA 5D86A 3UCFA 4BYMA 5KSPA 2PAAA 4B46A 2HH9A 2HU5A 2DOQA 3AR8A 2VDUE 3GC6A 4RL6A 2Y0BA 4UBIA 3BRSA 1WXDA 4F6RB 3BF8A 1G6Q1 3FRJA 4EYSA 3DVEA 2B7CA 2EFCB 3N1UA 2BCJQ 4WQ3A 5FTMA 1L7VC 1P3DA 3F49S 1B00A 3Q15C 1FL9A 1RE0A 3DF0A 3GJTA 3NOVA 3HADA 3SE0A 4OB7A 4QPJC 4J2HA 2D0PB 1R0SA 5DH9A 2IUFA 5JFOA 3PNVA 2XVZA 1C0PA 1E9EA 2AR9A 2P6PA 3ISTA 3TE6A 3D3QA 3WSVA 4DBVO 3DO8A 4BJ3A 5JASA 1KS9A 2WYIA 5A7FA 5FWYB 1MJFA 4WSOA 5JSQA 4JLAA 1C41A 1PJRA 4IXTA 1ST3A 4NKRA 4WEOA 4ZKDA 3HZHA 1A2QA 2D7JA 2X0IA 1IEQA 2R48A 3EY4A 3T7IA 4RF4A 2KGBC 1OXXK 3UWDA 3OECA 3KT6A 3NC0C 4P34A 1KDPA 1PVBA 3ETEA 3BXZA 2B5OA 1RAHA 3IJPA 3K94A 4RETA 3SYMA 1KJIA 1W30A 2NG1A 3U80A 4CVNA 2PMCA 2EL7A 2Y8EA 4ILKA 2WCHA 3ED5A 5L7YA 3PP8A 4FFPA 4ISBA 1F1JA 4GZ3A 1YRWA 1CM1A 4LV5B 2C59A 4MMYB 4BFCA 3KHKA 1CCWA 1ZNWA 1A1VA 4Q9KA 4E5SA 1WNFA 2IYSA 4MNTA 4C2TA 1B1CA 1YRQA 4KNWA 3ZXSA 1L7OA 5I9NA 1N1MA 1SNYA 3LXXA 5HQ3A 4UM9B 5BQ5A 3B51X 2WCJA 3ZWWA 2C9YA 3E82A 2Q5HA 1DJWA 4MS3A 1EFTA 2IPLA 5TF4A 3VOTA 3SAJA 1NDHA 3LUDA 1LK7A 3DV0A 1TNQA 4P22A 5FWYA 1MNQA 2O5EA 4YMIA 5DNEA 2AF3C 5SZKB 3VZSA 4Y2RA 2N3ZA 4JOSA 2CL7X 3U6BA 3EYWA 3EG9B 3S0EA 2QMEA 3RBXA 4D0LB 3KQLA 2ZIXB 2VL7A 3VJRA 2H1FA 3HKDB 2G2BA 5ALTA 2YL2A 3RU7A 1ES9A 3Q7TA 2PEZA 5JVDF 1VZ2A 3DZBA 1AZSC 5LP6C 3R7LA 3NP9A 3E2MA 4E2XA 1F8UA 3EX7C 4X1IB 5KIAA 2FRVA 4IJMA 4TWAA 4YO7A 5KZMB 1PTKA 5JNUA 1EP1B 5AW5A 4XXHA 2IDJA 3T9EA 2BGGA 4OP3A 3L4BC 3X1YA 4BKPA 1V6CA 3OE7A 3FUUA 5BNZA 3ZZ0A 1QIWA 4W63A 4E11A 1OBFO 3ET5A 1ZW6A 1FQOA 4MS3B 2PVBA 4QOHA 2V98A 3TH5A 4JXZA 4AZ3B 1M1NB 4MZJA 5DX1A 1A5BB 1JF0A 5ER9A 1KJYA 4HO1X 3SS4A 2XW6A 2Z1NA 1OGYA 3G5UA 1I94B 1JAYA 4R2JA 4C0BA 4X44A 1HE5A 3TG8A 4ZZIA 2M3WA 2C4MA 1FEZA 5FFFA 3ONEA 3CGAA 1HTTA 3EG9A 3IAUA 4FXPA 3AFNA 1G55A 3FAKA 2GV5A 4LMBA 5A5EA 3HKDA 1MB9A 3A6ZA 3FCXA 4YCAA 3JATA 4XWKA 2I55A 1JH9A 1QCZA 5AWFC 1Y1QA 3AB7A 1G7CA 3BN3A 2VCYA 4X0EA 5CG1A 4CR6A 2OCDA 1YV9A 1E62A 4LDZA 2CHGA 4UVIA 4KPYA 3DT9A 5G3YA 3V6MA 5AK6A 5DCUA 1D04A 1SWWA 5EESA 1DC6A 1RLOA 5FNVF 4E5YA 1MAUA 2ZIEA 1LX6A 4BOYA 1X42A 3ZY3A 1IPEA 3OZSA 2RI0A 1N34B 2QVBA 2VQ3A 3TRFA 1KVQA 1M1NA 4J76A 2P4EA 5CVCA 3HFGA 1LKJA 3S1AA 2AOTB 3ABSB 4DNOA 1E3EA 5CJPA 2PWZA 3CVXA 1BC5A 1ZD8A 3CRRA 2PGDA 2FW1A 1JAIA 1Z38A 3ICCA 1AIPA 3A3OA 2OHIA 4LNUA 3GO4A 4Q7EA 3X2SA 1PJ4A 1U2DC 4CN8A 2A30A 2PJRA 3KZOA 1ESZA 1C7IA 2JFZA 3EIOA 4DADA 1LLUA 1N33B 3JATB 1J5PA 2O6HA 1NX2A 3D0OA 2BCXA 3P0JA 3UMCA 4DEXA 4LJ8A 2H4HA 2V0CA 2DBRA 1YGPA 1TK9A 3FHTA 1JNXX 2HQRA 4NESA 3GJRA 1ZX1A 3AI7A 4PCAA 4PX9A 4MUGA 2DQKA 4FHEA 1WSAA 1JALA 2QR2A 3NJ4A 3P5SA 3N53A 4FGZA 2Q3DA 4FIZA 2X9NA 1RI1A 5FLEX 2H08A 1WXFA 3PSHA 4V0SA 2FETA 4ASUA 2JGRA 1IBLB 2GEDA 4XIYA 3VRQA 4UOZA 4K46A 3OKCA 2LLTA 2JFVA 2OVBA 5BV2P 4GGFA 1VJ5A 2AOTA 2FLVA 3TFQA 3ABOB 1YZLA 3QVKA 3R8FA 5K3OA 4S35A 5HIAA 2GEJA 2A4MA 1X1RA 2JAXA 1N5KA 2CFCA 2Q1TA 1TMYA 1YR6A 4LNUB 3QFSA 1CRWG 5IT0A 2ZRLA 3D81A 1ABEA 2JFUA 3OICA 1YS1X 3ED1A 1MD9A 2AUMA 5DSZA 2Q50A 1KMCA 2PXXA 2YWRA 1PFKA 2GJSA 2WTNA 3PEVA 4L75A 4X3OA 5IVIA 3S81A 4RPHA 4ZQFA 4B6RA 1AE1A 1GPNA 2GBFA 4FHFA 3D8RA 4A8PA 3PI7A 5IHXA 5TVGA 2R6ZA 3TI9A 2F17A 1PHRA 4AJEA 3W6UA 2V0GA 4CIWA 2VK1A 5K8TA 4C3ZA 1QUEA 1OXSC 4ZMSA 3O3OB 3CS1A 1WAMA 3HDJA 5DNAA 3CSDA 3RHTA 4QFBA 5E1DA 4R5HA 2XZTA 5BN3A 3HXQA 1NRIA 4EYKA 4NQZA 3VR2D 1JMVA 3NTUA 3TLBA 2B2CA 4PYQA 1XZBA 2TSYB 4C29A 1NVTA 4P1ZA 4YDQA 1PZEA 2VRCA 3NQ41 4QIHA 3W2IA 4D02A 3NDJA 1FSSA 1Y5IA 3QKRB 3CNOA 2QM0A 3D3KA 5HF5A 3RS4A 1Q1ZA 2IOYA 3AUYA 3FKQA 3HSKA 3IUEA 3PRYA 4WOBA 3SG0A 4DSZA 4TKUA 4UFPA 3ONNA 1R5BA 2MJWB 5BSKA 3WGVA 4M2OA 1KEPA 1KQOA 1K6EA 1QV1A 1ZEJA 3FB1A 2ZJAA 4DZTA 4A15A 1XPOA 5JPIA 2VYCA 5KNDA 4HBZA 3L6RA 3QGMA 4OF4A 1XRJA 1YRHA 4FX5A 5K6RA 2LZ0A 2BKHB 3DFUA 2YRXA 3T7AA 3QUAA 1MEJA 5C4IA 3G2LA 1A9TA 1ZO8A 2ZJFA 2J33A 3TTUA 2QRKA 4WFQA 1EWRA 4AQIA 1A8QA 3F7OA 2ET6A 3F2IA 3N8IA 1E4OA 1AT1A 1WRBA 5ARDA 3GCZA 5AVUA 1XZAA 3PKIA 1XD9A 3IMKA 4W9RA 2CCJA 2E4UA 3KB2A 1RYEA 3GG2A 1EHIA 5BVGB 1BU3A 3CJTA 4U2GA 3GFBA 3LBYA 1IIBA 3QKRA 4I6GA 4P4SB 2O2GA 3QIAA 2A1TR 4M8KA 4CIXA 4YUAA 1H6DA 1IJEA 3I76A 4IIJA 4DR5B 3U3JA 4MHTA 2R9VA 4EI2A 2ZIVB 4JASB 1DT7B 3EZ6A 3HRKA 3KTOA 1CJKC 2GVNA 1QQAA 2DTDA 4IGEA 1XOIA 1G60A 4DNXA 5TLSA 4Q4DA 4E13A 3UF0A 3DV9A 4YDRA 4IDCA 4AULA 2GCIA 3FDFA 4G1BA 3A4MA 1C29B 2AG8A 4Q3AA 3V7WA 1HLGA 5E3IA 4X84A 3GPLA 4HLUC 4B43A 5AM2A 5K3FA 4EMSA 2K0JA 1YZYA 3LF2A 3ADKA 4C4RA 2ONZA 3BEDA 3I1IA 4UNIA 4RJTA 4ZJYA 3RRBA 1U1IA 1RTKA 4MQEB 3UJBA 3ZWVA 1RVV1 4FFDA 1JIVA 1CMGA 2BUBA 4A7PA 1NWDA 2OTCA 3ROFA 1T36A 1Y4ZA 3AUKA 3DL7A 3RAGA 1LBQA 3TOSA 5C35A 1F4QA 4JPZB 1Z6XA 3HEMA 3KYDB 4P92A 1IZ7A 5LDGA 4WLVA 4ZVVA 1Q14A 1C7EA 1OSNA 2F4VB 1XFUO 3NTXA 1UBRS 4AY6A 1OWLA 1Y6JA 4YRRA 4B34A 2B1GA 1KTVA 3T5GA 3HL4A 1G20E 4MKXA 4WZ6A 5B3LA 2KDHA 4IQGA 1AQIA 3AZPA 1P8AA 1PLLA 5AM1A 5CVVA 3LC7O 4MQ4A 2VG8A 1WQ1R 2F1KA 1XALA 3HWRA 2HD4A 3OZCA 4FFOA 1I5OA 4XD2A 2FOXA 1S6IA 1VPLA 1W76A 2DFVA 3FZGA 4S1NA 3FVTA 3VHRA 1JUDA 4C6HA 4QGSA 4KX3A 4GXRA 3H5AA 1Y9DA 1BXRB 2MINB 5U4QA 1NVBA 4AZWA 4BWYA 1U1CA 2WYWA 1CZNA 1HNWB 1XZGA 3E61A 4JDUA 5F98A 2JLVA 2W6JD 4LWQA 3PE4A 4PDZA 2QVLA 4CTJA 1GEGA 1KYYA 3S5UA 1VG0B 3IXLA 5D1NA 2C4HA 1ENOA 2YIDA 2KLBA 3KYDA 3BT7A 1J99A 1D4FA 4QHYA 3X1KA 1DOAA 1BHQ1 1JF8A 2ZT6A 1MJ5A 2R00A 1ZXXA 2PASA 3AYXB 1QM5A 3MN1A 1VHDA 4YR7A 4MVJE 5JC8A 3REFA 2G0NA 4TZ0A 4EG5A 2C5BA 4JA2A 1ZCBA 4S2UA 3LCCA 2CKDA 1U0TA 4TXHA 4BQQA 4BBJA 2JHAA 1U2ZA 2CFTA 2PRZA 1EUZA 4LIPD 1GZ6A 3P20A 4YRDA 5I7EA 2H2WA 1K4KA 2IEAA 3O3MB 4RADA 4J7CA 3IHTA 4V2IA 3GYBA 2JH9A 3K5PA 4RVGA 3TZ6A 1MUUA 1N3LA 2VT7A 2FCRA 3AEUB 3TW8A 3N6XA 1RI5A 4R4JA 3CR8A 1N7HA 1ARZA 3HM9A 2IYPA 5JHHB 1P2FA 1Z2CA 3LX6A 3DPUA 5F9HA 4X91A 1YX7A 1N2CA 3DHNA 4EKDA 1C30B 1L7DA 1PDWA 3OUUA 2NUTA 3GGPA 4AY2A 1MFPA 3E3RA 5BXYA 3TXAA 5JATA 4WDQA 3C3PA 3RROA 4W8HA 2ERBA 1MRSA 1M46A 1VFNA 4NYJR 3VC3A 1I36A 1ZW1A 4BBZA 1Y82A 2ZCJA 2O2ZA 1PWYE 3LC1O 1G9TA 4IUDS 1IDN1 4G23A 1E2DA 3DP9A 3NO4A 3RC1A 1JLHA 1YQTA 1M2VB 3F5QA 3GLGB 1VGRA 2AQKA 4NU8X 4AMBA 3NASA 3I9JA 2DKOA 2HJHA 5E1BA 5K0EA 2V6IA 1E89A 1Q19A 1JR3A 1BJFA 3JYNA 4FI3F 3HCDA 1S8OA 3TW8B 5J4VA 2DSNA 2F1OA 3H7IA 3BTUA 3KZVA 3UKJA 1A97A 4OHPA 4MWCA 1BS1A 1DHRA 4LCBA 2Z2IA 2DR2A 3JD0A 4UM5A 1N2CB 2JT3A 1SK8A 2Q2QA 1YDHA 1Z36A 2YRFA 4Z0HO 1CQJA 1J9EA 1XCOA 2HF2A 5BXQC 2IHNA 3OO1A 3BTSA 5LBUA 4DHEA 4XZ3A 1LW6E 5AKZA 5KYTA 1YMVA 3NWJA 3R5KA 3HBLA 4OIMA 2CB9A 1HV8A 3VYTB 1D07A 4MS1B 4B3JA 5A3JA 1EWTA 2B61A 1ZUHA 2V5VA 3BKWA 4DBLC 4YMUA 5TQ2B 3OTQA 3OZIA 4X7BA 5FJJA 4R16A 1IIOA 3DA8A 4IUBS 4I6JA 1SMGA 3BOSA 2PUAA 5CLGA 1DXHA 1AQLA 3DR3A 1GV0A 2H31A 1YJAA 1KI9A 2YWHA 1ATZA 2FJUB 1WU7A 1NPQA 2J3KA 1WTAA 1TF2A 2EKPA 3BK7A 3GA7A 3MJRA 3NHMA 2IH2A 5DF1A 4GYKA 2UKDA 4CODB 3DVJA 3DTYA 4FGUA 3O90A 4F4CA 1BT6A 5EXDA 1U7PA 2ZB7A 4KWHA 1J8QA 4DIFA 1CPYA 2IF2A 3H8WA 3HL0A 4QU8A 3TDIA 3QTLA 3PV0A 4KO4S 2A0UA 1ANKA 1CQJB 1D9ZA 5TQ0A 4X7MA 4GGMX 4MSPA 1RC1A 3O1HB 5DGTA 2HIHA 3CC8A 3RTDA 3QY9A 1P2BA 4WESB 4Q9NA 4EHJA 5AI8A 2I7TA 3U3RA 4L76A 4MS1A 3CXUA 1R9GA 1E7YA 1G5IA 1G291 4K86A 2VUIB 1PK0D 3EHDA 3HWSA 4B0OA 2PA0A 2ZZKA 2IOFA 3AKAA 3ZPXA 4LF4B 1XCMA 1ULHA 4IHQA 3PATA 2MYTA 1DBPA 1PRYA 1PX0A 1A9QA 4M9QA 5LPNA 3KTDA 4C7MA 2DCUA 4DA9A 3EEBA 1CB0A 1NKTA 2Y68A 1IRJA 2NYAA 1MB0A 2ZYTX 3N2NA 2Y1FA 3WLEA 4ZI5A 2BJVA 3NGXA 1MHOA 3IAFA 4UXJA 5I01A 1MF7A 3Q6MA 5SZJA 2YJNA 4DC0A 2BOVA 4XVQA 1Z75A 3BE5A 1XDUA 3LV8A 2IL1A 4KWTA 2O60A 2EG9A 3DPIA 3PXDA 1E3DA 2JFQA 3VUEA 1NR7A 3A1DA 3R0XA 4N7JA 4Q4HB 1H3NA 5TQ0B 1B3RA 1S2IA 2FEOA 4QQFA 3HA7A 4WESA 1JTVA 2GPTA 4JBNA 1NU6A 4LF8B 2OBNA 1S9HA 3D3JA 1RXUA 2ZRKA 5BQFA 2NZWA 4HAZA 4NAVA 3GFVA 4QA9A 5I9BA 1VHQA 4RO0A 3VR4H 4AUEA 1QFYA 3IVMA 4X00A 1RYHA 1U8TA 7ABPA 5LDDC 2H17A 1ML3A 1EG3A 1BEZA 1NUAA 1UR5A 4L22A 3RD5A 2FRDA 1F5SA 1ZOLA 2KHZA 1JFTA 2WSMA 4EUKA 3H1AA 4F9EA 3O4HA 3AGQA 4NATA 5EAIA 3A6GA 3ASUA 4IIHA 1D03A 1VHLA 1VLMA 4P81A 1UDRA 2H2KA 1SIOA 2PBZA 3CZRA 2IK8A 1W4BA 3B8HA 3QXXA 4FHDA 4GKBA 1SBYA 2NO4A 4V0KA 1UKZA 4OLAA 2PS1A 5LR6A 2ZRBA 3MGCA 3RIGA 1YB6A 1KARA 1T3LA 1SYMA 4DRXA 4JFRA 1SBIA 1YC5A 4GKKB 4GSLA 3VR6H 1JR2A 4IXMA 4HLNA 2G6BA 4ETNA 1AUPA 4KQCA 3LYLA 4ISCA 5LZ7A 1R6VA 3MGAA 3OCVA 3G23A 1ZOTB 5IAAA 4C78A 5DNVA 4V3BA 3R5XA 2D54A 1V3VA 5HCNA 1P2DA 1WD5A 4RKWA 5IASA 3EUFA 4UBJA 4OR9B 1DCMA 1KO4A 1K7YA 2G36A 3GLRA 1QGAA 3LDFA 3Q40A 4M9CA 1TO6A 3RADC 2LCPA 2A5LA 3BF7A 2FWNA 1M1YE 1JKFA 2JGNA 1F2TB 2QMOA 3GV0A 3OHPA 4I5FA 5JDCC 5M7EA 3Q72A 4ECAA 2ZWMA 2FZWA 4XI9A 4GI7A 1FSFA 4XWWA 1EINA 1W5BA 2JD1A 1GQOA 4BGIA 4G41A 1KAOA 1S2DA 1YS9A 5ETJA 5EI5A 3TXYA 2F2PA 2AFHE 2GFQA 1DC1A 2BF7A 1EHCA 2J8ZA 2VTEA 1O77A 1H0RA 4BBPA 2JI7A 1BCRB 4IF4A 4PX2A 5GQSA 1U5BA 4A0GA 4B3RB 2IXFA 4PLYA 1GGMA 4OFXA 3K9FC 1M33A 4G97A 4BFVA 4BGDA 4NBLA 2Y76A 4NQRA 3T7SA 1U63A 2F1RA 4UUOA 1NPDA 3ZTYA 2QAGC 1OBHA 1QORA 2D2VA 1X1CA 1Z39A 4JUDX 5MDHA 5LQRA 1KK7Y 2WC6A 2XF8A 3PL1A 4HB4A 3TE7A 1KFXL 1A9XB 1IPFA 1T5BA 2G7MC 2ISCA 3K15A 5FJIA 4REOA 1FBNA 1T25A 2Z9DA 1RM4A 3L79A 1N65A 4K9PA 1GFZA 1TCCA 3FF1A 3PNSA 4Q6WA 4WIAA 1SCMC 1U04A 3AINA 5LLDA 2KBFA 3ZZUA 1PL6A 5EEHA 3SLGA 3ORQA 3HNOA 4IPTA 4GZ5A 3QENA 1VI2A 4YRBA 3TDMA 3PITA 5EJ5A 4WA7A 4A36A 2Y4QA 3AT1A 2V96A 1PLKA 1CKEA 1FUUA 3CLVA 1LK5A 1SULA 1POXA 1BCRA 2AN1A 3F67A 1TJ5A 2JXLA 3KOXA 5BSMA 5LSAA 4KLNA 3IP8A 3F5MA 5HKAA 1XELA 1H6CA 3UY4A 3FPFA 4WAUA 5E4TA 4G01B 4M1YA 2GRUA 2H1IA 4YRSA 2I71A 4XR9A 1Z6ZA 1E7QA 1QQ6A 2O06A 2P9BA 3R7DA 2UYHA 2WHXA 4PCVA 4YS6A 1G21B 3DD1A 2Y1XA 3B7GA 3B6ZA 1LA2A 3GFQA 3U40A 1NJ6A 3V8EA 3OQBA 3RARA 1RQGA 2ZUEA 3G1WA 1EKXA 3AJ8A 1NFQA 2L2EA 3DWGA 5EE1A 1OMVA 4D9NA 1T9ZA 1SQ5A 3V3TA 3KKOA 2IYYA 4ON9A 1FIUA 4HS9A 1WBJB 3L1UA 4R0VA 1J2UA 3A1UA 3QITA 2OQVA 3ZNOA 1LXCA 1DXOA 3K70C 5TC4A 2HF8A 4CF6A 1IWPB 1QCCA 1UJMA 1SZPA 1UADA 1C7WA 1FFYA 1T9AA 1RYZA 4FMCB 1IQ3A 1T9KA 1U8CB 2Q1SA 3KWMA 3ZE7A 5FQOA 2YHIA 4GUDA 2EDCA 3I9NA 2E87A 1GNTA 5EHGA 1JTFA 4RTOA 4RABA 1Q7BA 3DGEC 4MIYA 1GD1O 3UGTA 3IALA 1LI5A 4R2KA 3JTEA 1TD1A 1EFKA 5EIHA 3LL8B 2A1UB 1YUNA 1SXJD 2FN7A 2E9SA 4LPSA 5EHNA 4PTLA 3UKOA 4RD0A 2Z1MA 3AB3A 3K30A 2FZLA 4IEFB 1VBKA 2RCNA 2ZRJA 1DBWA 1MB3A 1TPYA 2OZLB 3V8PA 5KWVA 4KFCA 5HFJA 4ZVRA 1YE8A 3B7AA 1PF7E 1QVRA 1P17A 1JWBB 1RLTA 2BSXA 2BPOA 4LRSB 4S1VA 4XASA 4B6SA 4ZGGA 1C1YA 1IHYA 3BSYA 5LOVB 4QUKA 3T5TA 4ZRMA 1X74A 3OPMA 4N1AA 1FQWA 2V7BA 1USWA 2HTEA 3RS3A 1Y4UA 3KX2A 1ZN2A 1ZC3A 4EZBA 5A7HA 1DJYA 1KO1A 4I9HA 3JALA 2YBEA 2CMHA 2WJVA 4CETA 1Y1XA 1T2DA 3JQ7A 3CNQS 3EK2A 1LSOA 4LYAA 1MC1A 2DPGA 1AV6A 1DEOA 1L0BA 3B3JA 1UKYA 3NTLA 2C84A 2BTQB 1LCIA 2IE8A 2VHQA 2YHIB 3HEAA 3RB8A 3TDUA 2A5FA 3DZDA 3S5JA 4LSMA 1ZN9A 3TUYB 1UEXC 4FDTA 4KK4A 2GPYA 1G5QA 4OXKA 5T5QA 4HSZA 2QSJA 4CUKA 4KWEA 4ZODA 2KI6C 1JZTA 2A1UA 2WMOB 3GCGA 1QP7A 1HQYE 1YZFA 1GZ5A 3Q1LA 3ZQ4A 3O2NA 2I29A 3H8VA 5FYQA 5BMVF 2CVQA 3ZHBA 1X1EA 3LZ6A 3E5HA 4FNOA 4NJMB 4UUPA 1NI5A 1ZITA 1R16A 4YJ3B 3DE5X 4MPRA 5LOVA 3AU9A 2KSQA 2LVJA 2CZCA 4N5IX 1CTQA 2QX7A 3HPQA 3DBIA 2AN3A 2OV6A 1U2RA 3R3WA 4BB9A 5JMWA 4WRIA 2BBMA 1QIEA 3EJWA 1TE2A 1D2RA 1MP0A 1S2GA 2QN7A 1F4LA 3HCEA 2UDPA 2H18A 4JBXA 4ETOA 3CUSA 4XUCA 2NZJA 5EZ6B 5CU7A 1KAQA 1ZN8A 2HRQA 3OLVA 3P27A 1EH5A 2XE6A 4L9SA 3V1YA 1U0GA 1YVRA 1T9GS 3MWJA 3CNLA 3PPYA 3A9SA 4GPEA 4IV5A 2Q9UA 2FMHA 3F5SA 4RS4A 5KTNA 5IYZF 5KX5F 1PJSA 1SU4A 2GF9A 2OZKA 1EFUA 4GUKA 4L0MA 4X8MA 4DMGA 3BSSA 2YDYA 1W9MA 2GZMA 3NHBA 2HCJB 5DTJA 3X1JA 3CH7A 1YVUA 2IV3A 4PQEA 1U2TA 1UQRA 5TPWA 2I6QA 2ISSD 1BNCA 1IYZA 1Z17A 2QD4A 2QTVB 3O4GA 4BNXA 4X65B 5CG2A 5IBQA 1GQMA 3W78A 4E4TA 5MGNA 3PDCA 2PAFA 4WERA 5CTJA 4DG8A 5REQB 3S1LA 3S27A 3DEJA 2OQIA 1V11B 3KQOA 5JANA 3ZH9B 1K1EA 2F3SA 3D64A 3HUEA 4YAEA 4Z1MA 2DQ4A 1DKLA 3LUAA 3QFRA 2P3QA 2X7XA 2I91A 2O3SA 1FVFA 4BU0A 3GUZA 2CV2A 2ZSUA 4Z9BA 3WA6A 2GNOA 2FPMA 1DXQA 1MGOA 1QX2A 3DF7A 1E5TA 1IY8A 2Y5IA 2I8LA 3RVRA 1XZNA 2OXFA 4Z0TA 2ID7A 1KFUL 2CNWD 4BGVA 3HYTA 5CMLA 3RZSA 1VPDA 3AL2A 4OV6B 3V4FA 4BRWA 4G1EB 1XUOA 2NQTA 3OOSA 4ZMRA 2ZTMA 2GPWA 4MCIA 1D6MA 4QZVA 2I65A 4IIBA 2QTVA 2Y1WA 1F6BA 4J0HA 2P41A 3LQRA 4QQKA 1V39A 2QGNA 1Q83A 4I5KA 4NU0A 3EGEA 1QXPA 3TBFA 1DJOA 3L4SO 4YH1A 3T4PA 1KDTA 4XARA 1RBMA 1KETA 1RJWA 1KMQA 3RFFA 1WCWA 4B79A 1B8PA 5G4LA 3LS2A 3JZAA 2Q21A 4URYR 2WF7A 1R50A 4ZJZA 2OXTA 5L40A 4OJMX 4MW7A 4PC3A 1C80A 1NV8A 3VROA 1EE1A 4MR7B 2IEGA 2D1FA 3HJUA 3RR2A 1XAJA 1AQYA 1O58A 3KWFA 4DTCA 3JAWA 6YASA 1S4MA 3RH0A 2NCOA 2F33A 3CUEF 5KHAA 4MYTA 4P5OE 4HMPA 2J9XB 1XF9A 5ALXA 5K0BA 4QU5A 3PUYA 3PX3A 4BNMA 2ZNDA 2FJYA 3UG7A 1OFIA 3KXLA 3UMFA 2GHQA 2DSTA 4RDXA 1FP4A 1QHGA 2GKOA 2XKAA 3HVJA 2PALA 1T6ZA 1ZUNA 4KYNA 1C2YA 3RC9A 4P86A 5K89A 4G07A 4EF4A 1PGNA 1MAWA 1F0YA 4KBFA 3TW0A 4HF7A 2W00A 4MEBA 2BI4A 2BL4A 4MIEA 3U7IA 2XMSA 4GM0A 1WY5A 4MK4A 5E0KB 1Z29A 3IE0A 2HGSA 3KEQA 4EG8A 2O1SA 3LDUA 1RRMA 5TMDA 5K20A 2HFKA 1HI9A 3K2BA 2AN9A 4YMWA 1BROA 1NMXA 2CHFA 1BLQA 4DUZB 2ZJ6A 3IP7A 4G0PA 4M0PA 5I7UA 4Q3DA 4LF7B 3B1XA 2XGSA 2GD2A 3BYAA 1E3QA 2BWJA 1YTLA 3D7RA 3SSOA 4J1SA 1DSSG 4JL6A 4BTLA 4LMPA 4MWTA 4ND8B 5CXSA 2A3NA 3LSYA 2IOFK 2ZT7A 1DIRA 1E1CA 1ESEA 2LGJA 1Q44A 2PLAA 3FMFA 2QL5A 4LBWA 3K8QA 4BDSA 1DADA 4PTZA 1WNTA 4RVUA 5A71A 1Q2UA 1UDBA 4QNMA 3ZHOA 3OHSX 1E0JA 1NNUA 1ZUNB 3MGGA 3MJHA 3OCYA 4CLEA 2C7QA 2CTNA 3I5MA 3ND7A 3IDQA 5EPEA 1BN7A 5CA0F 1UOOA 1SEVA 1WCXA 4NZOA 2Q2NA 4HNTA 4WE3A 3P0FA 1UP4A 1UT5A 4R2WA 4FWBA 2VHTA 4DC9A 1QFJA 1E9AA 3MCWA 1ODJA 4PR3A 3P9PA 4ALNA 4BP1A 1R00A 1J2RA 4UDOA 2C8KA 1WDTA 1YI0A 4R8VA 1E5QA 3ZW9A 2GHIA 3LGSA 1UM8A 5JG7A 4P83A 3GB9A 1N8SA 3DDNA 2XT6A 3NXKA 4MV5A 1FYDA 1UXGA 4FUTA 1DKQA 4YROA 5JXWA 1UWOA 5FI1B 3HP4A 2XHEA 5TT1A 2GTIA 4NLLA 4ND8A 5TJ9A 3TZQA 2NMVA 2O2IA 2XR1A 3BS4A 3O2PA 4HBGA 4KGZA 4BO7A 2HM7A 5J4YA 2VF5X 4WECA 1JDTA 1ZMOA 1AH2A 3T1NA 4O3FA 1G8SA 2VYVA 1W4CA 3KM0A 3TWOA 2HQBA 3FNEA 2L98A 2CFOA 1JEOA 1BYUA 2NYRA 2M9GA 1CZKA 5GTDA 1CZLA 1YHYA 3OQMA 2ABWA 2WNDA 4UPGA 3CMCO 2CBLA 1B6TA 1FRNA 4NS4A 4NBTA 3KL2A 1XZFA 5U4XA 3FOZA 2CNLA 4LXXA 4EY7A 2WTMA 4OTZA 4TWIA 1OPRA 5FTKA 2PS9A 4CQMB 2W6ID</