2KAYA

Solution structure and dynamics of s100a5 in the ca2+ -bound states
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
92
structure length
92
Chain Sequence
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A5
publication title Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 40
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kayA00
1YUUA 2G2BA 3JTDC 1JC2A 1IJ5A 1QIWA 2MAZA 4MZLA 1YRUB 5HKZA 1YVLA 5ER5A 3VRRA 1F4QA 3CLNA 1M31A 1BR4B 3D10A 1ZMZA 1DJXA 4MSPA 1RECA 1CM4A 2IS9A 1TCFA 1V1GA 1LINA 1K95A 4GUKA 3CS1A 3DD4A 1JFJA 1WRLA 1QATA 3WHUB 1KQMC 1SKTA 2F2PA 4C0LA 3KF9A 1AUIB 1PALA 2K61A 3LL8B 4ORAB 1EL4A 1J7OA 3EK4A 1QV1A 1TCOB 1GGWA 1B47A 1S3PA 3O4YA 5I2QA 3I5HB 3TS5C 1KWOB 2M97A 1LXFC 4E68A 1QV0A 5HLVA 1FI6A 1WDCC 4QJ5B 2LANA 2GGZA 1LA3A 2MRDA 1CDNA 4OR9B 3EK8A 1CDMA 4OKHA 1NCXA 1W7JB 3D0YB 3KEVA 5BPJA 1SCVA 2EHBA 4XJKA 3VRPA 2M1KB 3CZTX 4PHNA 3TUYB 3M0WA 1BODA 1OSAA 3I5FB 4PDZA 4MBEA 1E8AA 1YURA 2HQWA 1XK4C 3SG3A 3TZ1A 1NUBA 2BE6A 1SMGA 2Y5IA 2K7DA 2F33A 3NSLA 3PM8A 1MHOA 5TNCA 3WXAA 4N5XA 2HQ8A 3OX5A 1NX3A 1UHHA 2KHNA 1RFJA 2LNKA 2BL0C 2MLEC 1DT7B 2OTGC 4M2PA 4CFRA 2KFGA 3SJSA 1QX5B 5K89A 4NDBA 1SW8A 3H4SE 4YI8A 2LC5A 1K96A 2JTTA 3PN7B 4A4CA 2BCXA 1JF2A 1C7WA 2BKHB 1QVIY 3SIAA 3VROA 2HPSA 3JTDB 2L4HA 4L9MA 1K8UA 3VRQA 2KQYA 1R2UA 1M39A 3DF0B 2RGIA 1VRKA 2M29A 3NXAA 2AUCA 2F3YA 1B8LA 3GK2A 3MSEB 4YGBB 1NIWA 2JNXA 2F8PA 1IJ6A 2ZFDA 1BJFA 2F2OA 1GGZA 1A29A 1S1EA 1NCYA 4M2OA 1A4PA 2SASA 5KSZA 1J7PA 1EG4A 1N0YA 3D0YA 1OMDA 1EJ3A 2AMIA 3EKJA 1CFFA 1XFUO 1TIZA 1NP8A 2M9GA 4A4BA 1J1EA 1QVIZ 5CSJA 2KI4C 2K8MB 2PVBA 3AKAA 2LUXA 4AOMA 3TS5B 1FW4A 1KK8C 1MR8A 1B8RA 4CIDA 4YI9A 1WDCB 1F55A 3I5HC 2ISDA 3F45A 3EVVA 4XYNA 3LK1A 3RLZA 2HF5A 1AP4A 1S6CA 5FYXA 1Y1XA 2WCEA 1QLSA 1BU3A 2K7BA 4R1EA 4YGAA 3OP0A 1XFYO 1RWYA 2M7LA 2CTNA 4FQOA 1CLBA 1YVHA 3TUYC 5HLOA 4ORCB 1F8HA 1KQVA 1DJGA 2JULA 1K9PA 2WNDA 3DF0A 1B7TY 2BL0B 2JOJA 2LV7A 2OTGB 4PE0A 3VGOA 4FTGA 5HKWA 2GGMA 2M1UA 2M3WA 1QLKA 2CT9A 1PVAA 1WRZA 1NX1A 1XYDA 1MWNA 1SNLA 2BBNA 4DS7A 1G8IA 2L51A 4UPGA 2GV5A 2KGRA 1YUSA 2BE4A 3SG5A 2JQ6A 1ZFSA 5DKNA 1HQVA 2M49B 2PALA 2JNFA 2JRFA 1DF0A 1G4YR 3ZWHA 2SCPA 3BQ3A 1W7IB 1PVBA 4HREE 1JF0A 1K2HA 5PALA 5CSFA 1B7TZ 2P6BB 2QACA 3FIAA 1QXPA 1UHJA 1LKJA 2L2EA 5DKQA 2K2AA 1FF1A 1UUSA 1K9UA 1RROA 1M63B 2FCDA 5HYDA 3QRXA 4N1GA 1SRAA 1DTLA 2LM5A 2WCFA 4PE4A 4PHMA 2MBXA 2KI4B 5ER4X 3ZNIA 1K94A 1XFZO 1XK4A 1NYAA 3FS7A 4ZCUA 2Y1MA 1B4CA 1DGUA 4NDCA 1KK8B 1EH2A 4GFTA 2O5GA 2TN4A 3I5GC 2COLB 4YGDB 2BBMA 2L0PA 1A03A 4MLWA 4MN0A 1SY9A 3VRNA 2ZN8A 5G08A 2JT8A 1SBJA 2EGDA 2KYFA 3BUMB 1XO5A 2LP3A 2LLUA 3IQQA 4JQ0D 3SG4A 1EG3A 3ICBA 3OB2B 4OV2A 3AKBA 2FJUB 2LAPA 2CNPA 4WRIA 1KSMA 1XFVO 3SG7A 1DJHA 2EC6C 2WORA 1C7VA 1PRWA 3JVTC 1NSHA 2K7OA 2WC8A 2NCOA 3GK1A 2LHIA 1TNPA 3EKHA 1OOJA 4TNCA 1DVIA 3LLEA 2FOTA 1B9AA 1JBAA 3PATA 1J55A 4MRXA 3BOWB 3CWGA 4PALA 1JSAA 3OB1B 2JC2A 1S26D 4OVNF 2JXCA 1YR5A 5KU1A 1EXRA 3AAJA 1GJYA 1LVCD 5AERA 1CFPA 1TNWA 1F54A 5HKYA 2BCAA 1WY9A 1M45A 1C07A 2KOTA 2PRUA 1K93D 1CLLA 1F71A 3CR5X 3KO0A 2Y4QA 3NSIA 4ORBB 1BG1A 1H4BA 3A8RA 5I2LA 2NXQA 2LCPA 1AJ5A 1RK9A 1NCZA 1JWDA 2MHHA 1L7ZA 3FWCA 1F4OA 3O6BA 2Q4UA 1DJIA 4YGEB 3I5GB 1TNXA 2BKIB 1IH0A 4GNKB 1QASA 3DVKA 3IQOA 1KCYA 4PCWA 4ICBA 3SG6A 4WQ2A 2OS8B 3BUNB 1IRJA 2H2KA 3HCMA 1A75B 1V1FA 2JZIA 4I5NB 3GOFA 1BOCA 5I8NA 4DCKA 4AQIA 1SL7A 1WLMA 3EVUA 3EVRA 3CGAA 1SL9A 2LMTA 2LVIA 1SPYA 1TTXA 3KPXA 1QIVA 3DVEA 1ODBA 3BOWA 2Q91A 4QJ4B 1WRKA 2F3ZA 1JFKA 1OZSA 2CXJA 4ZCVA 1CMFA 1K90D 2E30A 1SL8A 1TN4A 1XFWO 2EC6B 2I18A 3JVTB 1KK7Y 1CMGA 2I94A 3DVMA 5AEQA 3NSOA 4HRGA 4N1FA 4HRHA 4GPLB 2BECA 1PULA 3IF7A 2LVVA 3BXKA 2H61C 2JTZA 1G33A 1NX2A 2LUCA 3BUWB 2ZRSA 4HSZA 5JOLA 5IBWA 2JXLA 3LCPC 1Q80A 1DJZA 2KSPA 2KFFA 1YRTB 2NLNA 1LA0A 1UURA 5CPVA 1OE9B 3BUOB 2MJWB 4MVFA 1MXLC 1N65A 4C0JA 4YRUA 4AQJA 4PE1A 1AJ4A 1KK7Z 2ZRTA 3BUXB 2V53A 2M0RA 3I5IC 2ZNDA 3OX6A 1UP5A 1A75A 2JPTA 1ALVA 1S36A 1SK6D 1ZOTB 2KYCA 1ZACA 3PSRA 2KNEA 4M2QA 2KBIA 1YX8A 4C0KA 1BR1B 1OMRA 1UWOA 2CBLA 2DOQA 3RM1A 5B8IB 1MUXA 1BMOA 2KI6C 1S5GY 2A4JA 1S6IA 1B1GA 1IQ5A 2R2IA 3AAKA 5J3XA 3TDZA 4NQGA 3LK0A 4I5LB 4DUQA 4MZKA 1IG5A 1CNPA 1SR6C 1GQMA 2OS8C 1PSRA 4PHJA 1RTP1 1L2OC 3GK4X 4GBAA 2O60A 1CDPA 1QTXA 1SCMC 2MA2A 4CFQA 1WLZA 4NDDA 5D69A 1TRFA 1BLQA 4F0ZB 1QS7A 4GGFC 3TDUA 3BYAA 4I5JA 2JT0A 3DVJA 1S5GZ 1IWQA 1AK8A 4MEWA 1CB1A 1NPQA 1DGVA 1Y6WA 1DMOA 5I2OA 2E6WA 3O78A 4ETOA 1FBVA 2MLFC 3O2PA 4I5KA 1MQ1A 3E3RA 1QX2A 1XFXO 4MRYA 2KBMA 3CR2A 2ZKMX 4P5OE 1Y1AA 4DRWA 2CCMA 1R6PA 1U5IB 2NZ0A 5AANA 5D7FA 3SIBA 4U8DA 2PSRA 2JT3A 4BY5A 1BF5A 1K9KA 2M8UA 4DIRA 1DJWA 1J7RA 3I5IB 5F6TA 2D8NA 2KQ6A 1X02A 3CR4X 3PALA 1CFDA 2B1UA 3K21A 2L98A 2KFHA 2K7CA 2KGBC 1PK0D 1CFCA 1KFXL 1CDLA 2LLTA 1KFXS 3CTNA 5CSNA 1B8CA 1UHKA 1MXEA 2BCBA 5AFPA 2LP2A 4P2YB 1A2XA 5KTYA 2LHLA 2LVKA 5CSIA 4IL1A 1XVJA 4BY4A 1IKUA 2JWWA 2K2FA 4OCIA 2LLSA 3PFVA 1SR6B 4GGNA 2H61A 2OPOA 4YGCB 2KAVA 2PASA 4CLNA 2ZNEA 2KAYA 1M46A 1L2OB 1J1DA 1CLMA 1SCMB 1KQMB 4MZJA 3KHEA 2LMUA 1CTRA 1OZOA 1U5IA 1KSOA 2KDHA 2PMYA 1NX0A 2AAOA 1H8BA 1FPWA 1DF0B 1MF8B 3WNXB 1CKKA 2LE9B 2JU0A 1QJTA 1OMVA 3A4UB 4JWQA 1UHIA 1DJYA 2I7AA 1J7QA 1JUOA 3C1VA 4CPVA 1KWOC 4PE7A 1D1OA 2WCBA 4JPZB 1KFUL 1QX7A 1YTZC 1KFUS 1RJVA 2HETA 2I2RE 1UHNA 3EK7A 1AVSA 1ZUZA 2FCEA 2WOSA 2KI6D 1XA5A 3NSKA 1F70A 2L5XB 4Q04A 2G9BA 1Y0VH 1AHRA 5AXIA 1OQPA 1S6JA 2L4IA 1IGVA 3FWBA 1YX7A 2Y1NA 4D1EA 3I5FC 2QPTA 1IQ3A 1SYMA 1BT6A 1PSBA 3PLFB 4PHKA 5GQQC 1TNQA 4USLA 3HX4A 3SG2A 1TOPA 4YBHB 1CM1A 1N2DA 1Y1UA 1YUTA 1ALWA 2LVJA 4GAOA 4WQ3A 3WHTB 2K0JA 2LMVA 3TDIA 5JJGA 2NCPA 1FI5A 2ZN9A 4QJ3B 4XJKB 2VRGA 1HT9A 3OHMB 3PN7C 1NWDA 2KAXA 5DKRA 2L50A 2M7NA 4GGFA
chains in the Genus database with same CATH superfamily
1YUUA 2G2BA 3JTDC 3SS4A 1JC2A 1IJ5A 1QIWA 2MAZA 4MZLA 1YRUB 3D77A 5HKZA 1YVLA 5ER5A 3VRRA 1F4QA 3CLNA 1M31A 1BR4B 2QEBA 3D10A 1ZMZA 1DJXA 4MSPA 1RECA 1CM4A 2IS9A 1TCFA 1V1GA 1LINA 1K95A 4GUKA 3CS1A 3DD4A 1JFJA 1WRLA 1QATA 3WHUB 1KQMC 1SKTA 2F2PA 4C0LA 3KF9A 3S0FA 1AUIB 1LS8A 1PALA 2K61A 3LL8B 4ORAB 1EL4A 1J7OA 3K1EA 3EK4A 1QV1A 1TCOB 1GGWA 1GM0A 1B47A 1S3PA 3O4YA 5I2QA 3I5HB 3TS5C 1KWOB 2M97A 1LXFC 4E68A 1QV0A 5HLVA 1FI6A 1WDCC 4QJ5B 2LANA 2GGZA 2WC5A 1LA3A 2MRDA 1CDNA 4OR9B 3EK8A 1CDMA 3CZ1A 4OKHA 1NCXA 1W7JB 3D0YB 3KEVA 5BPJA 1SCVA 2EHBA 4XJKA 3VRPA 3SS3A 4IJ7A 3R1OA 2M1KB 3CZTX 4PHNA 3TUYB 3M0WA 1C3YA 1BODA 1OSAA 3I5FB 4PDZA 4MBEA 1E8AA 1YURA 2HQWA 1XK4C 3SG3A 3TZ1A 1NUBA 2BE6A 1SMGA 3R1VA 2Y5IA 2K7DA 2F33A 3NSLA 3PM8A 1MHOA 5TNCA 3WXAA 4N5XA 2HQ8A 3OX5A 1NX3A 1UHHA 2KHNA 1RFJA 2LNKA 2BL0C 2MLEC 1DT7B 2OTGC 3D75A 4M2PA 4CFRA 2KFGA 3SJSA 1QX5B 5K89A 4NDBA 1SW8A 3H4SE 4YI8A 2LC5A 1K96A 2JTTA 3PN7B 4A4CA 2BCXA 1JF2A 1C7WA 2BKHB 3CABA 1QVIY 1TUJA 3SIAA 3VROA 2HPSA 3JTDB 2L4HA 4L9MA 1K8UA 3VRQA 2KQYA 2BNXA 3EG5B 1R2UA 1M39A 2KLDA 3DF0B 2RGIA 1VRKA 2M29A 3CDNA 3NXAA 2AUCA 2F3YA 1B8LA 3GK2A 3MSEB 4YGBB 1NIWA 2JNXA 2F8PA 1IJ6A 2ZFDA 1BJFA 2F2OA 1GGZA 1A29A 1S1EA 1NCYA 2L2CA 4M2OA 1A4PA 2SASA 5KSZA 1J7PA 1EG4A 1N0YA 3D0YA 5FI6A 1OMDA 1EJ3A 2AMIA 3EKJA 1CFFA 1XFUO 1TIZA 1NP8A 2M9GA 4A4BA 1J1EA 1QVIZ 5CSJA 2KI4C 2K8MB 3OGNA 2PVBA 3AKAA 2LUXA 4JD9A 4KYNA 3TS5B 4AOMA 1FW4A 1KK8C 1MR8A 1B8RA 4CIDA 1OOHA 4YI9A 1WDCB 1F55A 3I5HC 2ISDA 3F45A 3EVVA 4XYNA 3LK1A 2K60A 3RLZA 2HF5A 4INWA 1AP4A 1S6CA 5FYXA 1Y1XA 2WCEA 1QLSA 1BU3A 2K7BA 4OZDA 1DELA 4R1EA 4YGAA 3OP0A 1XFYO 3BFAA 1RWYA 3CYZA 5D3OA 3BFBA 2M7LA 2CTNA 3FE8A 4FQOA 1CLBA 1YVHA 3TUYC 5HLOA 4ORCB 1F8HA 1KQVA 1DJGA 3FE9A 2JULA 1K9PA 2WNDA 3DF0A 1B7TY 2BL0B 2JOJA 2LV7A 2OTGB 4PE0A 3NHIA 3VGOA 4FTGA 5HKWA 2GGMA 2QDIA 3S0GA 2M1UA 2M3WA 1QLKA 2CT9A 1PVAA 1WRZA 1NX1A 1XYDA 1MWNA 1SNLA 2BBNA 4DS7A 1G8IA 2L51A 4UPGA 2GV5A 3PM2A 2KGRA 1YUSA 2BE4A 2P71A 3SG5A 2JQ6A 1ZFSA 5DKNA 1HQVA 2M49B 2PALA 3PJIA 2JNFA 2JRFA 1DF0A 1G4YR 3ZWHA 2SCPA 3BQ3A 1W7IB 1PVBA 4HREE 1DEKA 1JF0A 1K2HA 5EL2A 5PALA 5CSFA 1B7TZ 2P6BB 2QACA 3FIAA 1QXPA 1UHJA 1LKJA 2L2EA 5DKQA 2K2AA 1FF1A 1UUSA 1K9UA 1RROA 1M63B 2FCDA 5HYDA 3QRXA 4N1GA 1SRAA 1DTLA 2LM5A 2WCFA 4PE4A 4PHMA 2MBXA 2KI4B 5ER4X 3ZNIA 1K94A 1XFZO 1XK4A 1NYAA 3FS7A 4ZCUA 2Y1MA 5FI2A 1DGUA 4NDCA 1KK8B 1B4CA 1EH2A 3L4LA 4GFTA 2O5GA 2TN4A 3I5GC 2COLB 4YGDB 3D78A 3UO9A 2BBMA 2L0PA 1A03A 4MLWA 4MN0A 1Z4HA 1SY9A 3VRNA 2ZN8A 5G08A 2JT8A 1SBJA 2EGDA 2KYFA 3BUMB 1XO5A 1XFRA 2LLUA 2LP3A 3B6XA 3IQQA 1EG3A 3ICBA 3L4AA 3OB2B 4JQ0D 3SG4A 4OV2A 3AKBA 2FJUB 2LAPA 2CNPA 4WRIA 1KSMA 1XFVO 3SG7A 1DJHA 2EC6C 2WORA 1C7VA 1PRWA 1TUZA 3JVTC 1NSHA 3S0EA 2K7OA 2WC8A 3OBVA 2NCOA 3D76A 3GK1A 2LHIA 3N7HA 1TNPA 3EKHA 1OOJA 4TNCA 1DVIA 1OOFA 3LLEA 2FOTA 1B9AA 1JBAA 3PATA 1J55A 4MRXA 3BOWB 3CWGA 4PALA 1JSAA 3OB1B 2JC2A 1S26D 4OVNF 2JXCA 1YR5A 5KU1A 1EXRA 3AAJA 1GJYA 5JJGA 1LVCD 3SS5A 5AERA 1CFPA 1TNWA 1F54A 5HKYA 2BCAA 1WY9A 1M45A 1C07A 2KOTA 2PRUA 1K93D 1CLLA 1F71A 3CR5X 3KO0A 2Y4QA 3NSIA 4ORBB 1BG1A 1H4BA 3A8RA 5I2LA 2NXQA 2LCPA 1AJ5A 1RK9A 1NCZA 1JWDA 1OOIX 2MHHA 4F7FA 1L7ZA 3FWCA 1F4OA 3O6BA 2Q4UA 1DJIA 4YGEB 3I5GB 1TNXA 2BKIB 1IH0A 4GNKB 1QASA 3DVKA 3IQOA 1KCYA 4PCWA 3D73A 3DYEA 4ICBA 3SG6A 4WQ2A 2OS8B 3BUNB 1IRJA 1Z2CB 2H2KA 1A75B 1V1FA 2JZIA 3HCMA 3GOFA 4I5NB 1BOCA 2QEHA 5I8NA 4DCKA 4AQIA 1SL7A 1WLMA 3EVUA 3EVRA 3CGAA 1SL9A 2LMTA 2LVIA 1SPYA 1TTXA 3KPXA 1QIVA 3DVEA 1ODBA 3BOWA 2Q91A 4QJ4B 1WRKA 2F3ZA 1JFKA 1OZSA 2CXJA 4ZCVA 1CMFA 1K90D 2E30A 1SL8A 1TN4A 1XFWO 2EC6B 2I18A 3QMEA 3JVTB 1KK7Y 1CMGA 2I94A 3DVMA 3DY9A 5AEQA 3NSOA 4HRGA 4N1FA 4HRHA 4GPLB 2BECA 1PULA 3IF7A 2LVVA 3BXKA 2H61C 2JTZA 1ORGA 1G33A 1NX2A 2LUCA 3BUWB 3Q8IA 2ZRSA 4HSZA 5JOLA 5IBWA 1C3ZA 2JXLA 5HL1A 2KLEA 3LCPC 3CZ0A 3L47A 1Q80A 1DJZA 2KSPA 2KFFA 1YRTB 2WCMA 3IVTA 2NLNA 1LA0A 1UURA 5CPVA 1OE9B 1SSEB 3BUOB 2MJWB 4MVFA 2GTEA 1MXLC 1N65A 4INXA 4C0JA 4AQJA 4PE1A 4YRUA 1AJ4A 1KK7Z 2ZRTA 3BUXB 2V53A 2M0RA 3I5IC 2ZNDA 3OX6A 1UP5A 1A75A 2JPTA 2YGUA 1ALVA 1S36A 1SK6D 1ZOTB 2KYCA 1ZACA 3PSRA 2KNEA 3O4XA 4M2QA 2KBIA 1YX8A 4C0KA 1BR1B 1OMRA 1UWOA 2CBLA 3B86A 2DOQA 3DXLA 3RM1A 5B8IB 1MUXA 2H8VA 1BMOA 2KI6C 1S5GY 2A4JA 4JKTA 3S0AA 2PYQA 1S6IA 1B1GA 1IQ5A 2R2IA 3AAKA 5J3XA 3B7AA 3TDZA 4NQGA 3LK0A 1OW4A 4I5LB 4MZKA 4DUQA 1IG5A 1CNPA 1SR6C 3UNWA 1GQMA 2OS8C 1PSRA 4PHJA 1RTP1 1L2OC 3GK4X 4GBAA 2O60A 1CDPA 1QTXA 1SCMC 2MA2A 4CFQA 3BFHA 1WLZA 4NDDA 5D69A 1TRFA 1BLQA 4F0ZB 1QWVA 1QS7A 4GGFC 2BAPA 3BYAA 2KPHA 2JT0A 3BJHA 4I5JA 3TDUA 3DVJA 1S5GZ 1IWQA 1AK8A 4MEWA 1CB1A 5FI7A 1NPQA 1DGVA 1Y6WA 1DMOA 5I2OA 2E6WA 3FE6A 3O78A 4ETOA 1FBVA 2MLFC 3O2PA 4I5KA 1MQ1A 3E3RA 1QX2A 1XFXO 4MRYA 1TWOA 2KBMA 3CR2A 2ZKMX 4P5OE 1Y1AA 2WCJA 4DRWA 2CCMA 1R6PA 1U5IB 2NZ0A 5AANA 5D7FA 3SIBA 4U8DA 2PSRA 2JT3A 3R1PA 3D74A 4BY5A 1BF5A 3RZSA 1K9KA 2M8UA 4DIRA 2ERBA 2QEOA 1DJWA 1J7RA 3I5IB 5F6TA 2D8NA 2KQ6A 3V2LA 1X02A 3CR4X 3PALA 1CFDA 2B1UA 3K21A 2L98A 2KFHA 2K7CA 2KGBC 1PK0D 1CFCA 1KFXL 2WCLA 1CDLA 2LLTA 1KFXS 3CTNA 5CSNA 1B8CA 1UHKA 1MXEA 2BCBA 5AFPA 2LP2A 4P2YB 1A2XA 5KTYA 2LHLA 2LVKA 5CSIA 4IL1A 1XVJA 4BY4A 1IKUA 2JWWA 2P70A 2K2FA 4OCIA 2PQLA 2LLSA 3PFVA 1SR6B 4GGNA 2H61A 5DICA 2OPOA 4YGCB 2KAVA 2PASA 1W9ZA 4CLNA 2ZNEA 2KAYA 1M46A 1L2OB 1J1DA 1CLMA 3S0BA 1SCMB 1KQMB 3S0DA 4MZJA 3KHEA 1P28A 2LMUA 1CTRA 1OZOA 1U5IA 1KSOA 2KDHA 2PMYA 1NX0A 2AAOA 1OOGA 2WC6A 3NHTA 1H8BA 1FPWA 1DF0B 1MF8B 3WNXB 1CKKA 2LE9B 3R72A 2JU0A 1QJTA 1DC1A 2L5YA 1OMVA 3A4UB 1IIOA 4JWQA 1UHIA 3VB1A 1DJYA 2I7AA 3DZTA 1J7QA 5I94A 1JUOA 3C1VA 4CPVA 1KWOC 4PE7A 1D1OA 2WCBA 4JPZB 2WCHA 1KFUL 1QX7A 1YTZC 4PT1A 1KFUS 1RJVA 2HETA 1DQEA 2I2RE 1UHNA 3EK7A 1AVSA 1ZUZA 2FCEA 2FJYA 2WOSA 3B87A 2KI6D 1XA5A 3NSKA 1F70A 3CZ2A 2L5XB 4Q04A 2G9BA 1Y0VH 1AHRA 5AXIA 1OQPA 1S6JA 2L4IA 1IGVA 3FWBA 1YX7A 2Y1NA 4D1EA 3I5FC 2QPTA 1IQ3A 1SYMA 1BT6A 1PSBA 3PLFB 4PHKA 5GQQC 1TNQA 4FQTA 3HX4A 4USLA 3NGVA 3SG2A 1TOPA 4YBHB 1YUTA 1CM1A 1N2DA 1Y1UA 1ALWA 2JPOA 2LVJA 3B88A 4GAOA 2K0JA 2LMVA 4WQ3A 3TDIA 1T14A 2QEVA 3WHTB 2NCPA 1FI5A 2ZN9A 4QJ3B 4XJKB 2VRGA 1HT9A 3OHMB 3PN7C 1NWDA 2KAXA 5DKRA 2L50A 2WCKA 2M7NA 4GGFA
chains in the Genus database with same CATH topology
1YUUA 2G2BA 3JTDC 1JC2A 1IJ5A 1QIWA 2MAZA 4MZLA 1YRUB 5HKZA 1YVLA 5ER5A 3VRRA 1F4QA 3CLNA 1M31A 1BR4B 3D10A 1ZMZA 1DJXA 4MSPA 1RECA 1CM4A 2IS9A 1TCFA 1V1GA 1LINA 1K95A 4GUKA 3CS1A 3DD4A 1JFJA 1WRLA 1QATA 3WHUB 1KQMC 1SKTA 2F2PA 4C0LA 3KF9A 1AUIB 1PALA 2K61A 3LL8B 4ORAB 1EL4A 1J7OA 3EK4A 1QV1A 1TCOB 1GGWA 1B47A 1S3PA 3O4YA 5I2QA 3I5HB 3TS5C 1KWOB 2M97A 1LXFC 4E68A 1QV0A 5HLVA 1FI6A 1WDCC 4QJ5B 2LANA 2GGZA 1LA3A 2MRDA 1CDNA 4OR9B 3EK8A 1CDMA 4OKHA 1NCXA 1W7JB 3D0YB 3KEVA 5BPJA 1SCVA 2EHBA 4XJKA 3VRPA 2M1KB 3CZTX 4PHNA 3TUYB 3M0WA 1BODA 1OSAA 3I5FB 4PDZA 4MBEA 1E8AA 1YURA 2HQWA 1XK4C 3SG3A 3TZ1A 1NUBA 2BE6A 1SMGA 2Y5IA 2K7DA 2F33A 3NSLA 3PM8A 1MHOA 5TNCA 3WXAA 4N5XA 2HQ8A 3OX5A 1NX3A 1UHHA 2KHNA 1RFJA 2LNKA 2BL0C 2MLEC 1DT7B 2OTGC 4M2PA 4CFRA 2KFGA 3SJSA 1QX5B 5K89A 4NDBA 1SW8A 3H4SE 4YI8A 2LC5A 1K96A 2JTTA 3PN7B 4A4CA 2BCXA 1JF2A 1C7WA 2BKHB 1QVIY 3SIAA 3VROA 2HPSA 3JTDB 2L4HA 4L9MA 1K8UA 3VRQA 2KQYA 1R2UA 1M39A 3DF0B 2RGIA 1VRKA 2M29A 3NXAA 2AUCA 2F3YA 1B8LA 3GK2A 3MSEB 4YGBB 1NIWA 2JNXA 2F8PA 1IJ6A 2ZFDA 1BJFA 2F2OA 1GGZA 1A29A 1S1EA 1NCYA 4M2OA 1A4PA 2SASA 5KSZA 1J7PA 1EG4A 1N0YA 3D0YA 1OMDA 1EJ3A 2AMIA 3EKJA 1CFFA 1XFUO 1TIZA 1NP8A 2M9GA 4A4BA 1J1EA 1QVIZ 5CSJA 2KI4C 2K8MB 2PVBA 3AKAA 2LUXA 4AOMA 3TS5B 1FW4A 1KK8C 1MR8A 1B8RA 4CIDA 4YI9A 1WDCB 1F55A 3I5HC 2ISDA 3F45A 3EVVA 4XYNA 3LK1A 3RLZA 2HF5A 1AP4A 1S6CA 5FYXA 1Y1XA 2WCEA 1QLSA 1BU3A 2K7BA 4R1EA 4YGAA 3OP0A 1XFYO 1RWYA 2M7LA 2CTNA 4FQOA 1CLBA 1YVHA 3TUYC 5HLOA 4ORCB 1F8HA 1KQVA 1DJGA 2JULA 1K9PA 2WNDA 3DF0A 1B7TY 2BL0B 2JOJA 2LV7A 2OTGB 4PE0A 3VGOA 4FTGA 5HKWA 2GGMA 2M1UA 2M3WA 1QLKA 2CT9A 1PVAA 1WRZA 1NX1A 1XYDA 1MWNA 1SNLA 2BBNA 4DS7A 1G8IA 2L51A 4UPGA 2GV5A 2KGRA 1YUSA 2BE4A 3SG5A 2JQ6A 1ZFSA 5DKNA 1HQVA 2M49B 2PALA 2JNFA 2JRFA 1DF0A 1G4YR 3ZWHA 2SCPA 3BQ3A 1W7IB 1PVBA 4HREE 1JF0A 1K2HA 5PALA 5CSFA 1B7TZ 2P6BB 2QACA 3FIAA 1QXPA 1UHJA 1LKJA 2L2EA 5DKQA 2K2AA 1FF1A 1UUSA 1K9UA 1RROA 1M63B 2FCDA 5HYDA 3QRXA 4N1GA 1SRAA 1DTLA 2LM5A 2WCFA 4PE4A 4PHMA 2MBXA 2KI4B 5ER4X 3ZNIA 1K94A 1XFZO 1XK4A 1NYAA 3FS7A 4ZCUA 2Y1MA 1B4CA 1DGUA 4NDCA 1KK8B 1EH2A 4GFTA 2O5GA 2TN4A 3I5GC 2COLB 4YGDB 2BBMA 2L0PA 1A03A 4MLWA 4MN0A 1SY9A 3VRNA 2ZN8A 5G08A 2JT8A 1SBJA 2EGDA 2KYFA 3BUMB 1XO5A 2LP3A 2LLUA 3IQQA 4JQ0D 3SG4A 1EG3A 3ICBA 3OB2B 4OV2A 3AKBA 2FJUB 2LAPA 2CNPA 4WRIA 1KSMA 1XFVO 3SG7A 1DJHA 2EC6C 2WORA 1C7VA 1PRWA 3JVTC 1NSHA 2K7OA 2WC8A 2NCOA 3GK1A 2LHIA 1TNPA 3EKHA 1OOJA 4TNCA 1DVIA 3LLEA 2FOTA 1B9AA 1JBAA 3PATA 1J55A 4MRXA 3BOWB 3CWGA 4PALA 1JSAA 3OB1B 2JC2A 1S26D 4OVNF 2JXCA 1YR5A 5KU1A 1EXRA 3AAJA 1GJYA 1LVCD 5AERA 1CFPA 1TNWA 1F54A 5HKYA 2BCAA 1WY9A 1M45A 1C07A 2KOTA 2PRUA 1K93D 1CLLA 1F71A 3CR5X 3KO0A 2Y4QA 3NSIA 4ORBB 1BG1A 1H4BA 3A8RA 5I2LA 2NXQA 2LCPA 1AJ5A 1RK9A 1NCZA 1JWDA 2MHHA 1L7ZA 3FWCA 1F4OA 3O6BA 2Q4UA 1DJIA 4YGEB 3I5GB 1TNXA 2BKIB 1IH0A 4GNKB 1QASA 3DVKA 3IQOA 1KCYA 4PCWA 4ICBA 3SG6A 4WQ2A 2OS8B 3BUNB 1IRJA 2H2KA 3HCMA 1A75B 1V1FA 2JZIA 4I5NB 3GOFA 1BOCA 5I8NA 4DCKA 4AQIA 1SL7A 1WLMA 3EVUA 3EVRA 3CGAA 1SL9A 2LMTA 2LVIA 1SPYA 1TTXA 3KPXA 1QIVA 3DVEA 1ODBA 3BOWA 2Q91A 4QJ4B 1WRKA 2F3ZA 1JFKA 1OZSA 2CXJA 4ZCVA 1CMFA 1K90D 2E30A 1SL8A 1TN4A 1XFWO 2EC6B 2I18A 3JVTB 1KK7Y 1CMGA 2I94A 3DVMA 5AEQA 3NSOA 4HRGA 4N1FA 4HRHA 4GPLB 2BECA 1PULA 3IF7A 2LVVA 3BXKA 2H61C 2JTZA 1G33A 1NX2A 2LUCA 3BUWB 2ZRSA 4HSZA 5JOLA 5IBWA 2JXLA 3LCPC 1Q80A 1DJZA 2KSPA 2KFFA 1YRTB 2NLNA 1LA0A 1UURA 5CPVA 1OE9B 3BUOB 2MJWB 4MVFA 1MXLC 1N65A 4C0JA 4YRUA 4AQJA 4PE1A 1AJ4A 1KK7Z 2ZRTA 3BUXB 2V53A 2M0RA 3I5IC 2ZNDA 3OX6A 1UP5A 1A75A 2JPTA 1ALVA 1S36A 1SK6D 1ZOTB 2KYCA 1ZACA 3PSRA 2KNEA 4M2QA 2KBIA 1YX8A 4C0KA 1BR1B 1OMRA 1UWOA 2CBLA 2DOQA 3RM1A 5B8IB 1MUXA 1BMOA 2KI6C 1S5GY 2A4JA 1S6IA 1B1GA 1IQ5A 2R2IA 3AAKA 5J3XA 3TDZA 4NQGA 3LK0A 4I5LB 4DUQA 4MZKA 1IG5A 1CNPA 1SR6C 1GQMA 2OS8C 1PSRA 4PHJA 1RTP1 1L2OC 3GK4X 4GBAA 2O60A 1CDPA 1QTXA 1SCMC 2MA2A 4CFQA 1WLZA 4NDDA 5D69A 1TRFA 1BLQA 4F0ZB 1QS7A 4GGFC 3TDUA 3BYAA 4I5JA 2JT0A 3DVJA 1S5GZ 1IWQA 1AK8A 4MEWA 1CB1A 1NPQA 1DGVA 1Y6WA 1DMOA 5I2OA 2E6WA 3O78A 4ETOA 1FBVA 2MLFC 3O2PA 4I5KA 1MQ1A 3E3RA 1QX2A 1XFXO 4MRYA 2KBMA 3CR2A 2ZKMX 4P5OE 1Y1AA 4DRWA 2CCMA 1R6PA 1U5IB 2NZ0A 5AANA 5D7FA 3SIBA 4U8DA 2PSRA 2JT3A 4BY5A 1BF5A 1K9KA 2M8UA 4DIRA 1DJWA 1J7RA 3I5IB 5F6TA 2D8NA 2KQ6A 1X02A 3CR4X 3PALA 1CFDA 2B1UA 3K21A 2L98A 2KFHA 2K7CA 2KGBC 1PK0D 1CFCA 1KFXL 1CDLA 2LLTA 1KFXS 3CTNA 5CSNA 1B8CA 1UHKA 1MXEA 2BCBA 5AFPA 2LP2A 4P2YB 1A2XA 5KTYA 2LHLA 2LVKA 5CSIA 4IL1A 1XVJA 4BY4A 1IKUA 2JWWA 2K2FA 4OCIA 2LLSA 3PFVA 1SR6B 4GGNA 2H61A 2OPOA 4YGCB 2KAVA 2PASA 4CLNA 2ZNEA 2KAYA 1M46A 1L2OB 1J1DA 1CLMA 1SCMB 1KQMB 4MZJA 3KHEA 2LMUA 1CTRA 1OZOA 1U5IA 1KSOA 2KDHA 2PMYA 1NX0A 2AAOA 1H8BA 1FPWA 1DF0B 1MF8B 3WNXB 1CKKA 2LE9B 2JU0A 1QJTA 1OMVA 3A4UB 4JWQA 1UHIA 1DJYA 2I7AA 1J7QA 1JUOA 3C1VA 4CPVA 1KWOC 4PE7A 1D1OA 2WCBA 4JPZB 1KFUL 1QX7A 1YTZC 1KFUS 1RJVA 2HETA 2I2RE 1UHNA 3EK7A 1AVSA 1ZUZA 2FCEA 2WOSA 2KI6D 1XA5A 3NSKA 1F70A 2L5XB 4Q04A 2G9BA 1Y0VH 1AHRA 5AXIA 1OQPA 1S6JA 2L4IA 1IGVA 3FWBA 1YX7A 2Y1NA 4D1EA 3I5FC 2QPTA 1IQ3A 1SYMA 1BT6A 1PSBA 3PLFB 4PHKA 5GQQC 1TNQA 4USLA 3HX4A 3SG2A 1TOPA 4YBHB 1CM1A 1N2DA 1Y1UA 1YUTA 1ALWA 2LVJA 4GAOA 4WQ3A 3WHTB 2K0JA 2LMVA 3TDIA 5JJGA 2NCPA 1FI5A 2ZN9A 4QJ3B 4XJKB 2VRGA 1HT9A 3OHMB 3PN7C 1NWDA 2KAXA 5DKRA 2L50A 2M7NA 4GGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  2G2B A;  3JTD C;  1JC2 A;  1IJ5 A;  1QIW A;  2MAZ A;  4MZL A;  1YRU B;  5HKZ A;  1YVL A;  5ER5 A;  3VRR A;  1F4Q A;  3CLN A;  1M31 A;  1BR4 B;  3D10 A;  1ZMZ A;  1DJX A;  4MSP A;  1REC A;  1CM4 A;  2IS9 A;  1TCF A;  1V1G A;  1LIN A;  1K95 A;  4GUK A;  3CS1 A;  3DD4 A;  1JFJ A;  1WRL A;  1QAT A;  3WHU B;  1KQM C;  1SKT A;  2F2P A;  4C0L A;  3KF9 A;  1AUI B;  1PAL A;  2K61 A;  3LL8 B;  4ORA B;  1EL4 A;  1J7O A;  3EK4 A;  1QV1 A;  1TCO B;  1GGW A;  1B47 A;  1S3P A;  3O4Y A;  5I2Q A;  3I5H B;  3TS5 C;  1KWO B;  2M97 A;  1LXF C;  4E68 A;  1QV0 A;  5HLV A;  1FI6 A;  1WDC C;  4QJ5 B;  2LAN A;  2GGZ A;  1LA3 A;  2MRD A;  1CDN A;  4OR9 B;  3EK8 A;  1CDM A;  4OKH A;  1NCX A;  1W7J B;  3D0Y B;  3KEV A;  5BPJ A;  1SCV A;  2EHB A;  4XJK A;  3VRP A;  2M1K B;  3CZT X;  4PHN A;  3TUY B;  3M0W A;  1BOD A;  1OSA A;  3I5F B;  4PDZ A;  4MBE A;  1E8A A;  1YUR A;  2HQW A;  1XK4 C;  3SG3 A;  3TZ1 A;  1NUB A;  2BE6 A;  1SMG A;  2Y5I A;  2K7D A;  2F33 A;  3NSL A;  3PM8 A;  1MHO A;  5TNC A;  3WXA A;  4N5X A;  2HQ8 A;  3OX5 A;  1NX3 A;  1UHH A;  2KHN A;  1RFJ A;  2LNK A;  2BL0 C;  2MLE C;  1DT7 B;  2OTG C;  4M2P A;  4CFR A;  2KFG A;  3SJS A;  1QX5 B;  5K89 A;  4NDB A;  1SW8 A;  3H4S E;  4YI8 A;  2LC5 A;  1K96 A;  2JTT A;  3PN7 B;  4A4C A;  2BCX A;  1JF2 A;  1C7W A;  2BKH B;  1QVI Y;  3SIA A;  3VRO A;  2HPS A;  3JTD B;  2L4H A;  4L9M A;  1K8U A;  3VRQ A;  2KQY A;  1R2U A;  1M39 A;  3DF0 B;  2RGI A;  1VRK A;  2M29 A;  3NXA A;  2AUC A;  2F3Y A;  1B8L A;  3GK2 A;  3MSE B;  4YGB B;  1NIW A;  2JNX A;  2F8P A;  1IJ6 A;  2ZFD A;  1BJF A;  2F2O A;  1GGZ A;  1A29 A;  1S1E A;  1NCY A;  4M2O A;  1A4P A;  2SAS A;  5KSZ A;  1J7P A;  1EG4 A;  1N0Y A;  3D0Y A;  1OMD A;  1EJ3 A;  2AMI A;  3EKJ A;  1CFF A;  1XFU O;  1TIZ A;  1NP8 A;  2M9G A;  4A4B A;  1J1E A;  1QVI Z;  5CSJ A;  2KI4 C;  2K8M B;  2PVB A;  3AKA A;  2LUX A;  4AOM A;  3TS5 B;  1FW4 A;  1KK8 C;  1MR8 A;  1B8R A;  4CID A;  4YI9 A;  1WDC B;  1F55 A;  3I5H C;  2ISD A;  3F45 A;  3EVV A;  4XYN A;  3LK1 A;  3RLZ A;  2HF5 A;  1AP4 A;  1S6C A;  5FYX A;  1Y1X A;  2WCE A;  1QLS A;  1BU3 A;  2K7B A;  4R1E A;  4YGA A;  3OP0 A;  1XFY O;  1RWY A;  2M7L A;  2CTN A;  4FQO A;  1CLB A;  1YVH A;  3TUY C;  5HLO A;  4ORC B;  1F8H A;  1KQV A;  1DJG A;  2JUL A;  1K9P A;  2WND A;  3DF0 A;  1B7T Y;  2BL0 B;  2JOJ A;  2LV7 A;  2OTG B;  4PE0 A;  3VGO A;  4FTG A;  5HKW A;  2GGM A;  2M1U A;  2M3W A;  1QLK A;  2CT9 A;  1PVA A;  1WRZ A;  1NX1 A;  1XYD A;  1MWN A;  1SNL A;  2BBN A;  4DS7 A;  1G8I A;  2L51 A;  4UPG A;  2GV5 A;  2KGR A;  1YUS A;  2BE4 A;  3SG5 A;  2JQ6 A;  1ZFS A;  5DKN A;  1HQV A;  2M49 B;  2PAL A;  2JNF A;  2JRF A;  1DF0 A;  1G4Y R;  3ZWH A;  2SCP A;  3BQ3 A;  1W7I B;  1PVB A;  4HRE E;  1JF0 A;  1K2H A;  5PAL A;  5CSF A;  1B7T Z;  2P6B B;  2QAC A;  3FIA A;  1QXP A;  1UHJ A;  1LKJ A;  2L2E A;  5DKQ A;  2K2A A;  1FF1 A;  1UUS A;  1K9U A;  1RRO A;  1M63 B;  2FCD A;  5HYD A;  3QRX A;  4N1G A;  1SRA A;  1DTL A;  2LM5 A;  2WCF A;  4PE4 A;  4PHM A;  2MBX A;  2KI4 B;  5ER4 X;  3ZNI A;  1K94 A;  1XFZ O;  1XK4 A;  1NYA A;  3FS7 A;  4ZCU A;  2Y1M A;  1B4C A;  1DGU A;  4NDC A;  1KK8 B;  1EH2 A;  4GFT A;  2O5G A;  2TN4 A;  3I5G C;  2COL B;  4YGD B;  2BBM A;  2L0P A;  1A03 A;  4MLW A;  4MN0 A;  1SY9 A;  3VRN A;  2ZN8 A;  5G08 A;  2JT8 A;  1SBJ A;  2EGD A;  2KYF A;  3BUM B;  1XO5 A;  2LP3 A;  2LLU A;  3IQQ A;  4JQ0 D;  3SG4 A;  1EG3 A;  3ICB A;  3OB2 B;  4OV2 A;  3AKB A;  2FJU B;  2LAP A;  2CNP A;  4WRI A;  1KSM A;  1XFV O;  3SG7 A;  1DJH A;  2EC6 C;  2WOR A;  1C7V A;  1PRW A;  3JVT C;  1NSH A;  2K7O A;  2WC8 A;  2NCO A;  3GK1 A;  2LHI A;  1TNP A;  3EKH A;  1OOJ A;  4TNC A;  1DVI A;  3LLE A;  2FOT A;  1B9A A;  1JBA A;  3PAT A;  1J55 A;  4MRX A;  3BOW B;  3CWG A;  4PAL A;  1JSA A;  3OB1 B;  2JC2 A;  1S26 D;  4OVN F;  2JXC A;  1YR5 A;  5KU1 A;  1EXR A;  3AAJ A;  1GJY A;  1LVC D;  5AER A;  1CFP A;  1TNW A;  1F54 A;  5HKY A;  2BCA A;  1WY9 A;  1M45 A;  1C07 A;  2KOT A;  2PRU A;  1K93 D;  1CLL A;  1F71 A;  3CR5 X;  3KO0 A;  2Y4Q A;  3NSI A;  4ORB B;  1BG1 A;  1H4B A;  3A8R A;  5I2L A;  2NXQ A;  2LCP A;  1AJ5 A;  1RK9 A;  1NCZ A;  1JWD A;  2MHH A;  1L7Z A;  3FWC A;  1F4O A;  3O6B A;  2Q4U A;  1DJI A;  4YGE B;  3I5G B;  1TNX A;  2BKI B;  1IH0 A;  4GNK B;  1QAS A;  3DVK A;  3IQO A;  1KCY A;  4PCW A;  4ICB A;  3SG6 A;  4WQ2 A;  2OS8 B;  3BUN B;  1IRJ A;  2H2K A;  3HCM A;  1A75 B;  1V1F A;  2JZI A;  4I5N B;  3GOF A;  1BOC A;  5I8N A;  4DCK A;  4AQI A;  1SL7 A;  1WLM A;  3EVU A;  3EVR A;  3CGA A;  1SL9 A;  2LMT A;  2LVI A;  1SPY A;  1TTX A;  3KPX A;  1QIV A;  3DVE A;  1ODB A;  3BOW A;  2Q91 A;  4QJ4 B;  1WRK A;  2F3Z A;  1JFK A;  1OZS A;  2CXJ A;  4ZCV A;  1CMF A;  1K90 D;  2E30 A;  1SL8 A;  1TN4 A;  1XFW O;  2EC6 B;  2I18 A;  3JVT B;  1KK7 Y;  1CMG A;  2I94 A;  3DVM A;  5AEQ A;  3NSO A;  4HRG A;  4N1F A;  4HRH A;  4GPL B;  2BEC A;  1PUL A;  3IF7 A;  2LVV A;  3BXK A;  2H61 C;  2JTZ A;  1G33 A;  1NX2 A;  2LUC A;  3BUW B;  2ZRS A;  4HSZ A;  5JOL A;  5IBW A;  2JXL A;  3LCP C;  1Q80 A;  1DJZ A;  2KSP A;  2KFF A;  1YRT B;  2NLN A;  1LA0 A;  1UUR A;  5CPV A;  1OE9 B;  3BUO B;  2MJW B;  4MVF A;  1MXL C;  1N65 A;  4C0J A;  4YRU A;  4AQJ A;  4PE1 A;  1AJ4 A;  1KK7 Z;  2ZRT A;  3BUX B;  2V53 A;  2M0R A;  3I5I C;  2ZND A;  3OX6 A;  1UP5 A;  1A75 A;  2JPT A;  1ALV A;  1S36 A;  1SK6 D;  1ZOT B;  2KYC A;  1ZAC A;  3PSR A;  2KNE A;  4M2Q A;  2KBI A;  1YX8 A;  4C0K A;  1BR1 B;  1OMR A;  1UWO A;  2CBL A;  2DOQ A;  3RM1 A;  5B8I B;  1MUX A;  1BMO A;  2KI6 C;  1S5G Y;  2A4J A;  1S6I A;  1B1G A;  1IQ5 A;  2R2I A;  3AAK A;  5J3X A;  3TDZ A;  4NQG A;  3LK0 A;  4I5L B;  4DUQ A;  4MZK A;  1IG5 A;  1CNP A;  1SR6 C;  1GQM A;  2OS8 C;  1PSR A;  4PHJ A;  1RTP 1;  1L2O C;  3GK4 X;  4GBA A;  2O60 A;  1CDP A;  1QTX A;  1SCM C;  2MA2 A;  4CFQ A;  1WLZ A;  4NDD A;  5D69 A;  1TRF A;  1BLQ A;  4F0Z B;  1QS7 A;  4GGF C;  3TDU A;  3BYA A;  4I5J A;  2JT0 A;  3DVJ A;  1S5G Z;  1IWQ A;  1AK8 A;  4MEW A;  1CB1 A;  1NPQ A;  1DGV A;  1Y6W A;  1DMO A;  5I2O A;  2E6W A;  3O78 A;  4ETO A;  1FBV A;  2MLF C;  3O2P A;  4I5K A;  1MQ1 A;  3E3R A;  1QX2 A;  1XFX O;  4MRY A;  2KBM A;  3CR2 A;  2ZKM X;  4P5O E;  1Y1A A;  4DRW A;  2CCM A;  1R6P A;  1U5I B;  2NZ0 A;  5AAN A;  5D7F A;  3SIB A;  4U8D A;  2PSR A;  2JT3 A;  4BY5 A;  1BF5 A;  1K9K A;  2M8U A;  4DIR A;  1DJW A;  1J7R A;  3I5I B;  5F6T A;  2D8N A;  2KQ6 A;  1X02 A;  3CR4 X;  3PAL A;  1CFD A;  2B1U A;  3K21 A;  2L98 A;  2KFH A;  2K7C A;  2KGB C;  1PK0 D;  1CFC A;  1KFX L;  1CDL A;  2LLT A;  1KFX S;  3CTN A;  5CSN A;  1B8C A;  1UHK A;  1MXE A;  2BCB A;  5AFP A;  2LP2 A;  4P2Y B;  1A2X A;  5KTY A;  2LHL A;  2LVK A;  5CSI A;  4IL1 A;  1XVJ A;  4BY4 A;  1IKU A;  2JWW A;  2K2F A;  4OCI A;  2LLS A;  3PFV A;  1SR6 B;  4GGN A;  2H61 A;  2OPO A;  4YGC B;  2KAV A;  2PAS A;  4CLN A;  2ZNE A;  2KAY A;  1M46 A;  1L2O B;  1J1D A;  1CLM A;  1SCM B;  1KQM B;  4MZJ A;  3KHE A;  2LMU A;  1CTR A;  1OZO A;  1U5I A;  1KSO A;  2KDH A;  2PMY A;  1NX0 A;  2AAO A;  1H8B A;  1FPW A;  1DF0 B;  1MF8 B;  3WNX B;  1CKK A;  2LE9 B;  2JU0 A;  1QJT A;  1OMV A;  3A4U B;  4JWQ A;  1UHI A;  1DJY A;  2I7A A;  1J7Q A;  1JUO A;  3C1V A;  4CPV A;  1KWO C;  4PE7 A;  1D1O A;  2WCB A;  4JPZ B;  1KFU L;  1QX7 A;  1YTZ C;  1KFU S;  1RJV A;  2HET A;  2I2R E;  1UHN A;  3EK7 A;  1AVS A;  1ZUZ A;  2FCE A;  2WOS A;  2KI6 D;  1XA5 A;  3NSK A;  1F70 A;  2L5X B;  4Q04 A;  2G9B A;  1Y0V H;  1AHR A;  5AXI A;  1OQP A;  1S6J A;  2L4I A;  1IGV A;  3FWB A;  1YX7 A;  2Y1N A;  4D1E A;  3I5F C;  2QPT A;  1IQ3 A;  1SYM A;  1BT6 A;  1PSB A;  3PLF B;  4PHK A;  5GQQ C;  1TNQ A;  4USL A;  3HX4 A;  3SG2 A;  1TOP A;  4YBH B;  1CM1 A;  1N2D A;  1Y1U A;  1YUT A;  1ALW A;  2LVJ A;  4GAO A;  4WQ3 A;  3WHT B;  2K0J A;  2LMV A;  3TDI A;  5JJG A;  2NCP A;  1FI5 A;  2ZN9 A;  4QJ3 B;  4XJK B;  2VRG A;  1HT9 A;  3OHM B;  3PN7 C;  1NWD A;  2KAX A;  5DKR A;  2L50 A;  2M7N A;  4GGF A; 
#chains in the Genus database with same CATH topology
 1YUU A;  2G2B A;  3JTD C;  3SS4 A;  1JC2 A;  1IJ5 A;  1QIW A;  2MAZ A;  4MZL A;  1YRU B;  3D77 A;  5HKZ A;  1YVL A;  5ER5 A;  3VRR A;  1F4Q A;  3CLN A;  1M31 A;  1BR4 B;  2QEB A;  3D10 A;  1ZMZ A;  1DJX A;  4MSP A;  1REC A;  1CM4 A;  2IS9 A;  1TCF A;  1V1G A;  1LIN A;  1K95 A;  4GUK A;  3CS1 A;  3DD4 A;  1JFJ A;  1WRL A;  1QAT A;  3WHU B;  1KQM C;  1SKT A;  2F2P A;  4C0L A;  3KF9 A;  3S0F A;  1AUI B;  1LS8 A;  1PAL A;  2K61 A;  3LL8 B;  4ORA B;  1EL4 A;  1J7O A;  3K1E A;  3EK4 A;  1QV1 A;  1TCO B;  1GGW A;  1GM0 A;  1B47 A;  1S3P A;  3O4Y A;  5I2Q A;  3I5H B;  3TS5 C;  1KWO B;  2M97 A;  1LXF C;  4E68 A;  1QV0 A;  5HLV A;  1FI6 A;  1WDC C;  4QJ5 B;  2LAN A;  2GGZ A;  2WC5 A;  1LA3 A;  2MRD A;  1CDN A;  4OR9 B;  3EK8 A;  1CDM A;  3CZ1 A;  4OKH A;  1NCX A;  1W7J B;  3D0Y B;  3KEV A;  5BPJ A;  1SCV A;  2EHB A;  4XJK A;  3VRP A;  3SS3 A;  4IJ7 A;  3R1O A;  2M1K B;  3CZT X;  4PHN A;  3TUY B;  3M0W A;  1C3Y A;  1BOD A;  1OSA A;  3I5F B;  4PDZ A;  4MBE A;  1E8A A;  1YUR A;  2HQW A;  1XK4 C;  3SG3 A;  3TZ1 A;  1NUB A;  2BE6 A;  1SMG A;  3R1V A;  2Y5I A;  2K7D A;  2F33 A;  3NSL A;  3PM8 A;  1MHO A;  5TNC A;  3WXA A;  4N5X A;  2HQ8 A;  3OX5 A;  1NX3 A;  1UHH A;  2KHN A;  1RFJ A;  2LNK A;  2BL0 C;  2MLE C;  1DT7 B;  2OTG C;  3D75 A;  4M2P A;  4CFR A;  2KFG A;  3SJS A;  1QX5 B;  5K89 A;  4NDB A;  1SW8 A;  3H4S E;  4YI8 A;  2LC5 A;  1K96 A;  2JTT A;  3PN7 B;  4A4C A;  2BCX A;  1JF2 A;  1C7W A;  2BKH B;  3CAB A;  1QVI Y;  1TUJ A;  3SIA A;  3VRO A;  2HPS A;  3JTD B;  2L4H A;  4L9M A;  1K8U A;  3VRQ A;  2KQY A;  2BNX A;  3EG5 B;  1R2U A;  1M39 A;  2KLD A;  3DF0 B;  2RGI A;  1VRK A;  2M29 A;  3CDN A;  3NXA A;  2AUC A;  2F3Y A;  1B8L A;  3GK2 A;  3MSE B;  4YGB B;  1NIW A;  2JNX A;  2F8P A;  1IJ6 A;  2ZFD A;  1BJF A;  2F2O A;  1GGZ A;  1A29 A;  1S1E A;  1NCY A;  2L2C A;  4M2O A;  1A4P A;  2SAS A;  5KSZ A;  1J7P A;  1EG4 A;  1N0Y A;  3D0Y A;  5FI6 A;  1OMD A;  1EJ3 A;  2AMI A;  3EKJ A;  1CFF A;  1XFU O;  1TIZ A;  1NP8 A;  2M9G A;  4A4B A;  1J1E A;  1QVI Z;  5CSJ A;  2KI4 C;  2K8M B;  3OGN A;  2PVB A;  3AKA A;  2LUX A;  4JD9 A;  4KYN A;  3TS5 B;  4AOM A;  1FW4 A;  1KK8 C;  1MR8 A;  1B8R A;  4CID A;  1OOH A;  4YI9 A;  1WDC B;  1F55 A;  3I5H C;  2ISD A;  3F45 A;  3EVV A;  4XYN A;  3LK1 A;  2K60 A;  3RLZ A;  2HF5 A;  4INW A;  1AP4 A;  1S6C A;  5FYX A;  1Y1X A;  2WCE A;  1QLS A;  1BU3 A;  2K7B A;  4OZD A;  1DEL A;  4R1E A;  4YGA A;  3OP0 A;  1XFY O;  3BFA A;  1RWY A;  3CYZ A;  5D3O A;  3BFB A;  2M7L A;  2CTN A;  3FE8 A;  4FQO A;  1CLB A;  1YVH A;  3TUY C;  5HLO A;  4ORC B;  1F8H A;  1KQV A;  1DJG A;  3FE9 A;  2JUL A;  1K9P A;  2WND A;  3DF0 A;  1B7T Y;  2BL0 B;  2JOJ A;  2LV7 A;  2OTG B;  4PE0 A;  3NHI A;  3VGO A;  4FTG A;  5HKW A;  2GGM A;  2QDI A;  3S0G A;  2M1U A;  2M3W A;  1QLK A;  2CT9 A;  1PVA A;  1WRZ A;  1NX1 A;  1XYD A;  1MWN A;  1SNL A;  2BBN A;  4DS7 A;  1G8I A;  2L51 A;  4UPG A;  2GV5 A;  3PM2 A;  2KGR A;  1YUS A;  2BE4 A;  2P71 A;  3SG5 A;  2JQ6 A;  1ZFS A;  5DKN A;  1HQV A;  2M49 B;  2PAL A;  3PJI A;  2JNF A;  2JRF A;  1DF0 A;  1G4Y R;  3ZWH A;  2SCP A;  3BQ3 A;  1W7I B;  1PVB A;  4HRE E;  1DEK A;  1JF0 A;  1K2H A;  5EL2 A;  5PAL A;  5CSF A;  1B7T Z;  2P6B B;  2QAC A;  3FIA A;  1QXP A;  1UHJ A;  1LKJ A;  2L2E A;  5DKQ A;  2K2A A;  1FF1 A;  1UUS A;  1K9U A;  1RRO A;  1M63 B;  2FCD A;  5HYD A;  3QRX A;  4N1G A;  1SRA A;  1DTL A;  2LM5 A;  2WCF A;  4PE4 A;  4PHM A;  2MBX A;  2KI4 B;  5ER4 X;  3ZNI A;  1K94 A;  1XFZ O;  1XK4 A;  1NYA A;  3FS7 A;  4ZCU A;  2Y1M A;  5FI2 A;  1DGU A;  4NDC A;  1KK8 B;  1B4C A;  1EH2 A;  3L4L A;  4GFT A;  2O5G A;  2TN4 A;  3I5G C;  2COL B;  4YGD B;  3D78 A;  3UO9 A;  2BBM A;  2L0P A;  1A03 A;  4MLW A;  4MN0 A;  1Z4H A;  1SY9 A;  3VRN A;  2ZN8 A;  5G08 A;  2JT8 A;  1SBJ A;  2EGD A;  2KYF A;  3BUM B;  1XO5 A;  1XFR A;  2LLU A;  2LP3 A;  3B6X A;  3IQQ A;  1EG3 A;  3ICB A;  3L4A A;  3OB2 B;  4JQ0 D;  3SG4 A;  4OV2 A;  3AKB A;  2FJU B;  2LAP A;  2CNP A;  4WRI A;  1KSM A;  1XFV O;  3SG7 A;  1DJH A;  2EC6 C;  2WOR A;  1C7V A;  1PRW A;  1TUZ A;  3JVT C;  1NSH A;  3S0E A;  2K7O A;  2WC8 A;  3OBV A;  2NCO A;  3D76 A;  3GK1 A;  2LHI A;  3N7H A;  1TNP A;  3EKH A;  1OOJ A;  4TNC A;  1DVI A;  1OOF A;  3LLE A;  2FOT A;  1B9A A;  1JBA A;  3PAT A;  1J55 A;  4MRX A;  3BOW B;  3CWG A;  4PAL A;  1JSA A;  3OB1 B;  2JC2 A;  1S26 D;  4OVN F;  2JXC A;  1YR5 A;  5KU1 A;  1EXR A;  3AAJ A;  1GJY A;  5JJG A;  1LVC D;  3SS5 A;  5AER A;  1CFP A;  1TNW A;  1F54 A;  5HKY A;  2BCA A;  1WY9 A;  1M45 A;  1C07 A;  2KOT A;  2PRU A;  1K93 D;  1CLL A;  1F71 A;  3CR5 X;  3KO0 A;  2Y4Q A;  3NSI A;  4ORB B;  1BG1 A;  1H4B A;  3A8R A;  5I2L A;  2NXQ A;  2LCP A;  1AJ5 A;  1RK9 A;  1NCZ A;  1JWD A;  1OOI X;  2MHH A;  4F7F A;  1L7Z A;  3FWC A;  1F4O A;  3O6B A;  2Q4U A;  1DJI A;  4YGE B;  3I5G B;  1TNX A;  2BKI B;  1IH0 A;  4GNK B;  1QAS A;  3DVK A;  3IQO A;  1KCY A;  4PCW A;  3D73 A;  3DYE A;  4ICB A;  3SG6 A;  4WQ2 A;  2OS8 B;  3BUN B;  1IRJ A;  1Z2C B;  2H2K A;  1A75 B;  1V1F A;  2JZI A;  3HCM A;  3GOF A;  4I5N B;  1BOC A;  2QEH A;  5I8N A;  4DCK A;  4AQI A;  1SL7 A;  1WLM A;  3EVU A;  3EVR A;  3CGA A;  1SL9 A;  2LMT A;  2LVI A;  1SPY A;  1TTX A;  3KPX A;  1QIV A;  3DVE A;  1ODB A;  3BOW A;  2Q91 A;  4QJ4 B;  1WRK A;  2F3Z A;  1JFK A;  1OZS A;  2CXJ A;  4ZCV A;  1CMF A;  1K90 D;  2E30 A;  1SL8 A;  1TN4 A;  1XFW O;  2EC6 B;  2I18 A;  3QME A;  3JVT B;  1KK7 Y;  1CMG A;  2I94 A;  3DVM A;  3DY9 A;  5AEQ A;  3NSO A;  4HRG A;  4N1F A;  4HRH A;  4GPL B;  2BEC A;  1PUL A;  3IF7 A;  2LVV A;  3BXK A;  2H61 C;  2JTZ A;  1ORG A;  1G33 A;  1NX2 A;  2LUC A;  3BUW B;  3Q8I A;  2ZRS A;  4HSZ A;  5JOL A;  5IBW A;  1C3Z A;  2JXL A;  5HL1 A;  2KLE A;  3LCP C;  3CZ0 A;  3L47 A;  1Q80 A;  1DJZ A;  2KSP A;  2KFF A;  1YRT B;  2WCM A;  3IVT A;  2NLN A;  1LA0 A;  1UUR A;  5CPV A;  1OE9 B;  1SSE B;  3BUO B;  2MJW B;  4MVF A;  2GTE A;  1MXL C;  1N65 A;  4INX A;  4C0J A;  4AQJ A;  4PE1 A;  4YRU A;  1AJ4 A;  1KK7 Z;  2ZRT A;  3BUX B;  2V53 A;  2M0R A;  3I5I C;  2ZND A;  3OX6 A;  1UP5 A;  1A75 A;  2JPT A;  2YGU A;  1ALV A;  1S36 A;  1SK6 D;  1ZOT B;  2KYC A;  1ZAC A;  3PSR A;  2KNE A;  3O4X A;  4M2Q A;  2KBI A;  1YX8 A;  4C0K A;  1BR1 B;  1OMR A;  1UWO A;  2CBL A;  3B86 A;  2DOQ A;  3DXL A;  3RM1 A;  5B8I B;  1MUX A;  2H8V A;  1BMO A;  2KI6 C;  1S5G Y;  2A4J A;  4JKT A;  3S0A A;  2PYQ A;  1S6I A;  1B1G A;  1IQ5 A;  2R2I A;  3AAK A;  5J3X A;  3B7A A;  3TDZ A;  4NQG A;  3LK0 A;  1OW4 A;  4I5L B;  4MZK A;  4DUQ A;  1IG5 A;  1CNP A;  1SR6 C;  3UNW A;  1GQM A;  2OS8 C;  1PSR A;  4PHJ A;  1RTP 1;  1L2O C;  3GK4 X;  4GBA A;  2O60 A;  1CDP A;  1QTX A;  1SCM C;  2MA2 A;  4CFQ A;  3BFH A;  1WLZ A;  4NDD A;  5D69 A;  1TRF A;  1BLQ A;  4F0Z B;  1QWV A;  1QS7 A;  4GGF C;  2BAP A;  3BYA A;  2KPH A;  2JT0 A;  3BJH A;  4I5J A;  3TDU A;  3DVJ A;  1S5G Z;  1IWQ A;  1AK8 A;  4MEW A;  1CB1 A;  5FI7 A;  1NPQ A;  1DGV A;  1Y6W A;  1DMO A;  5I2O A;  2E6W A;  3FE6 A;  3O78 A;  4ETO A;  1FBV A;  2MLF C;  3O2P A;  4I5K A;  1MQ1 A;  3E3R A;  1QX2 A;  1XFX O;  4MRY A;  1TWO A;  2KBM A;  3CR2 A;  2ZKM X;  4P5O E;  1Y1A A;  2WCJ A;  4DRW A;  2CCM A;  1R6P A;  1U5I B;  2NZ0 A;  5AAN A;  5D7F A;  3SIB A;  4U8D A;  2PSR A;  2JT3 A;  3R1P A;  3D74 A;  4BY5 A;  1BF5 A;  3RZS A;  1K9K A;  2M8U A;  4DIR A;  2ERB A;  2QEO A;  1DJW A;  1J7R A;  3I5I B;  5F6T A;  2D8N A;  2KQ6 A;  3V2L A;  1X02 A;  3CR4 X;  3PAL A;  1CFD A;  2B1U A;  3K21 A;  2L98 A;  2KFH A;  2K7C A;  2KGB C;  1PK0 D;  1CFC A;  1KFX L;  2WCL A;  1CDL A;  2LLT A;  1KFX S;  3CTN A;  5CSN A;  1B8C A;  1UHK A;  1MXE A;  2BCB A;  5AFP A;  2LP2 A;  4P2Y B;  1A2X A;  5KTY A;  2LHL A;  2LVK A;  5CSI A;  4IL1 A;  1XVJ A;  4BY4 A;  1IKU A;  2JWW A;  2P70 A;  2K2F A;  4OCI A;  2PQL A;  2LLS A;  3PFV A;  1SR6 B;  4GGN A;  2H61 A;  5DIC A;  2OPO A;  4YGC B;  2KAV A;  2PAS A;  1W9Z A;  4CLN A;  2ZNE A;  2KAY A;  1M46 A;  1L2O B;  1J1D A;  1CLM A;  3S0B A;  1SCM B;  1KQM B;  3S0D A;  4MZJ A;  3KHE A;  1P28 A;  2LMU A;  1CTR A;  1OZO A;  1U5I A;  1KSO A;  2KDH A;  2PMY A;  1NX0 A;  2AAO A;  1OOG A;  2WC6 A;  3NHT A;  1H8B A;  1FPW A;  1DF0 B;  1MF8 B;  3WNX B;  1CKK A;  2LE9 B;  3R72 A;  2JU0 A;  1QJT A;  1DC1 A;  2L5Y A;  1OMV A;  3A4U B;  1IIO A;  4JWQ A;  1UHI A;  3VB1 A;  1DJY A;  2I7A A;  3DZT A;  1J7Q A;  5I94 A;  1JUO A;  3C1V A;  4CPV A;  1KWO C;  4PE7 A;  1D1O A;  2WCB A;  4JPZ B;  2WCH A;  1KFU L;  1QX7 A;  1YTZ C;  4PT1 A;  1KFU S;  1RJV A;  2HET A;  1DQE A;  2I2R E;  1UHN A;  3EK7 A;  1AVS A;  1ZUZ A;  2FCE A;  2FJY A;  2WOS A;  3B87 A;  2KI6 D;  1XA5 A;  3NSK A;  1F70 A;  3CZ2 A;  2L5X B;  4Q04 A;  2G9B A;  1Y0V H;  1AHR A;  5AXI A;  1OQP A;  1S6J A;  2L4I A;  1IGV A;  3FWB A;  1YX7 A;  2Y1N A;  4D1E A;  3I5F C;  2QPT A;  1IQ3 A;  1SYM A;  1BT6 A;  1PSB A;  3PLF B;  4PHK A;  5GQQ C;  1TNQ A;  4FQT A;  3HX4 A;  4USL A;  3NGV A;  3SG2 A;  1TOP A;  4YBH B;  1YUT A;  1CM1 A;  1N2D A;  1Y1U A;  1ALW A;  2JPO A;  2LVJ A;  3B88 A;  4GAO A;  2K0J A;  2LMV A;  4WQ3 A;  3TDI A;  1T14 A;  2QEV A;  3WHT B;  2NCP A;  1FI5 A;  2ZN9 A;  4QJ3 B;  4XJK B;  2VRG A;  1HT9 A;  3OHM B;  3PN7 C;  1NWD A;  2KAX A;  5DKR A;  2L50 A;  2WCK A;  2M7N A;  4GGF A; 
#chains in the Genus database with same CATH homology
 1YUU A;  2G2B A;  3JTD C;  1JC2 A;  1IJ5 A;  1QIW A;  2MAZ A;  4MZL A;  1YRU B;  5HKZ A;  1YVL A;  5ER5 A;  3VRR A;  1F4Q A;  3CLN A;  1M31 A;  1BR4 B;  3D10 A;  1ZMZ A;  1DJX A;  4MSP A;  1REC A;  1CM4 A;  2IS9 A;  1TCF A;  1V1G A;  1LIN A;  1K95 A;  4GUK A;  3CS1 A;  3DD4 A;  1JFJ A;  1WRL A;  1QAT A;  3WHU B;  1KQM C;  1SKT A;  2F2P A;  4C0L A;  3KF9 A;  1AUI B;  1PAL A;  2K61 A;  3LL8 B;  4ORA B;  1EL4 A;  1J7O A;  3EK4 A;  1QV1 A;  1TCO B;  1GGW A;  1B47 A;  1S3P A;  3O4Y A;  5I2Q A;  3I5H B;  3TS5 C;  1KWO B;  2M97 A;  1LXF C;  4E68 A;  1QV0 A;  5HLV A;  1FI6 A;  1WDC C;  4QJ5 B;  2LAN A;  2GGZ A;  1LA3 A;  2MRD A;  1CDN A;  4OR9 B;  3EK8 A;  1CDM A;  4OKH A;  1NCX A;  1W7J B;  3D0Y B;  3KEV A;  5BPJ A;  1SCV A;  2EHB A;  4XJK A;  3VRP A;  2M1K B;  3CZT X;  4PHN A;  3TUY B;  3M0W A;  1BOD A;  1OSA A;  3I5F B;  4PDZ A;  4MBE A;  1E8A A;  1YUR A;  2HQW A;  1XK4 C;  3SG3 A;  3TZ1 A;  1NUB A;  2BE6 A;  1SMG A;  2Y5I A;  2K7D A;  2F33 A;  3NSL A;  3PM8 A;  1MHO A;  5TNC A;  3WXA A;  4N5X A;  2HQ8 A;  3OX5 A;  1NX3 A;  1UHH A;  2KHN A;  1RFJ A;  2LNK A;  2BL0 C;  2MLE C;  1DT7 B;  2OTG C;  4M2P A;  4CFR A;  2KFG A;  3SJS A;  1QX5 B;  5K89 A;  4NDB A;  1SW8 A;  3H4S E;  4YI8 A;  2LC5 A;  1K96 A;  2JTT A;  3PN7 B;  4A4C A;  2BCX A;  1JF2 A;  1C7W A;  2BKH B;  1QVI Y;  3SIA A;  3VRO A;  2HPS A;  3JTD B;  2L4H A;  4L9M A;  1K8U A;  3VRQ A;  2KQY A;  1R2U A;  1M39 A;  3DF0 B;  2RGI A;  1VRK A;  2M29 A;  3NXA A;  2AUC A;  2F3Y A;  1B8L A;  3GK2 A;  3MSE B;  4YGB B;  1NIW A;  2JNX A;  2F8P A;  1IJ6 A;  2ZFD A;  1BJF A;  2F2O A;  1GGZ A;  1A29 A;  1S1E A;  1NCY A;  4M2O A;  1A4P A;  2SAS A;  5KSZ A;  1J7P A;  1EG4 A;  1N0Y A;  3D0Y A;  1OMD A;  1EJ3 A;  2AMI A;  3EKJ A;  1CFF A;  1XFU O;  1TIZ A;  1NP8 A;  2M9G A;  4A4B A;  1J1E A;  1QVI Z;  5CSJ A;  2KI4 C;  2K8M B;  2PVB A;  3AKA A;  2LUX A;  4AOM A;  3TS5 B;  1FW4 A;  1KK8 C;  1MR8 A;  1B8R A;  4CID A;  4YI9 A;  1WDC B;  1F55 A;  3I5H C;  2ISD A;  3F45 A;  3EVV A;  4XYN A;  3LK1 A;  3RLZ A;  2HF5 A;  1AP4 A;  1S6C A;  5FYX A;  1Y1X A;  2WCE A;  1QLS A;  1BU3 A;  2K7B A;  4R1E A;  4YGA A;  3OP0 A;  1XFY O;  1RWY A;  2M7L A;  2CTN A;  4FQO A;  1CLB A;  1YVH A;  3TUY C;  5HLO A;  4ORC B;  1F8H A;  1KQV A;  1DJG A;  2JUL A;  1K9P A;  2WND A;  3DF0 A;  1B7T Y;  2BL0 B;  2JOJ A;  2LV7 A;  2OTG B;  4PE0 A;  3VGO A;  4FTG A;  5HKW A;  2GGM A;  2M1U A;  2M3W A;  1QLK A;  2CT9 A;  1PVA A;  1WRZ A;  1NX1 A;  1XYD A;  1MWN A;  1SNL A;  2BBN A;  4DS7 A;  1G8I A;  2L51 A;  4UPG A;  2GV5 A;  2KGR A;  1YUS A;  2BE4 A;  3SG5 A;  2JQ6 A;  1ZFS A;  5DKN A;  1HQV A;  2M49 B;  2PAL A;  2JNF A;  2JRF A;  1DF0 A;  1G4Y R;  3ZWH A;  2SCP A;  3BQ3 A;  1W7I B;  1PVB A;  4HRE E;  1JF0 A;  1K2H A;  5PAL A;  5CSF A;  1B7T Z;  2P6B B;  2QAC A;  3FIA A;  1QXP A;  1UHJ A;  1LKJ A;  2L2E A;  5DKQ A;  2K2A A;  1FF1 A;  1UUS A;  1K9U A;  1RRO A;  1M63 B;  2FCD A;  5HYD A;  3QRX A;  4N1G A;  1SRA A;  1DTL A;  2LM5 A;  2WCF A;  4PE4 A;  4PHM A;  2MBX A;  2KI4 B;  5ER4 X;  3ZNI A;  1K94 A;  1XFZ O;  1XK4 A;  1NYA A;  3FS7 A;  4ZCU A;  2Y1M A;  1B4C A;  1DGU A;  4NDC A;  1KK8 B;  1EH2 A;  4GFT A;  2O5G A;  2TN4 A;  3I5G C;  2COL B;  4YGD B;  2BBM A;  2L0P A;  1A03 A;  4MLW A;  4MN0 A;  1SY9 A;  3VRN A;  2ZN8 A;  5G08 A;  2JT8 A;  1SBJ A;  2EGD A;  2KYF A;  3BUM B;  1XO5 A;  2LP3 A;  2LLU A;  3IQQ A;  4JQ0 D;  3SG4 A;  1EG3 A;  3ICB A;  3OB2 B;  4OV2 A;  3AKB A;  2FJU B;  2LAP A;  2CNP A;  4WRI A;  1KSM A;  1XFV O;  3SG7 A;  1DJH A;  2EC6 C;  2WOR A;  1C7V A;  1PRW A;  3JVT C;  1NSH A;  2K7O A;  2WC8 A;  2NCO A;  3GK1 A;  2LHI A;  1TNP A;  3EKH A;  1OOJ A;  4TNC A;  1DVI A;  3LLE A;  2FOT A;  1B9A A;  1JBA A;  3PAT A;  1J55 A;  4MRX A;  3BOW B;  3CWG A;  4PAL A;  1JSA A;  3OB1 B;  2JC2 A;  1S26 D;  4OVN F;  2JXC A;  1YR5 A;  5KU1 A;  1EXR A;  3AAJ A;  1GJY A;  1LVC D;  5AER A;  1CFP A;  1TNW A;  1F54 A;  5HKY A;  2BCA A;  1WY9 A;  1M45 A;  1C07 A;  2KOT A;  2PRU A;  1K93 D;  1CLL A;  1F71 A;  3CR5 X;  3KO0 A;  2Y4Q A;  3NSI A;  4ORB B;  1BG1 A;  1H4B A;  3A8R A;  5I2L A;  2NXQ A;  2LCP A;  1AJ5 A;  1RK9 A;  1NCZ A;  1JWD A;  2MHH A;  1L7Z A;  3FWC A;  1F4O A;  3O6B A;  2Q4U A;  1DJI A;  4YGE B;  3I5G B;  1TNX A;  2BKI B;  1IH0 A;  4GNK B;  1QAS A;  3DVK A;  3IQO A;  1KCY A;  4PCW A;  4ICB A;  3SG6 A;  4WQ2 A;  2OS8 B;  3BUN B;  1IRJ A;  2H2K A;  3HCM A;  1A75 B;  1V1F A;  2JZI A;  4I5N B;  3GOF A;  1BOC A;  5I8N A;  4DCK A;  4AQI A;  1SL7 A;  1WLM A;  3EVU A;  3EVR A;  3CGA A;  1SL9 A;  2LMT A;  2LVI A;  1SPY A;  1TTX A;  3KPX A;  1QIV A;  3DVE A;  1ODB A;  3BOW A;  2Q91 A;  4QJ4 B;  1WRK A;  2F3Z A;  1JFK A;  1OZS A;  2CXJ A;  4ZCV A;  1CMF A;  1K90 D;  2E30 A;  1SL8 A;  1TN4 A;  1XFW O;  2EC6 B;  2I18 A;  3JVT B;  1KK7 Y;  1CMG A;  2I94 A;  3DVM A;  5AEQ A;  3NSO A;  4HRG A;  4N1F A;  4HRH A;  4GPL B;  2BEC A;  1PUL A;  3IF7 A;  2LVV A;  3BXK A;  2H61 C;  2JTZ A;  1G33 A;  1NX2 A;  2LUC A;  3BUW B;  2ZRS A;  4HSZ A;  5JOL A;  5IBW A;  2JXL A;  3LCP C;  1Q80 A;  1DJZ A;  2KSP A;  2KFF A;  1YRT B;  2NLN A;  1LA0 A;  1UUR A;  5CPV A;  1OE9 B;  3BUO B;  2MJW B;  4MVF A;  1MXL C;  1N65 A;  4C0J A;  4YRU A;  4AQJ A;  4PE1 A;  1AJ4 A;  1KK7 Z;  2ZRT A;  3BUX B;  2V53 A;  2M0R A;  3I5I C;  2ZND A;  3OX6 A;  1UP5 A;  1A75 A;  2JPT A;  1ALV A;  1S36 A;  1SK6 D;  1ZOT B;  2KYC A;  1ZAC A;  3PSR A;  2KNE A;  4M2Q A;  2KBI A;  1YX8 A;  4C0K A;  1BR1 B;  1OMR A;  1UWO A;  2CBL A;  2DOQ A;  3RM1 A;  5B8I B;  1MUX A;  1BMO A;  2KI6 C;  1S5G Y;  2A4J A;  1S6I A;  1B1G A;  1IQ5 A;  2R2I A;  3AAK A;  5J3X A;  3TDZ A;  4NQG A;  3LK0 A;  4I5L B;  4DUQ A;  4MZK A;  1IG5 A;  1CNP A;  1SR6 C;  1GQM A;  2OS8 C;  1PSR A;  4PHJ A;  1RTP 1;  1L2O C;  3GK4 X;  4GBA A;  2O60 A;  1CDP A;  1QTX A;  1SCM C;  2MA2 A;  4CFQ A;  1WLZ A;  4NDD A;  5D69 A;  1TRF A;  1BLQ A;  4F0Z B;  1QS7 A;  4GGF C;  3TDU A;  3BYA A;  4I5J A;  2JT0 A;  3DVJ A;  1S5G Z;  1IWQ A;  1AK8 A;  4MEW A;  1CB1 A;  1NPQ A;  1DGV A;  1Y6W A;  1DMO A;  5I2O A;  2E6W A;  3O78 A;  4ETO A;  1FBV A;  2MLF C;  3O2P A;  4I5K A;  1MQ1 A;  3E3R A;  1QX2 A;  1XFX O;  4MRY A;  2KBM A;  3CR2 A;  2ZKM X;  4P5O E;  1Y1A A;  4DRW A;  2CCM A;  1R6P A;  1U5I B;  2NZ0 A;  5AAN A;  5D7F A;  3SIB A;  4U8D A;  2PSR A;  2JT3 A;  4BY5 A;  1BF5 A;  1K9K A;  2M8U A;  4DIR A;  1DJW A;  1J7R A;  3I5I B;  5F6T A;  2D8N A;  2KQ6 A;  1X02 A;  3CR4 X;  3PAL A;  1CFD A;  2B1U A;  3K21 A;  2L98 A;  2KFH A;  2K7C A;  2KGB C;  1PK0 D;  1CFC A;  1KFX L;  1CDL A;  2LLT A;  1KFX S;  3CTN A;  5CSN A;  1B8C A;  1UHK A;  1MXE A;  2BCB A;  5AFP A;  2LP2 A;  4P2Y B;  1A2X A;  5KTY A;  2LHL A;  2LVK A;  5CSI A;  4IL1 A;  1XVJ A;  4BY4 A;  1IKU A;  2JWW A;  2K2F A;  4OCI A;  2LLS A;  3PFV A;  1SR6 B;  4GGN A;  2H61 A;  2OPO A;  4YGC B;  2KAV A;  2PAS A;  4CLN A;  2ZNE A;  2KAY A;  1M46 A;  1L2O B;  1J1D A;  1CLM A;  1SCM B;  1KQM B;  4MZJ A;  3KHE A;  2LMU A;  1CTR A;  1OZO A;  1U5I A;  1KSO A;  2KDH A;  2PMY A;  1NX0 A;  2AAO A;  1H8B A;  1FPW A;  1DF0 B;  1MF8 B;  3WNX B;  1CKK A;  2LE9 B;  2JU0 A;  1QJT A;  1OMV A;  3A4U B;  4JWQ A;  1UHI A;  1DJY A;  2I7A A;  1J7Q A;  1JUO A;  3C1V A;  4CPV A;  1KWO C;  4PE7 A;  1D1O A;  2WCB A;  4JPZ B;  1KFU L;  1QX7 A;  1YTZ C;  1KFU S;  1RJV A;  2HET A;  2I2R E;  1UHN A;  3EK7 A;  1AVS A;  1ZUZ A;  2FCE A;  2WOS A;  2KI6 D;  1XA5 A;  3NSK A;  1F70 A;  2L5X B;  4Q04 A;  2G9B A;  1Y0V H;  1AHR A;  5AXI A;  1OQP A;  1S6J A;  2L4I A;  1IGV A;  3FWB A;  1YX7 A;  2Y1N A;  4D1E A;  3I5F C;  2QPT A;  1IQ3 A;  1SYM A;  1BT6 A;  1PSB A;  3PLF B;  4PHK A;  5GQQ C;  1TNQ A;  4USL A;  3HX4 A;  3SG2 A;  1TOP A;  4YBH B;  1CM1 A;  1N2D A;  1Y1U A;  1YUT A;  1ALW A;  2LVJ A;  4GAO A;  4WQ3 A;  3WHT B;  2K0J A;  2LMV A;  3TDI A;  5JJG A;  2NCP A;  1FI5 A;  2ZN9 A;  4QJ3 B;  4XJK B;  2VRG A;  1HT9 A;  3OHM B;  3PN7 C;  1NWD A;  2KAX A;  5DKR A;  2L50 A;  2M7N A;  4GGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...