2AUCA

Structure of the plasmodium mtip-myoa complex, a key component of the parasite invasion motor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
NGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Myosin A Tail Interacting Protein
publication title Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor.
pubmed doi rcsb
source organism Plasmodium knowlesi
total genus 33
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2aucA02
5KSZA 3TUYB 4PHNA 1JSAA 1YX8A 1K96A 3KPXA 1J7RA 3BUOB 3JVTB 4CLNA 4PE4A 1L2OB 4M2PA 3TUYC 1KQVA 1IQ3A 1JUOA 2LHIA 3JVTC 1N2DA 1L2OC 2BKIB 2K2AA 4C0KA 1UP5A 2VRGA 1DJXA 1SYMA 1K8UA 3EK7A 1JF2A 2CNPA 2JQ6A 3I5HB 1XA5A 3BYAA 3M0WA 3I5GC 4NDBA 1RJVA 1LA0A 1N65A 4MRXA 3I5HC 2MRDA 2BECA 3ZNIA 1XFYO 3PN7B 1IH0A 2LP3A 2LLSA 4N1FA 3PN7C 2ZN8A 1JFKA 1CMFA 1Y1AA 2KQYA 2G9BA 3WHTB 5I8NA 1EG4A 1E8AA 2JTTA 2JZIA 1KK7Y 2MBXA 1QJTA 1CLMA 1FBVA 4XJKB 4WRIA 1NPQA 4XJKA 2NXQA 1R6PA 1IGVA 3CZTX 4JWQA 5AXIA 3SIAA 1XK4A 1K94A 2LVVA 1YRTB 2KGBC 3AAKA 5AERA 1XK4C 2BCBA 2F3ZA 5AFPA 4NQGA 3KEVA 1CMGA 4NDDA 2LHLA 1MR8A 3QRXA 1B8CA 1GQMA 3ZWHA 1DJHA 1K9PA 1DJGA 2OPOA 1YUTA 4QJ3B 4DUQA 1JF0A 2JU0A 2KFGA 2KGRA 1A03A 4OR9B 1J7QA 3BXKA 3IF7A 1Y1UA 2AUCA 1M45A 1TRFA 1TTXA 3CWGA 1BLQA 1BODA 1H4BA 2A4JA 1MF8B 3VRRA 1RECA 3SG5A 2F3YA 2KNEA 3LCPC 1OMRA 2CTNA 1NYAA 1V1GA 2JT3A 1N0YA 1GJYA 2JRFA 2KYCA 2WORA 1DTLA 3PM8A 3EVUA 2I94A 1DF0A 1OE9B 3DD4A 3VRNA 4AQIA 2F33A 4GPLB 2Y4QA 2K7BA 4YRUA 2WCBA 5J3XA 3DVJA 1U5IA 4P5OE 1DJWA 1QV0A 5K89A 1NWDA 1F71A 1NP8A 1DVIA 2M8UA 4I5LB 5DKNA 1CFPA 1QX5B 2LE9B 3HX4A 2KFHA 1IJ5A 1NCZA 1F70A 2Y5IA 1Y6WA 1UHKA 2LVJA 1IQ5A 1XFVO 2M7NA 1B1GA 3VRPA 1EH2A 3KHEA 3TZ1A 4GAOA 1LXFC 2QACA 3SG2A 4UPGA 2O5GA 1B7TY 1QIWA 2SCPA 3DF0B 3E3RA 3MSEB 3OHMB 4MZLA 2ZRTA 5G08A 4JPZB 2BE6A 4PHMA 3AKAA 4CFQA 4GGNA 1KSOA 4ORBB 4PCWA 2NCOA 4R1EA 1DGVA 2JXLA 3CGAA 5JJGA 1GGZA 1ZOTB 2K0JA 4N1GA 2LV7A 2HQWA 1SRAA 3CS1A 2BE4A 1F8HA 1ALVA 4C0JA 1LVCD 2F2OA 2JWWA 5CSNA 3VROA 1B8LA 1AUIB 2EC6B 2BBNA 5D7FA 3SG4A 1OOJA 2QPTA 2LMUA 1NCXA 2EC6C 2JPTA 2MLFC 2BL0B 3NSKA 2GV5A 2GGMA 2GGZA 2IS9A 2COLB 2KSPA 3KO0A 3LLEA 4GUKA 4MZKA 4NDCA 3TDIA 3EK4A 4PHKA 2BL0C 2KAVA 1G33A 2MLEC 4YGDB 2TN4A 2LANA 1MXLC 2KI4B 2HPSA 1BG1A 2MJWB 1B7TZ 4MRYA 3VGOA 1MHOA 1F55A 2KI4C 1R2UA 2M3WA 5CPVA 2L4HA 1A75B 1SW8A 3PSRA 1YUSA 1ZACA 1IRJA 1CLBA 1AJ5A 2PASA 4BY5A 5HYDA 1SL7A 1YR5A 1A29A 4ORCB 2KDHA 4Q04A 5KU1A 2ZNEA 1RFJA 1S26D 3AAJA 2MHHA 1CNPA 3EVRA 2L98A 1ZUZA 1S5GY 1SMGA 4DCKA 1JWDA 1EJ3A 1S3PA 1YVLA 1SCVA 2K2FA 2L50A 1UHHA 1CLLA 2I7AA 4I5KA 3PATA 2JNXA 2K7OA 1F54A 1BR1B 2L5XB 1OSAA 2LM5A 1J1EA 5F6TA 3I5IB 1PVAA 2DOQA 1HQVA 1KFUS 2K7DA 2LAPA 3A4UB 1MQ1A 1CDPA 1YURA 1ALWA 1YVHA 1CKKA 1WLZA 3OB1B 1B9AA 1CDLA 1WLMA 5FYXA 1PK0D 1W7JB 3NXAA 2LP2A 1EG3A 3EVVA 3CR2A 1DJZA 2KHNA 2FJUB 3CR4X 3D0YB 4MN0A 1CB1A 3LL8B 1FF1A 4TNCA 3AKBA 2EGDA 1M46A 1Y1XA 2M49B 1BT6A 4I5NB 1GGWA 4DRWA 1M31A 4GGFC 1IG5A 2CCMA 1C7WA 2LMTA 3WNXB 2WNDA 2CXJA 2PMYA 3PALA 1ODBA 2M9GA 4IL1A 4YGBB 2KAXA 2F2PA 3EKHA 1DGUA 1A4PA 2BBMA 1QS7A 2B1UA 2JNFA 1KK7Z 1QIVA 5ER5A 4CPVA 4M2OA 2E30A 2KYFA 4QJ4B 3VRQA 3SJSA 2R2IA 2MAZA 1AHRA 2LLTA 3FIAA 4PE7A 4MZJA 1YRUB 1H8BA 1J7OA 1NX3A 1SNLA 2OTGB 2HQ8A 1B47A 1S6IA 2NZ0A 5HLVA 1RK9A 2AMIA 1KWOB 1QXPA 2OTGC 5CSJA 5I2QA 2L4IA 1C07A 3I5FB 1KWOC 2L0PA 3OB2B 4GNKB 4PE0A 5DKRA 5AANA 2ZKMX 4AQJA 4GBAA 1NUBA 4MBEA 1KCYA 3I5FC 1TCOB 3WXAA 2ZN9A 3ICBA 3O78A 3DF0A 1OMDA 4ICBA 2CBLA 1OMVA 1QLSA 2D8NA 2PALA 1M39A 1XYDA 5ER4X 1TN4A 4QJ5B 2KAYA 1AVSA 4BY4A 2M1KB 1G4YR 2V53A 5BPJA 1KSMA 2FOTA 4L9MA 2OS8B 4PHJA 5HKZA 1TNWA 1YUUA 2Q4UA 1NCYA 1TNXA 1V1FA 1XFUO 2KI6C 2O60A 1MWNA 1CM1A 3BUWB 5IBWA 1TNPA 1WRKA 2JT8A 1SL9A 5HKYA 1ZMZA 1DT7B 1IKUA 1J55A 3NSIA 1XFZO 3OX6A 4MLWA 1K9KA 3PFVA 2RGIA 5HKWA 3SIBA 4DIRA 1OZSA 1LINA 4YGCB 1Q80A 3BOWB 1SBJA 4A4CA 3LK0A 1SPYA 4OCIA 2F8PA 1F4QA 1WRLA 4D1EA 4WQ3A 1KK8B 1UURA 1PULA 2BCAA 1LA3A 3BUXB 2CT9A 2LCPA 1XVJA 4PE1A 2FCEA 1KK8C 1QX2A 1BOCA 4OV2A 5CSFA 2WC8A 5HLOA 1SR6B 2JXCA 3NSLA 2ZFDA 3GK4X 1HT9A 3IQQA 4N5XA 4PDZA 1J7PA 1A75A 1SR6C 2JT0A 3FS7A 1PRWA 3O6BA 1TOPA 1AP4A 1FPWA 2M1UA 3PLFB 1AK8A 1FI5A 3EKJA 1BF5A 2P6BB 2LMVA 1AJ4A 1NX2A 3OP0A 1EL4A 4U8DA 4CFRA 1YTZC 5JOLA 1BR4B 1TNQA 1S6JA 1TCFA 4OKHA 1NX1A 2JULA 2SASA 1MUXA 4HRHA 2LVKA 4I5JA 3I5GB 2E6WA 1RTP1 1K90D 1DJIA 4A4BA 2PRUA 2I18A 5DKQA 1A2XA 5TNCA 1UHIA 2I2RE 1KFUL 4YGEB 3HCMA 4F0ZB 2Y1NA 1QX7A 1PALA 4MEWA 3IQOA 5D69A 2ISDA 1L7ZA 3I5IC 1M63B 2Q91A 1QVIY 4HSZA 5I2OA 2HETA 3BUMB 4OVNF 3CR5X 1XFXO 3O2PA 2HF5A 3SG6A 1WDCB 3D0YA 3KF9A 3RLZA 4XYNA 1DJYA 3TDZA 4GGFA 1WDCC 2AAOA 2LVIA 1PSBA 1WRZA 5I2LA 1FW4A 2K61A 2KOTA 1SL8A 2KFFA 2L51A 1UHNA 4HREE 1S1EA 4YI8A 1UUSA 5PALA 5GQQC 1J1DA 1SKTA 1K95A 1S5GZ 4GFTA 3A8RA 5CSIA 1KQMB 2JC2A 3GOFA 1B4CA 2LNKA 2K7CA 3WHUB 1KQMC 1PVBA 2KBMA 4HRGA 2JOJA 1TIZA 3BUNB 1MXEA 4MSPA 5AEQA 1SY9A 4YGAA 2ZNDA 1S36A 1ZFSA 4JQ0D 2KQ6A 1XFWO 1QVIZ 2LUCA 3K21A 1BU3A 2PSRA 4ZCUA 2LC5A 2LUXA 3GK2A 4ZCVA 2Y1MA 2L2EA 4E68A 1NIWA 1XO5A 1F4OA 2WCFA 4YI9A 2H2KA 3OX5A 1JBAA 2KI6D 1JC2A 1UWOA 1QV1A 1CFCA 3F45A 1DF0B 5B8IB 1EXRA 2G2BA 2WCEA 3JTDB 3RM1A 1FI6A 1K2HA 2KBIA 1YX7A 1IJ6A 1IWQA 1U5IB 1SCMB 3JTDC 2WOSA 2M29A 1NX0A 1SCMC 2H61A 2BKHB 1QATA 1W7IB 1BMOA 2H61C 3H4SE 4PALA 1VRKA 2LLUA 4AOMA 1PSRA 2NCPA 2ZRSA 4CIDA 1UHJA 3DVMA 4P2YB 1CFFA 2M97A 1RROA 1B8RA 2M0RA 2MA2A 3SG7A 1K9UA 3SG3A 4C0LA 1DMOA 5KTYA 3DVKA 2K8MB 2OS8C 1X02A 2JTZA 2BCXA 3FWBA 4FTGA 4ETOA 3DVEA 4WQ2A 1KFXL 1NSHA 1CDMA 1CM4A 2PVBA 3GK1A 1QTXA 1KFXS 3BOWA 3TDUA 3CTNA 4USLA 1Y0VH 2NLNA 1BJFA 3NSOA 4YBHB 1CDNA 4M2QA 3TS5B 1OZOA 1CTRA 1D1OA 2FCDA 3D10A 3CLNA 4MVFA 1G8IA 1JFJA 3FWCA 1K93D 1CFDA 1LKJA 3O4YA 3TS5C 1C7VA 2EHBA 1QASA 4ORAB 1OQPA 1S6CA 3EK8A 1SK6D 4FQOA 2M7LA 3BQ3A 3LK1A 4DS7A 1QLKA 3C1VA 1WY9A 1RWYA
chains in the Genus database with same CATH superfamily
5KSZA 3TUYB 4PHNA 1JSAA 1YX8A 3SS5A 1K96A 3KPXA 1J7RA 3BUOB 3JVTB 4CLNA 4PE4A 1L2OB 4M2PA 3TUYC 1KQVA 1IQ3A 1JUOA 2LHIA 3JVTC 1N2DA 2GTEA 1L2OC 2BKIB 2K2AA 2QEOA 2QEVA 4INXA 4C0KA 1UP5A 2VRGA 1DJXA 1SYMA 1K8UA 3EK7A 1JF2A 2CNPA 2JQ6A 3I5HB 1XA5A 3BYAA 3M0WA 3I5GC 4NDBA 1RJVA 1LA0A 1N65A 4MRXA 3I5HC 2MRDA 2BECA 3ZNIA 3UO9A 1XFYO 3RZSA 1LS8A 3PN7B 1IH0A 2LP3A 2LLSA 4N1FA 3PN7C 2ZN8A 1DQEA 1JFKA 1CMFA 1Y1AA 2KQYA 2WCLA 2G9BA 3WHTB 5I8NA 1EG4A 1E8AA 3R72A 1P28A 2JTTA 2JZIA 1KK7Y 2JPOA 2MBXA 1QJTA 1CLMA 1FBVA 3SS3A 4XJKB 3R1VA 4WRIA 1NPQA 4XJKA 2NXQA 1R6PA 3QMEA 3N7HA 1IGVA 3CZTX 4JWQA 4F7FA 3S0EA 5AXIA 3SIAA 1XK4A 1K94A 2LVVA 1YRTB 2KGBC 3AAKA 5AERA 1XK4C 2BCBA 2F3ZA 5AFPA 4NQGA 3KEVA 1CMGA 4NDDA 4JD9A 2LHLA 1MR8A 3D76A 1B8CA 1GQMA 3QRXA 3ZWHA 3K1EA 1DJHA 1K9PA 1DJGA 2OPOA 1YUTA 4QJ3B 4DUQA 2FJYA 1JF0A 3B86A 2JU0A 2KFGA 2KGRA 1A03A 4OR9B 1J7QA 3BXKA 3IF7A 1Y1UA 2AUCA 1M45A 1TRFA 1TTXA 3CWGA 1BLQA 1BODA 1H4BA 2A4JA 4INWA 1MF8B 3VRRA 1RECA 3SG5A 2F3YA 2KNEA 3LCPC 1OMRA 2CTNA 1NYAA 1V1GA 2JT3A 1N0YA 1GJYA 2JRFA 2KYCA 2WORA 1DTLA 3PM8A 3EVUA 2I94A 1DF0A 1OE9B 3DD4A 3VRNA 2WC5A 2F33A 4AQIA 4GPLB 2Y4QA 2K7BA 4YRUA 2WCBA 5J3XA 3DVJA 1U5IA 4P5OE 1DJWA 1QV0A 3FE8A 1NWDA 5K89A 1F71A 1NP8A 1DVIA 2M8UA 4I5LB 5DKNA 1CFPA 1QX5B 2LE9B 3HX4A 2KFHA 1IJ5A 2WCHA 1NCZA 1QWVA 3DY9A 1F70A 2Y5IA 1Y6WA 1UHKA 2LVJA 1IQ5A 1XFVO 2M7NA 1B1GA 2K60A 3VRPA 1EH2A 3KHEA 3TZ1A 4GAOA 1LXFC 2QACA 3SG2A 4UPGA 2O5GA 3B6XA 1B7TY 1QIWA 2SCPA 3DF0B 3E3RA 3MSEB 3OHMB 4MZLA 2ZRTA 5G08A 4JPZB 2BE6A 4PHMA 3AKAA 4CFQA 4GGNA 1KSOA 4ORBB 4PCWA 2NCOA 4R1EA 1DGVA 2JXLA 1DEKA 3CGAA 5JJGA 1GGZA 1ZOTB 2K0JA 4N1GA 2LV7A 2HQWA 1SRAA 3CS1A 2BE4A 1F8HA 1ALVA 4C0JA 1LVCD 1OOFA 2F2OA 2JWWA 5CSNA 3VROA 1B8LA 5I94A 1AUIB 2EC6B 2BBNA 5D7FA 3SG4A 1OOJA 2QPTA 3CZ1A 5EL2A 2LMUA 1NCXA 2EC6C 2JPTA 2MLFC 2BL0B 3NSKA 2GV5A 2GGMA 2GGZA 1OOGA 2COLB 2IS9A 2KSPA 3KO0A 3LLEA 4GUKA 4MZKA 4NDCA 3TDIA 3EK4A 4PHKA 2BL0C 2KAVA 1G33A 2MLEC 3FE6A 1OOIX 2TN4A 4YGDB 2LANA 1MXLC 2KI4B 2HPSA 1BG1A 2MJWB 1TWOA 1B7TZ 4MRYA 2WCKA 3VGOA 1MHOA 1F55A 2KI4C 1R2UA 2M3WA 5CPVA 2L4HA 1A75B 1SW8A 3PSRA 1YUSA 3OBVA 1ZACA 1IRJA 1CLBA 1AJ5A 2PASA 4BY5A 5HYDA 1SL7A 1YR5A 1A29A 4ORCB 2KDHA 4Q04A 5KU1A 2ZNEA 3DXLA 1SSEB 1RFJA 1S26D 3AAJA 2MHHA 2KPHA 1CNPA 3EVRA 2L98A 1ZUZA 1ORGA 1S5GY 1SMGA 1Z4HA 4DCKA 1JWDA 1EJ3A 1S3PA 1YVLA 1SCVA 2L5YA 2K2FA 2L50A 1UHHA 1CLLA 2I7AA 4I5KA 3PATA 2JNXA 3R1PA 2K7OA 1F54A 1BR1B 2L5XB 1OSAA 2LM5A 1J1EA 5F6TA 3BJHA 3I5IB 1PVAA 2DOQA 1HQVA 1KFUS 2K7DA 2LAPA 3A4UB 1MQ1A 3CABA 1CDPA 1YURA 1ALWA 3PM2A 1YVHA 1CKKA 1WLZA 3S0GA 3OB1B 1B9AA 1CDLA 1WLMA 5FYXA 1PK0D 1W7JB 3B7AA 3NXAA 2LP2A 1EG3A 3EVVA 3CR2A 1DJZA 1TUJA 2FJUB 2KHNA 3CR4X 3D0YB 3D75A 4MN0A 3LL8B 1CB1A 4TNCA 1FF1A 3AKBA 2EGDA 1M46A 1T14A 1Y1XA 2M49B 1BT6A 4I5NB 1GGWA 4DRWA 1IIOA 1M31A 2BAPA 4GGFC 1IG5A 2CCMA 4JKTA 1C7WA 2LMTA 3WNXB 2WNDA 2CXJA 2PMYA 3PALA 1ODBA 2M9GA 4IL1A 4YGBB 2KAXA 3S0DA 2F2PA 3EKHA 1DGUA 5FI2A 1A4PA 3IVTA 2BBMA 1QS7A 2B1UA 2JNFA 2L2CA 1KK7Z 1QIVA 5ER5A 3CDNA 4CPVA 4M2OA 2E30A 3EG5B 2KYFA 4QJ4B 3VRQA 5FI6A 3SJSA 4KYNA 2R2IA 2MAZA 1AHRA 2LLTA 3FIAA 4PE7A 4MZJA 1YRUB 1H8BA 1J7OA 1NX3A 1DELA 1SNLA 2OTGB 2HQ8A 1B47A 1S6IA 2NZ0A 5HLVA 1RK9A 2AMIA 1KWOB 1QXPA 2OTGC 5CSJA 5FI7A 5I2QA 2L4IA 5D3OA 1C07A 3I5FB 1KWOC 2L0PA 3OB2B 4GNKB 4PE0A 5DKRA 5AANA 2ZKMX 4AQJA 3L4AA 4GBAA 1NUBA 4MBEA 1KCYA 3I5FC 3CYZA 1TCOB 3WXAA 2ZN9A 3ICBA 3O78A 3DF0A 1OMDA 4ICBA 2CBLA 1OMVA 1QLSA 2D8NA 2PALA 2PQLA 1M39A 1XYDA 5ER4X 1TN4A 4QJ5B 3L4LA 2KAYA 1AVSA 4BY4A 2M1KB 1G4YR 2V53A 5BPJA 1KSMA 2FOTA 4L9MA 2PYQA 3S0FA 2OS8B 4PHJA 5HKZA 1TNWA 1YUUA 2Q4UA 1NCYA 1TNXA 1V1FA 1XFUO 2KI6C 2O60A 1MWNA 1CM1A 3BUWB 1XFRA 2P71A 5IBWA 1TNPA 1WRKA 2JT8A 1SL9A 5HKYA 1ZMZA 1DT7B 1IKUA 1J55A 3NSIA 1XFZO 3OX6A 4MLWA 1K9KA 3PFVA 2RGIA 5HKWA 3SIBA 4DIRA 1OZSA 1LINA 4YGCB 1Q80A 3BOWB 1SBJA 4A4CA 3LK0A 1SPYA 4OCIA 2F8PA 1F4QA 1WRLA 4D1EA 3CZ0A 4WQ3A 1KK8B 1UURA 1PULA 3PJIA 2BCAA 1LA3A 3BUXB 2CT9A 2LCPA 1XVJA 4PE1A 2FCEA 1KK8C 1QX2A 1BOCA 4OV2A 5CSFA 2WC6A 2WC8A 5HLOA 3SS4A 1SR6B 2JXCA 3NSLA 2ZFDA 3GK4X 1HT9A 2QEHA 3IQQA 3OGNA 4N5XA 4PDZA 3L47A 1J7PA 1A75A 1SR6C 2JT0A 1C3YA 3FS7A 1PRWA 3O6BA 1TOPA 1AP4A 1FPWA 2M1UA 3PLFB 1AK8A 1FI5A 3EKJA 1BF5A 2P6BB 2LMVA 1AJ4A 1NX2A 3OP0A 1EL4A 4U8DA 4IJ7A 1YTZC 5JOLA 1BR4B 4CFRA 1GM0A 1TNQA 1S6JA 1TCFA 4OKHA 1NX1A 2JULA 2SASA 1MUXA 4HRHA 2LVKA 4I5JA 2KLEA 3I5GB 2E6WA 1RTP1 1K90D 5DICA 1DJIA 4A4BA 2PRUA 2I18A 5DKQA 1A2XA 5TNCA 1UHIA 2I2RE 1KFUL 4YGEB 3HCMA 4F0ZB 2Y1NA 1QX7A 1PALA 4MEWA 3IQOA 5D69A 3BFHA 2ISDA 1L7ZA 3I5IC 1M63B 1Z2CB 1QVIY 2Q91A 4HSZA 5I2OA 2HETA 3DYEA 3BUMB 4OVNF 3CR5X 1XFXO 3O2PA 2HF5A 3SG6A 1WDCB 3D0YA 3KF9A 3RLZA 5HL1A 4XYNA 1DJYA 3TDZA 4GGFA 2WCJA 1WDCC 2AAOA 2LVIA 3DZTA 1PSBA 1WRZA 5I2LA 4PT1A 1FW4A 2K61A 3B88A 2KOTA 1SL8A 3UNWA 2KFFA 3D74A 2L51A 1UHNA 4HREE 1S1EA 1W9ZA 3NGVA 1UUSA 3Q8IA 4YI8A 5PALA 5GQQC 1J1DA 3NHTA 1SKTA 3NHIA 1K95A 1S5GZ 4GFTA 3A8RA 5CSIA 2QEBA 1KQMB 1OW4A 2JC2A 3GOFA 1B4CA 2LNKA 2K7CA 3WHUB 1KQMC 1PVBA 2KBMA 4HRGA 2JOJA 1TIZA 3BUNB 1MXEA 3S0AA 4MSPA 5AEQA 1SY9A 4YGAA 3S0BA 2ZNDA 1S36A 1ZFSA 4JQ0D 2KQ6A 1XFWO 3V2LA 1OOHA 1QVIZ 2LUCA 3K21A 1BU3A 2PSRA 4ZCUA 2LC5A 2LUXA 3GK2A 4ZCVA 2Y1MA 2L2EA 2WCMA 4E68A 1NIWA 1XO5A 1F4OA 2WCFA 4YI9A 2H2KA 3OX5A 1JBAA 2KI6D 1JC2A 1UWOA 1QV1A 1CFCA 3F45A 3O4XA 1DF0B 2ERBA 1EXRA 2G2BA 2WCEA 3JTDB 3RM1A 5B8IB 1FI6A 1K2HA 2KBIA 1YX7A 1IJ6A 1IWQA 1U5IB 1SCMB 3BFAA 3JTDC 4OZDA 3R1OA 2WOSA 2M29A 2QDIA 1NX0A 1SCMC 2H61A 2BKHB 1QATA 1W7IB 1BMOA 2H61C 3H4SE 2YGUA 4PALA 3D73A 3D77A 1VRKA 2H8VA 2LLUA 2KLDA 1PSRA 4AOMA 2NCPA 2ZRSA 4CIDA 1UHJA 3DVMA 4P2YB 1CFFA 2BNXA 2M97A 1RROA 1B8RA 2M0RA 2MA2A 2P70A 1K9UA 3SG7A 3FE9A 3SG3A 4C0LA 1DC1A 3D78A 5KTYA 1DMOA 3DVKA 2K8MB 3B87A 2OS8C 1X02A 2JTZA 2BCXA 3FWBA 4FTGA 4ETOA 3DVEA 4WQ2A 1KFXL 1NSHA 1CDMA 1CM4A 2PVBA 3GK1A 1QTXA 1KFXS 4FQTA 3BFBA 3BOWA 3TDUA 3CTNA 4USLA 1Y0VH 2NLNA 1BJFA 3NSOA 4YBHB 1CDNA 4M2QA 3TS5B 1OZOA 1CTRA 1D1OA 2FCDA 3D10A 3CLNA 1C3ZA 4MVFA 1G8IA 1JFJA 3FWCA 1K93D 1CFDA 1LKJA 3CZ2A 3O4YA 3TS5C 1C7VA 2EHBA 1QASA 4ORAB 1OQPA 1S6CA 3EK8A 1SK6D 4FQOA 2M7LA 3BQ3A 3LK1A 1TUZA 3VB1A 4DS7A 1QLKA 3C1VA 1WY9A 1RWYA
chains in the Genus database with same CATH topology
5KSZA 3TUYB 4PHNA 1JSAA 1YX8A 1K96A 3KPXA 1J7RA 3BUOB 3JVTB 4CLNA 4PE4A 1L2OB 4M2PA 3TUYC 1KQVA 1IQ3A 1JUOA 2LHIA 3JVTC 1N2DA 1L2OC 2BKIB 2K2AA 4C0KA 1UP5A 2VRGA 1DJXA 1SYMA 1K8UA 3EK7A 1JF2A 2CNPA 2JQ6A 3I5HB 1XA5A 3BYAA 3M0WA 3I5GC 4NDBA 1RJVA 1LA0A 1N65A 4MRXA 3I5HC 2MRDA 2BECA 3ZNIA 1XFYO 3PN7B 1IH0A 2LP3A 2LLSA 4N1FA 3PN7C 2ZN8A 1JFKA 1CMFA 1Y1AA 2KQYA 2G9BA 3WHTB 5I8NA 1EG4A 1E8AA 2JTTA 2JZIA 1KK7Y 2MBXA 1QJTA 1CLMA 1FBVA 4XJKB 4WRIA 1NPQA 4XJKA 2NXQA 1R6PA 1IGVA 3CZTX 4JWQA 5AXIA 3SIAA 1XK4A 1K94A 2LVVA 1YRTB 2KGBC 3AAKA 5AERA 1XK4C 2BCBA 2F3ZA 5AFPA 4NQGA 3KEVA 1CMGA 4NDDA 2LHLA 1MR8A 3QRXA 1B8CA 1GQMA 3ZWHA 1DJHA 1K9PA 1DJGA 2OPOA 1YUTA 4QJ3B 4DUQA 1JF0A 2JU0A 2KFGA 2KGRA 1A03A 4OR9B 1J7QA 3BXKA 3IF7A 1Y1UA 2AUCA 1M45A 1TRFA 1TTXA 3CWGA 1BLQA 1BODA 1H4BA 2A4JA 1MF8B 3VRRA 1RECA 3SG5A 2F3YA 2KNEA 3LCPC 1OMRA 2CTNA 1NYAA 1V1GA 2JT3A 1N0YA 1GJYA 2JRFA 2KYCA 2WORA 1DTLA 3PM8A 3EVUA 2I94A 1DF0A 1OE9B 3DD4A 3VRNA 4AQIA 2F33A 4GPLB 2Y4QA 2K7BA 4YRUA 2WCBA 5J3XA 3DVJA 1U5IA 4P5OE 1DJWA 1QV0A 5K89A 1NWDA 1F71A 1NP8A 1DVIA 2M8UA 4I5LB 5DKNA 1CFPA 1QX5B 2LE9B 3HX4A 2KFHA 1IJ5A 1NCZA 1F70A 2Y5IA 1Y6WA 1UHKA 2LVJA 1IQ5A 1XFVO 2M7NA 1B1GA 3VRPA 1EH2A 3KHEA 3TZ1A 4GAOA 1LXFC 2QACA 3SG2A 4UPGA 2O5GA 1B7TY 1QIWA 2SCPA 3DF0B 3E3RA 3MSEB 3OHMB 4MZLA 2ZRTA 5G08A 4JPZB 2BE6A 4PHMA 3AKAA 4CFQA 4GGNA 1KSOA 4ORBB 4PCWA 2NCOA 4R1EA 1DGVA 2JXLA 3CGAA 5JJGA 1GGZA 1ZOTB 2K0JA 4N1GA 2LV7A 2HQWA 1SRAA 3CS1A 2BE4A 1F8HA 1ALVA 4C0JA 1LVCD 2F2OA 2JWWA 5CSNA 3VROA 1B8LA 1AUIB 2EC6B 2BBNA 5D7FA 3SG4A 1OOJA 2QPTA 2LMUA 1NCXA 2EC6C 2JPTA 2MLFC 2BL0B 3NSKA 2GV5A 2GGMA 2GGZA 2IS9A 2COLB 2KSPA 3KO0A 3LLEA 4GUKA 4MZKA 4NDCA 3TDIA 3EK4A 4PHKA 2BL0C 2KAVA 1G33A 2MLEC 4YGDB 2TN4A 2LANA 1MXLC 2KI4B 2HPSA 1BG1A 2MJWB 1B7TZ 4MRYA 3VGOA 1MHOA 1F55A 2KI4C 1R2UA 2M3WA 5CPVA 2L4HA 1A75B 1SW8A 3PSRA 1YUSA 1ZACA 1IRJA 1CLBA 1AJ5A 2PASA 4BY5A 5HYDA 1SL7A 1YR5A 1A29A 4ORCB 2KDHA 4Q04A 5KU1A 2ZNEA 1RFJA 1S26D 3AAJA 2MHHA 1CNPA 3EVRA 2L98A 1ZUZA 1S5GY 1SMGA 4DCKA 1JWDA 1EJ3A 1S3PA 1YVLA 1SCVA 2K2FA 2L50A 1UHHA 1CLLA 2I7AA 4I5KA 3PATA 2JNXA 2K7OA 1F54A 1BR1B 2L5XB 1OSAA 2LM5A 1J1EA 5F6TA 3I5IB 1PVAA 2DOQA 1HQVA 1KFUS 2K7DA 2LAPA 3A4UB 1MQ1A 1CDPA 1YURA 1ALWA 1YVHA 1CKKA 1WLZA 3OB1B 1B9AA 1CDLA 1WLMA 5FYXA 1PK0D 1W7JB 3NXAA 2LP2A 1EG3A 3EVVA 3CR2A 1DJZA 2KHNA 2FJUB 3CR4X 3D0YB 4MN0A 1CB1A 3LL8B 1FF1A 4TNCA 3AKBA 2EGDA 1M46A 1Y1XA 2M49B 1BT6A 4I5NB 1GGWA 4DRWA 1M31A 4GGFC 1IG5A 2CCMA 1C7WA 2LMTA 3WNXB 2WNDA 2CXJA 2PMYA 3PALA 1ODBA 2M9GA 4IL1A 4YGBB 2KAXA 2F2PA 3EKHA 1DGUA 1A4PA 2BBMA 1QS7A 2B1UA 2JNFA 1KK7Z 1QIVA 5ER5A 4CPVA 4M2OA 2E30A 2KYFA 4QJ4B 3VRQA 3SJSA 2R2IA 2MAZA 1AHRA 2LLTA 3FIAA 4PE7A 4MZJA 1YRUB 1H8BA 1J7OA 1NX3A 1SNLA 2OTGB 2HQ8A 1B47A 1S6IA 2NZ0A 5HLVA 1RK9A 2AMIA 1KWOB 1QXPA 2OTGC 5CSJA 5I2QA 2L4IA 1C07A 3I5FB 1KWOC 2L0PA 3OB2B 4GNKB 4PE0A 5DKRA 5AANA 2ZKMX 4AQJA 4GBAA 1NUBA 4MBEA 1KCYA 3I5FC 1TCOB 3WXAA 2ZN9A 3ICBA 3O78A 3DF0A 1OMDA 4ICBA 2CBLA 1OMVA 1QLSA 2D8NA 2PALA 1M39A 1XYDA 5ER4X 1TN4A 4QJ5B 2KAYA 1AVSA 4BY4A 2M1KB 1G4YR 2V53A 5BPJA 1KSMA 2FOTA 4L9MA 2OS8B 4PHJA 5HKZA 1TNWA 1YUUA 2Q4UA 1NCYA 1TNXA 1V1FA 1XFUO 2KI6C 2O60A 1MWNA 1CM1A 3BUWB 5IBWA 1TNPA 1WRKA 2JT8A 1SL9A 5HKYA 1ZMZA 1DT7B 1IKUA 1J55A 3NSIA 1XFZO 3OX6A 4MLWA 1K9KA 3PFVA 2RGIA 5HKWA 3SIBA 4DIRA 1OZSA 1LINA 4YGCB 1Q80A 3BOWB 1SBJA 4A4CA 3LK0A 1SPYA 4OCIA 2F8PA 1F4QA 1WRLA 4D1EA 4WQ3A 1KK8B 1UURA 1PULA 2BCAA 1LA3A 3BUXB 2CT9A 2LCPA 1XVJA 4PE1A 2FCEA 1KK8C 1QX2A 1BOCA 4OV2A 5CSFA 2WC8A 5HLOA 1SR6B 2JXCA 3NSLA 2ZFDA 3GK4X 1HT9A 3IQQA 4N5XA 4PDZA 1J7PA 1A75A 1SR6C 2JT0A 3FS7A 1PRWA 3O6BA 1TOPA 1AP4A 1FPWA 2M1UA 3PLFB 1AK8A 1FI5A 3EKJA 1BF5A 2P6BB 2LMVA 1AJ4A 1NX2A 3OP0A 1EL4A 4U8DA 4CFRA 1YTZC 5JOLA 1BR4B 1TNQA 1S6JA 1TCFA 4OKHA 1NX1A 2JULA 2SASA 1MUXA 4HRHA 2LVKA 4I5JA 3I5GB 2E6WA 1RTP1 1K90D 1DJIA 4A4BA 2PRUA 2I18A 5DKQA 1A2XA 5TNCA 1UHIA 2I2RE 1KFUL 4YGEB 3HCMA 4F0ZB 2Y1NA 1QX7A 1PALA 4MEWA 3IQOA 5D69A 2ISDA 1L7ZA 3I5IC 1M63B 2Q91A 1QVIY 4HSZA 5I2OA 2HETA 3BUMB 4OVNF 3CR5X 1XFXO 3O2PA 2HF5A 3SG6A 1WDCB 3D0YA 3KF9A 3RLZA 4XYNA 1DJYA 3TDZA 4GGFA 1WDCC 2AAOA 2LVIA 1PSBA 1WRZA 5I2LA 1FW4A 2K61A 2KOTA 1SL8A 2KFFA 2L51A 1UHNA 4HREE 1S1EA 4YI8A 1UUSA 5PALA 5GQQC 1J1DA 1SKTA 1K95A 1S5GZ 4GFTA 3A8RA 5CSIA 1KQMB 2JC2A 3GOFA 1B4CA 2LNKA 2K7CA 3WHUB 1KQMC 1PVBA 2KBMA 4HRGA 2JOJA 1TIZA 3BUNB 1MXEA 4MSPA 5AEQA 1SY9A 4YGAA 2ZNDA 1S36A 1ZFSA 4JQ0D 2KQ6A 1XFWO 1QVIZ 2LUCA 3K21A 1BU3A 2PSRA 4ZCUA 2LC5A 2LUXA 3GK2A 4ZCVA 2Y1MA 2L2EA 4E68A 1NIWA 1XO5A 1F4OA 2WCFA 4YI9A 2H2KA 3OX5A 1JBAA 2KI6D 1JC2A 1UWOA 1QV1A 1CFCA 3F45A 1DF0B 5B8IB 1EXRA 2G2BA 2WCEA 3JTDB 3RM1A 1FI6A 1K2HA 2KBIA 1YX7A 1IJ6A 1IWQA 1U5IB 1SCMB 3JTDC 2WOSA 2M29A 1NX0A 1SCMC 2H61A 2BKHB 1QATA 1W7IB 1BMOA 2H61C 3H4SE 4PALA 1VRKA 2LLUA 4AOMA 1PSRA 2NCPA 2ZRSA 4CIDA 1UHJA 3DVMA 4P2YB 1CFFA 2M97A 1RROA 1B8RA 2M0RA 2MA2A 3SG7A 1K9UA 3SG3A 4C0LA 1DMOA 5KTYA 3DVKA 2K8MB 2OS8C 1X02A 2JTZA 2BCXA 3FWBA 4FTGA 4ETOA 3DVEA 4WQ2A 1KFXL 1NSHA 1CDMA 1CM4A 2PVBA 3GK1A 1QTXA 1KFXS 3BOWA 3TDUA 3CTNA 4USLA 1Y0VH 2NLNA 1BJFA 3NSOA 4YBHB 1CDNA 4M2QA 3TS5B 1OZOA 1CTRA 1D1OA 2FCDA 3D10A 3CLNA 4MVFA 1G8IA 1JFJA 3FWCA 1K93D 1CFDA 1LKJA 3O4YA 3TS5C 1C7VA 2EHBA 1QASA 4ORAB 1OQPA 1S6CA 3EK8A 1SK6D 4FQOA 2M7LA 3BQ3A 3LK1A 4DS7A 1QLKA 3C1VA 1WY9A 1RWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KSZ A;  3TUY B;  4PHN A;  1JSA A;  1YX8 A;  1K96 A;  3KPX A;  1J7R A;  3BUO B;  3JVT B;  4CLN A;  4PE4 A;  1L2O B;  4M2P A;  3TUY C;  1KQV A;  1IQ3 A;  1JUO A;  2LHI A;  3JVT C;  1N2D A;  1L2O C;  2BKI B;  2K2A A;  4C0K A;  1UP5 A;  2VRG A;  1DJX A;  1SYM A;  1K8U A;  3EK7 A;  1JF2 A;  2CNP A;  2JQ6 A;  3I5H B;  1XA5 A;  3BYA A;  3M0W A;  3I5G C;  4NDB A;  1RJV A;  1LA0 A;  1N65 A;  4MRX A;  3I5H C;  2MRD A;  2BEC A;  3ZNI A;  1XFY O;  3PN7 B;  1IH0 A;  2LP3 A;  2LLS A;  4N1F A;  3PN7 C;  2ZN8 A;  1JFK A;  1CMF A;  1Y1A A;  2KQY A;  2G9B A;  3WHT B;  5I8N A;  1EG4 A;  1E8A A;  2JTT A;  2JZI A;  1KK7 Y;  2MBX A;  1QJT A;  1CLM A;  1FBV A;  4XJK B;  4WRI A;  1NPQ A;  4XJK A;  2NXQ A;  1R6P A;  1IGV A;  3CZT X;  4JWQ A;  5AXI A;  3SIA A;  1XK4 A;  1K94 A;  2LVV A;  1YRT B;  2KGB C;  3AAK A;  5AER A;  1XK4 C;  2BCB A;  2F3Z A;  5AFP A;  4NQG A;  3KEV A;  1CMG A;  4NDD A;  2LHL A;  1MR8 A;  3QRX A;  1B8C A;  1GQM A;  3ZWH A;  1DJH A;  1K9P A;  1DJG A;  2OPO A;  1YUT A;  4QJ3 B;  4DUQ A;  1JF0 A;  2JU0 A;  2KFG A;  2KGR A;  1A03 A;  4OR9 B;  1J7Q A;  3BXK A;  3IF7 A;  1Y1U A;  2AUC A;  1M45 A;  1TRF A;  1TTX A;  3CWG A;  1BLQ A;  1BOD A;  1H4B A;  2A4J A;  1MF8 B;  3VRR A;  1REC A;  3SG5 A;  2F3Y A;  2KNE A;  3LCP C;  1OMR A;  2CTN A;  1NYA A;  1V1G A;  2JT3 A;  1N0Y A;  1GJY A;  2JRF A;  2KYC A;  2WOR A;  1DTL A;  3PM8 A;  3EVU A;  2I94 A;  1DF0 A;  1OE9 B;  3DD4 A;  3VRN A;  4AQI A;  2F33 A;  4GPL B;  2Y4Q A;  2K7B A;  4YRU A;  2WCB A;  5J3X A;  3DVJ A;  1U5I A;  4P5O E;  1DJW A;  1QV0 A;  5K89 A;  1NWD A;  1F71 A;  1NP8 A;  1DVI A;  2M8U A;  4I5L B;  5DKN A;  1CFP A;  1QX5 B;  2LE9 B;  3HX4 A;  2KFH A;  1IJ5 A;  1NCZ A;  1F70 A;  2Y5I A;  1Y6W A;  1UHK A;  2LVJ A;  1IQ5 A;  1XFV O;  2M7N A;  1B1G A;  3VRP A;  1EH2 A;  3KHE A;  3TZ1 A;  4GAO A;  1LXF C;  2QAC A;  3SG2 A;  4UPG A;  2O5G A;  1B7T Y;  1QIW A;  2SCP A;  3DF0 B;  3E3R A;  3MSE B;  3OHM B;  4MZL A;  2ZRT A;  5G08 A;  4JPZ B;  2BE6 A;  4PHM A;  3AKA A;  4CFQ A;  4GGN A;  1KSO A;  4ORB B;  4PCW A;  2NCO A;  4R1E A;  1DGV A;  2JXL A;  3CGA A;  5JJG A;  1GGZ A;  1ZOT B;  2K0J A;  4N1G A;  2LV7 A;  2HQW A;  1SRA A;  3CS1 A;  2BE4 A;  1F8H A;  1ALV A;  4C0J A;  1LVC D;  2F2O A;  2JWW A;  5CSN A;  3VRO A;  1B8L A;  1AUI B;  2EC6 B;  2BBN A;  5D7F A;  3SG4 A;  1OOJ A;  2QPT A;  2LMU A;  1NCX A;  2EC6 C;  2JPT A;  2MLF C;  2BL0 B;  3NSK A;  2GV5 A;  2GGM A;  2GGZ A;  2IS9 A;  2COL B;  2KSP A;  3KO0 A;  3LLE A;  4GUK A;  4MZK A;  4NDC A;  3TDI A;  3EK4 A;  4PHK A;  2BL0 C;  2KAV A;  1G33 A;  2MLE C;  4YGD B;  2TN4 A;  2LAN A;  1MXL C;  2KI4 B;  2HPS A;  1BG1 A;  2MJW B;  1B7T Z;  4MRY A;  3VGO A;  1MHO A;  1F55 A;  2KI4 C;  1R2U A;  2M3W A;  5CPV A;  2L4H A;  1A75 B;  1SW8 A;  3PSR A;  1YUS A;  1ZAC A;  1IRJ A;  1CLB A;  1AJ5 A;  2PAS A;  4BY5 A;  5HYD A;  1SL7 A;  1YR5 A;  1A29 A;  4ORC B;  2KDH A;  4Q04 A;  5KU1 A;  2ZNE A;  1RFJ A;  1S26 D;  3AAJ A;  2MHH A;  1CNP A;  3EVR A;  2L98 A;  1ZUZ A;  1S5G Y;  1SMG A;  4DCK A;  1JWD A;  1EJ3 A;  1S3P A;  1YVL A;  1SCV A;  2K2F A;  2L50 A;  1UHH A;  1CLL A;  2I7A A;  4I5K A;  3PAT A;  2JNX A;  2K7O A;  1F54 A;  1BR1 B;  2L5X B;  1OSA A;  2LM5 A;  1J1E A;  5F6T A;  3I5I B;  1PVA A;  2DOQ A;  1HQV A;  1KFU S;  2K7D A;  2LAP A;  3A4U B;  1MQ1 A;  1CDP A;  1YUR A;  1ALW A;  1YVH A;  1CKK A;  1WLZ A;  3OB1 B;  1B9A A;  1CDL A;  1WLM A;  5FYX A;  1PK0 D;  1W7J B;  3NXA A;  2LP2 A;  1EG3 A;  3EVV A;  3CR2 A;  1DJZ A;  2KHN A;  2FJU B;  3CR4 X;  3D0Y B;  4MN0 A;  1CB1 A;  3LL8 B;  1FF1 A;  4TNC A;  3AKB A;  2EGD A;  1M46 A;  1Y1X A;  2M49 B;  1BT6 A;  4I5N B;  1GGW A;  4DRW A;  1M31 A;  4GGF C;  1IG5 A;  2CCM A;  1C7W A;  2LMT A;  3WNX B;  2WND A;  2CXJ A;  2PMY A;  3PAL A;  1ODB A;  2M9G A;  4IL1 A;  4YGB B;  2KAX A;  2F2P A;  3EKH A;  1DGU A;  1A4P A;  2BBM A;  1QS7 A;  2B1U A;  2JNF A;  1KK7 Z;  1QIV A;  5ER5 A;  4CPV A;  4M2O A;  2E30 A;  2KYF A;  4QJ4 B;  3VRQ A;  3SJS A;  2R2I A;  2MAZ A;  1AHR A;  2LLT A;  3FIA A;  4PE7 A;  4MZJ A;  1YRU B;  1H8B A;  1J7O A;  1NX3 A;  1SNL A;  2OTG B;  2HQ8 A;  1B47 A;  1S6I A;  2NZ0 A;  5HLV A;  1RK9 A;  2AMI A;  1KWO B;  1QXP A;  2OTG C;  5CSJ A;  5I2Q A;  2L4I A;  1C07 A;  3I5F B;  1KWO C;  2L0P A;  3OB2 B;  4GNK B;  4PE0 A;  5DKR A;  5AAN A;  2ZKM X;  4AQJ A;  4GBA A;  1NUB A;  4MBE A;  1KCY A;  3I5F C;  1TCO B;  3WXA A;  2ZN9 A;  3ICB A;  3O78 A;  3DF0 A;  1OMD A;  4ICB A;  2CBL A;  1OMV A;  1QLS A;  2D8N A;  2PAL A;  1M39 A;  1XYD A;  5ER4 X;  1TN4 A;  4QJ5 B;  2KAY A;  1AVS A;  4BY4 A;  2M1K B;  1G4Y R;  2V53 A;  5BPJ A;  1KSM A;  2FOT A;  4L9M A;  2OS8 B;  4PHJ A;  5HKZ A;  1TNW A;  1YUU A;  2Q4U A;  1NCY A;  1TNX A;  1V1F A;  1XFU O;  2KI6 C;  2O60 A;  1MWN A;  1CM1 A;  3BUW B;  5IBW A;  1TNP A;  1WRK A;  2JT8 A;  1SL9 A;  5HKY A;  1ZMZ A;  1DT7 B;  1IKU A;  1J55 A;  3NSI A;  1XFZ O;  3OX6 A;  4MLW A;  1K9K A;  3PFV A;  2RGI A;  5HKW A;  3SIB A;  4DIR A;  1OZS A;  1LIN A;  4YGC B;  1Q80 A;  3BOW B;  1SBJ A;  4A4C A;  3LK0 A;  1SPY A;  4OCI A;  2F8P A;  1F4Q A;  1WRL A;  4D1E A;  4WQ3 A;  1KK8 B;  1UUR A;  1PUL A;  2BCA A;  1LA3 A;  3BUX B;  2CT9 A;  2LCP A;  1XVJ A;  4PE1 A;  2FCE A;  1KK8 C;  1QX2 A;  1BOC A;  4OV2 A;  5CSF A;  2WC8 A;  5HLO A;  1SR6 B;  2JXC A;  3NSL A;  2ZFD A;  3GK4 X;  1HT9 A;  3IQQ A;  4N5X A;  4PDZ A;  1J7P A;  1A75 A;  1SR6 C;  2JT0 A;  3FS7 A;  1PRW A;  3O6B A;  1TOP A;  1AP4 A;  1FPW A;  2M1U A;  3PLF B;  1AK8 A;  1FI5 A;  3EKJ A;  1BF5 A;  2P6B B;  2LMV A;  1AJ4 A;  1NX2 A;  3OP0 A;  1EL4 A;  4U8D A;  4CFR A;  1YTZ C;  5JOL A;  1BR4 B;  1TNQ A;  1S6J A;  1TCF A;  4OKH A;  1NX1 A;  2JUL A;  2SAS A;  1MUX A;  4HRH A;  2LVK A;  4I5J A;  3I5G B;  2E6W A;  1RTP 1;  1K90 D;  1DJI A;  4A4B A;  2PRU A;  2I18 A;  5DKQ A;  1A2X A;  5TNC A;  1UHI A;  2I2R E;  1KFU L;  4YGE B;  3HCM A;  4F0Z B;  2Y1N A;  1QX7 A;  1PAL A;  4MEW A;  3IQO A;  5D69 A;  2ISD A;  1L7Z A;  3I5I C;  1M63 B;  2Q91 A;  1QVI Y;  4HSZ A;  5I2O A;  2HET A;  3BUM B;  4OVN F;  3CR5 X;  1XFX O;  3O2P A;  2HF5 A;  3SG6 A;  1WDC B;  3D0Y A;  3KF9 A;  3RLZ A;  4XYN A;  1DJY A;  3TDZ A;  4GGF A;  1WDC C;  2AAO A;  2LVI A;  1PSB A;  1WRZ A;  5I2L A;  1FW4 A;  2K61 A;  2KOT A;  1SL8 A;  2KFF A;  2L51 A;  1UHN A;  4HRE E;  1S1E A;  4YI8 A;  1UUS A;  5PAL A;  5GQQ C;  1J1D A;  1SKT A;  1K95 A;  1S5G Z;  4GFT A;  3A8R A;  5CSI A;  1KQM B;  2JC2 A;  3GOF A;  1B4C A;  2LNK A;  2K7C A;  3WHU B;  1KQM C;  1PVB A;  2KBM A;  4HRG A;  2JOJ A;  1TIZ A;  3BUN B;  1MXE A;  4MSP A;  5AEQ A;  1SY9 A;  4YGA A;  2ZND A;  1S36 A;  1ZFS A;  4JQ0 D;  2KQ6 A;  1XFW O;  1QVI Z;  2LUC A;  3K21 A;  1BU3 A;  2PSR A;  4ZCU A;  2LC5 A;  2LUX A;  3GK2 A;  4ZCV A;  2Y1M A;  2L2E A;  4E68 A;  1NIW A;  1XO5 A;  1F4O A;  2WCF A;  4YI9 A;  2H2K A;  3OX5 A;  1JBA A;  2KI6 D;  1JC2 A;  1UWO A;  1QV1 A;  1CFC A;  3F45 A;  1DF0 B;  5B8I B;  1EXR A;  2G2B A;  2WCE A;  3JTD B;  3RM1 A;  1FI6 A;  1K2H A;  2KBI A;  1YX7 A;  1IJ6 A;  1IWQ A;  1U5I B;  1SCM B;  3JTD C;  2WOS A;  2M29 A;  1NX0 A;  1SCM C;  2H61 A;  2BKH B;  1QAT A;  1W7I B;  1BMO A;  2H61 C;  3H4S E;  4PAL A;  1VRK A;  2LLU A;  4AOM A;  1PSR A;  2NCP A;  2ZRS A;  4CID A;  1UHJ A;  3DVM A;  4P2Y B;  1CFF A;  2M97 A;  1RRO A;  1B8R A;  2M0R A;  2MA2 A;  3SG7 A;  1K9U A;  3SG3 A;  4C0L A;  1DMO A;  5KTY A;  3DVK A;  2K8M B;  2OS8 C;  1X02 A;  2JTZ A;  2BCX A;  3FWB A;  4FTG A;  4ETO A;  3DVE A;  4WQ2 A;  1KFX L;  1NSH A;  1CDM A;  1CM4 A;  2PVB A;  3GK1 A;  1QTX A;  1KFX S;  3BOW A;  3TDU A;  3CTN A;  4USL A;  1Y0V H;  2NLN A;  1BJF A;  3NSO A;  4YBH B;  1CDN A;  4M2Q A;  3TS5 B;  1OZO A;  1CTR A;  1D1O A;  2FCD A;  3D10 A;  3CLN A;  4MVF A;  1G8I A;  1JFJ A;  3FWC A;  1K93 D;  1CFD A;  1LKJ A;  3O4Y A;  3TS5 C;  1C7V A;  2EHB A;  1QAS A;  4ORA B;  1OQP A;  1S6C A;  3EK8 A;  1SK6 D;  4FQO A;  2M7L A;  3BQ3 A;  3LK1 A;  4DS7 A;  1QLK A;  3C1V A;  1WY9 A;  1RWY A; 
#chains in the Genus database with same CATH topology
 5KSZ A;  3TUY B;  4PHN A;  1JSA A;  1YX8 A;  3SS5 A;  1K96 A;  3KPX A;  1J7R A;  3BUO B;  3JVT B;  4CLN A;  4PE4 A;  1L2O B;  4M2P A;  3TUY C;  1KQV A;  1IQ3 A;  1JUO A;  2LHI A;  3JVT C;  1N2D A;  2GTE A;  1L2O C;  2BKI B;  2K2A A;  2QEO A;  2QEV A;  4INX A;  4C0K A;  1UP5 A;  2VRG A;  1DJX A;  1SYM A;  1K8U A;  3EK7 A;  1JF2 A;  2CNP A;  2JQ6 A;  3I5H B;  1XA5 A;  3BYA A;  3M0W A;  3I5G C;  4NDB A;  1RJV A;  1LA0 A;  1N65 A;  4MRX A;  3I5H C;  2MRD A;  2BEC A;  3ZNI A;  3UO9 A;  1XFY O;  3RZS A;  1LS8 A;  3PN7 B;  1IH0 A;  2LP3 A;  2LLS A;  4N1F A;  3PN7 C;  2ZN8 A;  1DQE A;  1JFK A;  1CMF A;  1Y1A A;  2KQY A;  2WCL A;  2G9B A;  3WHT B;  5I8N A;  1EG4 A;  1E8A A;  3R72 A;  1P28 A;  2JTT A;  2JZI A;  1KK7 Y;  2JPO A;  2MBX A;  1QJT A;  1CLM A;  1FBV A;  3SS3 A;  4XJK B;  3R1V A;  4WRI A;  1NPQ A;  4XJK A;  2NXQ A;  1R6P A;  3QME A;  3N7H A;  1IGV A;  3CZT X;  4JWQ A;  4F7F A;  3S0E A;  5AXI A;  3SIA A;  1XK4 A;  1K94 A;  2LVV A;  1YRT B;  2KGB C;  3AAK A;  5AER A;  1XK4 C;  2BCB A;  2F3Z A;  5AFP A;  4NQG A;  3KEV A;  1CMG A;  4NDD A;  4JD9 A;  2LHL A;  1MR8 A;  3D76 A;  1B8C A;  1GQM A;  3QRX A;  3ZWH A;  3K1E A;  1DJH A;  1K9P A;  1DJG A;  2OPO A;  1YUT A;  4QJ3 B;  4DUQ A;  2FJY A;  1JF0 A;  3B86 A;  2JU0 A;  2KFG A;  2KGR A;  1A03 A;  4OR9 B;  1J7Q A;  3BXK A;  3IF7 A;  1Y1U A;  2AUC A;  1M45 A;  1TRF A;  1TTX A;  3CWG A;  1BLQ A;  1BOD A;  1H4B A;  2A4J A;  4INW A;  1MF8 B;  3VRR A;  1REC A;  3SG5 A;  2F3Y A;  2KNE A;  3LCP C;  1OMR A;  2CTN A;  1NYA A;  1V1G A;  2JT3 A;  1N0Y A;  1GJY A;  2JRF A;  2KYC A;  2WOR A;  1DTL A;  3PM8 A;  3EVU A;  2I94 A;  1DF0 A;  1OE9 B;  3DD4 A;  3VRN A;  2WC5 A;  2F33 A;  4AQI A;  4GPL B;  2Y4Q A;  2K7B A;  4YRU A;  2WCB A;  5J3X A;  3DVJ A;  1U5I A;  4P5O E;  1DJW A;  1QV0 A;  3FE8 A;  1NWD A;  5K89 A;  1F71 A;  1NP8 A;  1DVI A;  2M8U A;  4I5L B;  5DKN A;  1CFP A;  1QX5 B;  2LE9 B;  3HX4 A;  2KFH A;  1IJ5 A;  2WCH A;  1NCZ A;  1QWV A;  3DY9 A;  1F70 A;  2Y5I A;  1Y6W A;  1UHK A;  2LVJ A;  1IQ5 A;  1XFV O;  2M7N A;  1B1G A;  2K60 A;  3VRP A;  1EH2 A;  3KHE A;  3TZ1 A;  4GAO A;  1LXF C;  2QAC A;  3SG2 A;  4UPG A;  2O5G A;  3B6X A;  1B7T Y;  1QIW A;  2SCP A;  3DF0 B;  3E3R A;  3MSE B;  3OHM B;  4MZL A;  2ZRT A;  5G08 A;  4JPZ B;  2BE6 A;  4PHM A;  3AKA A;  4CFQ A;  4GGN A;  1KSO A;  4ORB B;  4PCW A;  2NCO A;  4R1E A;  1DGV A;  2JXL A;  1DEK A;  3CGA A;  5JJG A;  1GGZ A;  1ZOT B;  2K0J A;  4N1G A;  2LV7 A;  2HQW A;  1SRA A;  3CS1 A;  2BE4 A;  1F8H A;  1ALV A;  4C0J A;  1LVC D;  1OOF A;  2F2O A;  2JWW A;  5CSN A;  3VRO A;  1B8L A;  5I94 A;  1AUI B;  2EC6 B;  2BBN A;  5D7F A;  3SG4 A;  1OOJ A;  2QPT A;  3CZ1 A;  5EL2 A;  2LMU A;  1NCX A;  2EC6 C;  2JPT A;  2MLF C;  2BL0 B;  3NSK A;  2GV5 A;  2GGM A;  2GGZ A;  1OOG A;  2COL B;  2IS9 A;  2KSP A;  3KO0 A;  3LLE A;  4GUK A;  4MZK A;  4NDC A;  3TDI A;  3EK4 A;  4PHK A;  2BL0 C;  2KAV A;  1G33 A;  2MLE C;  3FE6 A;  1OOI X;  2TN4 A;  4YGD B;  2LAN A;  1MXL C;  2KI4 B;  2HPS A;  1BG1 A;  2MJW B;  1TWO A;  1B7T Z;  4MRY A;  2WCK A;  3VGO A;  1MHO A;  1F55 A;  2KI4 C;  1R2U A;  2M3W A;  5CPV A;  2L4H A;  1A75 B;  1SW8 A;  3PSR A;  1YUS A;  3OBV A;  1ZAC A;  1IRJ A;  1CLB A;  1AJ5 A;  2PAS A;  4BY5 A;  5HYD A;  1SL7 A;  1YR5 A;  1A29 A;  4ORC B;  2KDH A;  4Q04 A;  5KU1 A;  2ZNE A;  3DXL A;  1SSE B;  1RFJ A;  1S26 D;  3AAJ A;  2MHH A;  2KPH A;  1CNP A;  3EVR A;  2L98 A;  1ZUZ A;  1ORG A;  1S5G Y;  1SMG A;  1Z4H A;  4DCK A;  1JWD A;  1EJ3 A;  1S3P A;  1YVL A;  1SCV A;  2L5Y A;  2K2F A;  2L50 A;  1UHH A;  1CLL A;  2I7A A;  4I5K A;  3PAT A;  2JNX A;  3R1P A;  2K7O A;  1F54 A;  1BR1 B;  2L5X B;  1OSA A;  2LM5 A;  1J1E A;  5F6T A;  3BJH A;  3I5I B;  1PVA A;  2DOQ A;  1HQV A;  1KFU S;  2K7D A;  2LAP A;  3A4U B;  1MQ1 A;  3CAB A;  1CDP A;  1YUR A;  1ALW A;  3PM2 A;  1YVH A;  1CKK A;  1WLZ A;  3S0G A;  3OB1 B;  1B9A A;  1CDL A;  1WLM A;  5FYX A;  1PK0 D;  1W7J B;  3B7A A;  3NXA A;  2LP2 A;  1EG3 A;  3EVV A;  3CR2 A;  1DJZ A;  1TUJ A;  2FJU B;  2KHN A;  3CR4 X;  3D0Y B;  3D75 A;  4MN0 A;  3LL8 B;  1CB1 A;  4TNC A;  1FF1 A;  3AKB A;  2EGD A;  1M46 A;  1T14 A;  1Y1X A;  2M49 B;  1BT6 A;  4I5N B;  1GGW A;  4DRW A;  1IIO A;  1M31 A;  2BAP A;  4GGF C;  1IG5 A;  2CCM A;  4JKT A;  1C7W A;  2LMT A;  3WNX B;  2WND A;  2CXJ A;  2PMY A;  3PAL A;  1ODB A;  2M9G A;  4IL1 A;  4YGB B;  2KAX A;  3S0D A;  2F2P A;  3EKH A;  1DGU A;  5FI2 A;  1A4P A;  3IVT A;  2BBM A;  1QS7 A;  2B1U A;  2JNF A;  2L2C A;  1KK7 Z;  1QIV A;  5ER5 A;  3CDN A;  4CPV A;  4M2O A;  2E30 A;  3EG5 B;  2KYF A;  4QJ4 B;  3VRQ A;  5FI6 A;  3SJS A;  4KYN A;  2R2I A;  2MAZ A;  1AHR A;  2LLT A;  3FIA A;  4PE7 A;  4MZJ A;  1YRU B;  1H8B A;  1J7O A;  1NX3 A;  1DEL A;  1SNL A;  2OTG B;  2HQ8 A;  1B47 A;  1S6I A;  2NZ0 A;  5HLV A;  1RK9 A;  2AMI A;  1KWO B;  1QXP A;  2OTG C;  5CSJ A;  5FI7 A;  5I2Q A;  2L4I A;  5D3O A;  1C07 A;  3I5F B;  1KWO C;  2L0P A;  3OB2 B;  4GNK B;  4PE0 A;  5DKR A;  5AAN A;  2ZKM X;  4AQJ A;  3L4A A;  4GBA A;  1NUB A;  4MBE A;  1KCY A;  3I5F C;  3CYZ A;  1TCO B;  3WXA A;  2ZN9 A;  3ICB A;  3O78 A;  3DF0 A;  1OMD A;  4ICB A;  2CBL A;  1OMV A;  1QLS A;  2D8N A;  2PAL A;  2PQL A;  1M39 A;  1XYD A;  5ER4 X;  1TN4 A;  4QJ5 B;  3L4L A;  2KAY A;  1AVS A;  4BY4 A;  2M1K B;  1G4Y R;  2V53 A;  5BPJ A;  1KSM A;  2FOT A;  4L9M A;  2PYQ A;  3S0F A;  2OS8 B;  4PHJ A;  5HKZ A;  1TNW A;  1YUU A;  2Q4U A;  1NCY A;  1TNX A;  1V1F A;  1XFU O;  2KI6 C;  2O60 A;  1MWN A;  1CM1 A;  3BUW B;  1XFR A;  2P71 A;  5IBW A;  1TNP A;  1WRK A;  2JT8 A;  1SL9 A;  5HKY A;  1ZMZ A;  1DT7 B;  1IKU A;  1J55 A;  3NSI A;  1XFZ O;  3OX6 A;  4MLW A;  1K9K A;  3PFV A;  2RGI A;  5HKW A;  3SIB A;  4DIR A;  1OZS A;  1LIN A;  4YGC B;  1Q80 A;  3BOW B;  1SBJ A;  4A4C A;  3LK0 A;  1SPY A;  4OCI A;  2F8P A;  1F4Q A;  1WRL A;  4D1E A;  3CZ0 A;  4WQ3 A;  1KK8 B;  1UUR A;  1PUL A;  3PJI A;  2BCA A;  1LA3 A;  3BUX B;  2CT9 A;  2LCP A;  1XVJ A;  4PE1 A;  2FCE A;  1KK8 C;  1QX2 A;  1BOC A;  4OV2 A;  5CSF A;  2WC6 A;  2WC8 A;  5HLO A;  3SS4 A;  1SR6 B;  2JXC A;  3NSL A;  2ZFD A;  3GK4 X;  1HT9 A;  2QEH A;  3IQQ A;  3OGN A;  4N5X A;  4PDZ A;  3L47 A;  1J7P A;  1A75 A;  1SR6 C;  2JT0 A;  1C3Y A;  3FS7 A;  1PRW A;  3O6B A;  1TOP A;  1AP4 A;  1FPW A;  2M1U A;  3PLF B;  1AK8 A;  1FI5 A;  3EKJ A;  1BF5 A;  2P6B B;  2LMV A;  1AJ4 A;  1NX2 A;  3OP0 A;  1EL4 A;  4U8D A;  4IJ7 A;  1YTZ C;  5JOL A;  1BR4 B;  4CFR A;  1GM0 A;  1TNQ A;  1S6J A;  1TCF A;  4OKH A;  1NX1 A;  2JUL A;  2SAS A;  1MUX A;  4HRH A;  2LVK A;  4I5J A;  2KLE A;  3I5G B;  2E6W A;  1RTP 1;  1K90 D;  5DIC A;  1DJI A;  4A4B A;  2PRU A;  2I18 A;  5DKQ A;  1A2X A;  5TNC A;  1UHI A;  2I2R E;  1KFU L;  4YGE B;  3HCM A;  4F0Z B;  2Y1N A;  1QX7 A;  1PAL A;  4MEW A;  3IQO A;  5D69 A;  3BFH A;  2ISD A;  1L7Z A;  3I5I C;  1M63 B;  1Z2C B;  1QVI Y;  2Q91 A;  4HSZ A;  5I2O A;  2HET A;  3DYE A;  3BUM B;  4OVN F;  3CR5 X;  1XFX O;  3O2P A;  2HF5 A;  3SG6 A;  1WDC B;  3D0Y A;  3KF9 A;  3RLZ A;  5HL1 A;  4XYN A;  1DJY A;  3TDZ A;  4GGF A;  2WCJ A;  1WDC C;  2AAO A;  2LVI A;  3DZT A;  1PSB A;  1WRZ A;  5I2L A;  4PT1 A;  1FW4 A;  2K61 A;  3B88 A;  2KOT A;  1SL8 A;  3UNW A;  2KFF A;  3D74 A;  2L51 A;  1UHN A;  4HRE E;  1S1E A;  1W9Z A;  3NGV A;  1UUS A;  3Q8I A;  4YI8 A;  5PAL A;  5GQQ C;  1J1D A;  3NHT A;  1SKT A;  3NHI A;  1K95 A;  1S5G Z;  4GFT A;  3A8R A;  5CSI A;  2QEB A;  1KQM B;  1OW4 A;  2JC2 A;  3GOF A;  1B4C A;  2LNK A;  2K7C A;  3WHU B;  1KQM C;  1PVB A;  2KBM A;  4HRG A;  2JOJ A;  1TIZ A;  3BUN B;  1MXE A;  3S0A A;  4MSP A;  5AEQ A;  1SY9 A;  4YGA A;  3S0B A;  2ZND A;  1S36 A;  1ZFS A;  4JQ0 D;  2KQ6 A;  1XFW O;  3V2L A;  1OOH A;  1QVI Z;  2LUC A;  3K21 A;  1BU3 A;  2PSR A;  4ZCU A;  2LC5 A;  2LUX A;  3GK2 A;  4ZCV A;  2Y1M A;  2L2E A;  2WCM A;  4E68 A;  1NIW A;  1XO5 A;  1F4O A;  2WCF A;  4YI9 A;  2H2K A;  3OX5 A;  1JBA A;  2KI6 D;  1JC2 A;  1UWO A;  1QV1 A;  1CFC A;  3F45 A;  3O4X A;  1DF0 B;  2ERB A;  1EXR A;  2G2B A;  2WCE A;  3JTD B;  3RM1 A;  5B8I B;  1FI6 A;  1K2H A;  2KBI A;  1YX7 A;  1IJ6 A;  1IWQ A;  1U5I B;  1SCM B;  3BFA A;  3JTD C;  4OZD A;  3R1O A;  2WOS A;  2M29 A;  2QDI A;  1NX0 A;  1SCM C;  2H61 A;  2BKH B;  1QAT A;  1W7I B;  1BMO A;  2H61 C;  3H4S E;  2YGU A;  4PAL A;  3D73 A;  3D77 A;  1VRK A;  2H8V A;  2LLU A;  2KLD A;  1PSR A;  4AOM A;  2NCP A;  2ZRS A;  4CID A;  1UHJ A;  3DVM A;  4P2Y B;  1CFF A;  2BNX A;  2M97 A;  1RRO A;  1B8R A;  2M0R A;  2MA2 A;  2P70 A;  1K9U A;  3SG7 A;  3FE9 A;  3SG3 A;  4C0L A;  1DC1 A;  3D78 A;  5KTY A;  1DMO A;  3DVK A;  2K8M B;  3B87 A;  2OS8 C;  1X02 A;  2JTZ A;  2BCX A;  3FWB A;  4FTG A;  4ETO A;  3DVE A;  4WQ2 A;  1KFX L;  1NSH A;  1CDM A;  1CM4 A;  2PVB A;  3GK1 A;  1QTX A;  1KFX S;  4FQT A;  3BFB A;  3BOW A;  3TDU A;  3CTN A;  4USL A;  1Y0V H;  2NLN A;  1BJF A;  3NSO A;  4YBH B;  1CDN A;  4M2Q A;  3TS5 B;  1OZO A;  1CTR A;  1D1O A;  2FCD A;  3D10 A;  3CLN A;  1C3Z A;  4MVF A;  1G8I A;  1JFJ A;  3FWC A;  1K93 D;  1CFD A;  1LKJ A;  3CZ2 A;  3O4Y A;  3TS5 C;  1C7V A;  2EHB A;  1QAS A;  4ORA B;  1OQP A;  1S6C A;  3EK8 A;  1SK6 D;  4FQO A;  2M7L A;  3BQ3 A;  3LK1 A;  1TUZ A;  3VB1 A;  4DS7 A;  1QLK A;  3C1V A;  1WY9 A;  1RWY A; 
#chains in the Genus database with same CATH homology
 5KSZ A;  3TUY B;  4PHN A;  1JSA A;  1YX8 A;  1K96 A;  3KPX A;  1J7R A;  3BUO B;  3JVT B;  4CLN A;  4PE4 A;  1L2O B;  4M2P A;  3TUY C;  1KQV A;  1IQ3 A;  1JUO A;  2LHI A;  3JVT C;  1N2D A;  1L2O C;  2BKI B;  2K2A A;  4C0K A;  1UP5 A;  2VRG A;  1DJX A;  1SYM A;  1K8U A;  3EK7 A;  1JF2 A;  2CNP A;  2JQ6 A;  3I5H B;  1XA5 A;  3BYA A;  3M0W A;  3I5G C;  4NDB A;  1RJV A;  1LA0 A;  1N65 A;  4MRX A;  3I5H C;  2MRD A;  2BEC A;  3ZNI A;  1XFY O;  3PN7 B;  1IH0 A;  2LP3 A;  2LLS A;  4N1F A;  3PN7 C;  2ZN8 A;  1JFK A;  1CMF A;  1Y1A A;  2KQY A;  2G9B A;  3WHT B;  5I8N A;  1EG4 A;  1E8A A;  2JTT A;  2JZI A;  1KK7 Y;  2MBX A;  1QJT A;  1CLM A;  1FBV A;  4XJK B;  4WRI A;  1NPQ A;  4XJK A;  2NXQ A;  1R6P A;  1IGV A;  3CZT X;  4JWQ A;  5AXI A;  3SIA A;  1XK4 A;  1K94 A;  2LVV A;  1YRT B;  2KGB C;  3AAK A;  5AER A;  1XK4 C;  2BCB A;  2F3Z A;  5AFP A;  4NQG A;  3KEV A;  1CMG A;  4NDD A;  2LHL A;  1MR8 A;  3QRX A;  1B8C A;  1GQM A;  3ZWH A;  1DJH A;  1K9P A;  1DJG A;  2OPO A;  1YUT A;  4QJ3 B;  4DUQ A;  1JF0 A;  2JU0 A;  2KFG A;  2KGR A;  1A03 A;  4OR9 B;  1J7Q A;  3BXK A;  3IF7 A;  1Y1U A;  2AUC A;  1M45 A;  1TRF A;  1TTX A;  3CWG A;  1BLQ A;  1BOD A;  1H4B A;  2A4J A;  1MF8 B;  3VRR A;  1REC A;  3SG5 A;  2F3Y A;  2KNE A;  3LCP C;  1OMR A;  2CTN A;  1NYA A;  1V1G A;  2JT3 A;  1N0Y A;  1GJY A;  2JRF A;  2KYC A;  2WOR A;  1DTL A;  3PM8 A;  3EVU A;  2I94 A;  1DF0 A;  1OE9 B;  3DD4 A;  3VRN A;  4AQI A;  2F33 A;  4GPL B;  2Y4Q A;  2K7B A;  4YRU A;  2WCB A;  5J3X A;  3DVJ A;  1U5I A;  4P5O E;  1DJW A;  1QV0 A;  5K89 A;  1NWD A;  1F71 A;  1NP8 A;  1DVI A;  2M8U A;  4I5L B;  5DKN A;  1CFP A;  1QX5 B;  2LE9 B;  3HX4 A;  2KFH A;  1IJ5 A;  1NCZ A;  1F70 A;  2Y5I A;  1Y6W A;  1UHK A;  2LVJ A;  1IQ5 A;  1XFV O;  2M7N A;  1B1G A;  3VRP A;  1EH2 A;  3KHE A;  3TZ1 A;  4GAO A;  1LXF C;  2QAC A;  3SG2 A;  4UPG A;  2O5G A;  1B7T Y;  1QIW A;  2SCP A;  3DF0 B;  3E3R A;  3MSE B;  3OHM B;  4MZL A;  2ZRT A;  5G08 A;  4JPZ B;  2BE6 A;  4PHM A;  3AKA A;  4CFQ A;  4GGN A;  1KSO A;  4ORB B;  4PCW A;  2NCO A;  4R1E A;  1DGV A;  2JXL A;  3CGA A;  5JJG A;  1GGZ A;  1ZOT B;  2K0J A;  4N1G A;  2LV7 A;  2HQW A;  1SRA A;  3CS1 A;  2BE4 A;  1F8H A;  1ALV A;  4C0J A;  1LVC D;  2F2O A;  2JWW A;  5CSN A;  3VRO A;  1B8L A;  1AUI B;  2EC6 B;  2BBN A;  5D7F A;  3SG4 A;  1OOJ A;  2QPT A;  2LMU A;  1NCX A;  2EC6 C;  2JPT A;  2MLF C;  2BL0 B;  3NSK A;  2GV5 A;  2GGM A;  2GGZ A;  2IS9 A;  2COL B;  2KSP A;  3KO0 A;  3LLE A;  4GUK A;  4MZK A;  4NDC A;  3TDI A;  3EK4 A;  4PHK A;  2BL0 C;  2KAV A;  1G33 A;  2MLE C;  4YGD B;  2TN4 A;  2LAN A;  1MXL C;  2KI4 B;  2HPS A;  1BG1 A;  2MJW B;  1B7T Z;  4MRY A;  3VGO A;  1MHO A;  1F55 A;  2KI4 C;  1R2U A;  2M3W A;  5CPV A;  2L4H A;  1A75 B;  1SW8 A;  3PSR A;  1YUS A;  1ZAC A;  1IRJ A;  1CLB A;  1AJ5 A;  2PAS A;  4BY5 A;  5HYD A;  1SL7 A;  1YR5 A;  1A29 A;  4ORC B;  2KDH A;  4Q04 A;  5KU1 A;  2ZNE A;  1RFJ A;  1S26 D;  3AAJ A;  2MHH A;  1CNP A;  3EVR A;  2L98 A;  1ZUZ A;  1S5G Y;  1SMG A;  4DCK A;  1JWD A;  1EJ3 A;  1S3P A;  1YVL A;  1SCV A;  2K2F A;  2L50 A;  1UHH A;  1CLL A;  2I7A A;  4I5K A;  3PAT A;  2JNX A;  2K7O A;  1F54 A;  1BR1 B;  2L5X B;  1OSA A;  2LM5 A;  1J1E A;  5F6T A;  3I5I B;  1PVA A;  2DOQ A;  1HQV A;  1KFU S;  2K7D A;  2LAP A;  3A4U B;  1MQ1 A;  1CDP A;  1YUR A;  1ALW A;  1YVH A;  1CKK A;  1WLZ A;  3OB1 B;  1B9A A;  1CDL A;  1WLM A;  5FYX A;  1PK0 D;  1W7J B;  3NXA A;  2LP2 A;  1EG3 A;  3EVV A;  3CR2 A;  1DJZ A;  2KHN A;  2FJU B;  3CR4 X;  3D0Y B;  4MN0 A;  1CB1 A;  3LL8 B;  1FF1 A;  4TNC A;  3AKB A;  2EGD A;  1M46 A;  1Y1X A;  2M49 B;  1BT6 A;  4I5N B;  1GGW A;  4DRW A;  1M31 A;  4GGF C;  1IG5 A;  2CCM A;  1C7W A;  2LMT A;  3WNX B;  2WND A;  2CXJ A;  2PMY A;  3PAL A;  1ODB A;  2M9G A;  4IL1 A;  4YGB B;  2KAX A;  2F2P A;  3EKH A;  1DGU A;  1A4P A;  2BBM A;  1QS7 A;  2B1U A;  2JNF A;  1KK7 Z;  1QIV A;  5ER5 A;  4CPV A;  4M2O A;  2E30 A;  2KYF A;  4QJ4 B;  3VRQ A;  3SJS A;  2R2I A;  2MAZ A;  1AHR A;  2LLT A;  3FIA A;  4PE7 A;  4MZJ A;  1YRU B;  1H8B A;  1J7O A;  1NX3 A;  1SNL A;  2OTG B;  2HQ8 A;  1B47 A;  1S6I A;  2NZ0 A;  5HLV A;  1RK9 A;  2AMI A;  1KWO B;  1QXP A;  2OTG C;  5CSJ A;  5I2Q A;  2L4I A;  1C07 A;  3I5F B;  1KWO C;  2L0P A;  3OB2 B;  4GNK B;  4PE0 A;  5DKR A;  5AAN A;  2ZKM X;  4AQJ A;  4GBA A;  1NUB A;  4MBE A;  1KCY A;  3I5F C;  1TCO B;  3WXA A;  2ZN9 A;  3ICB A;  3O78 A;  3DF0 A;  1OMD A;  4ICB A;  2CBL A;  1OMV A;  1QLS A;  2D8N A;  2PAL A;  1M39 A;  1XYD A;  5ER4 X;  1TN4 A;  4QJ5 B;  2KAY A;  1AVS A;  4BY4 A;  2M1K B;  1G4Y R;  2V53 A;  5BPJ A;  1KSM A;  2FOT A;  4L9M A;  2OS8 B;  4PHJ A;  5HKZ A;  1TNW A;  1YUU A;  2Q4U A;  1NCY A;  1TNX A;  1V1F A;  1XFU O;  2KI6 C;  2O60 A;  1MWN A;  1CM1 A;  3BUW B;  5IBW A;  1TNP A;  1WRK A;  2JT8 A;  1SL9 A;  5HKY A;  1ZMZ A;  1DT7 B;  1IKU A;  1J55 A;  3NSI A;  1XFZ O;  3OX6 A;  4MLW A;  1K9K A;  3PFV A;  2RGI A;  5HKW A;  3SIB A;  4DIR A;  1OZS A;  1LIN A;  4YGC B;  1Q80 A;  3BOW B;  1SBJ A;  4A4C A;  3LK0 A;  1SPY A;  4OCI A;  2F8P A;  1F4Q A;  1WRL A;  4D1E A;  4WQ3 A;  1KK8 B;  1UUR A;  1PUL A;  2BCA A;  1LA3 A;  3BUX B;  2CT9 A;  2LCP A;  1XVJ A;  4PE1 A;  2FCE A;  1KK8 C;  1QX2 A;  1BOC A;  4OV2 A;  5CSF A;  2WC8 A;  5HLO A;  1SR6 B;  2JXC A;  3NSL A;  2ZFD A;  3GK4 X;  1HT9 A;  3IQQ A;  4N5X A;  4PDZ A;  1J7P A;  1A75 A;  1SR6 C;  2JT0 A;  3FS7 A;  1PRW A;  3O6B A;  1TOP A;  1AP4 A;  1FPW A;  2M1U A;  3PLF B;  1AK8 A;  1FI5 A;  3EKJ A;  1BF5 A;  2P6B B;  2LMV A;  1AJ4 A;  1NX2 A;  3OP0 A;  1EL4 A;  4U8D A;  4CFR A;  1YTZ C;  5JOL A;  1BR4 B;  1TNQ A;  1S6J A;  1TCF A;  4OKH A;  1NX1 A;  2JUL A;  2SAS A;  1MUX A;  4HRH A;  2LVK A;  4I5J A;  3I5G B;  2E6W A;  1RTP 1;  1K90 D;  1DJI A;  4A4B A;  2PRU A;  2I18 A;  5DKQ A;  1A2X A;  5TNC A;  1UHI A;  2I2R E;  1KFU L;  4YGE B;  3HCM A;  4F0Z B;  2Y1N A;  1QX7 A;  1PAL A;  4MEW A;  3IQO A;  5D69 A;  2ISD A;  1L7Z A;  3I5I C;  1M63 B;  2Q91 A;  1QVI Y;  4HSZ A;  5I2O A;  2HET A;  3BUM B;  4OVN F;  3CR5 X;  1XFX O;  3O2P A;  2HF5 A;  3SG6 A;  1WDC B;  3D0Y A;  3KF9 A;  3RLZ A;  4XYN A;  1DJY A;  3TDZ A;  4GGF A;  1WDC C;  2AAO A;  2LVI A;  1PSB A;  1WRZ A;  5I2L A;  1FW4 A;  2K61 A;  2KOT A;  1SL8 A;  2KFF A;  2L51 A;  1UHN A;  4HRE E;  1S1E A;  4YI8 A;  1UUS A;  5PAL A;  5GQQ C;  1J1D A;  1SKT A;  1K95 A;  1S5G Z;  4GFT A;  3A8R A;  5CSI A;  1KQM B;  2JC2 A;  3GOF A;  1B4C A;  2LNK A;  2K7C A;  3WHU B;  1KQM C;  1PVB A;  2KBM A;  4HRG A;  2JOJ A;  1TIZ A;  3BUN B;  1MXE A;  4MSP A;  5AEQ A;  1SY9 A;  4YGA A;  2ZND A;  1S36 A;  1ZFS A;  4JQ0 D;  2KQ6 A;  1XFW O;  1QVI Z;  2LUC A;  3K21 A;  1BU3 A;  2PSR A;  4ZCU A;  2LC5 A;  2LUX A;  3GK2 A;  4ZCV A;  2Y1M A;  2L2E A;  4E68 A;  1NIW A;  1XO5 A;  1F4O A;  2WCF A;  4YI9 A;  2H2K A;  3OX5 A;  1JBA A;  2KI6 D;  1JC2 A;  1UWO A;  1QV1 A;  1CFC A;  3F45 A;  1DF0 B;  5B8I B;  1EXR A;  2G2B A;  2WCE A;  3JTD B;  3RM1 A;  1FI6 A;  1K2H A;  2KBI A;  1YX7 A;  1IJ6 A;  1IWQ A;  1U5I B;  1SCM B;  3JTD C;  2WOS A;  2M29 A;  1NX0 A;  1SCM C;  2H61 A;  2BKH B;  1QAT A;  1W7I B;  1BMO A;  2H61 C;  3H4S E;  4PAL A;  1VRK A;  2LLU A;  4AOM A;  1PSR A;  2NCP A;  2ZRS A;  4CID A;  1UHJ A;  3DVM A;  4P2Y B;  1CFF A;  2M97 A;  1RRO A;  1B8R A;  2M0R A;  2MA2 A;  3SG7 A;  1K9U A;  3SG3 A;  4C0L A;  1DMO A;  5KTY A;  3DVK A;  2K8M B;  2OS8 C;  1X02 A;  2JTZ A;  2BCX A;  3FWB A;  4FTG A;  4ETO A;  3DVE A;  4WQ2 A;  1KFX L;  1NSH A;  1CDM A;  1CM4 A;  2PVB A;  3GK1 A;  1QTX A;  1KFX S;  3BOW A;  3TDU A;  3CTN A;  4USL A;  1Y0V H;  2NLN A;  1BJF A;  3NSO A;  4YBH B;  1CDN A;  4M2Q A;  3TS5 B;  1OZO A;  1CTR A;  1D1O A;  2FCD A;  3D10 A;  3CLN A;  4MVF A;  1G8I A;  1JFJ A;  3FWC A;  1K93 D;  1CFD A;  1LKJ A;  3O4Y A;  3TS5 C;  1C7V A;  2EHB A;  1QAS A;  4ORA B;  1OQP A;  1S6C A;  3EK8 A;  1SK6 D;  4FQO A;  2M7L A;  3BQ3 A;  3LK1 A;  4DS7 A;  1QLK A;  3C1V A;  1WY9 A;  1RWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...