2AUCA

Structure of the plasmodium mtip-myoa complex, a key component of the parasite invasion motor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
b'NGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin A Tail Interacting Protein
publication title Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor.
pubmed doi rcsb
source organism Plasmodium knowlesi
molecule tags Membrane protein
total genus 33
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2aucA02
4N1GA 1G4YR 1IH0A 1A75A 2KFFA 1UHIA 1UHNA 3D0YA 1CM4A 1MQ1A 3PATA 4YGCB 5B8IB 1J1EA 3MSEB 1NX3A 2H2KA 4UPGA 1RECA 1TCOB 1U5IA 3DVKA 1SCMB 1FI6A 1IGVA 1WDCB 4YI9A 3H4SE 1K95A 1MUXA 1PSRA 1XFZO 3CS1A 2ZKMX 1JFKA 2JT0A 1MXEA 2KBIA 2V53A 1DF0A 3AAKA 3JTDB 2MBXA 2ZN8A 2KI4B 3A4UB 1C7WA 3DVMA 2KGRA 2KAVA 4YGBB 3VRRA 2K0JA 2WOSA 4I5KA 1TNXA 4XYNA 2LP2A 1NSHA 3SG4A 4DUQA 3EKJA 1DT7B 1F8HA 1K9PA 1CFPA 5KU1A 2BBMA 4AQJA 2Y1MA 1DJHA 2KOTA 4BY4A 1S5GZ 2BL0C 3VRPA 2LHLA 3CWGA 1AP4A 1BOCA 1UHKA 5D69A 1BJFA 4M2OA 2KYCA 1NIWA 3BUNB 1BT6A 1UUSA 1QATA 3O6BA 1KWOC 4A4CA 1QX2A 1QS7A 1QVIY 4MBEA 4C0LA 1BR4B 1CTRA 1M63B 1NCXA 5JJGA 1V1FA 2PALA 1CB1A 1DGVA 2FCDA 2HPSA 1E8AA 3A8RA 3PFVA 2M0RA 1F4OA 2ZN9A 4GFTA 3JVTB 3GK1A 2AUCA 1K8UA 1SBJA 1WRLA 1H4BA 1ALVA 1GQMA 1SL9A 1S6JA 2HQWA 3EK7A 1OE9B 5TNCA 1BF5A 1TRFA 2GGZA 1XFWO 1J7QA 2LE9B 1CKKA 1K96A 4ZCUA 1IWQA 1IJ5A 2WORA 2KBMA 4I5JA 1TNPA 2ZNEA 4MZJA 2KYFA 1EJ3A 2L51A 4USLA 1QV0A 4ORBB 2SASA 3IF7A 1DJIA 1CDMA 4YGAA 3C1VA 1KSMA 3CR2A 1QV1A 1GGZA 1UHHA 1QIWA 1BR1B 1QX5B 1QJTA 1TN4A 1AUIB 1RWYA 2ZFDA 1CFCA 2OTGC 1W7IB 2B1UA 4MLWA 2JWWA 4C0KA 4WRIA 1G8IA 1YR5A 2BE4A 3ZWHA 1G33A 1YX7A 1XK4C 3I5IB 5HKWA 3SIBA 1R2UA 1A75B 3I5FC 4MSPA 4PHJA 2JT8A 1YVLA 3D0YB 3TZ1A 5HKYA 1JSAA 1A4PA 1RFJA 4YGDB 1SYMA 2JXLA 3EK8A 5CPVA 1H8BA 1LKJA 1U5IB 5ER5A 4MRXA 4OV2A 1ZMZA 2LNKA 3VGOA 4TNCA 4DIRA 1DF0B 3SG2A 2MA2A 1EG4A 3WNXB 4JPZB 4JQ0D 2F2OA 3DF0A 3LK1A 1L7ZA 1BG1A 2EC6C 3BUXB 1Y1UA 2GV5A 4GUKA 4QJ4B 1CMFA 1S3PA 4M2QA 2BKHB 1K2HA 1CNPA 1YX8A 1GJYA 2MRDA 3VROA 1CDNA 3OB1B 4ORCB 1PRWA 1WRKA 1KQMC 3KEVA 1WLMA 2M8UA 2WCEA 1SMGA 1SRAA 4I5NB 2JU0A 4OKHA 1JFJA 5DKQA 2M29A 2JNXA 2L5XB 3BUOB 1TCFA 1YVHA 2H61C 1UURA 1CDPA 4YI8A 1XO5A 2R2IA 2K2FA 2L4IA 1AJ5A 2BL0B 3DVEA 2F8PA 4ZCVA 2ZNDA 3OP0A 2AAOA 3E3RA 1D1OA 1NPQA 1ZACA 1F71A 4PDZA 2LM5A 4IL1A 1KWOB 1NCZA 2KAYA 1SL7A 2CXJA 1OMDA 4GGFA 3VRNA 1IQ3A 1M39A 4HRHA 1L2OC 3EK4A 1YURA 3PM8A 2VRGA 2I2RE 1NYAA 3KHEA 1IQ5A 2GGMA 3BYAA 3PN7B 2E30A 5KTYA 4MZKA 1JC2A 2PRUA 1NCYA 4YGEB 2K8MB 1NX1A 3I5HC 1DJXA 4OCIA 1M31A 2Y4QA 3O78A 2L0PA 2FCEA 1J55A 2NXQA 3EKHA 4PALA 2BKIB 1AK8A 1SCVA 2OS8B 2QACA 2RGIA 1PULA 3FWCA 1SL8A 1Y6WA 1W7JB 4U8DA 2KFGA 2NZ0A 2BCBA 2JOJA 1AHRA 3AKBA 3SG6A 3WHTB 2LMTA 1KQVA 1B9AA 1N0YA 1UWOA 4WQ2A 4PHMA 3KF9A 4PE4A 4R1EA 1BLQA 2FOTA 1YRUB 2M1UA 2JZIA 2KNEA 4PE1A 1OZSA 1HQVA 1WDCC 3DD4A 3ZNIA 5F6TA 1F55A 1FW4A 3BXKA 2OTGB 1SR6B 3PALA 1F54A 1LA0A 3TUYB 4ICBA 4PCWA 2EHBA 1F4QA 1B8CA 4NDDA 2KI4C 1K90D 4OR9B 1CLBA 2O5GA 5HLVA 1CM1A 3LK0A 1MF8B 5CSIA 2KI6C 1NX2A 1QVIZ 1NP8A 1WRZA 2A4JA 1J1DA 4P5OE 5DKNA 1R6PA 1WY9A 1N65A 1Y0VH 1SY9A 4XJKA 4GBAA 3WXAA 4NDBA 3I5GC 5DKRA 1K94A 1B8LA 5ER4X 1CLMA 2DOQA 5J3XA 1KCYA 2JTZA 1RTP1 2EC6B 1FPWA 2LUXA 4N5XA 5JOLA 1XVJA 4ORAB 1J7PA 2M3WA 4BY5A 3IQOA 1B7TY 2JC2A 2K61A 2ISDA 1QIVA 4MRYA 4PE7A 3NSOA 1SNLA 1J7RA 1QASA 3JVTC 2MAZA 4CFRA 3ICBA 1LINA 1XFUO 2CBLA 1KQMB 2F33A 2Q91A 2LANA 5AEQA 2L4HA 1EXRA 2G2BA 4HRGA 1X02A 5PALA 3QRXA 1OQPA 1TNQA 1DJWA 1RROA 3HCMA 2QPTA 3LL8B 5CSFA 2KHNA 2LVKA 1XK4A 3AAJA 2JNFA 2OPOA 1NUBA 3BUMB 1YUTA 1ODBA 4HSZA 1YRTB 2G9BA 2LMUA 1VRKA 2K7OA 4MN0A 5I2OA 4FQOA 4CPVA 1DMOA 4FTGA 1IRJA 1QLKA 1SW8A 1EH2A 1A29A 5I2QA 3PLFB 1JBAA 1TOPA 1PALA 2MLFC 1KFXL 2K7CA 4MVFA 5HLOA 1L2OB 4NQGA 1HT9A 1S26D 3FS7A 1JWDA 1EG3A 2WCFA 2M9GA 4GNKB 1DJYA 1KFUL 2I94A 1UP5A 4ETOA 1XFVO 3TDUA 1IJ6A 3GK2A 4N1FA 1BMOA 4GAOA 3I5HB 1LVCD 1M45A 1PVBA 1YTZC 1FBVA 1K9KA 2KQ6A 2AMIA 3SG3A 1WLZA 2LMVA 5AXIA 5IBWA 3SJSA 2KDHA 5BPJA 1BODA 1CDLA 1TTXA 2L2EA 2LC5A 3SG5A 4YBHB 4QJ3B 2H61A 4CFQA 1S5GY 4MEWA 1SKTA 5AANA 3SG7A 4DRWA 1OZOA 3O2PA 1EL4A 2PSRA 3NSKA 3OB2B 1KK8C 2K7BA 3CR5X 3LLEA 4XJKB 2M7LA 3CGAA 3CR4X 2L98A 2O60A 2JQ6A 3D10A 1LA3A 4P2YB 3GOFA 1CMGA 5HKZA 2ZRSA 2KQYA 4GPLB 1KFXS 2JT3A 4JWQA 1B8RA 1OOJA 2JPTA 3CLNA 4OVNF 2HETA 1S36A 2PVBA 1JF2A 3KO0A 4I5LB 1C7VA 2KSPA 2SCPA 2NCOA 3IQQA 2LLUA 2LUCA 1ZUZA 1CLLA 3AKAA 2PASA 1KFUS 3BUWB 3BQ3A 1KSOA 3TS5C 2CTNA 4PHNA 2LLSA 1PVAA 4F0ZB 1B47A 3M0WA 1K9UA 1N2DA 1RJVA 1S6IA 1DVIA 3I5GB 1M46A 3RLZA 4DCKA 1SCMC 3KPXA 1Q80A 2FJUB 3NSLA 5GQQC 1PK0D 5AERA 2NCPA 3BOWA 3DF0B 4M2PA 4CIDA 5K89A 1QTXA 3JTDC 1Y1AA 3GK4X 2HF5A 2MLEC 1UHJA 2Y1NA 4A4BA 3I5FB 3PSRA 3OHMB 1A2XA 1XFYO 5KSZA 3HX4A 4L9MA 3PN7C 2M49B 3TDIA 1NX0A 1ZOTB 1KK7Y 2ZRTA 1CFDA 1PSBA 3EVUA 3OX5A 3OX6A 4WQ3A 5FYXA 1CFFA 2CCMA 2EGDA 2WNDA 1GGWA 3CTNA 5I8NA 1XA5A 2JTTA 2JXCA 3VRQA 2OS8C 2BE6A 2F2PA 1MWNA 1ZFSA 5G08A 2LP3A 3WHUB 2LVJA 2M97A 1JUOA 4AQIA 1MXLC 2LVIA 2KGBC 3EVVA 4C0JA 2LHIA 2BECA 2K2AA 4MZLA 3F45A 4AOMA 4E68A 1FI5A 1V1GA 1S6CA 2WC8A 1MHOA 2L50A 2M7NA 2PMYA 3RM1A 1SK6D 1TIZA 1F70A 1JF0A 2D8NA 2I7AA 2KAXA 5CSJA 5D7FA 5HYDA 1SR6C 1KK7Z 2BBNA 1DJGA 3DVJA 1QXPA 5CSNA 3SIAA 2Y5IA 3O4YA 4GGNA 3TUYC 2KI6D 3EVRA 2COLB 4NDCA 2K7DA 2LAPA 3NXAA 1XYDA 2I18A 2CNPA 1SPYA 1IG5A 2MJWB 2P6BB 1DTLA 2NLNA 3FIAA 2IS9A 1B7TZ 2TN4A 3LCPC 4PE0A 1K93D 1BU3A 3TDZA 1C07A 2JRFA 1S1EA 2BCXA 3FWBA 1RK9A 2CT9A 2LLTA 3NSIA 1DGUA 5AFPA 1NWDA 1QX7A 1MR8A 1OMRA 4YRUA 1J7OA 2JULA 2WCBA 1AJ4A 2Q4UA 1OSAA 1YUSA 1FF1A 4CLNA 2HQ8A 2KFHA 3I5IC 1TNWA 4D1EA 3CZTX 1KK8B 4PHKA 1AVSA 2LV7A 1DJZA 5I2LA 1LXFC 2BCAA 1A03A 4DS7A 1B4CA 2F3YA 1XFXO 1ALWA 2LVVA 2M1KB 1IKUA 3BOWB 1OMVA 4HREE 1B1GA 2F3ZA 2E6WA 1YUUA 2MHHA 4Q04A 4GGFC 1Y1XA 2LCPA 1QLSA 3TS5B 3K21A 4QJ5B
chains in the Genus database with same CATH superfamily
4N1GA 1G4YR 1IH0A 1A75A 2BNXA 2FJYA 2KFFA 1UHIA 1UHNA 3D0YA 1CM4A 1MQ1A 3PATA 4YGCB 5B8IB 1J1EA 3MSEB 1NX3A 5DICA 2H2KA 4UPGA 1RECA 1TCOB 1U5IA 3DVKA 1SCMB 1FI6A 1IGVA 1WDCB 4YI9A 3H4SE 1K95A 1MUXA 1PSRA 1XFZO 2QEOA 3CS1A 1OW4A 2ZKMX 1JFKA 2JT0A 1MXEA 2KBIA 2V53A 1DF0A 3AAKA 3JTDB 2MBXA 3S0EA 2ZN8A 2KI4B 3A4UB 1C7WA 3DVMA 2KGRA 2KAVA 4YGBB 3VRRA 2K0JA 2WOSA 4I5KA 1TNXA 4XYNA 2LP2A 1NSHA 3IVTA 3SG4A 3EKJA 4DUQA 1DT7B 1K9PA 1F8HA 1CFPA 5KU1A 2BBMA 3B87A 2Y1MA 4AQJA 1DJHA 2KOTA 4BY4A 1S5GZ 2BL0C 2QEHA 2LHLA 3CWGA 3VRPA 1AP4A 1BOCA 1UHKA 5D69A 1BJFA 4M2OA 2KYCA 1NIWA 3BUNB 1BT6A 1UUSA 1QATA 3O6BA 1KWOC 3D74A 4A4CA 1QX2A 1QS7A 1QVIY 4MBEA 4C0LA 1BR4B 1CTRA 1M63B 1NCXA 5JJGA 1V1FA 2PALA 1CB1A 1DGVA 2FCDA 2HPSA 1E8AA 3A8RA 3PFVA 2M0RA 1F4OA 2ZN9A 4GFTA 3RZSA 3JVTB 3GK1A 2AUCA 3FE6A 3NGVA 1K8UA 1SBJA 1WRLA 1GM0A 1T14A 2QDIA 1H4BA 4PT1A 3SS3A 1ALVA 1GQMA 1SL9A 1S6JA 2HQWA 3EK7A 1OE9B 5TNCA 1BF5A 1TRFA 2GGZA 1XFWO 1J7QA 2LE9B 1CKKA 1K96A 4ZCUA 1IWQA 1IJ5A 2WORA 2KBMA 4I5JA 1TNPA 2ZNEA 4MZJA 2KYFA 1EJ3A 2L51A 3BFAA 3EG5B 2BAPA 4USLA 1QV0A 4ORBB 2SASA 3IF7A 1DJIA 3S0BA 1CDMA 4YGAA 3C1VA 1KSMA 3CR2A 1QV1A 1GGZA 1UHHA 3NHIA 1QIWA 1BR1B 1TUZA 1QX5B 1QJTA 1TN4A 1AUIB 1RWYA 2KLEA 2ZFDA 2OTGC 3SS5A 2K60A 1W7IB 2B1UA 3O4XA 4MLWA 1CFCA 2JWWA 4C0KA 4WRIA 1G8IA 1YR5A 2BE4A 3ZWHA 1G33A 1YX7A 1XK4C 3I5IB 3QMEA 5HKWA 3SIBA 1R2UA 3S0FA 1A75B 3I5FC 4MSPA 4PHJA 2JT8A 1YVLA 3D0YB 3TZ1A 5HKYA 1JSAA 1A4PA 2L5YA 1RFJA 4YGDB 1SYMA 2JXLA 3EK8A 5CPVA 1H8BA 1LKJA 1U5IB 5ER5A 3D73A 3D75A 4MRXA 4OV2A 1ZMZA 2LNKA 3VGOA 4TNCA 4DIRA 1DF0B 3SG2A 2MA2A 1EG4A 3WNXB 4JPZB 4JQ0D 2F2OA 3DF0A 3LK1A 3DYEA 2WC5A 1L7ZA 1BG1A 2EC6C 5D3OA 3BUXB 1Y1UA 2GV5A 4GUKA 4QJ4B 1CMFA 1W9ZA 1S3PA 4M2QA 4F7FA 2BKHB 1K2HA 1CNPA 1YX8A 1GJYA 2MRDA 3VROA 1CDNA 3OB1B 2PQLA 4ORCB 1PRWA 1WRKA 1KQMC 3KEVA 1WLMA 2M8UA 2WCEA 1SMGA 1SRAA 1SSEB 4I5NB 3BFBA 2JU0A 2H8VA 4OKHA 5HL1A 1JFJA 5DKQA 2M29A 2JNXA 2L5XB 3BUOB 1TCFA 1YVHA 2H61C 1UURA 1CDPA 4YI8A 1XO5A 2R2IA 2YGUA 2K2FA 2L4IA 1AJ5A 2BL0B 3DVEA 3VB1A 2F8PA 4ZCVA 2ZNDA 3OP0A 1DELA 2AAOA 3E3RA 1D1OA 1NPQA 1ZACA 1F71A 3B86A 3BFHA 4PDZA 2LM5A 4IL1A 1KWOB 1NCZA 2KAYA 1SL7A 2CXJA 2WCKA 1OMDA 4GGFA 3VRNA 2WC6A 1IQ3A 1M39A 2WCHA 4HRHA 3CYZA 1L2OC 3EK4A 1YURA 5FI7A 3PM8A 2VRGA 2I2RE 1NYAA 3KHEA 1IQ5A 3B88A 2GGMA 3BYAA 3L47A 3PN7B 2E30A 5KTYA 4MZKA 3CZ1A 1JC2A 3FE9A 2PRUA 1NCYA 4YGEB 2K8MB 1NX1A 3I5HC 1DJXA 4OCIA 1M31A 2Y4QA 2PYQA 3CABA 3O78A 2L0PA 2FCEA 1J55A 2NXQA 3EKHA 2GTEA 4PALA 2BKIB 1AK8A 1SCVA 2OS8B 2QACA 4INWA 2RGIA 1PULA 3FWCA 1SL8A 1Y6WA 1W7JB 4U8DA 2KFGA 2NZ0A 2BCBA 2JOJA 1AHRA 2WCLA 3AKBA 3SG6A 2LMTA 4OZDA 3WHTB 1KQVA 3DZTA 1B9AA 3OBVA 1N0YA 1UWOA 4WQ2A 4PHMA 3KF9A 4PE4A 4R1EA 1BLQA 2FOTA 1YRUB 2M1UA 2JZIA 5FI6A 2KNEA 4PE1A 1OZSA 1HQVA 3Q8IA 3K1EA 1WDCC 3DD4A 3ZNIA 5F6TA 1F55A 1FW4A 3BXKA 3B7AA 2OTGB 1SR6B 3PALA 3V2LA 3B6XA 2JPOA 1F54A 1LA0A 3TUYB 4ICBA 4PCWA 2EHBA 1F4QA 1B8CA 4NDDA 2KI4C 1K90D 4OR9B 1CLBA 2O5GA 5HLVA 1CM1A 3D76A 3LK0A 1MF8B 5CSIA 2KI6C 1NX2A 1QVIZ 1NP8A 1WRZA 2A4JA 1J1DA 4P5OE 5DKNA 2KLDA 1R6PA 1WY9A 1N65A 1Y0VH 1SY9A 4XJKA 4GBAA 3WXAA 2WCJA 4NDBA 3I5GC 3R1PA 1TUJA 5DKRA 1K94A 1B8LA 3CDNA 5ER4X 1CLMA 2DOQA 5J3XA 1KCYA 2JTZA 3N7HA 2P70A 1RTP1 2EC6B 1FPWA 2LUXA 4N5XA 5JOLA 1XVJA 4ORAB 1J7PA 2M3WA 5I94A 4BY5A 3IQOA 1B7TY 2JC2A 2K61A 2ISDA 1QIVA 4MRYA 4PE7A 3NSOA 1C3YA 1SNLA 1J7RA 1QASA 1Z2CB 5FI2A 3JVTC 2MAZA 4CFRA 3ICBA 1LINA 1XFUO 2CBLA 1KQMB 2F33A 2Q91A 2LANA 5AEQA 2L4HA 1EXRA 2G2BA 4HRGA 1X02A 5PALA 3QRXA 1OQPA 1TNQA 3CZ0A 1DJWA 1RROA 3HCMA 1DC1A 2QPTA 3LL8B 4JD9A 5CSFA 2KHNA 2LVKA 4FQTA 1XK4A 3AAJA 2JNFA 2OPOA 1NUBA 3DXLA 3BUMB 5EL2A 1YUTA 1ODBA 4HSZA 1YRTB 2G9BA 2LMUA 1VRKA 2K7OA 4MN0A 5I2OA 4FQOA 4CPVA 1DMOA 4FTGA 1IRJA 1QWVA 1OOHA 3UO9A 1QLKA 1SW8A 3S0GA 1A29A 5I2QA 1EH2A 3PLFB 1JBAA 1TOPA 1PALA 2MLFC 1KFXL 2K7CA 4MVFA 1OOIX 5HLOA 1FI5A 1L2OB 4NQGA 1DQEA 3PJIA 1HT9A 1S26D 3FS7A 1JWDA 1EG3A 2WCFA 2M9GA 4GNKB 1DJYA 1KFUL 4KYNA 2I94A 1UP5A 3SS4A 4ETOA 1XFVO 3TDUA 1IJ6A 3GK2A 4N1FA 1BMOA 4GAOA 3I5HB 1LVCD 1M45A 1PVBA 1YTZC 3PM2A 1FBVA 1K9KA 2KQ6A 2AMIA 3SG3A 1WLZA 2LMVA 5AXIA 5IBWA 3SJSA 2KDHA 5BPJA 1BODA 1CDLA 1TTXA 2L2EA 2LC5A 3SG5A 4YBHB 4QJ3B 2H61A 1C3ZA 4CFQA 3OGNA 1S5GY 1ORGA 4MEWA 1SKTA 5AANA 3SG7A 4DRWA 1OZOA 3O2PA 1EL4A 3L4LA 2PSRA 3NSKA 3OB2B 1KK8C 2K7BA 3CR5X 3LLEA 4XJKB 2M7LA 3CGAA 3CR4X 2L98A 2O60A 2JQ6A 3D10A 1LA3A 4P2YB 3GOFA 1CMGA 5HKZA 2ZRSA 2KQYA 4GPLB 3UNWA 1KFXS 2JT3A 4JWQA 1B8RA 1OOJA 2JPTA 3CLNA 4OVNF 2HETA 1S36A 2PVBA 1JF2A 3KO0A 4I5LB 1C7VA 2KSPA 2SCPA 2NCOA 3IQQA 2LLUA 2LUCA 1ZUZA 1CLLA 3AKAA 2PASA 1KFUS 3BUWB 3BQ3A 1KSOA 1LS8A 3TS5C 2CTNA 4PHNA 3FE8A 2LLSA 1PVAA 4F0ZB 1XFRA 1TWOA 1B47A 3M0WA 1K9UA 1N2DA 1RJVA 1S6IA 1DVIA 3I5GB 1M46A 3RLZA 4DCKA 1SCMC 3KPXA 3BJHA 3S0DA 1Q80A 2FJUB 3NSLA 5GQQC 1PK0D 4JKTA 5AERA 2NCPA 3BOWA 1P28A 3DF0B 4M2PA 4CIDA 5K89A 1QTXA 3JTDC 1Y1AA 3GK4X 2HF5A 2MLEC 1UHJA 2Y1NA 4A4BA 3I5FB 3PSRA 3OHMB 1A2XA 3S0AA 1XFYO 5KSZA 3HX4A 4L9MA 3PN7C 2M49B 3TDIA 1NX0A 1ZOTB 1KK7Y 2ZRTA 1CFDA 1PSBA 3EVUA 3OX5A 3OX6A 4WQ3A 5FYXA 1CFFA 2CCMA 2EGDA 3D78A 2WNDA 1GGWA 3CTNA 5I8NA 1XA5A 2JTTA 2JXCA 1OOGA 2OS8C 2QEVA 3VRQA 2BE6A 2F2PA 1MWNA 1Z4HA 1ZFSA 5G08A 2LP3A 3WHUB 1IIOA 2LVJA 3D77A 2M97A 1JUOA 3R72A 4AQIA 1MXLC 2LVIA 2KGBC 3EVVA 4C0JA 2LHIA 2BECA 2K2AA 3R1OA 3F45A 4MZLA 2P71A 4AOMA 1V1GA 1S6CA 4E68A 2WC8A 1MHOA 2ERBA 2L50A 2M7NA 2PMYA 3RM1A 1SK6D 1TIZA 1F70A 1JF0A 2D8NA 2I7AA 2KAXA 5CSJA 5D7FA 3CZ2A 5HYDA 1SR6C 1KK7Z 2BBNA 1DJGA 3DVJA 3NHTA 1QXPA 5CSNA 3SIAA 2Y5IA 1OOFA 3O4YA 4GGNA 3TUYC 2KI6D 3EVRA 2COLB 4NDCA 2K7DA 2KPHA 2LAPA 2L2CA 3NXAA 1XYDA 2I18A 2CNPA 1SPYA 4INXA 1IG5A 2MJWB 2QEBA 2P6BB 1DTLA 2NLNA 3FIAA 2IS9A 1B7TZ 2TN4A 3LCPC 4PE0A 1K93D 1BU3A 3R1VA 1DEKA 3TDZA 1C07A 4IJ7A 2WCMA 2JRFA 1S1EA 2BCXA 3FWBA 1RK9A 2CT9A 2LLTA 3NSIA 1DGUA 5AFPA 1NWDA 1QX7A 1MR8A 1OMRA 4YRUA 1J7OA 2JULA 2WCBA 1AJ4A 2Q4UA 1OSAA 1YUSA 1FF1A 4CLNA 2HQ8A 2KFHA 3L4AA 3I5IC 1TNWA 4D1EA 3DY9A 3CZTX 1KK8B 4PHKA 1AVSA 2LV7A 1DJZA 5I2LA 1LXFC 2BCAA 1A03A 4DS7A 1B4CA 2F3YA 1XFXO 1ALWA 2LVVA 2M1KB 1IKUA 3BOWB 1OMVA 4HREE 1B1GA 2F3ZA 2E6WA 1YUUA 2MHHA 4Q04A 4GGFC 1Y1XA 2LCPA 1QLSA 3TS5B 3K21A 4QJ5B
chains in the Genus database with same CATH topology
4N1GA 1G4YR 1IH0A 1A75A 2KFFA 1UHIA 1UHNA 3D0YA 1CM4A 1MQ1A 3PATA 4YGCB 5B8IB 1J1EA 3MSEB 1NX3A 2H2KA 4UPGA 1RECA 1TCOB 1U5IA 3DVKA 1SCMB 1FI6A 1IGVA 1WDCB 4YI9A 3H4SE 1K95A 1MUXA 1PSRA 1XFZO 3CS1A 2ZKMX 1JFKA 2JT0A 1MXEA 2KBIA 2V53A 1DF0A 3AAKA 3JTDB 2MBXA 2ZN8A 2KI4B 3A4UB 1C7WA 3DVMA 2KGRA 2KAVA 4YGBB 3VRRA 2K0JA 2WOSA 4I5KA 1TNXA 4XYNA 2LP2A 1NSHA 3SG4A 4DUQA 3EKJA 1DT7B 1F8HA 1K9PA 1CFPA 5KU1A 2BBMA 4AQJA 2Y1MA 1DJHA 2KOTA 4BY4A 1S5GZ 2BL0C 3VRPA 2LHLA 3CWGA 1AP4A 1BOCA 1UHKA 5D69A 1BJFA 4M2OA 2KYCA 1NIWA 3BUNB 1BT6A 1UUSA 1QATA 3O6BA 1KWOC 4A4CA 1QX2A 1QS7A 1QVIY 4MBEA 4C0LA 1BR4B 1CTRA 1M63B 1NCXA 5JJGA 1V1FA 2PALA 1CB1A 1DGVA 2FCDA 2HPSA 1E8AA 3A8RA 3PFVA 2M0RA 1F4OA 2ZN9A 4GFTA 3JVTB 3GK1A 2AUCA 1K8UA 1SBJA 1WRLA 1H4BA 1ALVA 1GQMA 1SL9A 1S6JA 2HQWA 3EK7A 1OE9B 5TNCA 1BF5A 1TRFA 2GGZA 1XFWO 1J7QA 2LE9B 1CKKA 1K96A 4ZCUA 1IWQA 1IJ5A 2WORA 2KBMA 4I5JA 1TNPA 2ZNEA 4MZJA 2KYFA 1EJ3A 2L51A 4USLA 1QV0A 4ORBB 2SASA 3IF7A 1DJIA 1CDMA 4YGAA 3C1VA 1KSMA 3CR2A 1QV1A 1GGZA 1UHHA 1QIWA 1BR1B 1QX5B 1QJTA 1TN4A 1AUIB 1RWYA 2ZFDA 1CFCA 2OTGC 1W7IB 2B1UA 4MLWA 2JWWA 4C0KA 4WRIA 1G8IA 1YR5A 2BE4A 3ZWHA 1G33A 1YX7A 1XK4C 3I5IB 5HKWA 3SIBA 1R2UA 1A75B 3I5FC 4MSPA 4PHJA 2JT8A 1YVLA 3D0YB 3TZ1A 5HKYA 1JSAA 1A4PA 1RFJA 4YGDB 1SYMA 2JXLA 3EK8A 5CPVA 1H8BA 1LKJA 1U5IB 5ER5A 4MRXA 4OV2A 1ZMZA 2LNKA 3VGOA 4TNCA 4DIRA 1DF0B 3SG2A 2MA2A 1EG4A 3WNXB 4JPZB 4JQ0D 2F2OA 3DF0A 3LK1A 1L7ZA 1BG1A 2EC6C 3BUXB 1Y1UA 2GV5A 4GUKA 4QJ4B 1CMFA 1S3PA 4M2QA 2BKHB 1K2HA 1CNPA 1YX8A 1GJYA 2MRDA 3VROA 1CDNA 3OB1B 4ORCB 1PRWA 1WRKA 1KQMC 3KEVA 1WLMA 2M8UA 2WCEA 1SMGA 1SRAA 4I5NB 2JU0A 4OKHA 1JFJA 5DKQA 2M29A 2JNXA 2L5XB 3BUOB 1TCFA 1YVHA 2H61C 1UURA 1CDPA 4YI8A 1XO5A 2R2IA 2K2FA 2L4IA 1AJ5A 2BL0B 3DVEA 2F8PA 4ZCVA 2ZNDA 3OP0A 2AAOA 3E3RA 1D1OA 1NPQA 1ZACA 1F71A 4PDZA 2LM5A 4IL1A 1KWOB 1NCZA 2KAYA 1SL7A 2CXJA 1OMDA 4GGFA 3VRNA 1IQ3A 1M39A 4HRHA 1L2OC 3EK4A 1YURA 3PM8A 2VRGA 2I2RE 1NYAA 3KHEA 1IQ5A 2GGMA 3BYAA 3PN7B 2E30A 5KTYA 4MZKA 1JC2A 2PRUA 1NCYA 4YGEB 2K8MB 1NX1A 3I5HC 1DJXA 4OCIA 1M31A 2Y4QA 3O78A 2L0PA 2FCEA 1J55A 2NXQA 3EKHA 4PALA 2BKIB 1AK8A 1SCVA 2OS8B 2QACA 2RGIA 1PULA 3FWCA 1SL8A 1Y6WA 1W7JB 4U8DA 2KFGA 2NZ0A 2BCBA 2JOJA 1AHRA 3AKBA 3SG6A 3WHTB 2LMTA 1KQVA 1B9AA 1N0YA 1UWOA 4WQ2A 4PHMA 3KF9A 4PE4A 4R1EA 1BLQA 2FOTA 1YRUB 2M1UA 2JZIA 2KNEA 4PE1A 1OZSA 1HQVA 1WDCC 3DD4A 3ZNIA 5F6TA 1F55A 1FW4A 3BXKA 2OTGB 1SR6B 3PALA 1F54A 1LA0A 3TUYB 4ICBA 4PCWA 2EHBA 1F4QA 1B8CA 4NDDA 2KI4C 1K90D 4OR9B 1CLBA 2O5GA 5HLVA 1CM1A 3LK0A 1MF8B 5CSIA 2KI6C 1NX2A 1QVIZ 1NP8A 1WRZA 2A4JA 1J1DA 4P5OE 5DKNA 1R6PA 1WY9A 1N65A 1Y0VH 1SY9A 4XJKA 4GBAA 3WXAA 4NDBA 3I5GC 5DKRA 1K94A 1B8LA 5ER4X 1CLMA 2DOQA 5J3XA 1KCYA 2JTZA 1RTP1 2EC6B 1FPWA 2LUXA 4N5XA 5JOLA 1XVJA 4ORAB 1J7PA 2M3WA 4BY5A 3IQOA 1B7TY 2JC2A 2K61A 2ISDA 1QIVA 4MRYA 4PE7A 3NSOA 1SNLA 1J7RA 1QASA 3JVTC 2MAZA 4CFRA 3ICBA 1LINA 1XFUO 2CBLA 1KQMB 2F33A 2Q91A 2LANA 5AEQA 2L4HA 1EXRA 2G2BA 4HRGA 1X02A 5PALA 3QRXA 1OQPA 1TNQA 1DJWA 1RROA 3HCMA 2QPTA 3LL8B 5CSFA 2KHNA 2LVKA 1XK4A 3AAJA 2JNFA 2OPOA 1NUBA 3BUMB 1YUTA 1ODBA 4HSZA 1YRTB 2G9BA 2LMUA 1VRKA 2K7OA 4MN0A 5I2OA 4FQOA 4CPVA 1DMOA 4FTGA 1IRJA 1QLKA 1SW8A 1EH2A 1A29A 5I2QA 3PLFB 1JBAA 1TOPA 1PALA 2MLFC 1KFXL 2K7CA 4MVFA 5HLOA 1L2OB 4NQGA 1HT9A 1S26D 3FS7A 1JWDA 1EG3A 2WCFA 2M9GA 4GNKB 1DJYA 1KFUL 2I94A 1UP5A 4ETOA 1XFVO 3TDUA 1IJ6A 3GK2A 4N1FA 1BMOA 4GAOA 3I5HB 1LVCD 1M45A 1PVBA 1YTZC 1FBVA 1K9KA 2KQ6A 2AMIA 3SG3A 1WLZA 2LMVA 5AXIA 5IBWA 3SJSA 2KDHA 5BPJA 1BODA 1CDLA 1TTXA 2L2EA 2LC5A 3SG5A 4YBHB 4QJ3B 2H61A 4CFQA 1S5GY 4MEWA 1SKTA 5AANA 3SG7A 4DRWA 1OZOA 3O2PA 1EL4A 2PSRA 3NSKA 3OB2B 1KK8C 2K7BA 3CR5X 3LLEA 4XJKB 2M7LA 3CGAA 3CR4X 2L98A 2O60A 2JQ6A 3D10A 1LA3A 4P2YB 3GOFA 1CMGA 5HKZA 2ZRSA 2KQYA 4GPLB 1KFXS 2JT3A 4JWQA 1B8RA 1OOJA 2JPTA 3CLNA 4OVNF 2HETA 1S36A 2PVBA 1JF2A 3KO0A 4I5LB 1C7VA 2KSPA 2SCPA 2NCOA 3IQQA 2LLUA 2LUCA 1ZUZA 1CLLA 3AKAA 2PASA 1KFUS 3BUWB 3BQ3A 1KSOA 3TS5C 2CTNA 4PHNA 2LLSA 1PVAA 4F0ZB 1B47A 3M0WA 1K9UA 1N2DA 1RJVA 1S6IA 1DVIA 3I5GB 1M46A 3RLZA 4DCKA 1SCMC 3KPXA 1Q80A 2FJUB 3NSLA 5GQQC 1PK0D 5AERA 2NCPA 3BOWA 3DF0B 4M2PA 4CIDA 5K89A 1QTXA 3JTDC 1Y1AA 3GK4X 2HF5A 2MLEC 1UHJA 2Y1NA 4A4BA 3I5FB 3PSRA 3OHMB 1A2XA 1XFYO 5KSZA 3HX4A 4L9MA 3PN7C 2M49B 3TDIA 1NX0A 1ZOTB 1KK7Y 2ZRTA 1CFDA 1PSBA 3EVUA 3OX5A 3OX6A 4WQ3A 5FYXA 1CFFA 2CCMA 2EGDA 2WNDA 1GGWA 3CTNA 5I8NA 1XA5A 2JTTA 2JXCA 3VRQA 2OS8C 2BE6A 2F2PA 1MWNA 1ZFSA 5G08A 2LP3A 3WHUB 2LVJA 2M97A 1JUOA 4AQIA 1MXLC 2LVIA 2KGBC 3EVVA 4C0JA 2LHIA 2BECA 2K2AA 4MZLA 3F45A 4AOMA 4E68A 1FI5A 1V1GA 1S6CA 2WC8A 1MHOA 2L50A 2M7NA 2PMYA 3RM1A 1SK6D 1TIZA 1F70A 1JF0A 2D8NA 2I7AA 2KAXA 5CSJA 5D7FA 5HYDA 1SR6C 1KK7Z 2BBNA 1DJGA 3DVJA 1QXPA 5CSNA 3SIAA 2Y5IA 3O4YA 4GGNA 3TUYC 2KI6D 3EVRA 2COLB 4NDCA 2K7DA 2LAPA 3NXAA 1XYDA 2I18A 2CNPA 1SPYA 1IG5A 2MJWB 2P6BB 1DTLA 2NLNA 3FIAA 2IS9A 1B7TZ 2TN4A 3LCPC 4PE0A 1K93D 1BU3A 3TDZA 1C07A 2JRFA 1S1EA 2BCXA 3FWBA 1RK9A 2CT9A 2LLTA 3NSIA 1DGUA 5AFPA 1NWDA 1QX7A 1MR8A 1OMRA 4YRUA 1J7OA 2JULA 2WCBA 1AJ4A 2Q4UA 1OSAA 1YUSA 1FF1A 4CLNA 2HQ8A 2KFHA 3I5IC 1TNWA 4D1EA 3CZTX 1KK8B 4PHKA 1AVSA 2LV7A 1DJZA 5I2LA 1LXFC 2BCAA 1A03A 4DS7A 1B4CA 2F3YA 1XFXO 1ALWA 2LVVA 2M1KB 1IKUA 3BOWB 1OMVA 4HREE 1B1GA 2F3ZA 2E6WA 1YUUA 2MHHA 4Q04A 4GGFC 1Y1XA 2LCPA 1QLSA 3TS5B 3K21A 4QJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1G A;  1G4Y R;  1IH0 A;  1A75 A;  2KFF A;  1UHI A;  1UHN A;  3D0Y A;  1CM4 A;  1MQ1 A;  3PAT A;  4YGC B;  5B8I B;  1J1E A;  3MSE B;  1NX3 A;  2H2K A;  4UPG A;  1REC A;  1TCO B;  1U5I A;  3DVK A;  1SCM B;  1FI6 A;  1IGV A;  1WDC B;  4YI9 A;  3H4S E;  1K95 A;  1MUX A;  1PSR A;  1XFZ O;  3CS1 A;  2ZKM X;  1JFK A;  2JT0 A;  1MXE A;  2KBI A;  2V53 A;  1DF0 A;  3AAK A;  3JTD B;  2MBX A;  2ZN8 A;  2KI4 B;  3A4U B;  1C7W A;  3DVM A;  2KGR A;  2KAV A;  4YGB B;  3VRR A;  2K0J A;  2WOS A;  4I5K A;  1TNX A;  4XYN A;  2LP2 A;  1NSH A;  3SG4 A;  4DUQ A;  3EKJ A;  1DT7 B;  1F8H A;  1K9P A;  1CFP A;  5KU1 A;  2BBM A;  4AQJ A;  2Y1M A;  1DJH A;  2KOT A;  4BY4 A;  1S5G Z;  2BL0 C;  3VRP A;  2LHL A;  3CWG A;  1AP4 A;  1BOC A;  1UHK A;  5D69 A;  1BJF A;  4M2O A;  2KYC A;  1NIW A;  3BUN B;  1BT6 A;  1UUS A;  1QAT A;  3O6B A;  1KWO C;  4A4C A;  1QX2 A;  1QS7 A;  1QVI Y;  4MBE A;  4C0L A;  1BR4 B;  1CTR A;  1M63 B;  1NCX A;  5JJG A;  1V1F A;  2PAL A;  1CB1 A;  1DGV A;  2FCD A;  2HPS A;  1E8A A;  3A8R A;  3PFV A;  2M0R A;  1F4O A;  2ZN9 A;  4GFT A;  3JVT B;  3GK1 A;  2AUC A;  1K8U A;  1SBJ A;  1WRL A;  1H4B A;  1ALV A;  1GQM A;  1SL9 A;  1S6J A;  2HQW A;  3EK7 A;  1OE9 B;  5TNC A;  1BF5 A;  1TRF A;  2GGZ A;  1XFW O;  1J7Q A;  2LE9 B;  1CKK A;  1K96 A;  4ZCU A;  1IWQ A;  1IJ5 A;  2WOR A;  2KBM A;  4I5J A;  1TNP A;  2ZNE A;  4MZJ A;  2KYF A;  1EJ3 A;  2L51 A;  4USL A;  1QV0 A;  4ORB B;  2SAS A;  3IF7 A;  1DJI A;  1CDM A;  4YGA A;  3C1V A;  1KSM A;  3CR2 A;  1QV1 A;  1GGZ A;  1UHH A;  1QIW A;  1BR1 B;  1QX5 B;  1QJT A;  1TN4 A;  1AUI B;  1RWY A;  2ZFD A;  1CFC A;  2OTG C;  1W7I B;  2B1U A;  4MLW A;  2JWW A;  4C0K A;  4WRI A;  1G8I A;  1YR5 A;  2BE4 A;  3ZWH A;  1G33 A;  1YX7 A;  1XK4 C;  3I5I B;  5HKW A;  3SIB A;  1R2U A;  1A75 B;  3I5F C;  4MSP A;  4PHJ A;  2JT8 A;  1YVL A;  3D0Y B;  3TZ1 A;  5HKY A;  1JSA A;  1A4P A;  1RFJ A;  4YGD B;  1SYM A;  2JXL A;  3EK8 A;  5CPV A;  1H8B A;  1LKJ A;  1U5I B;  5ER5 A;  4MRX A;  4OV2 A;  1ZMZ A;  2LNK A;  3VGO A;  4TNC A;  4DIR A;  1DF0 B;  3SG2 A;  2MA2 A;  1EG4 A;  3WNX B;  4JPZ B;  4JQ0 D;  2F2O A;  3DF0 A;  3LK1 A;  1L7Z A;  1BG1 A;  2EC6 C;  3BUX B;  1Y1U A;  2GV5 A;  4GUK A;  4QJ4 B;  1CMF A;  1S3P A;  4M2Q A;  2BKH B;  1K2H A;  1CNP A;  1YX8 A;  1GJY A;  2MRD A;  3VRO A;  1CDN A;  3OB1 B;  4ORC B;  1PRW A;  1WRK A;  1KQM C;  3KEV A;  1WLM A;  2M8U A;  2WCE A;  1SMG A;  1SRA A;  4I5N B;  2JU0 A;  4OKH A;  1JFJ A;  5DKQ A;  2M29 A;  2JNX A;  2L5X B;  3BUO B;  1TCF A;  1YVH A;  2H61 C;  1UUR A;  1CDP A;  4YI8 A;  1XO5 A;  2R2I A;  2K2F A;  2L4I A;  1AJ5 A;  2BL0 B;  3DVE A;  2F8P A;  4ZCV A;  2ZND A;  3OP0 A;  2AAO A;  3E3R A;  1D1O A;  1NPQ A;  1ZAC A;  1F71 A;  4PDZ A;  2LM5 A;  4IL1 A;  1KWO B;  1NCZ A;  2KAY A;  1SL7 A;  2CXJ A;  1OMD A;  4GGF A;  3VRN A;  1IQ3 A;  1M39 A;  4HRH A;  1L2O C;  3EK4 A;  1YUR A;  3PM8 A;  2VRG A;  2I2R E;  1NYA A;  3KHE A;  1IQ5 A;  2GGM A;  3BYA A;  3PN7 B;  2E30 A;  5KTY A;  4MZK A;  1JC2 A;  2PRU A;  1NCY A;  4YGE B;  2K8M B;  1NX1 A;  3I5H C;  1DJX A;  4OCI A;  1M31 A;  2Y4Q A;  3O78 A;  2L0P A;  2FCE A;  1J55 A;  2NXQ A;  3EKH A;  4PAL A;  2BKI B;  1AK8 A;  1SCV A;  2OS8 B;  2QAC A;  2RGI A;  1PUL A;  3FWC A;  1SL8 A;  1Y6W A;  1W7J B;  4U8D A;  2KFG A;  2NZ0 A;  2BCB A;  2JOJ A;  1AHR A;  3AKB A;  3SG6 A;  3WHT B;  2LMT A;  1KQV A;  1B9A A;  1N0Y A;  1UWO A;  4WQ2 A;  4PHM A;  3KF9 A;  4PE4 A;  4R1E A;  1BLQ A;  2FOT A;  1YRU B;  2M1U A;  2JZI A;  2KNE A;  4PE1 A;  1OZS A;  1HQV A;  1WDC C;  3DD4 A;  3ZNI A;  5F6T A;  1F55 A;  1FW4 A;  3BXK A;  2OTG B;  1SR6 B;  3PAL A;  1F54 A;  1LA0 A;  3TUY B;  4ICB A;  4PCW A;  2EHB A;  1F4Q A;  1B8C A;  4NDD A;  2KI4 C;  1K90 D;  4OR9 B;  1CLB A;  2O5G A;  5HLV A;  1CM1 A;  3LK0 A;  1MF8 B;  5CSI A;  2KI6 C;  1NX2 A;  1QVI Z;  1NP8 A;  1WRZ A;  2A4J A;  1J1D A;  4P5O E;  5DKN A;  1R6P A;  1WY9 A;  1N65 A;  1Y0V H;  1SY9 A;  4XJK A;  4GBA A;  3WXA A;  4NDB A;  3I5G C;  5DKR A;  1K94 A;  1B8L A;  5ER4 X;  1CLM A;  2DOQ A;  5J3X A;  1KCY A;  2JTZ A;  1RTP 1;  2EC6 B;  1FPW A;  2LUX A;  4N5X A;  5JOL A;  1XVJ A;  4ORA B;  1J7P A;  2M3W A;  4BY5 A;  3IQO A;  1B7T Y;  2JC2 A;  2K61 A;  2ISD A;  1QIV A;  4MRY A;  4PE7 A;  3NSO A;  1SNL A;  1J7R A;  1QAS A;  3JVT C;  2MAZ A;  4CFR A;  3ICB A;  1LIN A;  1XFU O;  2CBL A;  1KQM B;  2F33 A;  2Q91 A;  2LAN A;  5AEQ A;  2L4H A;  1EXR A;  2G2B A;  4HRG A;  1X02 A;  5PAL A;  3QRX A;  1OQP A;  1TNQ A;  1DJW A;  1RRO A;  3HCM A;  2QPT A;  3LL8 B;  5CSF A;  2KHN A;  2LVK A;  1XK4 A;  3AAJ A;  2JNF A;  2OPO A;  1NUB A;  3BUM B;  1YUT A;  1ODB A;  4HSZ A;  1YRT B;  2G9B A;  2LMU A;  1VRK A;  2K7O A;  4MN0 A;  5I2O A;  4FQO A;  4CPV A;  1DMO A;  4FTG A;  1IRJ A;  1QLK A;  1SW8 A;  1EH2 A;  1A29 A;  5I2Q A;  3PLF B;  1JBA A;  1TOP A;  1PAL A;  2MLF C;  1KFX L;  2K7C A;  4MVF A;  5HLO A;  1L2O B;  4NQG A;  1HT9 A;  1S26 D;  3FS7 A;  1JWD A;  1EG3 A;  2WCF A;  2M9G A;  4GNK B;  1DJY A;  1KFU L;  2I94 A;  1UP5 A;  4ETO A;  1XFV O;  3TDU A;  1IJ6 A;  3GK2 A;  4N1F A;  1BMO A;  4GAO A;  3I5H B;  1LVC D;  1M45 A;  1PVB A;  1YTZ C;  1FBV A;  1K9K A;  2KQ6 A;  2AMI A;  3SG3 A;  1WLZ A;  2LMV A;  5AXI A;  5IBW A;  3SJS A;  2KDH A;  5BPJ A;  1BOD A;  1CDL A;  1TTX A;  2L2E A;  2LC5 A;  3SG5 A;  4YBH B;  4QJ3 B;  2H61 A;  4CFQ A;  1S5G Y;  4MEW A;  1SKT A;  5AAN A;  3SG7 A;  4DRW A;  1OZO A;  3O2P A;  1EL4 A;  2PSR A;  3NSK A;  3OB2 B;  1KK8 C;  2K7B A;  3CR5 X;  3LLE A;  4XJK B;  2M7L A;  3CGA A;  3CR4 X;  2L98 A;  2O60 A;  2JQ6 A;  3D10 A;  1LA3 A;  4P2Y B;  3GOF A;  1CMG A;  5HKZ A;  2ZRS A;  2KQY A;  4GPL B;  1KFX S;  2JT3 A;  4JWQ A;  1B8R A;  1OOJ A;  2JPT A;  3CLN A;  4OVN F;  2HET A;  1S36 A;  2PVB A;  1JF2 A;  3KO0 A;  4I5L B;  1C7V A;  2KSP A;  2SCP A;  2NCO A;  3IQQ A;  2LLU A;  2LUC A;  1ZUZ A;  1CLL A;  3AKA A;  2PAS A;  1KFU S;  3BUW B;  3BQ3 A;  1KSO A;  3TS5 C;  2CTN A;  4PHN A;  2LLS A;  1PVA A;  4F0Z B;  1B47 A;  3M0W A;  1K9U A;  1N2D A;  1RJV A;  1S6I A;  1DVI A;  3I5G B;  1M46 A;  3RLZ A;  4DCK A;  1SCM C;  3KPX A;  1Q80 A;  2FJU B;  3NSL A;  5GQQ C;  1PK0 D;  5AER A;  2NCP A;  3BOW A;  3DF0 B;  4M2P A;  4CID A;  5K89 A;  1QTX A;  3JTD C;  1Y1A A;  3GK4 X;  2HF5 A;  2MLE C;  1UHJ A;  2Y1N A;  4A4B A;  3I5F B;  3PSR A;  3OHM B;  1A2X A;  1XFY O;  5KSZ A;  3HX4 A;  4L9M A;  3PN7 C;  2M49 B;  3TDI A;  1NX0 A;  1ZOT B;  1KK7 Y;  2ZRT A;  1CFD A;  1PSB A;  3EVU A;  3OX5 A;  3OX6 A;  4WQ3 A;  5FYX A;  1CFF A;  2CCM A;  2EGD A;  2WND A;  1GGW A;  3CTN A;  5I8N A;  1XA5 A;  2JTT A;  2JXC A;  3VRQ A;  2OS8 C;  2BE6 A;  2F2P A;  1MWN A;  1ZFS A;  5G08 A;  2LP3 A;  3WHU B;  2LVJ A;  2M97 A;  1JUO A;  4AQI A;  1MXL C;  2LVI A;  2KGB C;  3EVV A;  4C0J A;  2LHI A;  2BEC A;  2K2A A;  4MZL A;  3F45 A;  4AOM A;  4E68 A;  1FI5 A;  1V1G A;  1S6C A;  2WC8 A;  1MHO A;  2L50 A;  2M7N A;  2PMY A;  3RM1 A;  1SK6 D;  1TIZ A;  1F70 A;  1JF0 A;  2D8N A;  2I7A A;  2KAX A;  5CSJ A;  5D7F A;  5HYD A;  1SR6 C;  1KK7 Z;  2BBN A;  1DJG A;  3DVJ A;  1QXP A;  5CSN A;  3SIA A;  2Y5I A;  3O4Y A;  4GGN A;  3TUY C;  2KI6 D;  3EVR A;  2COL B;  4NDC A;  2K7D A;  2LAP A;  3NXA A;  1XYD A;  2I18 A;  2CNP A;  1SPY A;  1IG5 A;  2MJW B;  2P6B B;  1DTL A;  2NLN A;  3FIA A;  2IS9 A;  1B7T Z;  2TN4 A;  3LCP C;  4PE0 A;  1K93 D;  1BU3 A;  3TDZ A;  1C07 A;  2JRF A;  1S1E A;  2BCX A;  3FWB A;  1RK9 A;  2CT9 A;  2LLT A;  3NSI A;  1DGU A;  5AFP A;  1NWD A;  1QX7 A;  1MR8 A;  1OMR A;  4YRU A;  1J7O A;  2JUL A;  2WCB A;  1AJ4 A;  2Q4U A;  1OSA A;  1YUS A;  1FF1 A;  4CLN A;  2HQ8 A;  2KFH A;  3I5I C;  1TNW A;  4D1E A;  3CZT X;  1KK8 B;  4PHK A;  1AVS A;  2LV7 A;  1DJZ A;  5I2L A;  1LXF C;  2BCA A;  1A03 A;  4DS7 A;  1B4C A;  2F3Y A;  1XFX O;  1ALW A;  2LVV A;  2M1K B;  1IKU A;  3BOW B;  1OMV A;  4HRE E;  1B1G A;  2F3Z A;  2E6W A;  1YUU A;  2MHH A;  4Q04 A;  4GGF C;  1Y1X A;  2LCP A;  1QLS A;  3TS5 B;  3K21 A;  4QJ5 B; 
#chains in the Genus database with same CATH topology
 4N1G A;  1G4Y R;  1IH0 A;  1A75 A;  2BNX A;  2FJY A;  2KFF A;  1UHI A;  1UHN A;  3D0Y A;  1CM4 A;  1MQ1 A;  3PAT A;  4YGC B;  5B8I B;  1J1E A;  3MSE B;  1NX3 A;  5DIC A;  2H2K A;  4UPG A;  1REC A;  1TCO B;  1U5I A;  3DVK A;  1SCM B;  1FI6 A;  1IGV A;  1WDC B;  4YI9 A;  3H4S E;  1K95 A;  1MUX A;  1PSR A;  1XFZ O;  2QEO A;  3CS1 A;  1OW4 A;  2ZKM X;  1JFK A;  2JT0 A;  1MXE A;  2KBI A;  2V53 A;  1DF0 A;  3AAK A;  3JTD B;  2MBX A;  3S0E A;  2ZN8 A;  2KI4 B;  3A4U B;  1C7W A;  3DVM A;  2KGR A;  2KAV A;  4YGB B;  3VRR A;  2K0J A;  2WOS A;  4I5K A;  1TNX A;  4XYN A;  2LP2 A;  1NSH A;  3IVT A;  3SG4 A;  3EKJ A;  4DUQ A;  1DT7 B;  1K9P A;  1F8H A;  1CFP A;  5KU1 A;  2BBM A;  3B87 A;  2Y1M A;  4AQJ A;  1DJH A;  2KOT A;  4BY4 A;  1S5G Z;  2BL0 C;  2QEH A;  2LHL A;  3CWG A;  3VRP A;  1AP4 A;  1BOC A;  1UHK A;  5D69 A;  1BJF A;  4M2O A;  2KYC A;  1NIW A;  3BUN B;  1BT6 A;  1UUS A;  1QAT A;  3O6B A;  1KWO C;  3D74 A;  4A4C A;  1QX2 A;  1QS7 A;  1QVI Y;  4MBE A;  4C0L A;  1BR4 B;  1CTR A;  1M63 B;  1NCX A;  5JJG A;  1V1F A;  2PAL A;  1CB1 A;  1DGV A;  2FCD A;  2HPS A;  1E8A A;  3A8R A;  3PFV A;  2M0R A;  1F4O A;  2ZN9 A;  4GFT A;  3RZS A;  3JVT B;  3GK1 A;  2AUC A;  3FE6 A;  3NGV A;  1K8U A;  1SBJ A;  1WRL A;  1GM0 A;  1T14 A;  2QDI A;  1H4B A;  4PT1 A;  3SS3 A;  1ALV A;  1GQM A;  1SL9 A;  1S6J A;  2HQW A;  3EK7 A;  1OE9 B;  5TNC A;  1BF5 A;  1TRF A;  2GGZ A;  1XFW O;  1J7Q A;  2LE9 B;  1CKK A;  1K96 A;  4ZCU A;  1IWQ A;  1IJ5 A;  2WOR A;  2KBM A;  4I5J A;  1TNP A;  2ZNE A;  4MZJ A;  2KYF A;  1EJ3 A;  2L51 A;  3BFA A;  3EG5 B;  2BAP A;  4USL A;  1QV0 A;  4ORB B;  2SAS A;  3IF7 A;  1DJI A;  3S0B A;  1CDM A;  4YGA A;  3C1V A;  1KSM A;  3CR2 A;  1QV1 A;  1GGZ A;  1UHH A;  3NHI A;  1QIW A;  1BR1 B;  1TUZ A;  1QX5 B;  1QJT A;  1TN4 A;  1AUI B;  1RWY A;  2KLE A;  2ZFD A;  2OTG C;  3SS5 A;  2K60 A;  1W7I B;  2B1U A;  3O4X A;  4MLW A;  1CFC A;  2JWW A;  4C0K A;  4WRI A;  1G8I A;  1YR5 A;  2BE4 A;  3ZWH A;  1G33 A;  1YX7 A;  1XK4 C;  3I5I B;  3QME A;  5HKW A;  3SIB A;  1R2U A;  3S0F A;  1A75 B;  3I5F C;  4MSP A;  4PHJ A;  2JT8 A;  1YVL A;  3D0Y B;  3TZ1 A;  5HKY A;  1JSA A;  1A4P A;  2L5Y A;  1RFJ A;  4YGD B;  1SYM A;  2JXL A;  3EK8 A;  5CPV A;  1H8B A;  1LKJ A;  1U5I B;  5ER5 A;  3D73 A;  3D75 A;  4MRX A;  4OV2 A;  1ZMZ A;  2LNK A;  3VGO A;  4TNC A;  4DIR A;  1DF0 B;  3SG2 A;  2MA2 A;  1EG4 A;  3WNX B;  4JPZ B;  4JQ0 D;  2F2O A;  3DF0 A;  3LK1 A;  3DYE A;  2WC5 A;  1L7Z A;  1BG1 A;  2EC6 C;  5D3O A;  3BUX B;  1Y1U A;  2GV5 A;  4GUK A;  4QJ4 B;  1CMF A;  1W9Z A;  1S3P A;  4M2Q A;  4F7F A;  2BKH B;  1K2H A;  1CNP A;  1YX8 A;  1GJY A;  2MRD A;  3VRO A;  1CDN A;  3OB1 B;  2PQL A;  4ORC B;  1PRW A;  1WRK A;  1KQM C;  3KEV A;  1WLM A;  2M8U A;  2WCE A;  1SMG A;  1SRA A;  1SSE B;  4I5N B;  3BFB A;  2JU0 A;  2H8V A;  4OKH A;  5HL1 A;  1JFJ A;  5DKQ A;  2M29 A;  2JNX A;  2L5X B;  3BUO B;  1TCF A;  1YVH A;  2H61 C;  1UUR A;  1CDP A;  4YI8 A;  1XO5 A;  2R2I A;  2YGU A;  2K2F A;  2L4I A;  1AJ5 A;  2BL0 B;  3DVE A;  3VB1 A;  2F8P A;  4ZCV A;  2ZND A;  3OP0 A;  1DEL A;  2AAO A;  3E3R A;  1D1O A;  1NPQ A;  1ZAC A;  1F71 A;  3B86 A;  3BFH A;  4PDZ A;  2LM5 A;  4IL1 A;  1KWO B;  1NCZ A;  2KAY A;  1SL7 A;  2CXJ A;  2WCK A;  1OMD A;  4GGF A;  3VRN A;  2WC6 A;  1IQ3 A;  1M39 A;  2WCH A;  4HRH A;  3CYZ A;  1L2O C;  3EK4 A;  1YUR A;  5FI7 A;  3PM8 A;  2VRG A;  2I2R E;  1NYA A;  3KHE A;  1IQ5 A;  3B88 A;  2GGM A;  3BYA A;  3L47 A;  3PN7 B;  2E30 A;  5KTY A;  4MZK A;  3CZ1 A;  1JC2 A;  3FE9 A;  2PRU A;  1NCY A;  4YGE B;  2K8M B;  1NX1 A;  3I5H C;  1DJX A;  4OCI A;  1M31 A;  2Y4Q A;  2PYQ A;  3CAB A;  3O78 A;  2L0P A;  2FCE A;  1J55 A;  2NXQ A;  3EKH A;  2GTE A;  4PAL A;  2BKI B;  1AK8 A;  1SCV A;  2OS8 B;  2QAC A;  4INW A;  2RGI A;  1PUL A;  3FWC A;  1SL8 A;  1Y6W A;  1W7J B;  4U8D A;  2KFG A;  2NZ0 A;  2BCB A;  2JOJ A;  1AHR A;  2WCL A;  3AKB A;  3SG6 A;  2LMT A;  4OZD A;  3WHT B;  1KQV A;  3DZT A;  1B9A A;  3OBV A;  1N0Y A;  1UWO A;  4WQ2 A;  4PHM A;  3KF9 A;  4PE4 A;  4R1E A;  1BLQ A;  2FOT A;  1YRU B;  2M1U A;  2JZI A;  5FI6 A;  2KNE A;  4PE1 A;  1OZS A;  1HQV A;  3Q8I A;  3K1E A;  1WDC C;  3DD4 A;  3ZNI A;  5F6T A;  1F55 A;  1FW4 A;  3BXK A;  3B7A A;  2OTG B;  1SR6 B;  3PAL A;  3V2L A;  3B6X A;  2JPO A;  1F54 A;  1LA0 A;  3TUY B;  4ICB A;  4PCW A;  2EHB A;  1F4Q A;  1B8C A;  4NDD A;  2KI4 C;  1K90 D;  4OR9 B;  1CLB A;  2O5G A;  5HLV A;  1CM1 A;  3D76 A;  3LK0 A;  1MF8 B;  5CSI A;  2KI6 C;  1NX2 A;  1QVI Z;  1NP8 A;  1WRZ A;  2A4J A;  1J1D A;  4P5O E;  5DKN A;  2KLD A;  1R6P A;  1WY9 A;  1N65 A;  1Y0V H;  1SY9 A;  4XJK A;  4GBA A;  3WXA A;  2WCJ A;  4NDB A;  3I5G C;  3R1P A;  1TUJ A;  5DKR A;  1K94 A;  1B8L A;  3CDN A;  5ER4 X;  1CLM A;  2DOQ A;  5J3X A;  1KCY A;  2JTZ A;  3N7H A;  2P70 A;  1RTP 1;  2EC6 B;  1FPW A;  2LUX A;  4N5X A;  5JOL A;  1XVJ A;  4ORA B;  1J7P A;  2M3W A;  5I94 A;  4BY5 A;  3IQO A;  1B7T Y;  2JC2 A;  2K61 A;  2ISD A;  1QIV A;  4MRY A;  4PE7 A;  3NSO A;  1C3Y A;  1SNL A;  1J7R A;  1QAS A;  1Z2C B;  5FI2 A;  3JVT C;  2MAZ A;  4CFR A;  3ICB A;  1LIN A;  1XFU O;  2CBL A;  1KQM B;  2F33 A;  2Q91 A;  2LAN A;  5AEQ A;  2L4H A;  1EXR A;  2G2B A;  4HRG A;  1X02 A;  5PAL A;  3QRX A;  1OQP A;  1TNQ A;  3CZ0 A;  1DJW A;  1RRO A;  3HCM A;  1DC1 A;  2QPT A;  3LL8 B;  4JD9 A;  5CSF A;  2KHN A;  2LVK A;  4FQT A;  1XK4 A;  3AAJ A;  2JNF A;  2OPO A;  1NUB A;  3DXL A;  3BUM B;  5EL2 A;  1YUT A;  1ODB A;  4HSZ A;  1YRT B;  2G9B A;  2LMU A;  1VRK A;  2K7O A;  4MN0 A;  5I2O A;  4FQO A;  4CPV A;  1DMO A;  4FTG A;  1IRJ A;  1QWV A;  1OOH A;  3UO9 A;  1QLK A;  1SW8 A;  3S0G A;  1A29 A;  5I2Q A;  1EH2 A;  3PLF B;  1JBA A;  1TOP A;  1PAL A;  2MLF C;  1KFX L;  2K7C A;  4MVF A;  1OOI X;  5HLO A;  1FI5 A;  1L2O B;  4NQG A;  1DQE A;  3PJI A;  1HT9 A;  1S26 D;  3FS7 A;  1JWD A;  1EG3 A;  2WCF A;  2M9G A;  4GNK B;  1DJY A;  1KFU L;  4KYN A;  2I94 A;  1UP5 A;  3SS4 A;  4ETO A;  1XFV O;  3TDU A;  1IJ6 A;  3GK2 A;  4N1F A;  1BMO A;  4GAO A;  3I5H B;  1LVC D;  1M45 A;  1PVB A;  1YTZ C;  3PM2 A;  1FBV A;  1K9K A;  2KQ6 A;  2AMI A;  3SG3 A;  1WLZ A;  2LMV A;  5AXI A;  5IBW A;  3SJS A;  2KDH A;  5BPJ A;  1BOD A;  1CDL A;  1TTX A;  2L2E A;  2LC5 A;  3SG5 A;  4YBH B;  4QJ3 B;  2H61 A;  1C3Z A;  4CFQ A;  3OGN A;  1S5G Y;  1ORG A;  4MEW A;  1SKT A;  5AAN A;  3SG7 A;  4DRW A;  1OZO A;  3O2P A;  1EL4 A;  3L4L A;  2PSR A;  3NSK A;  3OB2 B;  1KK8 C;  2K7B A;  3CR5 X;  3LLE A;  4XJK B;  2M7L A;  3CGA A;  3CR4 X;  2L98 A;  2O60 A;  2JQ6 A;  3D10 A;  1LA3 A;  4P2Y B;  3GOF A;  1CMG A;  5HKZ A;  2ZRS A;  2KQY A;  4GPL B;  3UNW A;  1KFX S;  2JT3 A;  4JWQ A;  1B8R A;  1OOJ A;  2JPT A;  3CLN A;  4OVN F;  2HET A;  1S36 A;  2PVB A;  1JF2 A;  3KO0 A;  4I5L B;  1C7V A;  2KSP A;  2SCP A;  2NCO A;  3IQQ A;  2LLU A;  2LUC A;  1ZUZ A;  1CLL A;  3AKA A;  2PAS A;  1KFU S;  3BUW B;  3BQ3 A;  1KSO A;  1LS8 A;  3TS5 C;  2CTN A;  4PHN A;  3FE8 A;  2LLS A;  1PVA A;  4F0Z B;  1XFR A;  1TWO A;  1B47 A;  3M0W A;  1K9U A;  1N2D A;  1RJV A;  1S6I A;  1DVI A;  3I5G B;  1M46 A;  3RLZ A;  4DCK A;  1SCM C;  3KPX A;  3BJH A;  3S0D A;  1Q80 A;  2FJU B;  3NSL A;  5GQQ C;  1PK0 D;  4JKT A;  5AER A;  2NCP A;  3BOW A;  1P28 A;  3DF0 B;  4M2P A;  4CID A;  5K89 A;  1QTX A;  3JTD C;  1Y1A A;  3GK4 X;  2HF5 A;  2MLE C;  1UHJ A;  2Y1N A;  4A4B A;  3I5F B;  3PSR A;  3OHM B;  1A2X A;  3S0A A;  1XFY O;  5KSZ A;  3HX4 A;  4L9M A;  3PN7 C;  2M49 B;  3TDI A;  1NX0 A;  1ZOT B;  1KK7 Y;  2ZRT A;  1CFD A;  1PSB A;  3EVU A;  3OX5 A;  3OX6 A;  4WQ3 A;  5FYX A;  1CFF A;  2CCM A;  2EGD A;  3D78 A;  2WND A;  1GGW A;  3CTN A;  5I8N A;  1XA5 A;  2JTT A;  2JXC A;  1OOG A;  2OS8 C;  2QEV A;  3VRQ A;  2BE6 A;  2F2P A;  1MWN A;  1Z4H A;  1ZFS A;  5G08 A;  2LP3 A;  3WHU B;  1IIO A;  2LVJ A;  3D77 A;  2M97 A;  1JUO A;  3R72 A;  4AQI A;  1MXL C;  2LVI A;  2KGB C;  3EVV A;  4C0J A;  2LHI A;  2BEC A;  2K2A A;  3R1O A;  3F45 A;  4MZL A;  2P71 A;  4AOM A;  1V1G A;  1S6C A;  4E68 A;  2WC8 A;  1MHO A;  2ERB A;  2L50 A;  2M7N A;  2PMY A;  3RM1 A;  1SK6 D;  1TIZ A;  1F70 A;  1JF0 A;  2D8N A;  2I7A A;  2KAX A;  5CSJ A;  5D7F A;  3CZ2 A;  5HYD A;  1SR6 C;  1KK7 Z;  2BBN A;  1DJG A;  3DVJ A;  3NHT A;  1QXP A;  5CSN A;  3SIA A;  2Y5I A;  1OOF A;  3O4Y A;  4GGN A;  3TUY C;  2KI6 D;  3EVR A;  2COL B;  4NDC A;  2K7D A;  2KPH A;  2LAP A;  2L2C A;  3NXA A;  1XYD A;  2I18 A;  2CNP A;  1SPY A;  4INX A;  1IG5 A;  2MJW B;  2QEB A;  2P6B B;  1DTL A;  2NLN A;  3FIA A;  2IS9 A;  1B7T Z;  2TN4 A;  3LCP C;  4PE0 A;  1K93 D;  1BU3 A;  3R1V A;  1DEK A;  3TDZ A;  1C07 A;  4IJ7 A;  2WCM A;  2JRF A;  1S1E A;  2BCX A;  3FWB A;  1RK9 A;  2CT9 A;  2LLT A;  3NSI A;  1DGU A;  5AFP A;  1NWD A;  1QX7 A;  1MR8 A;  1OMR A;  4YRU A;  1J7O A;  2JUL A;  2WCB A;  1AJ4 A;  2Q4U A;  1OSA A;  1YUS A;  1FF1 A;  4CLN A;  2HQ8 A;  2KFH A;  3L4A A;  3I5I C;  1TNW A;  4D1E A;  3DY9 A;  3CZT X;  1KK8 B;  4PHK A;  1AVS A;  2LV7 A;  1DJZ A;  5I2L A;  1LXF C;  2BCA A;  1A03 A;  4DS7 A;  1B4C A;  2F3Y A;  1XFX O;  1ALW A;  2LVV A;  2M1K B;  1IKU A;  3BOW B;  1OMV A;  4HRE E;  1B1G A;  2F3Z A;  2E6W A;  1YUU A;  2MHH A;  4Q04 A;  4GGF C;  1Y1X A;  2LCP A;  1QLS A;  3TS5 B;  3K21 A;  4QJ5 B; 
#chains in the Genus database with same CATH homology
 4N1G A;  1G4Y R;  1IH0 A;  1A75 A;  2KFF A;  1UHI A;  1UHN A;  3D0Y A;  1CM4 A;  1MQ1 A;  3PAT A;  4YGC B;  5B8I B;  1J1E A;  3MSE B;  1NX3 A;  2H2K A;  4UPG A;  1REC A;  1TCO B;  1U5I A;  3DVK A;  1SCM B;  1FI6 A;  1IGV A;  1WDC B;  4YI9 A;  3H4S E;  1K95 A;  1MUX A;  1PSR A;  1XFZ O;  3CS1 A;  2ZKM X;  1JFK A;  2JT0 A;  1MXE A;  2KBI A;  2V53 A;  1DF0 A;  3AAK A;  3JTD B;  2MBX A;  2ZN8 A;  2KI4 B;  3A4U B;  1C7W A;  3DVM A;  2KGR A;  2KAV A;  4YGB B;  3VRR A;  2K0J A;  2WOS A;  4I5K A;  1TNX A;  4XYN A;  2LP2 A;  1NSH A;  3SG4 A;  4DUQ A;  3EKJ A;  1DT7 B;  1F8H A;  1K9P A;  1CFP A;  5KU1 A;  2BBM A;  4AQJ A;  2Y1M A;  1DJH A;  2KOT A;  4BY4 A;  1S5G Z;  2BL0 C;  3VRP A;  2LHL A;  3CWG A;  1AP4 A;  1BOC A;  1UHK A;  5D69 A;  1BJF A;  4M2O A;  2KYC A;  1NIW A;  3BUN B;  1BT6 A;  1UUS A;  1QAT A;  3O6B A;  1KWO C;  4A4C A;  1QX2 A;  1QS7 A;  1QVI Y;  4MBE A;  4C0L A;  1BR4 B;  1CTR A;  1M63 B;  1NCX A;  5JJG A;  1V1F A;  2PAL A;  1CB1 A;  1DGV A;  2FCD A;  2HPS A;  1E8A A;  3A8R A;  3PFV A;  2M0R A;  1F4O A;  2ZN9 A;  4GFT A;  3JVT B;  3GK1 A;  2AUC A;  1K8U A;  1SBJ A;  1WRL A;  1H4B A;  1ALV A;  1GQM A;  1SL9 A;  1S6J A;  2HQW A;  3EK7 A;  1OE9 B;  5TNC A;  1BF5 A;  1TRF A;  2GGZ A;  1XFW O;  1J7Q A;  2LE9 B;  1CKK A;  1K96 A;  4ZCU A;  1IWQ A;  1IJ5 A;  2WOR A;  2KBM A;  4I5J A;  1TNP A;  2ZNE A;  4MZJ A;  2KYF A;  1EJ3 A;  2L51 A;  4USL A;  1QV0 A;  4ORB B;  2SAS A;  3IF7 A;  1DJI A;  1CDM A;  4YGA A;  3C1V A;  1KSM A;  3CR2 A;  1QV1 A;  1GGZ A;  1UHH A;  1QIW A;  1BR1 B;  1QX5 B;  1QJT A;  1TN4 A;  1AUI B;  1RWY A;  2ZFD A;  1CFC A;  2OTG C;  1W7I B;  2B1U A;  4MLW A;  2JWW A;  4C0K A;  4WRI A;  1G8I A;  1YR5 A;  2BE4 A;  3ZWH A;  1G33 A;  1YX7 A;  1XK4 C;  3I5I B;  5HKW A;  3SIB A;  1R2U A;  1A75 B;  3I5F C;  4MSP A;  4PHJ A;  2JT8 A;  1YVL A;  3D0Y B;  3TZ1 A;  5HKY A;  1JSA A;  1A4P A;  1RFJ A;  4YGD B;  1SYM A;  2JXL A;  3EK8 A;  5CPV A;  1H8B A;  1LKJ A;  1U5I B;  5ER5 A;  4MRX A;  4OV2 A;  1ZMZ A;  2LNK A;  3VGO A;  4TNC A;  4DIR A;  1DF0 B;  3SG2 A;  2MA2 A;  1EG4 A;  3WNX B;  4JPZ B;  4JQ0 D;  2F2O A;  3DF0 A;  3LK1 A;  1L7Z A;  1BG1 A;  2EC6 C;  3BUX B;  1Y1U A;  2GV5 A;  4GUK A;  4QJ4 B;  1CMF A;  1S3P A;  4M2Q A;  2BKH B;  1K2H A;  1CNP A;  1YX8 A;  1GJY A;  2MRD A;  3VRO A;  1CDN A;  3OB1 B;  4ORC B;  1PRW A;  1WRK A;  1KQM C;  3KEV A;  1WLM A;  2M8U A;  2WCE A;  1SMG A;  1SRA A;  4I5N B;  2JU0 A;  4OKH A;  1JFJ A;  5DKQ A;  2M29 A;  2JNX A;  2L5X B;  3BUO B;  1TCF A;  1YVH A;  2H61 C;  1UUR A;  1CDP A;  4YI8 A;  1XO5 A;  2R2I A;  2K2F A;  2L4I A;  1AJ5 A;  2BL0 B;  3DVE A;  2F8P A;  4ZCV A;  2ZND A;  3OP0 A;  2AAO A;  3E3R A;  1D1O A;  1NPQ A;  1ZAC A;  1F71 A;  4PDZ A;  2LM5 A;  4IL1 A;  1KWO B;  1NCZ A;  2KAY A;  1SL7 A;  2CXJ A;  1OMD A;  4GGF A;  3VRN A;  1IQ3 A;  1M39 A;  4HRH A;  1L2O C;  3EK4 A;  1YUR A;  3PM8 A;  2VRG A;  2I2R E;  1NYA A;  3KHE A;  1IQ5 A;  2GGM A;  3BYA A;  3PN7 B;  2E30 A;  5KTY A;  4MZK A;  1JC2 A;  2PRU A;  1NCY A;  4YGE B;  2K8M B;  1NX1 A;  3I5H C;  1DJX A;  4OCI A;  1M31 A;  2Y4Q A;  3O78 A;  2L0P A;  2FCE A;  1J55 A;  2NXQ A;  3EKH A;  4PAL A;  2BKI B;  1AK8 A;  1SCV A;  2OS8 B;  2QAC A;  2RGI A;  1PUL A;  3FWC A;  1SL8 A;  1Y6W A;  1W7J B;  4U8D A;  2KFG A;  2NZ0 A;  2BCB A;  2JOJ A;  1AHR A;  3AKB A;  3SG6 A;  3WHT B;  2LMT A;  1KQV A;  1B9A A;  1N0Y A;  1UWO A;  4WQ2 A;  4PHM A;  3KF9 A;  4PE4 A;  4R1E A;  1BLQ A;  2FOT A;  1YRU B;  2M1U A;  2JZI A;  2KNE A;  4PE1 A;  1OZS A;  1HQV A;  1WDC C;  3DD4 A;  3ZNI A;  5F6T A;  1F55 A;  1FW4 A;  3BXK A;  2OTG B;  1SR6 B;  3PAL A;  1F54 A;  1LA0 A;  3TUY B;  4ICB A;  4PCW A;  2EHB A;  1F4Q A;  1B8C A;  4NDD A;  2KI4 C;  1K90 D;  4OR9 B;  1CLB A;  2O5G A;  5HLV A;  1CM1 A;  3LK0 A;  1MF8 B;  5CSI A;  2KI6 C;  1NX2 A;  1QVI Z;  1NP8 A;  1WRZ A;  2A4J A;  1J1D A;  4P5O E;  5DKN A;  1R6P A;  1WY9 A;  1N65 A;  1Y0V H;  1SY9 A;  4XJK A;  4GBA A;  3WXA A;  4NDB A;  3I5G C;  5DKR A;  1K94 A;  1B8L A;  5ER4 X;  1CLM A;  2DOQ A;  5J3X A;  1KCY A;  2JTZ A;  1RTP 1;  2EC6 B;  1FPW A;  2LUX A;  4N5X A;  5JOL A;  1XVJ A;  4ORA B;  1J7P A;  2M3W A;  4BY5 A;  3IQO A;  1B7T Y;  2JC2 A;  2K61 A;  2ISD A;  1QIV A;  4MRY A;  4PE7 A;  3NSO A;  1SNL A;  1J7R A;  1QAS A;  3JVT C;  2MAZ A;  4CFR A;  3ICB A;  1LIN A;  1XFU O;  2CBL A;  1KQM B;  2F33 A;  2Q91 A;  2LAN A;  5AEQ A;  2L4H A;  1EXR A;  2G2B A;  4HRG A;  1X02 A;  5PAL A;  3QRX A;  1OQP A;  1TNQ A;  1DJW A;  1RRO A;  3HCM A;  2QPT A;  3LL8 B;  5CSF A;  2KHN A;  2LVK A;  1XK4 A;  3AAJ A;  2JNF A;  2OPO A;  1NUB A;  3BUM B;  1YUT A;  1ODB A;  4HSZ A;  1YRT B;  2G9B A;  2LMU A;  1VRK A;  2K7O A;  4MN0 A;  5I2O A;  4FQO A;  4CPV A;  1DMO A;  4FTG A;  1IRJ A;  1QLK A;  1SW8 A;  1EH2 A;  1A29 A;  5I2Q A;  3PLF B;  1JBA A;  1TOP A;  1PAL A;  2MLF C;  1KFX L;  2K7C A;  4MVF A;  5HLO A;  1L2O B;  4NQG A;  1HT9 A;  1S26 D;  3FS7 A;  1JWD A;  1EG3 A;  2WCF A;  2M9G A;  4GNK B;  1DJY A;  1KFU L;  2I94 A;  1UP5 A;  4ETO A;  1XFV O;  3TDU A;  1IJ6 A;  3GK2 A;  4N1F A;  1BMO A;  4GAO A;  3I5H B;  1LVC D;  1M45 A;  1PVB A;  1YTZ C;  1FBV A;  1K9K A;  2KQ6 A;  2AMI A;  3SG3 A;  1WLZ A;  2LMV A;  5AXI A;  5IBW A;  3SJS A;  2KDH A;  5BPJ A;  1BOD A;  1CDL A;  1TTX A;  2L2E A;  2LC5 A;  3SG5 A;  4YBH B;  4QJ3 B;  2H61 A;  4CFQ A;  1S5G Y;  4MEW A;  1SKT A;  5AAN A;  3SG7 A;  4DRW A;  1OZO A;  3O2P A;  1EL4 A;  2PSR A;  3NSK A;  3OB2 B;  1KK8 C;  2K7B A;  3CR5 X;  3LLE A;  4XJK B;  2M7L A;  3CGA A;  3CR4 X;  2L98 A;  2O60 A;  2JQ6 A;  3D10 A;  1LA3 A;  4P2Y B;  3GOF A;  1CMG A;  5HKZ A;  2ZRS A;  2KQY A;  4GPL B;  1KFX S;  2JT3 A;  4JWQ A;  1B8R A;  1OOJ A;  2JPT A;  3CLN A;  4OVN F;  2HET A;  1S36 A;  2PVB A;  1JF2 A;  3KO0 A;  4I5L B;  1C7V A;  2KSP A;  2SCP A;  2NCO A;  3IQQ A;  2LLU A;  2LUC A;  1ZUZ A;  1CLL A;  3AKA A;  2PAS A;  1KFU S;  3BUW B;  3BQ3 A;  1KSO A;  3TS5 C;  2CTN A;  4PHN A;  2LLS A;  1PVA A;  4F0Z B;  1B47 A;  3M0W A;  1K9U A;  1N2D A;  1RJV A;  1S6I A;  1DVI A;  3I5G B;  1M46 A;  3RLZ A;  4DCK A;  1SCM C;  3KPX A;  1Q80 A;  2FJU B;  3NSL A;  5GQQ C;  1PK0 D;  5AER A;  2NCP A;  3BOW A;  3DF0 B;  4M2P A;  4CID A;  5K89 A;  1QTX A;  3JTD C;  1Y1A A;  3GK4 X;  2HF5 A;  2MLE C;  1UHJ A;  2Y1N A;  4A4B A;  3I5F B;  3PSR A;  3OHM B;  1A2X A;  1XFY O;  5KSZ A;  3HX4 A;  4L9M A;  3PN7 C;  2M49 B;  3TDI A;  1NX0 A;  1ZOT B;  1KK7 Y;  2ZRT A;  1CFD A;  1PSB A;  3EVU A;  3OX5 A;  3OX6 A;  4WQ3 A;  5FYX A;  1CFF A;  2CCM A;  2EGD A;  2WND A;  1GGW A;  3CTN A;  5I8N A;  1XA5 A;  2JTT A;  2JXC A;  3VRQ A;  2OS8 C;  2BE6 A;  2F2P A;  1MWN A;  1ZFS A;  5G08 A;  2LP3 A;  3WHU B;  2LVJ A;  2M97 A;  1JUO A;  4AQI A;  1MXL C;  2LVI A;  2KGB C;  3EVV A;  4C0J A;  2LHI A;  2BEC A;  2K2A A;  4MZL A;  3F45 A;  4AOM A;  4E68 A;  1FI5 A;  1V1G A;  1S6C A;  2WC8 A;  1MHO A;  2L50 A;  2M7N A;  2PMY A;  3RM1 A;  1SK6 D;  1TIZ A;  1F70 A;  1JF0 A;  2D8N A;  2I7A A;  2KAX A;  5CSJ A;  5D7F A;  5HYD A;  1SR6 C;  1KK7 Z;  2BBN A;  1DJG A;  3DVJ A;  1QXP A;  5CSN A;  3SIA A;  2Y5I A;  3O4Y A;  4GGN A;  3TUY C;  2KI6 D;  3EVR A;  2COL B;  4NDC A;  2K7D A;  2LAP A;  3NXA A;  1XYD A;  2I18 A;  2CNP A;  1SPY A;  1IG5 A;  2MJW B;  2P6B B;  1DTL A;  2NLN A;  3FIA A;  2IS9 A;  1B7T Z;  2TN4 A;  3LCP C;  4PE0 A;  1K93 D;  1BU3 A;  3TDZ A;  1C07 A;  2JRF A;  1S1E A;  2BCX A;  3FWB A;  1RK9 A;  2CT9 A;  2LLT A;  3NSI A;  1DGU A;  5AFP A;  1NWD A;  1QX7 A;  1MR8 A;  1OMR A;  4YRU A;  1J7O A;  2JUL A;  2WCB A;  1AJ4 A;  2Q4U A;  1OSA A;  1YUS A;  1FF1 A;  4CLN A;  2HQ8 A;  2KFH A;  3I5I C;  1TNW A;  4D1E A;  3CZT X;  1KK8 B;  4PHK A;  1AVS A;  2LV7 A;  1DJZ A;  5I2L A;  1LXF C;  2BCA A;  1A03 A;  4DS7 A;  1B4C A;  2F3Y A;  1XFX O;  1ALW A;  2LVV A;  2M1K B;  1IKU A;  3BOW B;  1OMV A;  4HRE E;  1B1G A;  2F3Z A;  2E6W A;  1YUU A;  2MHH A;  4Q04 A;  4GGF C;  1Y1X A;  2LCP A;  1QLS A;  3TS5 B;  3K21 A;  4QJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...