4PE0A

Crystal structure of calcium-loaded s100b bound to sbi4434
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
total genus 33
structure length 92
sequence length 92
chains with identical sequence X
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pe0A00
5BPJA 1ALWA 1QX2A 5I2QA 1XK4C 3PN7B 1PVBA 4HRHA 3M0WA 2K61A 3VRRA 2M1UA 1KQMC 2K7CA 2MLEC 1MXLC 1TIZA 1BJFA 2HPSA 1K2HA 3OP0A 2H2KA 4MSPA 3PN7C 1OMDA 4XJKB 2M1KB 2JNFA 2R2IA 1DF0A 4AQIA 3PLFB 4PHJA 2H61C 1FW4A 4QJ3B 5I2OA 5FYXA 4OVNF 2BCAA 5B8IB 2ZNDA 3VRNA 1OMVA 2JRFA 3I5FB 1XFYO 3DF0B 3PM8A 2RGIA 3SIAA 3RM1A 1BOCA 2KI4B 1S5GY 1EXRA 2K2FA 4GNKB 1BU3A 1V1FA 3AKBA 1RROA 2E30A 2LP2A 1WRLA 1JUOA 1EJ3A 1UHJA 1RJVA 2G9BA 1YUTA 3CGAA 1KFXL 2K7DA 2V53A 2F3ZA 2F8PA 2KI4C 4BY5A 2OTGB 5KSZA 2COLB 1XFUO 3VRQA 2JNXA 3OHMB 2CNPA 1JFKA 2BKHB 5HLOA 1HT9A 5DKRA 1ODBA 4PDZA 2KYFA 1S5GZ 1B8RA 1J55A 1CLMA 1KSOA 3IF7A 1W7JB 2BE4A 2JXCA 1UHHA 3PATA 1RK9A 1DTLA 2KFFA 4HSZA 4ORBB 4GBAA 3NSOA 1GGZA 1Y0VH 1RWYA 2KAVA 1SK6D 3I5GB 2KI6D 3OB2B 4PE1A 4E68A 3EKJA 2ZN9A 3C1VA 3A4UB 1CDLA 1B47A 1N65A 5HKZA 1NCXA 1PRWA 2CCMA 1NYAA 1QV0A 3I5GC 3SG2A 4N1GA 2L98A 1ZFSA 1YUUA 1DJIA 2OPOA 1PSRA 5J3XA 1QJTA 2KOTA 1RTP1 5KU1A 1G8IA 1QLSA 3TUYC 1CMFA 1CM4A 1B1GA 1SNLA 5AFPA 1Y6WA 3SIBA 5AEQA 1BF5A 4DCKA 5CSNA 2ZFDA 2M29A 3AKAA 2JWWA 5CSIA 2K2AA 1SKTA 2KQYA 3CLNA 1A75B 1UUSA 4CFRA 1KK8C 1XVJA 1DT7B 1K94A 2I2RE 2LC5A 2GGZA 1AJ5A 3RLZA 1S36A 2JC2A 3F45A 2KSPA 4ORAB 1XFWO 1AP4A 3LK1A 1K95A 3CR5X 4MRXA 2MLFC 1MXEA 1UHNA 1YRUB 2LV7A 4C0LA 3TDUA 2KBMA 4MEWA 2ISDA 2Y1NA 3BOWA 2LM5A 1RECA 1SW8A 2WCEA 3KF9A 3NSKA 4OKHA 5CSFA 3KPXA 5JJGA 1KWOC 2ZN8A 2BBNA 5AXIA 2KGBC 5HLVA 3EVRA 1IWQA 4AOMA 1ZOTB 1NSHA 1QASA 4M2QA 4USLA 1J1DA 3QRXA 2EC6C 1NPQA 1F4QA 3O4YA 4QJ4B 2B1UA 1KQMB 1A03A 3NSIA 3K21A 1J7OA 1CNPA 2KHNA 4YGAA 1CDPA 1M63B 1AHRA 1DJXA 2ZRTA 2K7BA 2JT8A 1J7RA 4ZCVA 2LVVA 1YRTB 1S6CA 1C7WA 1IRJA 4JQ0D 4Q04A 1U5IA 2MA2A 3D0YB 3I5HB 1W7IB 2LLTA 2KYCA 1L2OC 5HKYA 3KO0A 1CFPA 3PFVA 4OCIA 2PRUA 1S26D 2LMUA 3DD4A 4PHKA 1FPWA 2F2PA 1OE9B 3I5HC 1FI5A 3SG6A 2BECA 1A2XA 4GGNA 4R1EA 4I5KA 2LMTA 1IH0A 4XYNA 1BR4B 1N0YA 1UP5A 4GGFA 1OMRA 2LUXA 1K90D 1Y1AA 2M9GA 1OZOA 1K9UA 2OS8B 3GK2A 1SYMA 4FQOA 2JQ6A 4MN0A 3VROA 4PE0A 2D8NA 2LCPA 1CTRA 2GV5A 3JTDC 1FI6A 2HETA 2TN4A 3GK4X 2KDHA 4N1FA 4FTGA 2OS8C 4DS7A 4PCWA 2MAZA 1XO5A 1B4CA 4M2PA 1B8LA 2KNEA 1NP8A 1G4YR 1WLMA 5ER5A 4UPGA 2EGDA 1XFXO 1PALA 4BY4A 4PE7A 3SG5A 2KBIA 1F55A 4C0KA 1G33A 1S3PA 1TCOB 2I7AA 3GOFA 1NUBA 2L0PA 1SCVA 1WDCC 3BYAA 3LL8B 5HKWA 1CFCA 2HQWA 2JT3A 1SL9A 4MBEA 2WCBA 3WXAA 1LA3A 1DGUA 3LK0A 2O60A 3FWBA 4PE4A 3FWCA 1KFUL 1C7VA 2ZNEA 2F2OA 2PVBA 1H8BA 2BCBA 2PMYA 4ZCUA 2BE6A 2H61A 3LCPC 4NDBA 1TNWA 2LVKA 3TUYB 3VGOA 3TS5B 2BL0B 4MZLA 4L9MA 2QPTA 4YGEB 1SCMC 1Y1UA 2G2BA 1NWDA 4XJKA 1Q80A 1JF0A 4CFQA 2P6BB 4YGBB 1JSAA 1ALVA 2SCPA 2KFHA 1GGWA 3TS5C 2BL0C 4JPZB 3EVVA 2M7LA 2Y1MA 1GQMA 1FF1A 2NCOA 1KK8B 2M97A 3DF0A 4YI8A 1S1EA 3DVEA 2Q91A 3CR4X 4I5JA 4YGCB 1AK8A 1F54A 3OX5A 1C07A 1F8HA 4MRYA 2LLUA 1YURA 2L2EA 4U8DA 1MHOA 1SPYA 1SY9A 3GK1A 1TNQA 2K0JA 5AERA 1BODA 1YUSA 3PALA 2JXLA 4D1EA 1DF0B 2LHLA 2DOQA 1J7QA 1WY9A 2LVIA 1TOPA 1QX7A 3BUNB 4MVFA 1KWOB 3E3RA 1XA5A 2AMIA 4CLNA 3KHEA 1QXPA 1B9AA 3BUMB 3KEVA 3ZNIA 4P2YB 4C0JA 1XYDA 4P5OE 3OB1B 4OR9B 5AANA 2EC6B 1V1GA 3SG4A 4WQ2A 3DVMA 3IQQA 1HQVA 1BG1A 1M39A 2AUCA 2WNDA 4I5NB 4OV2A 1N2DA 1PVAA 3O78A 4NDDA 1QX5B 4PALA 1XFZO 2F33A 3IQOA 5G08A 2BKIB 1QIVA 2LNKA 2MJWB 2LMVA 2E6WA 2KFGA 3NXAA 3PSRA 5HYDA 3TDZA 1IQ3A 1S6JA 1CKKA 2WOSA 4A4CA 1TNPA 2O5GA 1L2OB 2L50A 1CB1A 1K93D 1SL7A 4F0ZB 2IS9A 1CM1A 2FJUB 3EKHA 3CWGA 2M49B 4DRWA 2HF5A 2JU0A 1OSAA 3SG7A 1UHIA 3VRPA 1LINA 1MQ1A 5PALA 1K9PA 2KAYA 5I2LA 3HCMA 1CDNA 1PK0D 2Q4UA 2FOTA 4NDCA 1EG3A 2LANA 2BCXA 1F71A 4TNCA 1JFJA 1DGVA 2EHBA 4GFTA 1SR6B 3JTDB 1TRFA 4GAOA 1OQPA 4MZJA 2GGMA 4ORCB 5IBWA 3H4SE 1A75A 1VRKA 1E8AA 1UWOA 1M45A 3EVUA 1QIWA 1YX8A 1KSMA 1CFFA 3HX4A 1UURA 4MLWA 5DKQA 2NCPA 2HQ8A 1JC2A 1NX2A 1SR6C 3D10A 1KK7Y 3WHTB 3WHUB 3DVJA 1TTXA 2LUCA 1WRKA 2CTNA 2MHHA 3I5IB 1QLKA 1R6PA 2JT0A 2Y4QA 1PULA 2JZIA 4PHNA 1NIWA 1LXFC 3EK7A 1CDMA 3SG3A 5GQQC 2AAOA 2JPTA 1CLBA 1NCYA 3AAJA 1WDCB 4DUQA 1CMGA 1MF8B 1TN4A 2JOJA 2MRDA 3I5IC 4MZKA 4GUKA 1TCFA 1Y1XA 1KCYA 1KK7Z 3BQ3A 3FIAA 3I5FC 1XK4A 4NQGA 1F4OA 4YI9A 1NCZA 2CXJA 3CR2A 3O6BA 1JBAA 1QATA 1YVLA 1DJYA 1J7PA 2WC8A 4A4BA 1TNXA 2NLNA 1AVSA 1IKUA 1LA0A 3CZTX 1NX1A 2M3WA 1SCMB 4IL1A 4WQ3A 1SMGA 2MBXA 1FBVA 2FCEA 2M7NA 2QACA 1NX3A 3O2PA 1S6IA 4YBHB 1AJ4A 1R2UA 3FS7A 2WORA 3BOWB 1K8UA 1WLZA 2I18A 2OTGC 3D0YA 1ZACA 4QJ5B 2KQ6A 1DJHA 5ER4X 2CT9A 1YR5A 3BUOB 1KFXS 1OOJA 2JTZA 1K9KA 1DMOA 2PASA 5I8NA 3A8RA 5TNCA 1MR8A 3EK4A 1IQ5A 3ZWHA 1EG4A 2LLSA 1DJGA 1IG5A 1YVHA 2ZKMX 2L4HA 1NX0A 3DVKA 1B7TY 3LLEA 2L4IA 2BBMA 4M2OA 3JVTB 3ICBA 3WNXB 1QVIY 1EH2A 1GJYA 2KI6C 1F70A 2JTTA 5D7FA 1J1EA 2JULA 1SRAA 1X02A 2WCFA 1A4PA 1SL8A 2FCDA 2KGRA 3NSLA 1CLLA 1U5IB 4ICBA 4PHMA 3TDIA 4CIDA 1BLQA 1SBJA 2LHIA 1IJ6A 1A29A 1WRZA 2Y5IA 3JVTC 2CBLA 2NXQA 4N5XA 5CPVA 1M31A 5KTYA 1IGVA 2K8MB 4HREE 1B7TZ 2F3YA 1B8CA 1KFUS 1LVCD 2PALA 1KQVA 4YRUA 2L51A 1JWDA 1QVIZ 4ETOA 2NZ0A 3EK8A 1YTZC 2M8UA 2ZRSA 1BT6A 2KAXA 1AUIB 4GPLB 4HRGA 1LKJA 4JWQA 1IJ5A 5DKNA 1K96A 5D69A 1EL4A 1DVIA 1DJZA 1YX7A 3SJSA 4YGDB 1QTXA 1RFJA 3OX6A 4DIRA 2M0RA 4GGFC 1QV1A 1DJWA 2I94A 1JF2A 5JOLA 1L7ZA 2SASA 3CTNA 3CS1A 2K7OA 5F6TA 2PSRA 1UHKA 1M46A 3MSEB 1H4BA 1D1OA 1CFDA 2LE9B 1ZUZA 2L5XB 1PSBA 2VRGA 1BR1B 2LVJA 3BUWB 2LAPA 1OZSA 3BUXB 3AAKA 4I5LB 1MWNA 5K89A 4CPVA 4AQJA 3TZ1A 1BMOA 1MUXA 1ZMZA 2LP3A 1XFVO 1QS7A 5CSJA 3BXKA 2A4JA 4WRIA
chains in the Genus database with same CATH superfamily
5BPJA 1ALWA 1QX2A 5I2QA 4OZDA 1XK4C 3PN7B 1PVBA 4HRHA 3M0WA 2FJYA 2K61A 3VRRA 1OOGA 2M1UA 1KQMC 2K7CA 2MLEC 1MXLC 1TIZA 1BJFA 2HPSA 1K2HA 2WC6A 2H2KA 3OP0A 2ERBA 4MSPA 3PN7C 1OMDA 4XJKB 2M1KB 2JNFA 2R2IA 1DF0A 4AQIA 3PLFB 4PHJA 2H61C 1FW4A 4QJ3B 5I2OA 5FYXA 4OVNF 2BCAA 2P70A 5B8IB 2ZNDA 3VRNA 1OMVA 2JRFA 3D73A 3I5FB 3DY9A 1XFYO 3DF0B 3PM8A 2RGIA 2QEOA 3SIAA 3RM1A 1BOCA 2KI4B 1S5GY 1EXRA 2K2FA 4GNKB 1BU3A 1V1FA 3AKBA 1RROA 2E30A 2LP2A 1WRLA 1JUOA 1EJ3A 1UHJA 1RJVA 2G9BA 1YUTA 3CGAA 1KFXL 2K7DA 2V53A 2F3ZA 2F8PA 2KI4C 4BY5A 2OTGB 5KSZA 3FE8A 2COLB 1XFUO 2QEVA 5FI7A 3VRQA 2JNXA 2L5YA 2CNPA 1JFKA 2BKHB 2WCMA 3OHMB 1HT9A 5HLOA 5DKRA 1ODBA 4PDZA 2KYFA 1S5GZ 1B8RA 3S0AA 3S0DA 1J55A 1CLMA 1KSOA 3IF7A 1DELA 3EG5B 1W7JB 2BE4A 2JXCA 1UHHA 3PATA 1RK9A 1DTLA 2KFFA 4HSZA 4ORBB 3NHTA 4GBAA 3NSOA 1GGZA 1Y0VH 1RWYA 2KAVA 1SK6D 3I5GB 2KI6D 3OB2B 4PE1A 4E68A 3EKJA 2ZN9A 3C1VA 3D78A 3A4UB 1CDLA 1B47A 1N65A 5HKZA 1NCXA 1PRWA 2CCMA 1NYAA 1QV0A 3I5GC 2WCLA 3SG2A 4N1GA 2L98A 1ZFSA 3N7HA 3S0BA 1YUUA 1DJIA 3R1OA 2OPOA 3B7AA 1PSRA 3NGVA 5J3XA 1QJTA 2KOTA 1RTP1 5KU1A 3B6XA 1G8IA 1QLSA 3TUYC 1CMFA 1CM4A 1B1GA 1SNLA 5AFPA 1Y6WA 3SIBA 2GTEA 5AEQA 1BF5A 4DCKA 1IIOA 5CSNA 3S0EA 1OW4A 3DZTA 2ZFDA 2M29A 3AKAA 2JWWA 5CSIA 2K2AA 1LS8A 1SKTA 3L47A 2KQYA 3CLNA 1A75B 1UUSA 4CFRA 1KK8C 1XVJA 1DT7B 1K94A 2I2RE 2LC5A 2GGZA 1AJ5A 3RLZA 5HL1A 1S36A 2JC2A 3F45A 2KSPA 4ORAB 1XFWO 1AP4A 3LK1A 1K95A 3CR5X 4MRXA 2MLFC 1MXEA 1UHNA 1YRUB 2LV7A 3NHIA 3TDUA 4C0LA 2KBMA 4MEWA 2ISDA 3VB1A 2Y1NA 3BOWA 2LM5A 1RECA 1SW8A 3D74A 2WCEA 3KF9A 3NSKA 1W9ZA 4INXA 3KPXA 4OKHA 5CSFA 1KWOC 5JJGA 2ZN8A 2BBNA 5AXIA 2KGBC 5HLVA 3O4XA 3EVRA 1IWQA 4AOMA 1ZOTB 1NSHA 1QASA 4M2QA 4USLA 1J1DA 3QRXA 2EC6C 3CDNA 1NPQA 1F4QA 3O4YA 4QJ4B 2B1UA 1KQMB 1A03A 2JPOA 3NSIA 3K21A 1J7OA 2K60A 1CNPA 3FE9A 2KHNA 4YGAA 1CDPA 1M63B 1AHRA 1DJXA 2ZRTA 2K7BA 2JT8A 1J7RA 4ZCVA 2LVVA 1YRTB 1S6CA 1C7WA 1IRJA 4JQ0D 4Q04A 1U5IA 2MA2A 3BFBA 3D0YB 3I5HB 2H8VA 1W7IB 2LLTA 2KYCA 1SSEB 1L2OC 4INWA 3KO0A 5HKYA 1CFPA 3CABA 3PFVA 4OCIA 3OGNA 2PRUA 2PYQA 1S26D 2LMUA 3DD4A 3SS5A 4PHKA 1FPWA 4IJ7A 2F2PA 1OE9B 3I5HC 1FI5A 3SG6A 2BECA 1A2XA 4GGNA 2WC5A 4I5KA 4R1EA 2LMTA 1IH0A 3PJIA 4XYNA 3R72A 1BR4B 1N0YA 1UP5A 4GGFA 1OMRA 2LUXA 1K90D 1Y1AA 2M9GA 1OZOA 1K9UA 2OS8B 3GK2A 5D3OA 1SYMA 4FQOA 2JQ6A 4MN0A 1OOIX 3VROA 4PE0A 4PT1A 2D8NA 2LCPA 1CTRA 2GV5A 3JTDC 1FI6A 2HETA 2TN4A 3GK4X 2KDHA 4N1FA 4FTGA 2OS8C 4FQTA 4DS7A 4PCWA 2MAZA 1XO5A 1B4CA 4M2PA 1B8LA 2KNEA 1NP8A 1P28A 3S0GA 1G4YR 1WLMA 5ER5A 4UPGA 2EGDA 1XFXO 1PALA 1DC1A 4BY4A 4PE7A 3SG5A 2KBIA 1F55A 4C0KA 1G33A 1S3PA 1TCOB 2I7AA 3GOFA 1NUBA 2L0PA 1SCVA 1WDCC 3BYAA 3LL8B 5HKWA 1CFCA 2HQWA 2JT3A 1SL9A 3BFHA 2WCBA 4MBEA 3WXAA 1LA3A 1DGUA 3LK0A 2O60A 3FWBA 4PE4A 3FWCA 3B88A 1DEKA 1KFUL 1C7VA 2ZNEA 2F2OA 2PVBA 1H8BA 2BCBA 2PMYA 4ZCUA 2BE6A 2H61A 3LCPC 4NDBA 1TNWA 2LVKA 3TUYB 1OOFA 3VGOA 3TS5B 2BL0B 4MZLA 4L9MA 2QPTA 4YGEB 1SCMC 1Y1UA 2G2BA 1NWDA 4XJKA 1Q80A 1JF0A 4CFQA 2P6BB 4YGBB 1JSAA 1ALVA 2SCPA 2KFHA 5FI6A 3TS5C 1GGWA 2BL0C 4JPZB 3EVVA 2M7LA 2Y1MA 3CZ2A 1GQMA 1FF1A 2NCOA 1KK8B 2M97A 5I94A 3DF0A 4YI8A 1S1EA 3DVEA 2Q91A 3CR4X 4I5JA 4YGCB 1AK8A 1F54A 3OX5A 2WCJA 1C07A 1F8HA 2KLDA 2LLUA 4MRYA 1YURA 2L2EA 4U8DA 1MHOA 1SPYA 1SY9A 3GK1A 1TNQA 2K0JA 5AERA 1BODA 1YUSA 3PALA 2JXLA 3DYEA 4D1EA 1DF0B 1TUZA 2LHLA 2DOQA 3BJHA 1J7QA 1WY9A 2LVIA 1TOPA 1QX7A 3BUNB 4MVFA 1KWOB 3E3RA 1XA5A 2AMIA 4CLNA 3KHEA 1QXPA 3B87A 1B9AA 3BUMB 1QWVA 3KEVA 2QDIA 3ZNIA 3CZ0A 4P2YB 4C0JA 3S0FA 1XYDA 4P5OE 3OB1B 4OR9B 5AANA 2EC6B 1V1GA 3SG4A 2WCHA 4WQ2A 3DVMA 3IQQA 1HQVA 1BG1A 1M39A 2AUCA 2WNDA 4I5NB 2QEBA 4OV2A 1N2DA 1PVAA 2BAPA 3K1EA 3O78A 1QX5B 4NDDA 4PALA 1XFZO 2F33A 3IQOA 1Z2CB 3PM2A 5G08A 2BKIB 1QIVA 1OOHA 2LNKA 2MJWB 2LMVA 2E6WA 2KFGA 3NXAA 3PSRA 4F7FA 5HYDA 3TDZA 1IQ3A 1S6JA 1CKKA 2WOSA 4A4CA 1TNPA 2O5GA 4JD9A 1L2OB 2L50A 3FE6A 1CB1A 1K93D 1SL7A 4F0ZB 2IS9A 1CM1A 2FJUB 3EKHA 3CWGA 2M49B 3R1PA 4DRWA 2HF5A 2JU0A 1OSAA 3SG7A 1UHIA 3CZ1A 1LINA 1MQ1A 5PALA 3VRPA 1K9PA 2KAYA 5I2LA 3HCMA 1CDNA 1PK0D 2Q4UA 5FI2A 2FOTA 4NDCA 1EG3A 2LANA 2BCXA 1F71A 4TNCA 3R1VA 3D75A 1JFJA 3QMEA 1DGVA 2EHBA 4GFTA 1SR6B 3JTDB 3V2LA 1TRFA 4GAOA 1OQPA 4MZJA 2GGMA 4ORCB 5IBWA 3H4SE 1A75A 1VRKA 1E8AA 1UWOA 1M45A 3EVUA 1QIWA 1YX8A 1KSMA 1CFFA 3HX4A 1UURA 4MLWA 5DKQA 2NCPA 2HQ8A 1JC2A 1NX2A 1SR6C 3D10A 1KK7Y 3WHTB 3WHUB 3DVJA 1TTXA 2KPHA 2LUCA 1WRKA 2CTNA 2MHHA 3I5IB 1QLKA 1R6PA 2JT0A 2Y4QA 1PULA 2JZIA 2BNXA 4JKTA 4PHNA 1NIWA 1LXFC 2WCKA 1CDMA 3EK7A 3SG3A 5GQQC 2AAOA 2JPTA 1T14A 5DICA 1CLBA 1NCYA 3AAJA 1WDCB 4DUQA 1CMGA 1MF8B 1TN4A 2JOJA 2MRDA 3I5IC 4MZKA 4GUKA 1TCFA 1Y1XA 1KCYA 1KK7Z 3BQ3A 3FIAA 3RZSA 3I5FC 1XK4A 4NQGA 1F4OA 4YI9A 1NCZA 2P71A 2CXJA 2PQLA 3CR2A 3O6BA 1JBAA 1QATA 3UNWA 1YVLA 1DJYA 1J7PA 2WC8A 4A4BA 1TNXA 2NLNA 1AVSA 1IKUA 1LA0A 1TWOA 3CZTX 3L4LA 1NX1A 2M3WA 1SCMB 4IL1A 4WQ3A 1SMGA 2MBXA 1FBVA 2FCEA 2M7NA 2QACA 1NX3A 3O2PA 1S6IA 4YBHB 1AJ4A 1R2UA 3FS7A 2WORA 3L4AA 3BOWB 1K8UA 1WLZA 1XFRA 2I18A 2OTGC 3D0YA 1ORGA 1ZACA 4QJ5B 2KQ6A 1DJHA 5ER4X 2CT9A 1YR5A 3BUOB 1KFXS 1OOJA 2JTZA 1K9KA 1DMOA 2PASA 3DXLA 3A8RA 5I8NA 5TNCA 1MR8A 3EK4A 1IQ5A 3ZWHA 1EG4A 2LLSA 1DJGA 1IG5A 1YVHA 2ZKMX 2L4HA 1NX0A 3DVKA 1B7TY 3LLEA 2L4IA 2BBMA 3BFAA 4M2OA 3JVTB 3ICBA 3WNXB 1QVIY 2KLEA 1EH2A 1GJYA 2KI6C 1F70A 2JTTA 5D7FA 1J1EA 2JULA 1SRAA 1X02A 2WCFA 1A4PA 1SL8A 2FCDA 2KGRA 3NSLA 1CLLA 1U5IB 4ICBA 4PHMA 3TDIA 3SS4A 4CIDA 1SBJA 1BLQA 2LHIA 1IJ6A 1A29A 1WRZA 2Y5IA 2YGUA 3JVTC 2CBLA 2NXQA 4N5XA 5CPVA 1C3ZA 1M31A 5KTYA 1IGVA 2K8MB 4HREE 1B7TZ 2F3YA 1B8CA 1KFUS 1LVCD 2PALA 1KQVA 4YRUA 2L51A 1JWDA 1QVIZ 4ETOA 2NZ0A 3EK8A 1YTZC 2M8UA 3B86A 2ZRSA 1BT6A 2KAXA 1AUIB 4GPLB 4HRGA 1LKJA 4JWQA 1IJ5A 5DKNA 1K96A 5D69A 1TUJA 1EL4A 1DVIA 3D77A 1DJZA 1YX7A 3SJSA 4YGDB 1Z4HA 1QTXA 1RFJA 3OX6A 4DIRA 2M0RA 4GGFC 1QV1A 1DJWA 2I94A 2QEHA 1JF2A 5JOLA 1L7ZA 2SASA 3CTNA 3CS1A 3CYZA 2K7OA 5F6TA 2PSRA 1UHKA 1M46A 3MSEB 3IVTA 1D1OA 1H4BA 1DQEA 1CFDA 4KYNA 2LE9B 1ZUZA 2L5XB 1PSBA 2VRGA 3D76A 1BR1B 2LVJA 3BUWB 1C3YA 2LAPA 1OZSA 5EL2A 3BUXB 3AAKA 4I5LB 1MWNA 5K89A 2L2CA 4CPVA 4AQJA 3SS3A 3OBVA 3TZ1A 1BMOA 1MUXA 1ZMZA 2LP3A 1XFVO 3UO9A 1QS7A 3Q8IA 1GM0A 5CSJA 3BXKA 2A4JA 4WRIA
chains in the Genus database with same CATH topology
5BPJA 1ALWA 1QX2A 5I2QA 1XK4C 3PN7B 1PVBA 4HRHA 3M0WA 2K61A 3VRRA 2M1UA 1KQMC 2K7CA 2MLEC 1MXLC 1TIZA 1BJFA 2HPSA 1K2HA 3OP0A 2H2KA 4MSPA 3PN7C 1OMDA 4XJKB 2M1KB 2JNFA 2R2IA 1DF0A 4AQIA 3PLFB 4PHJA 2H61C 1FW4A 4QJ3B 5I2OA 5FYXA 4OVNF 2BCAA 5B8IB 2ZNDA 3VRNA 1OMVA 2JRFA 3I5FB 1XFYO 3DF0B 3PM8A 2RGIA 3SIAA 3RM1A 1BOCA 2KI4B 1S5GY 1EXRA 2K2FA 4GNKB 1BU3A 1V1FA 3AKBA 1RROA 2E30A 2LP2A 1WRLA 1JUOA 1EJ3A 1UHJA 1RJVA 2G9BA 1YUTA 3CGAA 1KFXL 2K7DA 2V53A 2F3ZA 2F8PA 2KI4C 4BY5A 2OTGB 5KSZA 2COLB 1XFUO 3VRQA 2JNXA 3OHMB 2CNPA 1JFKA 2BKHB 5HLOA 1HT9A 5DKRA 1ODBA 4PDZA 2KYFA 1S5GZ 1B8RA 1J55A 1CLMA 1KSOA 3IF7A 1W7JB 2BE4A 2JXCA 1UHHA 3PATA 1RK9A 1DTLA 2KFFA 4HSZA 4ORBB 4GBAA 3NSOA 1GGZA 1Y0VH 1RWYA 2KAVA 1SK6D 3I5GB 2KI6D 3OB2B 4PE1A 4E68A 3EKJA 2ZN9A 3C1VA 3A4UB 1CDLA 1B47A 1N65A 5HKZA 1NCXA 1PRWA 2CCMA 1NYAA 1QV0A 3I5GC 3SG2A 4N1GA 2L98A 1ZFSA 1YUUA 1DJIA 2OPOA 1PSRA 5J3XA 1QJTA 2KOTA 1RTP1 5KU1A 1G8IA 1QLSA 3TUYC 1CMFA 1CM4A 1B1GA 1SNLA 5AFPA 1Y6WA 3SIBA 5AEQA 1BF5A 4DCKA 5CSNA 2ZFDA 2M29A 3AKAA 2JWWA 5CSIA 2K2AA 1SKTA 2KQYA 3CLNA 1A75B 1UUSA 4CFRA 1KK8C 1XVJA 1DT7B 1K94A 2I2RE 2LC5A 2GGZA 1AJ5A 3RLZA 1S36A 2JC2A 3F45A 2KSPA 4ORAB 1XFWO 1AP4A 3LK1A 1K95A 3CR5X 4MRXA 2MLFC 1MXEA 1UHNA 1YRUB 2LV7A 4C0LA 3TDUA 2KBMA 4MEWA 2ISDA 2Y1NA 3BOWA 2LM5A 1RECA 1SW8A 2WCEA 3KF9A 3NSKA 4OKHA 5CSFA 3KPXA 5JJGA 1KWOC 2ZN8A 2BBNA 5AXIA 2KGBC 5HLVA 3EVRA 1IWQA 4AOMA 1ZOTB 1NSHA 1QASA 4M2QA 4USLA 1J1DA 3QRXA 2EC6C 1NPQA 1F4QA 3O4YA 4QJ4B 2B1UA 1KQMB 1A03A 3NSIA 3K21A 1J7OA 1CNPA 2KHNA 4YGAA 1CDPA 1M63B 1AHRA 1DJXA 2ZRTA 2K7BA 2JT8A 1J7RA 4ZCVA 2LVVA 1YRTB 1S6CA 1C7WA 1IRJA 4JQ0D 4Q04A 1U5IA 2MA2A 3D0YB 3I5HB 1W7IB 2LLTA 2KYCA 1L2OC 5HKYA 3KO0A 1CFPA 3PFVA 4OCIA 2PRUA 1S26D 2LMUA 3DD4A 4PHKA 1FPWA 2F2PA 1OE9B 3I5HC 1FI5A 3SG6A 2BECA 1A2XA 4GGNA 4R1EA 4I5KA 2LMTA 1IH0A 4XYNA 1BR4B 1N0YA 1UP5A 4GGFA 1OMRA 2LUXA 1K90D 1Y1AA 2M9GA 1OZOA 1K9UA 2OS8B 3GK2A 1SYMA 4FQOA 2JQ6A 4MN0A 3VROA 4PE0A 2D8NA 2LCPA 1CTRA 2GV5A 3JTDC 1FI6A 2HETA 2TN4A 3GK4X 2KDHA 4N1FA 4FTGA 2OS8C 4DS7A 4PCWA 2MAZA 1XO5A 1B4CA 4M2PA 1B8LA 2KNEA 1NP8A 1G4YR 1WLMA 5ER5A 4UPGA 2EGDA 1XFXO 1PALA 4BY4A 4PE7A 3SG5A 2KBIA 1F55A 4C0KA 1G33A 1S3PA 1TCOB 2I7AA 3GOFA 1NUBA 2L0PA 1SCVA 1WDCC 3BYAA 3LL8B 5HKWA 1CFCA 2HQWA 2JT3A 1SL9A 4MBEA 2WCBA 3WXAA 1LA3A 1DGUA 3LK0A 2O60A 3FWBA 4PE4A 3FWCA 1KFUL 1C7VA 2ZNEA 2F2OA 2PVBA 1H8BA 2BCBA 2PMYA 4ZCUA 2BE6A 2H61A 3LCPC 4NDBA 1TNWA 2LVKA 3TUYB 3VGOA 3TS5B 2BL0B 4MZLA 4L9MA 2QPTA 4YGEB 1SCMC 1Y1UA 2G2BA 1NWDA 4XJKA 1Q80A 1JF0A 4CFQA 2P6BB 4YGBB 1JSAA 1ALVA 2SCPA 2KFHA 1GGWA 3TS5C 2BL0C 4JPZB 3EVVA 2M7LA 2Y1MA 1GQMA 1FF1A 2NCOA 1KK8B 2M97A 3DF0A 4YI8A 1S1EA 3DVEA 2Q91A 3CR4X 4I5JA 4YGCB 1AK8A 1F54A 3OX5A 1C07A 1F8HA 4MRYA 2LLUA 1YURA 2L2EA 4U8DA 1MHOA 1SPYA 1SY9A 3GK1A 1TNQA 2K0JA 5AERA 1BODA 1YUSA 3PALA 2JXLA 4D1EA 1DF0B 2LHLA 2DOQA 1J7QA 1WY9A 2LVIA 1TOPA 1QX7A 3BUNB 4MVFA 1KWOB 3E3RA 1XA5A 2AMIA 4CLNA 3KHEA 1QXPA 1B9AA 3BUMB 3KEVA 3ZNIA 4P2YB 4C0JA 1XYDA 4P5OE 3OB1B 4OR9B 5AANA 2EC6B 1V1GA 3SG4A 4WQ2A 3DVMA 3IQQA 1HQVA 1BG1A 1M39A 2AUCA 2WNDA 4I5NB 4OV2A 1N2DA 1PVAA 3O78A 4NDDA 1QX5B 4PALA 1XFZO 2F33A 3IQOA 5G08A 2BKIB 1QIVA 2LNKA 2MJWB 2LMVA 2E6WA 2KFGA 3NXAA 3PSRA 5HYDA 3TDZA 1IQ3A 1S6JA 1CKKA 2WOSA 4A4CA 1TNPA 2O5GA 1L2OB 2L50A 1CB1A 1K93D 1SL7A 4F0ZB 2IS9A 1CM1A 2FJUB 3EKHA 3CWGA 2M49B 4DRWA 2HF5A 2JU0A 1OSAA 3SG7A 1UHIA 3VRPA 1LINA 1MQ1A 5PALA 1K9PA 2KAYA 5I2LA 3HCMA 1CDNA 1PK0D 2Q4UA 2FOTA 4NDCA 1EG3A 2LANA 2BCXA 1F71A 4TNCA 1JFJA 1DGVA 2EHBA 4GFTA 1SR6B 3JTDB 1TRFA 4GAOA 1OQPA 4MZJA 2GGMA 4ORCB 5IBWA 3H4SE 1A75A 1VRKA 1E8AA 1UWOA 1M45A 3EVUA 1QIWA 1YX8A 1KSMA 1CFFA 3HX4A 1UURA 4MLWA 5DKQA 2NCPA 2HQ8A 1JC2A 1NX2A 1SR6C 3D10A 1KK7Y 3WHTB 3WHUB 3DVJA 1TTXA 2LUCA 1WRKA 2CTNA 2MHHA 3I5IB 1QLKA 1R6PA 2JT0A 2Y4QA 1PULA 2JZIA 4PHNA 1NIWA 1LXFC 3EK7A 1CDMA 3SG3A 5GQQC 2AAOA 2JPTA 1CLBA 1NCYA 3AAJA 1WDCB 4DUQA 1CMGA 1MF8B 1TN4A 2JOJA 2MRDA 3I5IC 4MZKA 4GUKA 1TCFA 1Y1XA 1KCYA 1KK7Z 3BQ3A 3FIAA 3I5FC 1XK4A 4NQGA 1F4OA 4YI9A 1NCZA 2CXJA 3CR2A 3O6BA 1JBAA 1QATA 1YVLA 1DJYA 1J7PA 2WC8A 4A4BA 1TNXA 2NLNA 1AVSA 1IKUA 1LA0A 3CZTX 1NX1A 2M3WA 1SCMB 4IL1A 4WQ3A 1SMGA 2MBXA 1FBVA 2FCEA 2M7NA 2QACA 1NX3A 3O2PA 1S6IA 4YBHB 1AJ4A 1R2UA 3FS7A 2WORA 3BOWB 1K8UA 1WLZA 2I18A 2OTGC 3D0YA 1ZACA 4QJ5B 2KQ6A 1DJHA 5ER4X 2CT9A 1YR5A 3BUOB 1KFXS 1OOJA 2JTZA 1K9KA 1DMOA 2PASA 5I8NA 3A8RA 5TNCA 1MR8A 3EK4A 1IQ5A 3ZWHA 1EG4A 2LLSA 1DJGA 1IG5A 1YVHA 2ZKMX 2L4HA 1NX0A 3DVKA 1B7TY 3LLEA 2L4IA 2BBMA 4M2OA 3JVTB 3ICBA 3WNXB 1QVIY 1EH2A 1GJYA 2KI6C 1F70A 2JTTA 5D7FA 1J1EA 2JULA 1SRAA 1X02A 2WCFA 1A4PA 1SL8A 2FCDA 2KGRA 3NSLA 1CLLA 1U5IB 4ICBA 4PHMA 3TDIA 4CIDA 1BLQA 1SBJA 2LHIA 1IJ6A 1A29A 1WRZA 2Y5IA 3JVTC 2CBLA 2NXQA 4N5XA 5CPVA 1M31A 5KTYA 1IGVA 2K8MB 4HREE 1B7TZ 2F3YA 1B8CA 1KFUS 1LVCD 2PALA 1KQVA 4YRUA 2L51A 1JWDA 1QVIZ 4ETOA 2NZ0A 3EK8A 1YTZC 2M8UA 2ZRSA 1BT6A 2KAXA 1AUIB 4GPLB 4HRGA 1LKJA 4JWQA 1IJ5A 5DKNA 1K96A 5D69A 1EL4A 1DVIA 1DJZA 1YX7A 3SJSA 4YGDB 1QTXA 1RFJA 3OX6A 4DIRA 2M0RA 4GGFC 1QV1A 1DJWA 2I94A 1JF2A 5JOLA 1L7ZA 2SASA 3CTNA 3CS1A 2K7OA 5F6TA 2PSRA 1UHKA 1M46A 3MSEB 1H4BA 1D1OA 1CFDA 2LE9B 1ZUZA 2L5XB 1PSBA 2VRGA 1BR1B 2LVJA 3BUWB 2LAPA 1OZSA 3BUXB 3AAKA 4I5LB 1MWNA 5K89A 4CPVA 4AQJA 3TZ1A 1BMOA 1MUXA 1ZMZA 2LP3A 1XFVO 1QS7A 5CSJA 3BXKA 2A4JA 4WRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPJ A;  1ALW A;  1QX2 A;  5I2Q A;  1XK4 C;  3PN7 B;  1PVB A;  4HRH A;  3M0W A;  2K61 A;  3VRR A;  2M1U A;  1KQM C;  2K7C A;  2MLE C;  1MXL C;  1TIZ A;  1BJF A;  2HPS A;  1K2H A;  3OP0 A;  2H2K A;  4MSP A;  3PN7 C;  1OMD A;  4XJK B;  2M1K B;  2JNF A;  2R2I A;  1DF0 A;  4AQI A;  3PLF B;  4PHJ A;  2H61 C;  1FW4 A;  4QJ3 B;  5I2O A;  5FYX A;  4OVN F;  2BCA A;  5B8I B;  2ZND A;  3VRN A;  1OMV A;  2JRF A;  3I5F B;  1XFY O;  3DF0 B;  3PM8 A;  2RGI A;  3SIA A;  3RM1 A;  1BOC A;  2KI4 B;  1S5G Y;  1EXR A;  2K2F A;  4GNK B;  1BU3 A;  1V1F A;  3AKB A;  1RRO A;  2E30 A;  2LP2 A;  1WRL A;  1JUO A;  1EJ3 A;  1UHJ A;  1RJV A;  2G9B A;  1YUT A;  3CGA A;  1KFX L;  2K7D A;  2V53 A;  2F3Z A;  2F8P A;  2KI4 C;  4BY5 A;  2OTG B;  5KSZ A;  2COL B;  1XFU O;  3VRQ A;  2JNX A;  3OHM B;  2CNP A;  1JFK A;  2BKH B;  5HLO A;  1HT9 A;  5DKR A;  1ODB A;  4PDZ A;  2KYF A;  1S5G Z;  1B8R A;  1J55 A;  1CLM A;  1KSO A;  3IF7 A;  1W7J B;  2BE4 A;  2JXC A;  1UHH A;  3PAT A;  1RK9 A;  1DTL A;  2KFF A;  4HSZ A;  4ORB B;  4GBA A;  3NSO A;  1GGZ A;  1Y0V H;  1RWY A;  2KAV A;  1SK6 D;  3I5G B;  2KI6 D;  3OB2 B;  4PE1 A;  4E68 A;  3EKJ A;  2ZN9 A;  3C1V A;  3A4U B;  1CDL A;  1B47 A;  1N65 A;  5HKZ A;  1NCX A;  1PRW A;  2CCM A;  1NYA A;  1QV0 A;  3I5G C;  3SG2 A;  4N1G A;  2L98 A;  1ZFS A;  1YUU A;  1DJI A;  2OPO A;  1PSR A;  5J3X A;  1QJT A;  2KOT A;  1RTP 1;  5KU1 A;  1G8I A;  1QLS A;  3TUY C;  1CMF A;  1CM4 A;  1B1G A;  1SNL A;  5AFP A;  1Y6W A;  3SIB A;  5AEQ A;  1BF5 A;  4DCK A;  5CSN A;  2ZFD A;  2M29 A;  3AKA A;  2JWW A;  5CSI A;  2K2A A;  1SKT A;  2KQY A;  3CLN A;  1A75 B;  1UUS A;  4CFR A;  1KK8 C;  1XVJ A;  1DT7 B;  1K94 A;  2I2R E;  2LC5 A;  2GGZ A;  1AJ5 A;  3RLZ A;  1S36 A;  2JC2 A;  3F45 A;  2KSP A;  4ORA B;  1XFW O;  1AP4 A;  3LK1 A;  1K95 A;  3CR5 X;  4MRX A;  2MLF C;  1MXE A;  1UHN A;  1YRU B;  2LV7 A;  4C0L A;  3TDU A;  2KBM A;  4MEW A;  2ISD A;  2Y1N A;  3BOW A;  2LM5 A;  1REC A;  1SW8 A;  2WCE A;  3KF9 A;  3NSK A;  4OKH A;  5CSF A;  3KPX A;  5JJG A;  1KWO C;  2ZN8 A;  2BBN A;  5AXI A;  2KGB C;  5HLV A;  3EVR A;  1IWQ A;  4AOM A;  1ZOT B;  1NSH A;  1QAS A;  4M2Q A;  4USL A;  1J1D A;  3QRX A;  2EC6 C;  1NPQ A;  1F4Q A;  3O4Y A;  4QJ4 B;  2B1U A;  1KQM B;  1A03 A;  3NSI A;  3K21 A;  1J7O A;  1CNP A;  2KHN A;  4YGA A;  1CDP A;  1M63 B;  1AHR A;  1DJX A;  2ZRT A;  2K7B A;  2JT8 A;  1J7R A;  4ZCV A;  2LVV A;  1YRT B;  1S6C A;  1C7W A;  1IRJ A;  4JQ0 D;  4Q04 A;  1U5I A;  2MA2 A;  3D0Y B;  3I5H B;  1W7I B;  2LLT A;  2KYC A;  1L2O C;  5HKY A;  3KO0 A;  1CFP A;  3PFV A;  4OCI A;  2PRU A;  1S26 D;  2LMU A;  3DD4 A;  4PHK A;  1FPW A;  2F2P A;  1OE9 B;  3I5H C;  1FI5 A;  3SG6 A;  2BEC A;  1A2X A;  4GGN A;  4R1E A;  4I5K A;  2LMT A;  1IH0 A;  4XYN A;  1BR4 B;  1N0Y A;  1UP5 A;  4GGF A;  1OMR A;  2LUX A;  1K90 D;  1Y1A A;  2M9G A;  1OZO A;  1K9U A;  2OS8 B;  3GK2 A;  1SYM A;  4FQO A;  2JQ6 A;  4MN0 A;  3VRO A;  4PE0 A;  2D8N A;  2LCP A;  1CTR A;  2GV5 A;  3JTD C;  1FI6 A;  2HET A;  2TN4 A;  3GK4 X;  2KDH A;  4N1F A;  4FTG A;  2OS8 C;  4DS7 A;  4PCW A;  2MAZ A;  1XO5 A;  1B4C A;  4M2P A;  1B8L A;  2KNE A;  1NP8 A;  1G4Y R;  1WLM A;  5ER5 A;  4UPG A;  2EGD A;  1XFX O;  1PAL A;  4BY4 A;  4PE7 A;  3SG5 A;  2KBI A;  1F55 A;  4C0K A;  1G33 A;  1S3P A;  1TCO B;  2I7A A;  3GOF A;  1NUB A;  2L0P A;  1SCV A;  1WDC C;  3BYA A;  3LL8 B;  5HKW A;  1CFC A;  2HQW A;  2JT3 A;  1SL9 A;  4MBE A;  2WCB A;  3WXA A;  1LA3 A;  1DGU A;  3LK0 A;  2O60 A;  3FWB A;  4PE4 A;  3FWC A;  1KFU L;  1C7V A;  2ZNE A;  2F2O A;  2PVB A;  1H8B A;  2BCB A;  2PMY A;  4ZCU A;  2BE6 A;  2H61 A;  3LCP C;  4NDB A;  1TNW A;  2LVK A;  3TUY B;  3VGO A;  3TS5 B;  2BL0 B;  4MZL A;  4L9M A;  2QPT A;  4YGE B;  1SCM C;  1Y1U A;  2G2B A;  1NWD A;  4XJK A;  1Q80 A;  1JF0 A;  4CFQ A;  2P6B B;  4YGB B;  1JSA A;  1ALV A;  2SCP A;  2KFH A;  1GGW A;  3TS5 C;  2BL0 C;  4JPZ B;  3EVV A;  2M7L A;  2Y1M A;  1GQM A;  1FF1 A;  2NCO A;  1KK8 B;  2M97 A;  3DF0 A;  4YI8 A;  1S1E A;  3DVE A;  2Q91 A;  3CR4 X;  4I5J A;  4YGC B;  1AK8 A;  1F54 A;  3OX5 A;  1C07 A;  1F8H A;  4MRY A;  2LLU A;  1YUR A;  2L2E A;  4U8D A;  1MHO A;  1SPY A;  1SY9 A;  3GK1 A;  1TNQ A;  2K0J A;  5AER A;  1BOD A;  1YUS A;  3PAL A;  2JXL A;  4D1E A;  1DF0 B;  2LHL A;  2DOQ A;  1J7Q A;  1WY9 A;  2LVI A;  1TOP A;  1QX7 A;  3BUN B;  4MVF A;  1KWO B;  3E3R A;  1XA5 A;  2AMI A;  4CLN A;  3KHE A;  1QXP A;  1B9A A;  3BUM B;  3KEV A;  3ZNI A;  4P2Y B;  4C0J A;  1XYD A;  4P5O E;  3OB1 B;  4OR9 B;  5AAN A;  2EC6 B;  1V1G A;  3SG4 A;  4WQ2 A;  3DVM A;  3IQQ A;  1HQV A;  1BG1 A;  1M39 A;  2AUC A;  2WND A;  4I5N B;  4OV2 A;  1N2D A;  1PVA A;  3O78 A;  4NDD A;  1QX5 B;  4PAL A;  1XFZ O;  2F33 A;  3IQO A;  5G08 A;  2BKI B;  1QIV A;  2LNK A;  2MJW B;  2LMV A;  2E6W A;  2KFG A;  3NXA A;  3PSR A;  5HYD A;  3TDZ A;  1IQ3 A;  1S6J A;  1CKK A;  2WOS A;  4A4C A;  1TNP A;  2O5G A;  1L2O B;  2L50 A;  1CB1 A;  1K93 D;  1SL7 A;  4F0Z B;  2IS9 A;  1CM1 A;  2FJU B;  3EKH A;  3CWG A;  2M49 B;  4DRW A;  2HF5 A;  2JU0 A;  1OSA A;  3SG7 A;  1UHI A;  3VRP A;  1LIN A;  1MQ1 A;  5PAL A;  1K9P A;  2KAY A;  5I2L A;  3HCM A;  1CDN A;  1PK0 D;  2Q4U A;  2FOT A;  4NDC A;  1EG3 A;  2LAN A;  2BCX A;  1F71 A;  4TNC A;  1JFJ A;  1DGV A;  2EHB A;  4GFT A;  1SR6 B;  3JTD B;  1TRF A;  4GAO A;  1OQP A;  4MZJ A;  2GGM A;  4ORC B;  5IBW A;  3H4S E;  1A75 A;  1VRK A;  1E8A A;  1UWO A;  1M45 A;  3EVU A;  1QIW A;  1YX8 A;  1KSM A;  1CFF A;  3HX4 A;  1UUR A;  4MLW A;  5DKQ A;  2NCP A;  2HQ8 A;  1JC2 A;  1NX2 A;  1SR6 C;  3D10 A;  1KK7 Y;  3WHT B;  3WHU B;  3DVJ A;  1TTX A;  2LUC A;  1WRK A;  2CTN A;  2MHH A;  3I5I B;  1QLK A;  1R6P A;  2JT0 A;  2Y4Q A;  1PUL A;  2JZI A;  4PHN A;  1NIW A;  1LXF C;  3EK7 A;  1CDM A;  3SG3 A;  5GQQ C;  2AAO A;  2JPT A;  1CLB A;  1NCY A;  3AAJ A;  1WDC B;  4DUQ A;  1CMG A;  1MF8 B;  1TN4 A;  2JOJ A;  2MRD A;  3I5I C;  4MZK A;  4GUK A;  1TCF A;  1Y1X A;  1KCY A;  1KK7 Z;  3BQ3 A;  3FIA A;  3I5F C;  1XK4 A;  4NQG A;  1F4O A;  4YI9 A;  1NCZ A;  2CXJ A;  3CR2 A;  3O6B A;  1JBA A;  1QAT A;  1YVL A;  1DJY A;  1J7P A;  2WC8 A;  4A4B A;  1TNX A;  2NLN A;  1AVS A;  1IKU A;  1LA0 A;  3CZT X;  1NX1 A;  2M3W A;  1SCM B;  4IL1 A;  4WQ3 A;  1SMG A;  2MBX A;  1FBV A;  2FCE A;  2M7N A;  2QAC A;  1NX3 A;  3O2P A;  1S6I A;  4YBH B;  1AJ4 A;  1R2U A;  3FS7 A;  2WOR A;  3BOW B;  1K8U A;  1WLZ A;  2I18 A;  2OTG C;  3D0Y A;  1ZAC A;  4QJ5 B;  2KQ6 A;  1DJH A;  5ER4 X;  2CT9 A;  1YR5 A;  3BUO B;  1KFX S;  1OOJ A;  2JTZ A;  1K9K A;  1DMO A;  2PAS A;  5I8N A;  3A8R A;  5TNC A;  1MR8 A;  3EK4 A;  1IQ5 A;  3ZWH A;  1EG4 A;  2LLS A;  1DJG A;  1IG5 A;  1YVH A;  2ZKM X;  2L4H A;  1NX0 A;  3DVK A;  1B7T Y;  3LLE A;  2L4I A;  2BBM A;  4M2O A;  3JVT B;  3ICB A;  3WNX B;  1QVI Y;  1EH2 A;  1GJY A;  2KI6 C;  1F70 A;  2JTT A;  5D7F A;  1J1E A;  2JUL A;  1SRA A;  1X02 A;  2WCF A;  1A4P A;  1SL8 A;  2FCD A;  2KGR A;  3NSL A;  1CLL A;  1U5I B;  4ICB A;  4PHM A;  3TDI A;  4CID A;  1BLQ A;  1SBJ A;  2LHI A;  1IJ6 A;  1A29 A;  1WRZ A;  2Y5I A;  3JVT C;  2CBL A;  2NXQ A;  4N5X A;  5CPV A;  1M31 A;  5KTY A;  1IGV A;  2K8M B;  4HRE E;  1B7T Z;  2F3Y A;  1B8C A;  1KFU S;  1LVC D;  2PAL A;  1KQV A;  4YRU A;  2L51 A;  1JWD A;  1QVI Z;  4ETO A;  2NZ0 A;  3EK8 A;  1YTZ C;  2M8U A;  2ZRS A;  1BT6 A;  2KAX A;  1AUI B;  4GPL B;  4HRG A;  1LKJ A;  4JWQ A;  1IJ5 A;  5DKN A;  1K96 A;  5D69 A;  1EL4 A;  1DVI A;  1DJZ A;  1YX7 A;  3SJS A;  4YGD B;  1QTX A;  1RFJ A;  3OX6 A;  4DIR A;  2M0R A;  4GGF C;  1QV1 A;  1DJW A;  2I94 A;  1JF2 A;  5JOL A;  1L7Z A;  2SAS A;  3CTN A;  3CS1 A;  2K7O A;  5F6T A;  2PSR A;  1UHK A;  1M46 A;  3MSE B;  1H4B A;  1D1O A;  1CFD A;  2LE9 B;  1ZUZ A;  2L5X B;  1PSB A;  2VRG A;  1BR1 B;  2LVJ A;  3BUW B;  2LAP A;  1OZS A;  3BUX B;  3AAK A;  4I5L B;  1MWN A;  5K89 A;  4CPV A;  4AQJ A;  3TZ1 A;  1BMO A;  1MUX A;  1ZMZ A;  2LP3 A;  1XFV O;  1QS7 A;  5CSJ A;  3BXK A;  2A4J A;  4WRI A; 
#chains in the Genus database with same CATH topology
 5BPJ A;  1ALW A;  1QX2 A;  5I2Q A;  4OZD A;  1XK4 C;  3PN7 B;  1PVB A;  4HRH A;  3M0W A;  2FJY A;  2K61 A;  3VRR A;  1OOG A;  2M1U A;  1KQM C;  2K7C A;  2MLE C;  1MXL C;  1TIZ A;  1BJF A;  2HPS A;  1K2H A;  2WC6 A;  2H2K A;  3OP0 A;  2ERB A;  4MSP A;  3PN7 C;  1OMD A;  4XJK B;  2M1K B;  2JNF A;  2R2I A;  1DF0 A;  4AQI A;  3PLF B;  4PHJ A;  2H61 C;  1FW4 A;  4QJ3 B;  5I2O A;  5FYX A;  4OVN F;  2BCA A;  2P70 A;  5B8I B;  2ZND A;  3VRN A;  1OMV A;  2JRF A;  3D73 A;  3I5F B;  3DY9 A;  1XFY O;  3DF0 B;  3PM8 A;  2RGI A;  2QEO A;  3SIA A;  3RM1 A;  1BOC A;  2KI4 B;  1S5G Y;  1EXR A;  2K2F A;  4GNK B;  1BU3 A;  1V1F A;  3AKB A;  1RRO A;  2E30 A;  2LP2 A;  1WRL A;  1JUO A;  1EJ3 A;  1UHJ A;  1RJV A;  2G9B A;  1YUT A;  3CGA A;  1KFX L;  2K7D A;  2V53 A;  2F3Z A;  2F8P A;  2KI4 C;  4BY5 A;  2OTG B;  5KSZ A;  3FE8 A;  2COL B;  1XFU O;  2QEV A;  5FI7 A;  3VRQ A;  2JNX A;  2L5Y A;  2CNP A;  1JFK A;  2BKH B;  2WCM A;  3OHM B;  1HT9 A;  5HLO A;  5DKR A;  1ODB A;  4PDZ A;  2KYF A;  1S5G Z;  1B8R A;  3S0A A;  3S0D A;  1J55 A;  1CLM A;  1KSO A;  3IF7 A;  1DEL A;  3EG5 B;  1W7J B;  2BE4 A;  2JXC A;  1UHH A;  3PAT A;  1RK9 A;  1DTL A;  2KFF A;  4HSZ A;  4ORB B;  3NHT A;  4GBA A;  3NSO A;  1GGZ A;  1Y0V H;  1RWY A;  2KAV A;  1SK6 D;  3I5G B;  2KI6 D;  3OB2 B;  4PE1 A;  4E68 A;  3EKJ A;  2ZN9 A;  3C1V A;  3D78 A;  3A4U B;  1CDL A;  1B47 A;  1N65 A;  5HKZ A;  1NCX A;  1PRW A;  2CCM A;  1NYA A;  1QV0 A;  3I5G C;  2WCL A;  3SG2 A;  4N1G A;  2L98 A;  1ZFS A;  3N7H A;  3S0B A;  1YUU A;  1DJI A;  3R1O A;  2OPO A;  3B7A A;  1PSR A;  3NGV A;  5J3X A;  1QJT A;  2KOT A;  1RTP 1;  5KU1 A;  3B6X A;  1G8I A;  1QLS A;  3TUY C;  1CMF A;  1CM4 A;  1B1G A;  1SNL A;  5AFP A;  1Y6W A;  3SIB A;  2GTE A;  5AEQ A;  1BF5 A;  4DCK A;  1IIO A;  5CSN A;  3S0E A;  1OW4 A;  3DZT A;  2ZFD A;  2M29 A;  3AKA A;  2JWW A;  5CSI A;  2K2A A;  1LS8 A;  1SKT A;  3L47 A;  2KQY A;  3CLN A;  1A75 B;  1UUS A;  4CFR A;  1KK8 C;  1XVJ A;  1DT7 B;  1K94 A;  2I2R E;  2LC5 A;  2GGZ A;  1AJ5 A;  3RLZ A;  5HL1 A;  1S36 A;  2JC2 A;  3F45 A;  2KSP A;  4ORA B;  1XFW O;  1AP4 A;  3LK1 A;  1K95 A;  3CR5 X;  4MRX A;  2MLF C;  1MXE A;  1UHN A;  1YRU B;  2LV7 A;  3NHI A;  3TDU A;  4C0L A;  2KBM A;  4MEW A;  2ISD A;  3VB1 A;  2Y1N A;  3BOW A;  2LM5 A;  1REC A;  1SW8 A;  3D74 A;  2WCE A;  3KF9 A;  3NSK A;  1W9Z A;  4INX A;  3KPX A;  4OKH A;  5CSF A;  1KWO C;  5JJG A;  2ZN8 A;  2BBN A;  5AXI A;  2KGB C;  5HLV A;  3O4X A;  3EVR A;  1IWQ A;  4AOM A;  1ZOT B;  1NSH A;  1QAS A;  4M2Q A;  4USL A;  1J1D A;  3QRX A;  2EC6 C;  3CDN A;  1NPQ A;  1F4Q A;  3O4Y A;  4QJ4 B;  2B1U A;  1KQM B;  1A03 A;  2JPO A;  3NSI A;  3K21 A;  1J7O A;  2K60 A;  1CNP A;  3FE9 A;  2KHN A;  4YGA A;  1CDP A;  1M63 B;  1AHR A;  1DJX A;  2ZRT A;  2K7B A;  2JT8 A;  1J7R A;  4ZCV A;  2LVV A;  1YRT B;  1S6C A;  1C7W A;  1IRJ A;  4JQ0 D;  4Q04 A;  1U5I A;  2MA2 A;  3BFB A;  3D0Y B;  3I5H B;  2H8V A;  1W7I B;  2LLT A;  2KYC A;  1SSE B;  1L2O C;  4INW A;  3KO0 A;  5HKY A;  1CFP A;  3CAB A;  3PFV A;  4OCI A;  3OGN A;  2PRU A;  2PYQ A;  1S26 D;  2LMU A;  3DD4 A;  3SS5 A;  4PHK A;  1FPW A;  4IJ7 A;  2F2P A;  1OE9 B;  3I5H C;  1FI5 A;  3SG6 A;  2BEC A;  1A2X A;  4GGN A;  2WC5 A;  4I5K A;  4R1E A;  2LMT A;  1IH0 A;  3PJI A;  4XYN A;  3R72 A;  1BR4 B;  1N0Y A;  1UP5 A;  4GGF A;  1OMR A;  2LUX A;  1K90 D;  1Y1A A;  2M9G A;  1OZO A;  1K9U A;  2OS8 B;  3GK2 A;  5D3O A;  1SYM A;  4FQO A;  2JQ6 A;  4MN0 A;  1OOI X;  3VRO A;  4PE0 A;  4PT1 A;  2D8N A;  2LCP A;  1CTR A;  2GV5 A;  3JTD C;  1FI6 A;  2HET A;  2TN4 A;  3GK4 X;  2KDH A;  4N1F A;  4FTG A;  2OS8 C;  4FQT A;  4DS7 A;  4PCW A;  2MAZ A;  1XO5 A;  1B4C A;  4M2P A;  1B8L A;  2KNE A;  1NP8 A;  1P28 A;  3S0G A;  1G4Y R;  1WLM A;  5ER5 A;  4UPG A;  2EGD A;  1XFX O;  1PAL A;  1DC1 A;  4BY4 A;  4PE7 A;  3SG5 A;  2KBI A;  1F55 A;  4C0K A;  1G33 A;  1S3P A;  1TCO B;  2I7A A;  3GOF A;  1NUB A;  2L0P A;  1SCV A;  1WDC C;  3BYA A;  3LL8 B;  5HKW A;  1CFC A;  2HQW A;  2JT3 A;  1SL9 A;  3BFH A;  2WCB A;  4MBE A;  3WXA A;  1LA3 A;  1DGU A;  3LK0 A;  2O60 A;  3FWB A;  4PE4 A;  3FWC A;  3B88 A;  1DEK A;  1KFU L;  1C7V A;  2ZNE A;  2F2O A;  2PVB A;  1H8B A;  2BCB A;  2PMY A;  4ZCU A;  2BE6 A;  2H61 A;  3LCP C;  4NDB A;  1TNW A;  2LVK A;  3TUY B;  1OOF A;  3VGO A;  3TS5 B;  2BL0 B;  4MZL A;  4L9M A;  2QPT A;  4YGE B;  1SCM C;  1Y1U A;  2G2B A;  1NWD A;  4XJK A;  1Q80 A;  1JF0 A;  4CFQ A;  2P6B B;  4YGB B;  1JSA A;  1ALV A;  2SCP A;  2KFH A;  5FI6 A;  3TS5 C;  1GGW A;  2BL0 C;  4JPZ B;  3EVV A;  2M7L A;  2Y1M A;  3CZ2 A;  1GQM A;  1FF1 A;  2NCO A;  1KK8 B;  2M97 A;  5I94 A;  3DF0 A;  4YI8 A;  1S1E A;  3DVE A;  2Q91 A;  3CR4 X;  4I5J A;  4YGC B;  1AK8 A;  1F54 A;  3OX5 A;  2WCJ A;  1C07 A;  1F8H A;  2KLD A;  2LLU A;  4MRY A;  1YUR A;  2L2E A;  4U8D A;  1MHO A;  1SPY A;  1SY9 A;  3GK1 A;  1TNQ A;  2K0J A;  5AER A;  1BOD A;  1YUS A;  3PAL A;  2JXL A;  3DYE A;  4D1E A;  1DF0 B;  1TUZ A;  2LHL A;  2DOQ A;  3BJH A;  1J7Q A;  1WY9 A;  2LVI A;  1TOP A;  1QX7 A;  3BUN B;  4MVF A;  1KWO B;  3E3R A;  1XA5 A;  2AMI A;  4CLN A;  3KHE A;  1QXP A;  3B87 A;  1B9A A;  3BUM B;  1QWV A;  3KEV A;  2QDI A;  3ZNI A;  3CZ0 A;  4P2Y B;  4C0J A;  3S0F A;  1XYD A;  4P5O E;  3OB1 B;  4OR9 B;  5AAN A;  2EC6 B;  1V1G A;  3SG4 A;  2WCH A;  4WQ2 A;  3DVM A;  3IQQ A;  1HQV A;  1BG1 A;  1M39 A;  2AUC A;  2WND A;  4I5N B;  2QEB A;  4OV2 A;  1N2D A;  1PVA A;  2BAP A;  3K1E A;  3O78 A;  1QX5 B;  4NDD A;  4PAL A;  1XFZ O;  2F33 A;  3IQO A;  1Z2C B;  3PM2 A;  5G08 A;  2BKI B;  1QIV A;  1OOH A;  2LNK A;  2MJW B;  2LMV A;  2E6W A;  2KFG A;  3NXA A;  3PSR A;  4F7F A;  5HYD A;  3TDZ A;  1IQ3 A;  1S6J A;  1CKK A;  2WOS A;  4A4C A;  1TNP A;  2O5G A;  4JD9 A;  1L2O B;  2L50 A;  3FE6 A;  1CB1 A;  1K93 D;  1SL7 A;  4F0Z B;  2IS9 A;  1CM1 A;  2FJU B;  3EKH A;  3CWG A;  2M49 B;  3R1P A;  4DRW A;  2HF5 A;  2JU0 A;  1OSA A;  3SG7 A;  1UHI A;  3CZ1 A;  1LIN A;  1MQ1 A;  5PAL A;  3VRP A;  1K9P A;  2KAY A;  5I2L A;  3HCM A;  1CDN A;  1PK0 D;  2Q4U A;  5FI2 A;  2FOT A;  4NDC A;  1EG3 A;  2LAN A;  2BCX A;  1F71 A;  4TNC A;  3R1V A;  3D75 A;  1JFJ A;  3QME A;  1DGV A;  2EHB A;  4GFT A;  1SR6 B;  3JTD B;  3V2L A;  1TRF A;  4GAO A;  1OQP A;  4MZJ A;  2GGM A;  4ORC B;  5IBW A;  3H4S E;  1A75 A;  1VRK A;  1E8A A;  1UWO A;  1M45 A;  3EVU A;  1QIW A;  1YX8 A;  1KSM A;  1CFF A;  3HX4 A;  1UUR A;  4MLW A;  5DKQ A;  2NCP A;  2HQ8 A;  1JC2 A;  1NX2 A;  1SR6 C;  3D10 A;  1KK7 Y;  3WHT B;  3WHU B;  3DVJ A;  1TTX A;  2KPH A;  2LUC A;  1WRK A;  2CTN A;  2MHH A;  3I5I B;  1QLK A;  1R6P A;  2JT0 A;  2Y4Q A;  1PUL A;  2JZI A;  2BNX A;  4JKT A;  4PHN A;  1NIW A;  1LXF C;  2WCK A;  1CDM A;  3EK7 A;  3SG3 A;  5GQQ C;  2AAO A;  2JPT A;  1T14 A;  5DIC A;  1CLB A;  1NCY A;  3AAJ A;  1WDC B;  4DUQ A;  1CMG A;  1MF8 B;  1TN4 A;  2JOJ A;  2MRD A;  3I5I C;  4MZK A;  4GUK A;  1TCF A;  1Y1X A;  1KCY A;  1KK7 Z;  3BQ3 A;  3FIA A;  3RZS A;  3I5F C;  1XK4 A;  4NQG A;  1F4O A;  4YI9 A;  1NCZ A;  2P71 A;  2CXJ A;  2PQL A;  3CR2 A;  3O6B A;  1JBA A;  1QAT A;  3UNW A;  1YVL A;  1DJY A;  1J7P A;  2WC8 A;  4A4B A;  1TNX A;  2NLN A;  1AVS A;  1IKU A;  1LA0 A;  1TWO A;  3CZT X;  3L4L A;  1NX1 A;  2M3W A;  1SCM B;  4IL1 A;  4WQ3 A;  1SMG A;  2MBX A;  1FBV A;  2FCE A;  2M7N A;  2QAC A;  1NX3 A;  3O2P A;  1S6I A;  4YBH B;  1AJ4 A;  1R2U A;  3FS7 A;  2WOR A;  3L4A A;  3BOW B;  1K8U A;  1WLZ A;  1XFR A;  2I18 A;  2OTG C;  3D0Y A;  1ORG A;  1ZAC A;  4QJ5 B;  2KQ6 A;  1DJH A;  5ER4 X;  2CT9 A;  1YR5 A;  3BUO B;  1KFX S;  1OOJ A;  2JTZ A;  1K9K A;  1DMO A;  2PAS A;  3DXL A;  3A8R A;  5I8N A;  5TNC A;  1MR8 A;  3EK4 A;  1IQ5 A;  3ZWH A;  1EG4 A;  2LLS A;  1DJG A;  1IG5 A;  1YVH A;  2ZKM X;  2L4H A;  1NX0 A;  3DVK A;  1B7T Y;  3LLE A;  2L4I A;  2BBM A;  3BFA A;  4M2O A;  3JVT B;  3ICB A;  3WNX B;  1QVI Y;  2KLE A;  1EH2 A;  1GJY A;  2KI6 C;  1F70 A;  2JTT A;  5D7F A;  1J1E A;  2JUL A;  1SRA A;  1X02 A;  2WCF A;  1A4P A;  1SL8 A;  2FCD A;  2KGR A;  3NSL A;  1CLL A;  1U5I B;  4ICB A;  4PHM A;  3TDI A;  3SS4 A;  4CID A;  1SBJ A;  1BLQ A;  2LHI A;  1IJ6 A;  1A29 A;  1WRZ A;  2Y5I A;  2YGU A;  3JVT C;  2CBL A;  2NXQ A;  4N5X A;  5CPV A;  1C3Z A;  1M31 A;  5KTY A;  1IGV A;  2K8M B;  4HRE E;  1B7T Z;  2F3Y A;  1B8C A;  1KFU S;  1LVC D;  2PAL A;  1KQV A;  4YRU A;  2L51 A;  1JWD A;  1QVI Z;  4ETO A;  2NZ0 A;  3EK8 A;  1YTZ C;  2M8U A;  3B86 A;  2ZRS A;  1BT6 A;  2KAX A;  1AUI B;  4GPL B;  4HRG A;  1LKJ A;  4JWQ A;  1IJ5 A;  5DKN A;  1K96 A;  5D69 A;  1TUJ A;  1EL4 A;  1DVI A;  3D77 A;  1DJZ A;  1YX7 A;  3SJS A;  4YGD B;  1Z4H A;  1QTX A;  1RFJ A;  3OX6 A;  4DIR A;  2M0R A;  4GGF C;  1QV1 A;  1DJW A;  2I94 A;  2QEH A;  1JF2 A;  5JOL A;  1L7Z A;  2SAS A;  3CTN A;  3CS1 A;  3CYZ A;  2K7O A;  5F6T A;  2PSR A;  1UHK A;  1M46 A;  3MSE B;  3IVT A;  1D1O A;  1H4B A;  1DQE A;  1CFD A;  4KYN A;  2LE9 B;  1ZUZ A;  2L5X B;  1PSB A;  2VRG A;  3D76 A;  1BR1 B;  2LVJ A;  3BUW B;  1C3Y A;  2LAP A;  1OZS A;  5EL2 A;  3BUX B;  3AAK A;  4I5L B;  1MWN A;  5K89 A;  2L2C A;  4CPV A;  4AQJ A;  3SS3 A;  3OBV A;  3TZ1 A;  1BMO A;  1MUX A;  1ZMZ A;  2LP3 A;  1XFV O;  3UO9 A;  1QS7 A;  3Q8I A;  1GM0 A;  5CSJ A;  3BXK A;  2A4J A;  4WRI A; 
#chains in the Genus database with same CATH homology
 5BPJ A;  1ALW A;  1QX2 A;  5I2Q A;  1XK4 C;  3PN7 B;  1PVB A;  4HRH A;  3M0W A;  2K61 A;  3VRR A;  2M1U A;  1KQM C;  2K7C A;  2MLE C;  1MXL C;  1TIZ A;  1BJF A;  2HPS A;  1K2H A;  3OP0 A;  2H2K A;  4MSP A;  3PN7 C;  1OMD A;  4XJK B;  2M1K B;  2JNF A;  2R2I A;  1DF0 A;  4AQI A;  3PLF B;  4PHJ A;  2H61 C;  1FW4 A;  4QJ3 B;  5I2O A;  5FYX A;  4OVN F;  2BCA A;  5B8I B;  2ZND A;  3VRN A;  1OMV A;  2JRF A;  3I5F B;  1XFY O;  3DF0 B;  3PM8 A;  2RGI A;  3SIA A;  3RM1 A;  1BOC A;  2KI4 B;  1S5G Y;  1EXR A;  2K2F A;  4GNK B;  1BU3 A;  1V1F A;  3AKB A;  1RRO A;  2E30 A;  2LP2 A;  1WRL A;  1JUO A;  1EJ3 A;  1UHJ A;  1RJV A;  2G9B A;  1YUT A;  3CGA A;  1KFX L;  2K7D A;  2V53 A;  2F3Z A;  2F8P A;  2KI4 C;  4BY5 A;  2OTG B;  5KSZ A;  2COL B;  1XFU O;  3VRQ A;  2JNX A;  3OHM B;  2CNP A;  1JFK A;  2BKH B;  5HLO A;  1HT9 A;  5DKR A;  1ODB A;  4PDZ A;  2KYF A;  1S5G Z;  1B8R A;  1J55 A;  1CLM A;  1KSO A;  3IF7 A;  1W7J B;  2BE4 A;  2JXC A;  1UHH A;  3PAT A;  1RK9 A;  1DTL A;  2KFF A;  4HSZ A;  4ORB B;  4GBA A;  3NSO A;  1GGZ A;  1Y0V H;  1RWY A;  2KAV A;  1SK6 D;  3I5G B;  2KI6 D;  3OB2 B;  4PE1 A;  4E68 A;  3EKJ A;  2ZN9 A;  3C1V A;  3A4U B;  1CDL A;  1B47 A;  1N65 A;  5HKZ A;  1NCX A;  1PRW A;  2CCM A;  1NYA A;  1QV0 A;  3I5G C;  3SG2 A;  4N1G A;  2L98 A;  1ZFS A;  1YUU A;  1DJI A;  2OPO A;  1PSR A;  5J3X A;  1QJT A;  2KOT A;  1RTP 1;  5KU1 A;  1G8I A;  1QLS A;  3TUY C;  1CMF A;  1CM4 A;  1B1G A;  1SNL A;  5AFP A;  1Y6W A;  3SIB A;  5AEQ A;  1BF5 A;  4DCK A;  5CSN A;  2ZFD A;  2M29 A;  3AKA A;  2JWW A;  5CSI A;  2K2A A;  1SKT A;  2KQY A;  3CLN A;  1A75 B;  1UUS A;  4CFR A;  1KK8 C;  1XVJ A;  1DT7 B;  1K94 A;  2I2R E;  2LC5 A;  2GGZ A;  1AJ5 A;  3RLZ A;  1S36 A;  2JC2 A;  3F45 A;  2KSP A;  4ORA B;  1XFW O;  1AP4 A;  3LK1 A;  1K95 A;  3CR5 X;  4MRX A;  2MLF C;  1MXE A;  1UHN A;  1YRU B;  2LV7 A;  4C0L A;  3TDU A;  2KBM A;  4MEW A;  2ISD A;  2Y1N A;  3BOW A;  2LM5 A;  1REC A;  1SW8 A;  2WCE A;  3KF9 A;  3NSK A;  4OKH A;  5CSF A;  3KPX A;  5JJG A;  1KWO C;  2ZN8 A;  2BBN A;  5AXI A;  2KGB C;  5HLV A;  3EVR A;  1IWQ A;  4AOM A;  1ZOT B;  1NSH A;  1QAS A;  4M2Q A;  4USL A;  1J1D A;  3QRX A;  2EC6 C;  1NPQ A;  1F4Q A;  3O4Y A;  4QJ4 B;  2B1U A;  1KQM B;  1A03 A;  3NSI A;  3K21 A;  1J7O A;  1CNP A;  2KHN A;  4YGA A;  1CDP A;  1M63 B;  1AHR A;  1DJX A;  2ZRT A;  2K7B A;  2JT8 A;  1J7R A;  4ZCV A;  2LVV A;  1YRT B;  1S6C A;  1C7W A;  1IRJ A;  4JQ0 D;  4Q04 A;  1U5I A;  2MA2 A;  3D0Y B;  3I5H B;  1W7I B;  2LLT A;  2KYC A;  1L2O C;  5HKY A;  3KO0 A;  1CFP A;  3PFV A;  4OCI A;  2PRU A;  1S26 D;  2LMU A;  3DD4 A;  4PHK A;  1FPW A;  2F2P A;  1OE9 B;  3I5H C;  1FI5 A;  3SG6 A;  2BEC A;  1A2X A;  4GGN A;  4R1E A;  4I5K A;  2LMT A;  1IH0 A;  4XYN A;  1BR4 B;  1N0Y A;  1UP5 A;  4GGF A;  1OMR A;  2LUX A;  1K90 D;  1Y1A A;  2M9G A;  1OZO A;  1K9U A;  2OS8 B;  3GK2 A;  1SYM A;  4FQO A;  2JQ6 A;  4MN0 A;  3VRO A;  4PE0 A;  2D8N A;  2LCP A;  1CTR A;  2GV5 A;  3JTD C;  1FI6 A;  2HET A;  2TN4 A;  3GK4 X;  2KDH A;  4N1F A;  4FTG A;  2OS8 C;  4DS7 A;  4PCW A;  2MAZ A;  1XO5 A;  1B4C A;  4M2P A;  1B8L A;  2KNE A;  1NP8 A;  1G4Y R;  1WLM A;  5ER5 A;  4UPG A;  2EGD A;  1XFX O;  1PAL A;  4BY4 A;  4PE7 A;  3SG5 A;  2KBI A;  1F55 A;  4C0K A;  1G33 A;  1S3P A;  1TCO B;  2I7A A;  3GOF A;  1NUB A;  2L0P A;  1SCV A;  1WDC C;  3BYA A;  3LL8 B;  5HKW A;  1CFC A;  2HQW A;  2JT3 A;  1SL9 A;  4MBE A;  2WCB A;  3WXA A;  1LA3 A;  1DGU A;  3LK0 A;  2O60 A;  3FWB A;  4PE4 A;  3FWC A;  1KFU L;  1C7V A;  2ZNE A;  2F2O A;  2PVB A;  1H8B A;  2BCB A;  2PMY A;  4ZCU A;  2BE6 A;  2H61 A;  3LCP C;  4NDB A;  1TNW A;  2LVK A;  3TUY B;  3VGO A;  3TS5 B;  2BL0 B;  4MZL A;  4L9M A;  2QPT A;  4YGE B;  1SCM C;  1Y1U A;  2G2B A;  1NWD A;  4XJK A;  1Q80 A;  1JF0 A;  4CFQ A;  2P6B B;  4YGB B;  1JSA A;  1ALV A;  2SCP A;  2KFH A;  1GGW A;  3TS5 C;  2BL0 C;  4JPZ B;  3EVV A;  2M7L A;  2Y1M A;  1GQM A;  1FF1 A;  2NCO A;  1KK8 B;  2M97 A;  3DF0 A;  4YI8 A;  1S1E A;  3DVE A;  2Q91 A;  3CR4 X;  4I5J A;  4YGC B;  1AK8 A;  1F54 A;  3OX5 A;  1C07 A;  1F8H A;  4MRY A;  2LLU A;  1YUR A;  2L2E A;  4U8D A;  1MHO A;  1SPY A;  1SY9 A;  3GK1 A;  1TNQ A;  2K0J A;  5AER A;  1BOD A;  1YUS A;  3PAL A;  2JXL A;  4D1E A;  1DF0 B;  2LHL A;  2DOQ A;  1J7Q A;  1WY9 A;  2LVI A;  1TOP A;  1QX7 A;  3BUN B;  4MVF A;  1KWO B;  3E3R A;  1XA5 A;  2AMI A;  4CLN A;  3KHE A;  1QXP A;  1B9A A;  3BUM B;  3KEV A;  3ZNI A;  4P2Y B;  4C0J A;  1XYD A;  4P5O E;  3OB1 B;  4OR9 B;  5AAN A;  2EC6 B;  1V1G A;  3SG4 A;  4WQ2 A;  3DVM A;  3IQQ A;  1HQV A;  1BG1 A;  1M39 A;  2AUC A;  2WND A;  4I5N B;  4OV2 A;  1N2D A;  1PVA A;  3O78 A;  4NDD A;  1QX5 B;  4PAL A;  1XFZ O;  2F33 A;  3IQO A;  5G08 A;  2BKI B;  1QIV A;  2LNK A;  2MJW B;  2LMV A;  2E6W A;  2KFG A;  3NXA A;  3PSR A;  5HYD A;  3TDZ A;  1IQ3 A;  1S6J A;  1CKK A;  2WOS A;  4A4C A;  1TNP A;  2O5G A;  1L2O B;  2L50 A;  1CB1 A;  1K93 D;  1SL7 A;  4F0Z B;  2IS9 A;  1CM1 A;  2FJU B;  3EKH A;  3CWG A;  2M49 B;  4DRW A;  2HF5 A;  2JU0 A;  1OSA A;  3SG7 A;  1UHI A;  3VRP A;  1LIN A;  1MQ1 A;  5PAL A;  1K9P A;  2KAY A;  5I2L A;  3HCM A;  1CDN A;  1PK0 D;  2Q4U A;  2FOT A;  4NDC A;  1EG3 A;  2LAN A;  2BCX A;  1F71 A;  4TNC A;  1JFJ A;  1DGV A;  2EHB A;  4GFT A;  1SR6 B;  3JTD B;  1TRF A;  4GAO A;  1OQP A;  4MZJ A;  2GGM A;  4ORC B;  5IBW A;  3H4S E;  1A75 A;  1VRK A;  1E8A A;  1UWO A;  1M45 A;  3EVU A;  1QIW A;  1YX8 A;  1KSM A;  1CFF A;  3HX4 A;  1UUR A;  4MLW A;  5DKQ A;  2NCP A;  2HQ8 A;  1JC2 A;  1NX2 A;  1SR6 C;  3D10 A;  1KK7 Y;  3WHT B;  3WHU B;  3DVJ A;  1TTX A;  2LUC A;  1WRK A;  2CTN A;  2MHH A;  3I5I B;  1QLK A;  1R6P A;  2JT0 A;  2Y4Q A;  1PUL A;  2JZI A;  4PHN A;  1NIW A;  1LXF C;  3EK7 A;  1CDM A;  3SG3 A;  5GQQ C;  2AAO A;  2JPT A;  1CLB A;  1NCY A;  3AAJ A;  1WDC B;  4DUQ A;  1CMG A;  1MF8 B;  1TN4 A;  2JOJ A;  2MRD A;  3I5I C;  4MZK A;  4GUK A;  1TCF A;  1Y1X A;  1KCY A;  1KK7 Z;  3BQ3 A;  3FIA A;  3I5F C;  1XK4 A;  4NQG A;  1F4O A;  4YI9 A;  1NCZ A;  2CXJ A;  3CR2 A;  3O6B A;  1JBA A;  1QAT A;  1YVL A;  1DJY A;  1J7P A;  2WC8 A;  4A4B A;  1TNX A;  2NLN A;  1AVS A;  1IKU A;  1LA0 A;  3CZT X;  1NX1 A;  2M3W A;  1SCM B;  4IL1 A;  4WQ3 A;  1SMG A;  2MBX A;  1FBV A;  2FCE A;  2M7N A;  2QAC A;  1NX3 A;  3O2P A;  1S6I A;  4YBH B;  1AJ4 A;  1R2U A;  3FS7 A;  2WOR A;  3BOW B;  1K8U A;  1WLZ A;  2I18 A;  2OTG C;  3D0Y A;  1ZAC A;  4QJ5 B;  2KQ6 A;  1DJH A;  5ER4 X;  2CT9 A;  1YR5 A;  3BUO B;  1KFX S;  1OOJ A;  2JTZ A;  1K9K A;  1DMO A;  2PAS A;  5I8N A;  3A8R A;  5TNC A;  1MR8 A;  3EK4 A;  1IQ5 A;  3ZWH A;  1EG4 A;  2LLS A;  1DJG A;  1IG5 A;  1YVH A;  2ZKM X;  2L4H A;  1NX0 A;  3DVK A;  1B7T Y;  3LLE A;  2L4I A;  2BBM A;  4M2O A;  3JVT B;  3ICB A;  3WNX B;  1QVI Y;  1EH2 A;  1GJY A;  2KI6 C;  1F70 A;  2JTT A;  5D7F A;  1J1E A;  2JUL A;  1SRA A;  1X02 A;  2WCF A;  1A4P A;  1SL8 A;  2FCD A;  2KGR A;  3NSL A;  1CLL A;  1U5I B;  4ICB A;  4PHM A;  3TDI A;  4CID A;  1BLQ A;  1SBJ A;  2LHI A;  1IJ6 A;  1A29 A;  1WRZ A;  2Y5I A;  3JVT C;  2CBL A;  2NXQ A;  4N5X A;  5CPV A;  1M31 A;  5KTY A;  1IGV A;  2K8M B;  4HRE E;  1B7T Z;  2F3Y A;  1B8C A;  1KFU S;  1LVC D;  2PAL A;  1KQV A;  4YRU A;  2L51 A;  1JWD A;  1QVI Z;  4ETO A;  2NZ0 A;  3EK8 A;  1YTZ C;  2M8U A;  2ZRS A;  1BT6 A;  2KAX A;  1AUI B;  4GPL B;  4HRG A;  1LKJ A;  4JWQ A;  1IJ5 A;  5DKN A;  1K96 A;  5D69 A;  1EL4 A;  1DVI A;  1DJZ A;  1YX7 A;  3SJS A;  4YGD B;  1QTX A;  1RFJ A;  3OX6 A;  4DIR A;  2M0R A;  4GGF C;  1QV1 A;  1DJW A;  2I94 A;  1JF2 A;  5JOL A;  1L7Z A;  2SAS A;  3CTN A;  3CS1 A;  2K7O A;  5F6T A;  2PSR A;  1UHK A;  1M46 A;  3MSE B;  1H4B A;  1D1O A;  1CFD A;  2LE9 B;  1ZUZ A;  2L5X B;  1PSB A;  2VRG A;  1BR1 B;  2LVJ A;  3BUW B;  2LAP A;  1OZS A;  3BUX B;  3AAK A;  4I5L B;  1MWN A;  5K89 A;  4CPV A;  4AQJ A;  3TZ1 A;  1BMO A;  1MUX A;  1ZMZ A;  2LP3 A;  1XFV O;  1QS7 A;  5CSJ A;  3BXK A;  2A4J A;  4WRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...