1UWOA

Calcium form of human s100b, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords S100B
publication title A novel calcium-sensitive switch revealed by the structure of human S100B in the calcium-bound form.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uwoA00
1SL7A 1J55A 4A4CA 1QVIY 2A4JA 2LP3A 1MQ1A 1YUUA 2OPOA 4CLNA 2K8MB 1ODBA 1YTZC 3WHUB 3TDUA 1ZOTB 1J7RA 3LK1A 1UHKA 1A4PA 2CBLA 4DRWA 2CCMA 2BKHB 1DVIA 1DF0A 1NX3A 2BE4A 4C0LA 1HT9A 1QVIZ 1AHRA 2KFFA 3CR4X 4ZCUA 3SG2A 2M0RA 2LMUA 2L4HA 1IWQA 2KAYA 2SCPA 4PE1A 1NIWA 2DOQA 3VGOA 4AQIA 2EGDA 2K7DA 4I5LB 5JOLA 2ZN8A 3QRXA 2HQWA 2AUCA 3BOWB 3CGAA 1JFKA 2FCDA 4PE4A 1EJ3A 3AKBA 1WRKA 4R1EA 4FTGA 4OKHA 1KFUL 1AVSA 2E6WA 1XFUO 3EVUA 2BECA 3BUWB 4WRIA 2VRGA 2BCBA 1LXFC 2F3ZA 1BT6A 4PHMA 2JXCA 2K0JA 3NSKA 1K9PA 3FIAA 3I5FB 1SYMA 1JBAA 1CDPA 1IJ6A 1OZOA 4QJ5B 1LA0A 1AJ5A 1TTXA 1SL8A 1YURA 4ORAB 4PHKA 1B9AA 4DUQA 1ZFSA 2G2BA 1B8CA 2JQ6A 1GGZA 1RWYA 1MXLC 5PALA 1K2HA 1XA5A 1ALWA 1NUBA 1PSRA 4GBAA 4HSZA 5I2QA 4HREE 4ZCVA 4NDDA 5AEQA 1RK9A 1S6IA 1K8UA 1RFJA 1LVCD 3VRQA 3I5IB 4PCWA 4HRGA 1A75B 2LHIA 2BBNA 1Y1AA 3VRPA 2WOSA 4HRHA 3I5FC 2H61C 4OR9B 1BMOA 1TNPA 1S36A 2KDHA 2B1UA 3NSIA 3VRRA 3RLZA 1CMFA 2JWWA 3O6BA 1YVLA 3PATA 2F3YA 1SR6B 4YBHB 1K9KA 2AAOA 3BUMB 2KAVA 1A29A 1R2UA 3O4YA 1WY9A 2GGMA 2KQYA 1NCYA 1DGVA 2AMIA 4IL1A 1CLMA 4YGEB 5AXIA 4PDZA 2M9GA 1PVBA 1OMRA 1UURA 3LL8B 1W7IB 3CZTX 3K21A 1RTP1 1K96A 4JWQA 1OOJA 3LLEA 4M2PA 4MZKA 1NP8A 1S3PA 2ZRTA 5F6TA 1SMGA 4CFQA 4MBEA 2EHBA 1QX7A 3AAKA 5GQQC 1SR6C 1JWDA 1CKKA 1Q80A 2BL0C 4UPGA 3ICBA 1MWNA 1QIWA 2NZ0A 1W7JB 3TDIA 2WCFA 5AFPA 3EVRA 3SG4A 4U8DA 2LVJA 1OE9B 3HX4A 1C07A 5CSFA 3WNXB 4GAOA 2KI4C 2PMYA 3IQQA 4GGNA 3BXKA 1UHNA 1M46A 2M3WA 3RM1A 1FI6A 3DF0B 2GGZA 2QPTA 2JU0A 2K2FA 2M49B 2HF5A 2F2OA 1A2XA 3BOWA 1J7QA 1KSMA 4YI9A 5K89A 1K90D 2QACA 2LVVA 1RROA 1QJTA 1E8AA 2OS8B 1H8BA 1XYDA 2L4IA 3JVTB 1B1GA 1KFUS 1SPYA 1BODA 1CFCA 2HPSA 3LK0A 3EK7A 2FJUB 4MN0A 1J1EA 1JUOA 1TOPA 1UUSA 1MHOA 2H61A 4PHNA 3WXAA 2IS9A 3EVVA 4MZLA 2G9BA 3GOFA 2LMTA 2ZKMX 1ZACA 1FW4A 1TN4A 4BY5A 3FS7A 4YRUA 1SCVA 2BCXA 5DKRA 2PRUA 3SJSA 5D7FA 5I8NA 2O60A 1B7TY 1PVAA 2Q91A 3DVEA 1OMVA 1CFDA 1LINA 1UHJA 4MRXA 4MSPA 2ZN9A 5DKQA 1ALVA 3TUYC 2OS8C 1GQMA 5HLVA 3JVTC 1CDMA 1F4OA 4NDCA 2ISDA 1KSOA 1A75A 2K7BA 3I5GB 4XYNA 2KOTA 1B7TZ 2LUCA 3O2PA 3AAJA 1IKUA 2LP2A 1XFWO 2MRDA 4ICBA 5HKYA 1QS7A 1KFXL 3BUXB 4USLA 5AANA 1CNPA 2COLB 2I94A 1BR4B 4I5JA 1TIZA 1HQVA 1ZUZA 3DVKA 1EG4A 3BUNB 1V1FA 1QX2A 2LANA 1NCXA 1GGWA 2ZNEA 1NX0A 1QIVA 1AP4A 2JZIA 2KFGA 4ORCB 1LKJA 1SNLA 1KK8B 4GGFC 3I5GC 2PALA 1DJGA 3SG5A 2ZFDA 4TNCA 1UHHA 2MBXA 2OTGB 3WHTB 3SG3A 1F54A 3NSLA 1MR8A 1PULA 3CS1A 5IBWA 1CLBA 1C7VA 1NSHA 1KK7Z 4L9MA 3CR2A 2M7LA 1S5GY 2K7CA 1XVJA 2KYFA 5FYXA 3CR5X 2GV5A 1QV1A 1SKTA 5JJGA 1YX8A 4NQGA 4P2YB 1G33A 1S6JA 1YUSA 1TNXA 3TZ1A 1IRJA 1ZMZA 4JPZB 3DD4A 2L51A 4CIDA 2H2KA 1S5GZ 1KK8C 3HCMA 4BY4A 5ER5A 2BL0B 3TDZA 1QX5B 2BCAA 1R6PA 1WRLA 2OTGC 1XFVO 4I5KA 4QJ4B 1NWDA 1TRFA 1OZSA 5AERA 1XFZO 2LV7A 1SCMC 3DF0A 1CDNA 4MLWA 3PN7B 3CWGA 3VRNA 2KI4B 4CPVA 2JPTA 4MZJA 4WQ2A 3SG6A 1Y1XA 1XO5A 3GK1A 1WRZA 5ER4X 1YUTA 2KFHA 1U5IB 1H4BA 2L50A 1CDLA 2M1UA 1NX1A 3M0WA 4JQ0D 1A03A 1IQ3A 1XFXO 1UHIA 2WC8A 1L7ZA 2KNEA 3NSOA 1XK4C 2JT3A 2P6BB 2F2PA 1TCFA 1TNWA 4AQJA 1AK8A 1SBJA 3BQ3A 2MJWB 2WNDA 2D8NA 3D0YB 1OSAA 3PN7C 3OHMB 4GPLB 4DCKA 1M45A 2LVIA 3GK2A 3KHEA 1AJ4A 1UWOA 2Q4UA 1JSAA 2LLSA 1AUIB 2LLUA 2JC2A 2K7OA 5TNCA 5HYDA 2FCEA 4A4BA 4GGFA 1DJXA 1BLQA 2L98A 1TNQA 3CLNA 1FI5A 4WQ3A 2KGBC 2ZRSA 5CSNA 1M31A 3TUYB 4ETOA 1BG1A 1J7PA 3OB1B 4N1GA 1QLSA 4GFTA 1DJYA 2Y1MA 3KPXA 3E3RA 1RJVA 2KBMA 3A8RA 1S6CA 5CSJA 5I2LA 4DS7A 3PALA 4QJ3B 1F71A 5HKZA 3SIBA 3EKJA 2JNXA 1VRKA 2LCPA 2KI6D 2LC5A 4C0JA 3D10A 1IG5A 2EC6B 3SIAA 2LMVA 2WCBA 4M2QA 5CSIA 3OX6A 1S26D 1JFJA 5J3XA 1BOCA 2L0PA 4ORBB 1B8RA 1L2OB 1NYAA 1G8IA 1K9UA 5I2OA 3LCPC 1K94A 1QXPA 1SK6D 3SG7A 1LA3A 2I18A 3H4SE 2LVKA 5HKWA 4F0ZB 1DGUA 1CM1A 3DVMA 4Q04A 3FWCA 1SW8A 1PALA 4N1FA 3C1VA 1CTRA 2JTZA 3GK4X 2HETA 1KQMB 2CXJA 1MXEA 1Y6WA 1YR5A 2EC6C 2HQ8A 2NCPA 3AKAA 3EK8A 4XJKB 1JC2A 1M63B 1KQVA 5KSZA 3TS5B 1BR1B 2FOTA 1PRWA 2PSRA 1DMOA 2MLFC 1FBVA 1L2OC 1N2DA 1WDCB 2M97A 4PE7A 4I5NB 1EG3A 2I7AA 2WCEA 1X02A 1XK4A 4OVNF 2BBMA 3I5HB 4E68A 1KK7Y 2M8UA 2PASA 1NX2A 1K95A 1YRTB 4YGAA 1PSBA 1S1EA 3PSRA 3VROA 3BYAA 2LM5A 1SY9A 1QASA 5KTYA 1F4QA 3KF9A 1DTLA 3MSEB 1V1GA 1B47A 2F8PA 1KWOB 1SCMB 1F8HA 2JOJA 3OB2B 1KQMC 4YGDB 1DJIA 2NLNA 4MVFA 5CPVA 2K2AA 3KO0A 2L2EA 1IJ5A 3DVJA 1U5IA 1SL9A 3BUOB 3TS5C 1B8LA 1Y1UA 4N5XA 2WORA 4M2OA 2JNFA 2KYCA 3CTNA 4MEWA 1WDCC 1DF0B 4MRYA 2M29A 2Y4QA 1CM4A 2KBIA 3I5HC 1QATA 2CTNA 4C0KA 1FF1A 5DKNA 1BU3A 4CFRA 1IH0A 4GUKA 2MHHA 2MA2A 1NCZA 2KSPA 3D0YA 1CLLA 4AOMA 2E30A 2LHLA 5KU1A 2Y1NA 1KWOC 2KAXA 2NXQA 3EKHA 4D1EA 1N65A 1EH2A 2TN4A 1GJYA 1EXRA 4YGBB 1YVHA 3KEVA 2V53A 1G4YR 2M7NA 3JTDB 1K93D 1JF2A 2JULA 2KGRA 3F45A 1F55A 1WLZA 3ZNIA 3IQOA 3A4UB 1BJFA 2KHNA 1J1DA 4DIRA 1N0YA 3OX5A 1YRUB 1QTXA 1DJHA 1C7WA 1UP5A 1Y0VH 4FQOA 2LLTA 2LNKA 1M39A 3IF7A 1J7OA 5BPJA 2O5GA 3I5IC 4NDBA 4P5OE 1CFPA 1PK0D 1XFYO 2SASA 1WLMA 2JXLA 2LAPA 3FWBA 2KI6C 4PHJA 1CB1A 2CT9A 1DJZA 3JTDC 1DJWA 1D1OA 1RECA 2M1KB 1IQ5A 2K61A 1EL4A 3OP0A 3NXAA 1CFFA 2I2RE 2F33A 2MLEC 2Y5IA 5G08A 4YI8A 1DT7B 2JTTA 1SRAA 1MUXA 4YGCB 2NCOA 4PALA 3O78A 5D69A 4OCIA 4OV2A 1B4CA 5B8IB 1JF0A 2JRFA 2LE9B 3PLFB 3PM8A 1KFXS 1CMGA 2RGIA 4XJKA 1NPQA 2BE6A 3EK4A 2JT0A 2BKIB 3PFVA 1KCYA 1MF8B 2L5XB 1BF5A 2R2IA 1OQPA 1QLKA 1OMDA 1QV0A 2ZNDA 1F70A 5HLOA 2PVBA 3ZWHA 1YX7A 1TCOB 4PE0A 2KQ6A 2LUXA 2MAZA 2JT8A 1FPWA 2CNPA 1IGVA 4GNKB
chains in the Genus database with same CATH superfamily
1SL7A 1J55A 3Q8IA 4A4CA 1QVIY 2A4JA 2WC6A 2LP3A 1MQ1A 1YUUA 2OPOA 4CLNA 2K8MB 1ODBA 1YTZC 3WHUB 3TDUA 1ZOTB 3DXLA 1J7RA 3LK1A 1UHKA 1A4PA 2CBLA 3L47A 4DRWA 2CCMA 2BKHB 1XFRA 1DVIA 1DF0A 1NX3A 2BE4A 4C0LA 1HT9A 1QVIZ 1AHRA 2ERBA 2KFFA 3CR4X 5FI6A 4ZCUA 3SG2A 3K1EA 2M0RA 2LMUA 2L4HA 1IWQA 2KAYA 2SCPA 4PE1A 1NIWA 2DOQA 3VGOA 1OOGA 4AQIA 2EGDA 2K7DA 3FE8A 4I5LB 2ZN8A 5JOLA 3QRXA 2HQWA 2AUCA 3BOWB 1GM0A 3CGAA 1JFKA 2FCDA 4PE4A 1EJ3A 3AKBA 1WRKA 5I94A 4R1EA 3B6XA 4FTGA 4OKHA 1KFUL 1AVSA 2E6WA 1XFUO 3EVUA 2BECA 3BUWB 4WRIA 2VRGA 4IJ7A 2BCBA 1LXFC 2F3ZA 1BT6A 4PHMA 2JXCA 2K0JA 3NGVA 1K9PA 3FIAA 3I5FB 1SYMA 3NSKA 1CDPA 1IJ6A 2H8VA 1OZOA 3S0FA 1JBAA 3S0GA 1LA0A 1AJ5A 1TTXA 1SL8A 4QJ5B 1YURA 4ORAB 4PHKA 1B9AA 1QWVA 4DUQA 1Z2CB 3S0DA 1ZFSA 2G2BA 1B8CA 2JQ6A 1GGZA 1RWYA 1MXLC 5PALA 3UO9A 1K2HA 1XA5A 2BAPA 1ALWA 1NUBA 1PSRA 4GBAA 4HSZA 5I2QA 4HREE 4ZCVA 4NDDA 5AEQA 1RK9A 1S6IA 3SS5A 5FI7A 1K8UA 1RFJA 1LVCD 3VRQA 3I5IB 4PCWA 4HRGA 1A75B 2LHIA 2BBNA 1Y1AA 3VRPA 2WOSA 3CABA 4JD9A 4HRHA 3I5FC 2H61C 4OR9B 1BMOA 1TNPA 1S36A 2KDHA 2PYQA 2B1UA 3NSIA 2KPHA 3VRRA 3RLZA 1CMFA 2JWWA 3O6BA 1YVLA 3S0EA 3PATA 2F3YA 1SR6B 4YBHB 1K9KA 3L4AA 2AAOA 3BUMB 2KAVA 1A29A 1R2UA 3O4YA 1WY9A 2GGMA 2KQYA 1NCYA 2L5YA 1DGVA 2AMIA 4IL1A 1C3YA 1CLMA 4YGEB 5AXIA 4PDZA 3D75A 3B7AA 2M9GA 1PVBA 3DY9A 3D73A 3N7HA 1OMRA 1UURA 2P71A 3LL8B 1W7IB 4INXA 3CZTX 3K21A 1RTP1 1K96A 4JWQA 1OOJA 3LLEA 3NHTA 4M2PA 4MZKA 3SS3A 1NP8A 3L4LA 1S3PA 2ZRTA 5F6TA 1SMGA 4CFQA 4MBEA 4OZDA 2EHBA 1QX7A 3AAKA 5GQQC 1SR6C 1JWDA 1CKKA 1Q80A 2BL0C 4UPGA 3ICBA 4JKTA 1MWNA 1QIWA 2NZ0A 1W7JB 1DEKA 3TDIA 2WCFA 5AFPA 3EVRA 3SG4A 4U8DA 2LVJA 3DYEA 1OE9B 1P28A 3HX4A 1C07A 3DZTA 5CSFA 3WNXB 4GAOA 2KI4C 2PMYA 3IQQA 4GGNA 3BXKA 1UHNA 1M46A 2M3WA 3RM1A 1FI6A 3DF0B 3NHIA 2GGZA 2QPTA 2JU0A 2K2FA 2M49B 2BNXA 2HF5A 2F2OA 1A2XA 3BOWA 1J7QA 1KSMA 4YI9A 5K89A 1K90D 2QACA 3S0AA 2WCJA 2LVVA 1RROA 1QJTA 1E8AA 2OS8B 1H8BA 1XYDA 2L4IA 3JVTB 1B1GA 2QEOA 1KFUS 1SPYA 1BODA 1CFCA 3B86A 2HPSA 3LK0A 3EK7A 2FJUB 2WCMA 1J1EA 1JUOA 1TOPA 4MN0A 1UUSA 1MHOA 2H61A 4PHNA 3WXAA 2IS9A 3EVVA 4MZLA 2G9BA 3GOFA 1IIOA 2LMTA 2ZKMX 1ZACA 1FW4A 1TN4A 4BY5A 3FS7A 4YRUA 2PQLA 1SCVA 2BCXA 5DKRA 2PRUA 3SJSA 5D7FA 5I8NA 1TUZA 2O60A 2QEVA 1B7TY 1PVAA 2Q91A 3DVEA 1OMVA 1CFDA 1LINA 1UHJA 4MRXA 4MSPA 2ZN9A 5DKQA 1ALVA 3TUYC 2OS8C 1GQMA 5HLVA 3JVTC 1CDMA 1F4OA 4NDCA 2ISDA 1KSOA 1A75A 1TWOA 2K7BA 2WCHA 3I5GB 4FQTA 1LS8A 4XYNA 1W9ZA 2GTEA 1T14A 2KOTA 3D78A 1B7TZ 2LUCA 3O2PA 3OGNA 3AAJA 3FE9A 2LP2A 1IKUA 1XFWO 2MRDA 4ICBA 5HKYA 1QS7A 2WC5A 1KFXL 3BUXB 4USLA 5AANA 1CNPA 2WCLA 2COLB 2I94A 1BR4B 4I5JA 1TIZA 1HQVA 1ZUZA 3DVKA 1EG4A 3BUNB 1V1FA 1QX2A 1Z4HA 4KYNA 2LANA 3S0BA 1NCXA 1GGWA 2ZNEA 1NX0A 1QIVA 1AP4A 2JZIA 2KFGA 4ORCB 1LKJA 1SNLA 1KK8B 2QDIA 4GGFC 3I5GC 2PALA 1SSEB 1DJGA 3SG5A 2ZFDA 4TNCA 1UHHA 2MBXA 2OTGB 3WHTB 3SG3A 1F54A 3NSLA 1MR8A 1PULA 3CS1A 5IBWA 1OOFA 1CLBA 2QEBA 3R1OA 1C7VA 1NSHA 1KK7Z 2L2CA 4L9MA 3CR2A 3R72A 2M7LA 1S5GY 2K7CA 1XVJA 2KYFA 5FYXA 2FJYA 1C3ZA 3CR5X 2GV5A 1QV1A 1SKTA 5JJGA 1YX8A 4NQGA 4P2YB 1G33A 3B87A 4F7FA 1S6JA 1YUSA 1TNXA 3TZ1A 1IRJA 1ZMZA 4JPZB 3DD4A 2L51A 4CIDA 2H2KA 1S5GZ 1KK8C 3HCMA 5FI2A 5ER5A 4BY4A 2BL0B 3TDZA 1QX5B 2BCAA 1R6PA 1WRLA 2OTGC 1XFVO 4I5KA 4QJ4B 1NWDA 1TRFA 1OZSA 5AERA 1XFZO 2LV7A 1SCMC 3DF0A 1CDNA 4MLWA 3PN7B 3V2LA 3CWGA 3VRNA 2KI4B 4CPVA 2JPTA 3BJHA 4MZJA 3BFBA 3VB1A 4WQ2A 3SG6A 1DQEA 1Y1XA 1XO5A 3GK1A 1WRZA 5ER4X 3EG5B 1YUTA 2KFHA 1U5IB 1H4BA 2L50A 1CDLA 2M1UA 1NX1A 3M0WA 4JQ0D 1A03A 1IQ3A 1XFXO 1UHIA 2KLDA 2WC8A 1L7ZA 2KNEA 3NSOA 1XK4C 2JT3A 2P6BB 2F2PA 1TCFA 2K60A 1TNWA 3CZ0A 4AQJA 1SBJA 1AK8A 3BQ3A 2MJWB 2WNDA 2D8NA 3D0YB 1OSAA 3PN7C 3OHMB 4GPLB 4DCKA 1M45A 2LVIA 2QEHA 3GK2A 3KHEA 1AJ4A 1UWOA 2Q4UA 1JSAA 2LLSA 3SS4A 1AUIB 2LLUA 2JC2A 2K7OA 5TNCA 5HYDA 2FCEA 4A4BA 5HL1A 4GGFA 1DJXA 1BLQA 2L98A 1TNQA 3CLNA 1FI5A 4WQ3A 2KGBC 2ZRSA 5CSNA 1M31A 3TUYB 4ETOA 1BG1A 1J7PA 3CZ2A 3OB1B 1QLSA 4GFTA 1DJYA 4N1GA 2Y1MA 3KPXA 3E3RA 1RJVA 2KBMA 3A8RA 1S6CA 5CSJA 5I2LA 4DS7A 3PALA 3RZSA 3CZ1A 4QJ3B 2YGUA 1F71A 5HKZA 3SIBA 3EKJA 2JNXA 1VRKA 3B88A 2LCPA 3PJIA 2KI6D 2LC5A 4C0JA 3D10A 1IG5A 2EC6B 2KLEA 3SIAA 2LMVA 2WCBA 4M2QA 5CSIA 3OX6A 1S26D 1JFJA 3D74A 5J3XA 1BOCA 2L0PA 4ORBB 1B8RA 1L2OB 1NYAA 2JPOA 1G8IA 1K9UA 4INWA 5I2OA 3LCPC 1K94A 1QXPA 1SK6D 3SG7A 1LA3A 2I18A 3H4SE 2LVKA 5HKWA 4F0ZB 1DGUA 1CM1A 1ORGA 3DVMA 4Q04A 1OW4A 1SW8A 3FWCA 1PALA 4N1FA 3C1VA 1CTRA 2JTZA 3GK4X 2HETA 1KQMB 3FE6A 2CXJA 1MXEA 1Y6WA 1YR5A 2EC6C 2HQ8A 2NCPA 3AKAA 3EK8A 4XJKB 3BFAA 1M63B 1JC2A 1KQVA 5KSZA 3TS5B 1BR1B 2FOTA 1PRWA 2PSRA 1DMOA 2MLFC 1FBVA 1L2OC 1N2DA 1WDCB 2M97A 4PE7A 4I5NB 1EG3A 2I7AA 2WCEA 1X02A 1XK4A 4OVNF 2BBMA 3I5HB 4E68A 1KK7Y 2M8UA 2PASA 1NX2A 1K95A 1YRTB 4YGAA 1PSBA 1S1EA 3PSRA 4PT1A 3VROA 3BYAA 2LM5A 1SY9A 1QASA 5KTYA 1F4QA 3KF9A 1DTLA 3MSEB 1V1GA 1B47A 2F8PA 1KWOB 1SCMB 1F8HA 2JOJA 3OB2B 1KQMC 3BFHA 4YGDB 3PM2A 1DJIA 2NLNA 4MVFA 5CPVA 2K2AA 3KO0A 2L2EA 1IJ5A 3DVJA 1U5IA 1SL9A 3BUOB 3TS5C 1B8LA 1OOIX 1Y1UA 2WORA 4N5XA 4M2OA 2JNFA 2KYCA 3CDNA 3CTNA 4MEWA 1WDCC 1DF0B 4MRYA 2M29A 2Y4QA 1CM4A 2KBIA 3I5HC 1QATA 2CTNA 4C0KA 1FF1A 3CYZA 5DKNA 1BU3A 3QMEA 4CFRA 1IH0A 4GUKA 2MHHA 2MA2A 1NCZA 2KSPA 3D0YA 3R1PA 1CLLA 4AOMA 2E30A 2LHLA 5KU1A 2Y1NA 1KWOC 2KAXA 2NXQA 3EKHA 4D1EA 1N65A 1EH2A 5EL2A 2TN4A 1GJYA 1EXRA 4YGBB 1YVHA 5D3OA 3KEVA 2V53A 1TUJA 1G4YR 2M7NA 1K93D 1JF2A 1OOHA 3JTDB 2JULA 2KGRA 3F45A 1F55A 1WLZA 3ZNIA 3IQOA 3A4UB 1BJFA 2KHNA 1J1DA 3IVTA 4DIRA 1N0YA 3OX5A 1YRUB 1QTXA 1DJHA 1C7WA 1UP5A 1Y0VH 4FQOA 2LLTA 2LNKA 1M39A 3IF7A 3O4XA 1J7OA 5BPJA 2O5GA 3I5IC 4NDBA 3R1VA 4P5OE 1PK0D 1CFPA 1XFYO 2SASA 1WLMA 2JXLA 2LAPA 3FWBA 2KI6C 3OBVA 4PHJA 2CT9A 1CB1A 2P70A 1DJZA 3JTDC 1DJWA 1D1OA 1RECA 2M1KB 1IQ5A 2K61A 1EL4A 3OP0A 3NXAA 1CFFA 2I2RE 2F33A 2MLEC 2Y5IA 5G08A 4YI8A 1DT7B 2JTTA 1SRAA 1MUXA 4YGCB 2NCOA 4PALA 3O78A 5D69A 4OCIA 3D77A 4OV2A 1B4CA 1DC1A 5B8IB 1JF0A 5DICA 2JRFA 2LE9B 3PLFB 3PM8A 1KFXS 1CMGA 2RGIA 4XJKA 1NPQA 2BE6A 3EK4A 2JT0A 2BKIB 3PFVA 1KCYA 1MF8B 2L5XB 1BF5A 2R2IA 1OQPA 1QLKA 1OMDA 3UNWA 1QV0A 2ZNDA 1F70A 5HLOA 2PVBA 3ZWHA 1DELA 1YX7A 2WCKA 1TCOB 4PE0A 2KQ6A 2LUXA 2MAZA 2JT8A 1FPWA 2CNPA 1IGVA 4GNKB 3D76A
chains in the Genus database with same CATH topology
1SL7A 1J55A 4A4CA 1QVIY 2A4JA 2LP3A 1MQ1A 1YUUA 2OPOA 4CLNA 2K8MB 1ODBA 1YTZC 3WHUB 3TDUA 1ZOTB 1J7RA 3LK1A 1UHKA 1A4PA 2CBLA 4DRWA 2CCMA 2BKHB 1DVIA 1DF0A 1NX3A 2BE4A 4C0LA 1HT9A 1QVIZ 1AHRA 2KFFA 3CR4X 4ZCUA 3SG2A 2M0RA 2LMUA 2L4HA 1IWQA 2KAYA 2SCPA 4PE1A 1NIWA 2DOQA 3VGOA 4AQIA 2EGDA 2K7DA 4I5LB 5JOLA 2ZN8A 3QRXA 2HQWA 2AUCA 3BOWB 3CGAA 1JFKA 2FCDA 4PE4A 1EJ3A 3AKBA 1WRKA 4R1EA 4FTGA 4OKHA 1KFUL 1AVSA 2E6WA 1XFUO 3EVUA 2BECA 3BUWB 4WRIA 2VRGA 2BCBA 1LXFC 2F3ZA 1BT6A 4PHMA 2JXCA 2K0JA 3NSKA 1K9PA 3FIAA 3I5FB 1SYMA 1JBAA 1CDPA 1IJ6A 1OZOA 4QJ5B 1LA0A 1AJ5A 1TTXA 1SL8A 1YURA 4ORAB 4PHKA 1B9AA 4DUQA 1ZFSA 2G2BA 1B8CA 2JQ6A 1GGZA 1RWYA 1MXLC 5PALA 1K2HA 1XA5A 1ALWA 1NUBA 1PSRA 4GBAA 4HSZA 5I2QA 4HREE 4ZCVA 4NDDA 5AEQA 1RK9A 1S6IA 1K8UA 1RFJA 1LVCD 3VRQA 3I5IB 4PCWA 4HRGA 1A75B 2LHIA 2BBNA 1Y1AA 3VRPA 2WOSA 4HRHA 3I5FC 2H61C 4OR9B 1BMOA 1TNPA 1S36A 2KDHA 2B1UA 3NSIA 3VRRA 3RLZA 1CMFA 2JWWA 3O6BA 1YVLA 3PATA 2F3YA 1SR6B 4YBHB 1K9KA 2AAOA 3BUMB 2KAVA 1A29A 1R2UA 3O4YA 1WY9A 2GGMA 2KQYA 1NCYA 1DGVA 2AMIA 4IL1A 1CLMA 4YGEB 5AXIA 4PDZA 2M9GA 1PVBA 1OMRA 1UURA 3LL8B 1W7IB 3CZTX 3K21A 1RTP1 1K96A 4JWQA 1OOJA 3LLEA 4M2PA 4MZKA 1NP8A 1S3PA 2ZRTA 5F6TA 1SMGA 4CFQA 4MBEA 2EHBA 1QX7A 3AAKA 5GQQC 1SR6C 1JWDA 1CKKA 1Q80A 2BL0C 4UPGA 3ICBA 1MWNA 1QIWA 2NZ0A 1W7JB 3TDIA 2WCFA 5AFPA 3EVRA 3SG4A 4U8DA 2LVJA 1OE9B 3HX4A 1C07A 5CSFA 3WNXB 4GAOA 2KI4C 2PMYA 3IQQA 4GGNA 3BXKA 1UHNA 1M46A 2M3WA 3RM1A 1FI6A 3DF0B 2GGZA 2QPTA 2JU0A 2K2FA 2M49B 2HF5A 2F2OA 1A2XA 3BOWA 1J7QA 1KSMA 4YI9A 5K89A 1K90D 2QACA 2LVVA 1RROA 1QJTA 1E8AA 2OS8B 1H8BA 1XYDA 2L4IA 3JVTB 1B1GA 1KFUS 1SPYA 1BODA 1CFCA 2HPSA 3LK0A 3EK7A 2FJUB 4MN0A 1J1EA 1JUOA 1TOPA 1UUSA 1MHOA 2H61A 4PHNA 3WXAA 2IS9A 3EVVA 4MZLA 2G9BA 3GOFA 2LMTA 2ZKMX 1ZACA 1FW4A 1TN4A 4BY5A 3FS7A 4YRUA 1SCVA 2BCXA 5DKRA 2PRUA 3SJSA 5D7FA 5I8NA 2O60A 1B7TY 1PVAA 2Q91A 3DVEA 1OMVA 1CFDA 1LINA 1UHJA 4MRXA 4MSPA 2ZN9A 5DKQA 1ALVA 3TUYC 2OS8C 1GQMA 5HLVA 3JVTC 1CDMA 1F4OA 4NDCA 2ISDA 1KSOA 1A75A 2K7BA 3I5GB 4XYNA 2KOTA 1B7TZ 2LUCA 3O2PA 3AAJA 1IKUA 2LP2A 1XFWO 2MRDA 4ICBA 5HKYA 1QS7A 1KFXL 3BUXB 4USLA 5AANA 1CNPA 2COLB 2I94A 1BR4B 4I5JA 1TIZA 1HQVA 1ZUZA 3DVKA 1EG4A 3BUNB 1V1FA 1QX2A 2LANA 1NCXA 1GGWA 2ZNEA 1NX0A 1QIVA 1AP4A 2JZIA 2KFGA 4ORCB 1LKJA 1SNLA 1KK8B 4GGFC 3I5GC 2PALA 1DJGA 3SG5A 2ZFDA 4TNCA 1UHHA 2MBXA 2OTGB 3WHTB 3SG3A 1F54A 3NSLA 1MR8A 1PULA 3CS1A 5IBWA 1CLBA 1C7VA 1NSHA 1KK7Z 4L9MA 3CR2A 2M7LA 1S5GY 2K7CA 1XVJA 2KYFA 5FYXA 3CR5X 2GV5A 1QV1A 1SKTA 5JJGA 1YX8A 4NQGA 4P2YB 1G33A 1S6JA 1YUSA 1TNXA 3TZ1A 1IRJA 1ZMZA 4JPZB 3DD4A 2L51A 4CIDA 2H2KA 1S5GZ 1KK8C 3HCMA 4BY4A 5ER5A 2BL0B 3TDZA 1QX5B 2BCAA 1R6PA 1WRLA 2OTGC 1XFVO 4I5KA 4QJ4B 1NWDA 1TRFA 1OZSA 5AERA 1XFZO 2LV7A 1SCMC 3DF0A 1CDNA 4MLWA 3PN7B 3CWGA 3VRNA 2KI4B 4CPVA 2JPTA 4MZJA 4WQ2A 3SG6A 1Y1XA 1XO5A 3GK1A 1WRZA 5ER4X 1YUTA 2KFHA 1U5IB 1H4BA 2L50A 1CDLA 2M1UA 1NX1A 3M0WA 4JQ0D 1A03A 1IQ3A 1XFXO 1UHIA 2WC8A 1L7ZA 2KNEA 3NSOA 1XK4C 2JT3A 2P6BB 2F2PA 1TCFA 1TNWA 4AQJA 1AK8A 1SBJA 3BQ3A 2MJWB 2WNDA 2D8NA 3D0YB 1OSAA 3PN7C 3OHMB 4GPLB 4DCKA 1M45A 2LVIA 3GK2A 3KHEA 1AJ4A 1UWOA 2Q4UA 1JSAA 2LLSA 1AUIB 2LLUA 2JC2A 2K7OA 5TNCA 5HYDA 2FCEA 4A4BA 4GGFA 1DJXA 1BLQA 2L98A 1TNQA 3CLNA 1FI5A 4WQ3A 2KGBC 2ZRSA 5CSNA 1M31A 3TUYB 4ETOA 1BG1A 1J7PA 3OB1B 4N1GA 1QLSA 4GFTA 1DJYA 2Y1MA 3KPXA 3E3RA 1RJVA 2KBMA 3A8RA 1S6CA 5CSJA 5I2LA 4DS7A 3PALA 4QJ3B 1F71A 5HKZA 3SIBA 3EKJA 2JNXA 1VRKA 2LCPA 2KI6D 2LC5A 4C0JA 3D10A 1IG5A 2EC6B 3SIAA 2LMVA 2WCBA 4M2QA 5CSIA 3OX6A 1S26D 1JFJA 5J3XA 1BOCA 2L0PA 4ORBB 1B8RA 1L2OB 1NYAA 1G8IA 1K9UA 5I2OA 3LCPC 1K94A 1QXPA 1SK6D 3SG7A 1LA3A 2I18A 3H4SE 2LVKA 5HKWA 4F0ZB 1DGUA 1CM1A 3DVMA 4Q04A 3FWCA 1SW8A 1PALA 4N1FA 3C1VA 1CTRA 2JTZA 3GK4X 2HETA 1KQMB 2CXJA 1MXEA 1Y6WA 1YR5A 2EC6C 2HQ8A 2NCPA 3AKAA 3EK8A 4XJKB 1JC2A 1M63B 1KQVA 5KSZA 3TS5B 1BR1B 2FOTA 1PRWA 2PSRA 1DMOA 2MLFC 1FBVA 1L2OC 1N2DA 1WDCB 2M97A 4PE7A 4I5NB 1EG3A 2I7AA 2WCEA 1X02A 1XK4A 4OVNF 2BBMA 3I5HB 4E68A 1KK7Y 2M8UA 2PASA 1NX2A 1K95A 1YRTB 4YGAA 1PSBA 1S1EA 3PSRA 3VROA 3BYAA 2LM5A 1SY9A 1QASA 5KTYA 1F4QA 3KF9A 1DTLA 3MSEB 1V1GA 1B47A 2F8PA 1KWOB 1SCMB 1F8HA 2JOJA 3OB2B 1KQMC 4YGDB 1DJIA 2NLNA 4MVFA 5CPVA 2K2AA 3KO0A 2L2EA 1IJ5A 3DVJA 1U5IA 1SL9A 3BUOB 3TS5C 1B8LA 1Y1UA 4N5XA 2WORA 4M2OA 2JNFA 2KYCA 3CTNA 4MEWA 1WDCC 1DF0B 4MRYA 2M29A 2Y4QA 1CM4A 2KBIA 3I5HC 1QATA 2CTNA 4C0KA 1FF1A 5DKNA 1BU3A 4CFRA 1IH0A 4GUKA 2MHHA 2MA2A 1NCZA 2KSPA 3D0YA 1CLLA 4AOMA 2E30A 2LHLA 5KU1A 2Y1NA 1KWOC 2KAXA 2NXQA 3EKHA 4D1EA 1N65A 1EH2A 2TN4A 1GJYA 1EXRA 4YGBB 1YVHA 3KEVA 2V53A 1G4YR 2M7NA 3JTDB 1K93D 1JF2A 2JULA 2KGRA 3F45A 1F55A 1WLZA 3ZNIA 3IQOA 3A4UB 1BJFA 2KHNA 1J1DA 4DIRA 1N0YA 3OX5A 1YRUB 1QTXA 1DJHA 1C7WA 1UP5A 1Y0VH 4FQOA 2LLTA 2LNKA 1M39A 3IF7A 1J7OA 5BPJA 2O5GA 3I5IC 4NDBA 4P5OE 1CFPA 1PK0D 1XFYO 2SASA 1WLMA 2JXLA 2LAPA 3FWBA 2KI6C 4PHJA 1CB1A 2CT9A 1DJZA 3JTDC 1DJWA 1D1OA 1RECA 2M1KB 1IQ5A 2K61A 1EL4A 3OP0A 3NXAA 1CFFA 2I2RE 2F33A 2MLEC 2Y5IA 5G08A 4YI8A 1DT7B 2JTTA 1SRAA 1MUXA 4YGCB 2NCOA 4PALA 3O78A 5D69A 4OCIA 4OV2A 1B4CA 5B8IB 1JF0A 2JRFA 2LE9B 3PLFB 3PM8A 1KFXS 1CMGA 2RGIA 4XJKA 1NPQA 2BE6A 3EK4A 2JT0A 2BKIB 3PFVA 1KCYA 1MF8B 2L5XB 1BF5A 2R2IA 1OQPA 1QLKA 1OMDA 1QV0A 2ZNDA 1F70A 5HLOA 2PVBA 3ZWHA 1YX7A 1TCOB 4PE0A 2KQ6A 2LUXA 2MAZA 2JT8A 1FPWA 2CNPA 1IGVA 4GNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL7 A;  1J55 A;  4A4C A;  1QVI Y;  2A4J A;  2LP3 A;  1MQ1 A;  1YUU A;  2OPO A;  4CLN A;  2K8M B;  1ODB A;  1YTZ C;  3WHU B;  3TDU A;  1ZOT B;  1J7R A;  3LK1 A;  1UHK A;  1A4P A;  2CBL A;  4DRW A;  2CCM A;  2BKH B;  1DVI A;  1DF0 A;  1NX3 A;  2BE4 A;  4C0L A;  1HT9 A;  1QVI Z;  1AHR A;  2KFF A;  3CR4 X;  4ZCU A;  3SG2 A;  2M0R A;  2LMU A;  2L4H A;  1IWQ A;  2KAY A;  2SCP A;  4PE1 A;  1NIW A;  2DOQ A;  3VGO A;  4AQI A;  2EGD A;  2K7D A;  4I5L B;  5JOL A;  2ZN8 A;  3QRX A;  2HQW A;  2AUC A;  3BOW B;  3CGA A;  1JFK A;  2FCD A;  4PE4 A;  1EJ3 A;  3AKB A;  1WRK A;  4R1E A;  4FTG A;  4OKH A;  1KFU L;  1AVS A;  2E6W A;  1XFU O;  3EVU A;  2BEC A;  3BUW B;  4WRI A;  2VRG A;  2BCB A;  1LXF C;  2F3Z A;  1BT6 A;  4PHM A;  2JXC A;  2K0J A;  3NSK A;  1K9P A;  3FIA A;  3I5F B;  1SYM A;  1JBA A;  1CDP A;  1IJ6 A;  1OZO A;  4QJ5 B;  1LA0 A;  1AJ5 A;  1TTX A;  1SL8 A;  1YUR A;  4ORA B;  4PHK A;  1B9A A;  4DUQ A;  1ZFS A;  2G2B A;  1B8C A;  2JQ6 A;  1GGZ A;  1RWY A;  1MXL C;  5PAL A;  1K2H A;  1XA5 A;  1ALW A;  1NUB A;  1PSR A;  4GBA A;  4HSZ A;  5I2Q A;  4HRE E;  4ZCV A;  4NDD A;  5AEQ A;  1RK9 A;  1S6I A;  1K8U A;  1RFJ A;  1LVC D;  3VRQ A;  3I5I B;  4PCW A;  4HRG A;  1A75 B;  2LHI A;  2BBN A;  1Y1A A;  3VRP A;  2WOS A;  4HRH A;  3I5F C;  2H61 C;  4OR9 B;  1BMO A;  1TNP A;  1S36 A;  2KDH A;  2B1U A;  3NSI A;  3VRR A;  3RLZ A;  1CMF A;  2JWW A;  3O6B A;  1YVL A;  3PAT A;  2F3Y A;  1SR6 B;  4YBH B;  1K9K A;  2AAO A;  3BUM B;  2KAV A;  1A29 A;  1R2U A;  3O4Y A;  1WY9 A;  2GGM A;  2KQY A;  1NCY A;  1DGV A;  2AMI A;  4IL1 A;  1CLM A;  4YGE B;  5AXI A;  4PDZ A;  2M9G A;  1PVB A;  1OMR A;  1UUR A;  3LL8 B;  1W7I B;  3CZT X;  3K21 A;  1RTP 1;  1K96 A;  4JWQ A;  1OOJ A;  3LLE A;  4M2P A;  4MZK A;  1NP8 A;  1S3P A;  2ZRT A;  5F6T A;  1SMG A;  4CFQ A;  4MBE A;  2EHB A;  1QX7 A;  3AAK A;  5GQQ C;  1SR6 C;  1JWD A;  1CKK A;  1Q80 A;  2BL0 C;  4UPG A;  3ICB A;  1MWN A;  1QIW A;  2NZ0 A;  1W7J B;  3TDI A;  2WCF A;  5AFP A;  3EVR A;  3SG4 A;  4U8D A;  2LVJ A;  1OE9 B;  3HX4 A;  1C07 A;  5CSF A;  3WNX B;  4GAO A;  2KI4 C;  2PMY A;  3IQQ A;  4GGN A;  3BXK A;  1UHN A;  1M46 A;  2M3W A;  3RM1 A;  1FI6 A;  3DF0 B;  2GGZ A;  2QPT A;  2JU0 A;  2K2F A;  2M49 B;  2HF5 A;  2F2O A;  1A2X A;  3BOW A;  1J7Q A;  1KSM A;  4YI9 A;  5K89 A;  1K90 D;  2QAC A;  2LVV A;  1RRO A;  1QJT A;  1E8A A;  2OS8 B;  1H8B A;  1XYD A;  2L4I A;  3JVT B;  1B1G A;  1KFU S;  1SPY A;  1BOD A;  1CFC A;  2HPS A;  3LK0 A;  3EK7 A;  2FJU B;  4MN0 A;  1J1E A;  1JUO A;  1TOP A;  1UUS A;  1MHO A;  2H61 A;  4PHN A;  3WXA A;  2IS9 A;  3EVV A;  4MZL A;  2G9B A;  3GOF A;  2LMT A;  2ZKM X;  1ZAC A;  1FW4 A;  1TN4 A;  4BY5 A;  3FS7 A;  4YRU A;  1SCV A;  2BCX A;  5DKR A;  2PRU A;  3SJS A;  5D7F A;  5I8N A;  2O60 A;  1B7T Y;  1PVA A;  2Q91 A;  3DVE A;  1OMV A;  1CFD A;  1LIN A;  1UHJ A;  4MRX A;  4MSP A;  2ZN9 A;  5DKQ A;  1ALV A;  3TUY C;  2OS8 C;  1GQM A;  5HLV A;  3JVT C;  1CDM A;  1F4O A;  4NDC A;  2ISD A;  1KSO A;  1A75 A;  2K7B A;  3I5G B;  4XYN A;  2KOT A;  1B7T Z;  2LUC A;  3O2P A;  3AAJ A;  1IKU A;  2LP2 A;  1XFW O;  2MRD A;  4ICB A;  5HKY A;  1QS7 A;  1KFX L;  3BUX B;  4USL A;  5AAN A;  1CNP A;  2COL B;  2I94 A;  1BR4 B;  4I5J A;  1TIZ A;  1HQV A;  1ZUZ A;  3DVK A;  1EG4 A;  3BUN B;  1V1F A;  1QX2 A;  2LAN A;  1NCX A;  1GGW A;  2ZNE A;  1NX0 A;  1QIV A;  1AP4 A;  2JZI A;  2KFG A;  4ORC B;  1LKJ A;  1SNL A;  1KK8 B;  4GGF C;  3I5G C;  2PAL A;  1DJG A;  3SG5 A;  2ZFD A;  4TNC A;  1UHH A;  2MBX A;  2OTG B;  3WHT B;  3SG3 A;  1F54 A;  3NSL A;  1MR8 A;  1PUL A;  3CS1 A;  5IBW A;  1CLB A;  1C7V A;  1NSH A;  1KK7 Z;  4L9M A;  3CR2 A;  2M7L A;  1S5G Y;  2K7C A;  1XVJ A;  2KYF A;  5FYX A;  3CR5 X;  2GV5 A;  1QV1 A;  1SKT A;  5JJG A;  1YX8 A;  4NQG A;  4P2Y B;  1G33 A;  1S6J A;  1YUS A;  1TNX A;  3TZ1 A;  1IRJ A;  1ZMZ A;  4JPZ B;  3DD4 A;  2L51 A;  4CID A;  2H2K A;  1S5G Z;  1KK8 C;  3HCM A;  4BY4 A;  5ER5 A;  2BL0 B;  3TDZ A;  1QX5 B;  2BCA A;  1R6P A;  1WRL A;  2OTG C;  1XFV O;  4I5K A;  4QJ4 B;  1NWD A;  1TRF A;  1OZS A;  5AER A;  1XFZ O;  2LV7 A;  1SCM C;  3DF0 A;  1CDN A;  4MLW A;  3PN7 B;  3CWG A;  3VRN A;  2KI4 B;  4CPV A;  2JPT A;  4MZJ A;  4WQ2 A;  3SG6 A;  1Y1X A;  1XO5 A;  3GK1 A;  1WRZ A;  5ER4 X;  1YUT A;  2KFH A;  1U5I B;  1H4B A;  2L50 A;  1CDL A;  2M1U A;  1NX1 A;  3M0W A;  4JQ0 D;  1A03 A;  1IQ3 A;  1XFX O;  1UHI A;  2WC8 A;  1L7Z A;  2KNE A;  3NSO A;  1XK4 C;  2JT3 A;  2P6B B;  2F2P A;  1TCF A;  1TNW A;  4AQJ A;  1AK8 A;  1SBJ A;  3BQ3 A;  2MJW B;  2WND A;  2D8N A;  3D0Y B;  1OSA A;  3PN7 C;  3OHM B;  4GPL B;  4DCK A;  1M45 A;  2LVI A;  3GK2 A;  3KHE A;  1AJ4 A;  1UWO A;  2Q4U A;  1JSA A;  2LLS A;  1AUI B;  2LLU A;  2JC2 A;  2K7O A;  5TNC A;  5HYD A;  2FCE A;  4A4B A;  4GGF A;  1DJX A;  1BLQ A;  2L98 A;  1TNQ A;  3CLN A;  1FI5 A;  4WQ3 A;  2KGB C;  2ZRS A;  5CSN A;  1M31 A;  3TUY B;  4ETO A;  1BG1 A;  1J7P A;  3OB1 B;  4N1G A;  1QLS A;  4GFT A;  1DJY A;  2Y1M A;  3KPX A;  3E3R A;  1RJV A;  2KBM A;  3A8R A;  1S6C A;  5CSJ A;  5I2L A;  4DS7 A;  3PAL A;  4QJ3 B;  1F71 A;  5HKZ A;  3SIB A;  3EKJ A;  2JNX A;  1VRK A;  2LCP A;  2KI6 D;  2LC5 A;  4C0J A;  3D10 A;  1IG5 A;  2EC6 B;  3SIA A;  2LMV A;  2WCB A;  4M2Q A;  5CSI A;  3OX6 A;  1S26 D;  1JFJ A;  5J3X A;  1BOC A;  2L0P A;  4ORB B;  1B8R A;  1L2O B;  1NYA A;  1G8I A;  1K9U A;  5I2O A;  3LCP C;  1K94 A;  1QXP A;  1SK6 D;  3SG7 A;  1LA3 A;  2I18 A;  3H4S E;  2LVK A;  5HKW A;  4F0Z B;  1DGU A;  1CM1 A;  3DVM A;  4Q04 A;  3FWC A;  1SW8 A;  1PAL A;  4N1F A;  3C1V A;  1CTR A;  2JTZ A;  3GK4 X;  2HET A;  1KQM B;  2CXJ A;  1MXE A;  1Y6W A;  1YR5 A;  2EC6 C;  2HQ8 A;  2NCP A;  3AKA A;  3EK8 A;  4XJK B;  1JC2 A;  1M63 B;  1KQV A;  5KSZ A;  3TS5 B;  1BR1 B;  2FOT A;  1PRW A;  2PSR A;  1DMO A;  2MLF C;  1FBV A;  1L2O C;  1N2D A;  1WDC B;  2M97 A;  4PE7 A;  4I5N B;  1EG3 A;  2I7A A;  2WCE A;  1X02 A;  1XK4 A;  4OVN F;  2BBM A;  3I5H B;  4E68 A;  1KK7 Y;  2M8U A;  2PAS A;  1NX2 A;  1K95 A;  1YRT B;  4YGA A;  1PSB A;  1S1E A;  3PSR A;  3VRO A;  3BYA A;  2LM5 A;  1SY9 A;  1QAS A;  5KTY A;  1F4Q A;  3KF9 A;  1DTL A;  3MSE B;  1V1G A;  1B47 A;  2F8P A;  1KWO B;  1SCM B;  1F8H A;  2JOJ A;  3OB2 B;  1KQM C;  4YGD B;  1DJI A;  2NLN A;  4MVF A;  5CPV A;  2K2A A;  3KO0 A;  2L2E A;  1IJ5 A;  3DVJ A;  1U5I A;  1SL9 A;  3BUO B;  3TS5 C;  1B8L A;  1Y1U A;  4N5X A;  2WOR A;  4M2O A;  2JNF A;  2KYC A;  3CTN A;  4MEW A;  1WDC C;  1DF0 B;  4MRY A;  2M29 A;  2Y4Q A;  1CM4 A;  2KBI A;  3I5H C;  1QAT A;  2CTN A;  4C0K A;  1FF1 A;  5DKN A;  1BU3 A;  4CFR A;  1IH0 A;  4GUK A;  2MHH A;  2MA2 A;  1NCZ A;  2KSP A;  3D0Y A;  1CLL A;  4AOM A;  2E30 A;  2LHL A;  5KU1 A;  2Y1N A;  1KWO C;  2KAX A;  2NXQ A;  3EKH A;  4D1E A;  1N65 A;  1EH2 A;  2TN4 A;  1GJY A;  1EXR A;  4YGB B;  1YVH A;  3KEV A;  2V53 A;  1G4Y R;  2M7N A;  3JTD B;  1K93 D;  1JF2 A;  2JUL A;  2KGR A;  3F45 A;  1F55 A;  1WLZ A;  3ZNI A;  3IQO A;  3A4U B;  1BJF A;  2KHN A;  1J1D A;  4DIR A;  1N0Y A;  3OX5 A;  1YRU B;  1QTX A;  1DJH A;  1C7W A;  1UP5 A;  1Y0V H;  4FQO A;  2LLT A;  2LNK A;  1M39 A;  3IF7 A;  1J7O A;  5BPJ A;  2O5G A;  3I5I C;  4NDB A;  4P5O E;  1CFP A;  1PK0 D;  1XFY O;  2SAS A;  1WLM A;  2JXL A;  2LAP A;  3FWB A;  2KI6 C;  4PHJ A;  1CB1 A;  2CT9 A;  1DJZ A;  3JTD C;  1DJW A;  1D1O A;  1REC A;  2M1K B;  1IQ5 A;  2K61 A;  1EL4 A;  3OP0 A;  3NXA A;  1CFF A;  2I2R E;  2F33 A;  2MLE C;  2Y5I A;  5G08 A;  4YI8 A;  1DT7 B;  2JTT A;  1SRA A;  1MUX A;  4YGC B;  2NCO A;  4PAL A;  3O78 A;  5D69 A;  4OCI A;  4OV2 A;  1B4C A;  5B8I B;  1JF0 A;  2JRF A;  2LE9 B;  3PLF B;  3PM8 A;  1KFX S;  1CMG A;  2RGI A;  4XJK A;  1NPQ A;  2BE6 A;  3EK4 A;  2JT0 A;  2BKI B;  3PFV A;  1KCY A;  1MF8 B;  2L5X B;  1BF5 A;  2R2I A;  1OQP A;  1QLK A;  1OMD A;  1QV0 A;  2ZND A;  1F70 A;  5HLO A;  2PVB A;  3ZWH A;  1YX7 A;  1TCO B;  4PE0 A;  2KQ6 A;  2LUX A;  2MAZ A;  2JT8 A;  1FPW A;  2CNP A;  1IGV A;  4GNK B; 
#chains in the Genus database with same CATH topology
 1SL7 A;  1J55 A;  3Q8I A;  4A4C A;  1QVI Y;  2A4J A;  2WC6 A;  2LP3 A;  1MQ1 A;  1YUU A;  2OPO A;  4CLN A;  2K8M B;  1ODB A;  1YTZ C;  3WHU B;  3TDU A;  1ZOT B;  3DXL A;  1J7R A;  3LK1 A;  1UHK A;  1A4P A;  2CBL A;  3L47 A;  4DRW A;  2CCM A;  2BKH B;  1XFR A;  1DVI A;  1DF0 A;  1NX3 A;  2BE4 A;  4C0L A;  1HT9 A;  1QVI Z;  1AHR A;  2ERB A;  2KFF A;  3CR4 X;  5FI6 A;  4ZCU A;  3SG2 A;  3K1E A;  2M0R A;  2LMU A;  2L4H A;  1IWQ A;  2KAY A;  2SCP A;  4PE1 A;  1NIW A;  2DOQ A;  3VGO A;  1OOG A;  4AQI A;  2EGD A;  2K7D A;  3FE8 A;  4I5L B;  2ZN8 A;  5JOL A;  3QRX A;  2HQW A;  2AUC A;  3BOW B;  1GM0 A;  3CGA A;  1JFK A;  2FCD A;  4PE4 A;  1EJ3 A;  3AKB A;  1WRK A;  5I94 A;  4R1E A;  3B6X A;  4FTG A;  4OKH A;  1KFU L;  1AVS A;  2E6W A;  1XFU O;  3EVU A;  2BEC A;  3BUW B;  4WRI A;  2VRG A;  4IJ7 A;  2BCB A;  1LXF C;  2F3Z A;  1BT6 A;  4PHM A;  2JXC A;  2K0J A;  3NGV A;  1K9P A;  3FIA A;  3I5F B;  1SYM A;  3NSK A;  1CDP A;  1IJ6 A;  2H8V A;  1OZO A;  3S0F A;  1JBA A;  3S0G A;  1LA0 A;  1AJ5 A;  1TTX A;  1SL8 A;  4QJ5 B;  1YUR A;  4ORA B;  4PHK A;  1B9A A;  1QWV A;  4DUQ A;  1Z2C B;  3S0D A;  1ZFS A;  2G2B A;  1B8C A;  2JQ6 A;  1GGZ A;  1RWY A;  1MXL C;  5PAL A;  3UO9 A;  1K2H A;  1XA5 A;  2BAP A;  1ALW A;  1NUB A;  1PSR A;  4GBA A;  4HSZ A;  5I2Q A;  4HRE E;  4ZCV A;  4NDD A;  5AEQ A;  1RK9 A;  1S6I A;  3SS5 A;  5FI7 A;  1K8U A;  1RFJ A;  1LVC D;  3VRQ A;  3I5I B;  4PCW A;  4HRG A;  1A75 B;  2LHI A;  2BBN A;  1Y1A A;  3VRP A;  2WOS A;  3CAB A;  4JD9 A;  4HRH A;  3I5F C;  2H61 C;  4OR9 B;  1BMO A;  1TNP A;  1S36 A;  2KDH A;  2PYQ A;  2B1U A;  3NSI A;  2KPH A;  3VRR A;  3RLZ A;  1CMF A;  2JWW A;  3O6B A;  1YVL A;  3S0E A;  3PAT A;  2F3Y A;  1SR6 B;  4YBH B;  1K9K A;  3L4A A;  2AAO A;  3BUM B;  2KAV A;  1A29 A;  1R2U A;  3O4Y A;  1WY9 A;  2GGM A;  2KQY A;  1NCY A;  2L5Y A;  1DGV A;  2AMI A;  4IL1 A;  1C3Y A;  1CLM A;  4YGE B;  5AXI A;  4PDZ A;  3D75 A;  3B7A A;  2M9G A;  1PVB A;  3DY9 A;  3D73 A;  3N7H A;  1OMR A;  1UUR A;  2P71 A;  3LL8 B;  1W7I B;  4INX A;  3CZT X;  3K21 A;  1RTP 1;  1K96 A;  4JWQ A;  1OOJ A;  3LLE A;  3NHT A;  4M2P A;  4MZK A;  3SS3 A;  1NP8 A;  3L4L A;  1S3P A;  2ZRT A;  5F6T A;  1SMG A;  4CFQ A;  4MBE A;  4OZD A;  2EHB A;  1QX7 A;  3AAK A;  5GQQ C;  1SR6 C;  1JWD A;  1CKK A;  1Q80 A;  2BL0 C;  4UPG A;  3ICB A;  4JKT A;  1MWN A;  1QIW A;  2NZ0 A;  1W7J B;  1DEK A;  3TDI A;  2WCF A;  5AFP A;  3EVR A;  3SG4 A;  4U8D A;  2LVJ A;  3DYE A;  1OE9 B;  1P28 A;  3HX4 A;  1C07 A;  3DZT A;  5CSF A;  3WNX B;  4GAO A;  2KI4 C;  2PMY A;  3IQQ A;  4GGN A;  3BXK A;  1UHN A;  1M46 A;  2M3W A;  3RM1 A;  1FI6 A;  3DF0 B;  3NHI A;  2GGZ A;  2QPT A;  2JU0 A;  2K2F A;  2M49 B;  2BNX A;  2HF5 A;  2F2O A;  1A2X A;  3BOW A;  1J7Q A;  1KSM A;  4YI9 A;  5K89 A;  1K90 D;  2QAC A;  3S0A A;  2WCJ A;  2LVV A;  1RRO A;  1QJT A;  1E8A A;  2OS8 B;  1H8B A;  1XYD A;  2L4I A;  3JVT B;  1B1G A;  2QEO A;  1KFU S;  1SPY A;  1BOD A;  1CFC A;  3B86 A;  2HPS A;  3LK0 A;  3EK7 A;  2FJU B;  2WCM A;  1J1E A;  1JUO A;  1TOP A;  4MN0 A;  1UUS A;  1MHO A;  2H61 A;  4PHN A;  3WXA A;  2IS9 A;  3EVV A;  4MZL A;  2G9B A;  3GOF A;  1IIO A;  2LMT A;  2ZKM X;  1ZAC A;  1FW4 A;  1TN4 A;  4BY5 A;  3FS7 A;  4YRU A;  2PQL A;  1SCV A;  2BCX A;  5DKR A;  2PRU A;  3SJS A;  5D7F A;  5I8N A;  1TUZ A;  2O60 A;  2QEV A;  1B7T Y;  1PVA A;  2Q91 A;  3DVE A;  1OMV A;  1CFD A;  1LIN A;  1UHJ A;  4MRX A;  4MSP A;  2ZN9 A;  5DKQ A;  1ALV A;  3TUY C;  2OS8 C;  1GQM A;  5HLV A;  3JVT C;  1CDM A;  1F4O A;  4NDC A;  2ISD A;  1KSO A;  1A75 A;  1TWO A;  2K7B A;  2WCH A;  3I5G B;  4FQT A;  1LS8 A;  4XYN A;  1W9Z A;  2GTE A;  1T14 A;  2KOT A;  3D78 A;  1B7T Z;  2LUC A;  3O2P A;  3OGN A;  3AAJ A;  3FE9 A;  2LP2 A;  1IKU A;  1XFW O;  2MRD A;  4ICB A;  5HKY A;  1QS7 A;  2WC5 A;  1KFX L;  3BUX B;  4USL A;  5AAN A;  1CNP A;  2WCL A;  2COL B;  2I94 A;  1BR4 B;  4I5J A;  1TIZ A;  1HQV A;  1ZUZ A;  3DVK A;  1EG4 A;  3BUN B;  1V1F A;  1QX2 A;  1Z4H A;  4KYN A;  2LAN A;  3S0B A;  1NCX A;  1GGW A;  2ZNE A;  1NX0 A;  1QIV A;  1AP4 A;  2JZI A;  2KFG A;  4ORC B;  1LKJ A;  1SNL A;  1KK8 B;  2QDI A;  4GGF C;  3I5G C;  2PAL A;  1SSE B;  1DJG A;  3SG5 A;  2ZFD A;  4TNC A;  1UHH A;  2MBX A;  2OTG B;  3WHT B;  3SG3 A;  1F54 A;  3NSL A;  1MR8 A;  1PUL A;  3CS1 A;  5IBW A;  1OOF A;  1CLB A;  2QEB A;  3R1O A;  1C7V A;  1NSH A;  1KK7 Z;  2L2C A;  4L9M A;  3CR2 A;  3R72 A;  2M7L A;  1S5G Y;  2K7C A;  1XVJ A;  2KYF A;  5FYX A;  2FJY A;  1C3Z A;  3CR5 X;  2GV5 A;  1QV1 A;  1SKT A;  5JJG A;  1YX8 A;  4NQG A;  4P2Y B;  1G33 A;  3B87 A;  4F7F A;  1S6J A;  1YUS A;  1TNX A;  3TZ1 A;  1IRJ A;  1ZMZ A;  4JPZ B;  3DD4 A;  2L51 A;  4CID A;  2H2K A;  1S5G Z;  1KK8 C;  3HCM A;  5FI2 A;  5ER5 A;  4BY4 A;  2BL0 B;  3TDZ A;  1QX5 B;  2BCA A;  1R6P A;  1WRL A;  2OTG C;  1XFV O;  4I5K A;  4QJ4 B;  1NWD A;  1TRF A;  1OZS A;  5AER A;  1XFZ O;  2LV7 A;  1SCM C;  3DF0 A;  1CDN A;  4MLW A;  3PN7 B;  3V2L A;  3CWG A;  3VRN A;  2KI4 B;  4CPV A;  2JPT A;  3BJH A;  4MZJ A;  3BFB A;  3VB1 A;  4WQ2 A;  3SG6 A;  1DQE A;  1Y1X A;  1XO5 A;  3GK1 A;  1WRZ A;  5ER4 X;  3EG5 B;  1YUT A;  2KFH A;  1U5I B;  1H4B A;  2L50 A;  1CDL A;  2M1U A;  1NX1 A;  3M0W A;  4JQ0 D;  1A03 A;  1IQ3 A;  1XFX O;  1UHI A;  2KLD A;  2WC8 A;  1L7Z A;  2KNE A;  3NSO A;  1XK4 C;  2JT3 A;  2P6B B;  2F2P A;  1TCF A;  2K60 A;  1TNW A;  3CZ0 A;  4AQJ A;  1SBJ A;  1AK8 A;  3BQ3 A;  2MJW B;  2WND A;  2D8N A;  3D0Y B;  1OSA A;  3PN7 C;  3OHM B;  4GPL B;  4DCK A;  1M45 A;  2LVI A;  2QEH A;  3GK2 A;  3KHE A;  1AJ4 A;  1UWO A;  2Q4U A;  1JSA A;  2LLS A;  3SS4 A;  1AUI B;  2LLU A;  2JC2 A;  2K7O A;  5TNC A;  5HYD A;  2FCE A;  4A4B A;  5HL1 A;  4GGF A;  1DJX A;  1BLQ A;  2L98 A;  1TNQ A;  3CLN A;  1FI5 A;  4WQ3 A;  2KGB C;  2ZRS A;  5CSN A;  1M31 A;  3TUY B;  4ETO A;  1BG1 A;  1J7P A;  3CZ2 A;  3OB1 B;  1QLS A;  4GFT A;  1DJY A;  4N1G A;  2Y1M A;  3KPX A;  3E3R A;  1RJV A;  2KBM A;  3A8R A;  1S6C A;  5CSJ A;  5I2L A;  4DS7 A;  3PAL A;  3RZS A;  3CZ1 A;  4QJ3 B;  2YGU A;  1F71 A;  5HKZ A;  3SIB A;  3EKJ A;  2JNX A;  1VRK A;  3B88 A;  2LCP A;  3PJI A;  2KI6 D;  2LC5 A;  4C0J A;  3D10 A;  1IG5 A;  2EC6 B;  2KLE A;  3SIA A;  2LMV A;  2WCB A;  4M2Q A;  5CSI A;  3OX6 A;  1S26 D;  1JFJ A;  3D74 A;  5J3X A;  1BOC A;  2L0P A;  4ORB B;  1B8R A;  1L2O B;  1NYA A;  2JPO A;  1G8I A;  1K9U A;  4INW A;  5I2O A;  3LCP C;  1K94 A;  1QXP A;  1SK6 D;  3SG7 A;  1LA3 A;  2I18 A;  3H4S E;  2LVK A;  5HKW A;  4F0Z B;  1DGU A;  1CM1 A;  1ORG A;  3DVM A;  4Q04 A;  1OW4 A;  1SW8 A;  3FWC A;  1PAL A;  4N1F A;  3C1V A;  1CTR A;  2JTZ A;  3GK4 X;  2HET A;  1KQM B;  3FE6 A;  2CXJ A;  1MXE A;  1Y6W A;  1YR5 A;  2EC6 C;  2HQ8 A;  2NCP A;  3AKA A;  3EK8 A;  4XJK B;  3BFA A;  1M63 B;  1JC2 A;  1KQV A;  5KSZ A;  3TS5 B;  1BR1 B;  2FOT A;  1PRW A;  2PSR A;  1DMO A;  2MLF C;  1FBV A;  1L2O C;  1N2D A;  1WDC B;  2M97 A;  4PE7 A;  4I5N B;  1EG3 A;  2I7A A;  2WCE A;  1X02 A;  1XK4 A;  4OVN F;  2BBM A;  3I5H B;  4E68 A;  1KK7 Y;  2M8U A;  2PAS A;  1NX2 A;  1K95 A;  1YRT B;  4YGA A;  1PSB A;  1S1E A;  3PSR A;  4PT1 A;  3VRO A;  3BYA A;  2LM5 A;  1SY9 A;  1QAS A;  5KTY A;  1F4Q A;  3KF9 A;  1DTL A;  3MSE B;  1V1G A;  1B47 A;  2F8P A;  1KWO B;  1SCM B;  1F8H A;  2JOJ A;  3OB2 B;  1KQM C;  3BFH A;  4YGD B;  3PM2 A;  1DJI A;  2NLN A;  4MVF A;  5CPV A;  2K2A A;  3KO0 A;  2L2E A;  1IJ5 A;  3DVJ A;  1U5I A;  1SL9 A;  3BUO B;  3TS5 C;  1B8L A;  1OOI X;  1Y1U A;  2WOR A;  4N5X A;  4M2O A;  2JNF A;  2KYC A;  3CDN A;  3CTN A;  4MEW A;  1WDC C;  1DF0 B;  4MRY A;  2M29 A;  2Y4Q A;  1CM4 A;  2KBI A;  3I5H C;  1QAT A;  2CTN A;  4C0K A;  1FF1 A;  3CYZ A;  5DKN A;  1BU3 A;  3QME A;  4CFR A;  1IH0 A;  4GUK A;  2MHH A;  2MA2 A;  1NCZ A;  2KSP A;  3D0Y A;  3R1P A;  1CLL A;  4AOM A;  2E30 A;  2LHL A;  5KU1 A;  2Y1N A;  1KWO C;  2KAX A;  2NXQ A;  3EKH A;  4D1E A;  1N65 A;  1EH2 A;  5EL2 A;  2TN4 A;  1GJY A;  1EXR A;  4YGB B;  1YVH A;  5D3O A;  3KEV A;  2V53 A;  1TUJ A;  1G4Y R;  2M7N A;  1K93 D;  1JF2 A;  1OOH A;  3JTD B;  2JUL A;  2KGR A;  3F45 A;  1F55 A;  1WLZ A;  3ZNI A;  3IQO A;  3A4U B;  1BJF A;  2KHN A;  1J1D A;  3IVT A;  4DIR A;  1N0Y A;  3OX5 A;  1YRU B;  1QTX A;  1DJH A;  1C7W A;  1UP5 A;  1Y0V H;  4FQO A;  2LLT A;  2LNK A;  1M39 A;  3IF7 A;  3O4X A;  1J7O A;  5BPJ A;  2O5G A;  3I5I C;  4NDB A;  3R1V A;  4P5O E;  1PK0 D;  1CFP A;  1XFY O;  2SAS A;  1WLM A;  2JXL A;  2LAP A;  3FWB A;  2KI6 C;  3OBV A;  4PHJ A;  2CT9 A;  1CB1 A;  2P70 A;  1DJZ A;  3JTD C;  1DJW A;  1D1O A;  1REC A;  2M1K B;  1IQ5 A;  2K61 A;  1EL4 A;  3OP0 A;  3NXA A;  1CFF A;  2I2R E;  2F33 A;  2MLE C;  2Y5I A;  5G08 A;  4YI8 A;  1DT7 B;  2JTT A;  1SRA A;  1MUX A;  4YGC B;  2NCO A;  4PAL A;  3O78 A;  5D69 A;  4OCI A;  3D77 A;  4OV2 A;  1B4C A;  1DC1 A;  5B8I B;  1JF0 A;  5DIC A;  2JRF A;  2LE9 B;  3PLF B;  3PM8 A;  1KFX S;  1CMG A;  2RGI A;  4XJK A;  1NPQ A;  2BE6 A;  3EK4 A;  2JT0 A;  2BKI B;  3PFV A;  1KCY A;  1MF8 B;  2L5X B;  1BF5 A;  2R2I A;  1OQP A;  1QLK A;  1OMD A;  3UNW A;  1QV0 A;  2ZND A;  1F70 A;  5HLO A;  2PVB A;  3ZWH A;  1DEL A;  1YX7 A;  2WCK A;  1TCO B;  4PE0 A;  2KQ6 A;  2LUX A;  2MAZ A;  2JT8 A;  1FPW A;  2CNP A;  1IGV A;  4GNK B;  3D76 A; 
#chains in the Genus database with same CATH homology
 1SL7 A;  1J55 A;  4A4C A;  1QVI Y;  2A4J A;  2LP3 A;  1MQ1 A;  1YUU A;  2OPO A;  4CLN A;  2K8M B;  1ODB A;  1YTZ C;  3WHU B;  3TDU A;  1ZOT B;  1J7R A;  3LK1 A;  1UHK A;  1A4P A;  2CBL A;  4DRW A;  2CCM A;  2BKH B;  1DVI A;  1DF0 A;  1NX3 A;  2BE4 A;  4C0L A;  1HT9 A;  1QVI Z;  1AHR A;  2KFF A;  3CR4 X;  4ZCU A;  3SG2 A;  2M0R A;  2LMU A;  2L4H A;  1IWQ A;  2KAY A;  2SCP A;  4PE1 A;  1NIW A;  2DOQ A;  3VGO A;  4AQI A;  2EGD A;  2K7D A;  4I5L B;  5JOL A;  2ZN8 A;  3QRX A;  2HQW A;  2AUC A;  3BOW B;  3CGA A;  1JFK A;  2FCD A;  4PE4 A;  1EJ3 A;  3AKB A;  1WRK A;  4R1E A;  4FTG A;  4OKH A;  1KFU L;  1AVS A;  2E6W A;  1XFU O;  3EVU A;  2BEC A;  3BUW B;  4WRI A;  2VRG A;  2BCB A;  1LXF C;  2F3Z A;  1BT6 A;  4PHM A;  2JXC A;  2K0J A;  3NSK A;  1K9P A;  3FIA A;  3I5F B;  1SYM A;  1JBA A;  1CDP A;  1IJ6 A;  1OZO A;  4QJ5 B;  1LA0 A;  1AJ5 A;  1TTX A;  1SL8 A;  1YUR A;  4ORA B;  4PHK A;  1B9A A;  4DUQ A;  1ZFS A;  2G2B A;  1B8C A;  2JQ6 A;  1GGZ A;  1RWY A;  1MXL C;  5PAL A;  1K2H A;  1XA5 A;  1ALW A;  1NUB A;  1PSR A;  4GBA A;  4HSZ A;  5I2Q A;  4HRE E;  4ZCV A;  4NDD A;  5AEQ A;  1RK9 A;  1S6I A;  1K8U A;  1RFJ A;  1LVC D;  3VRQ A;  3I5I B;  4PCW A;  4HRG A;  1A75 B;  2LHI A;  2BBN A;  1Y1A A;  3VRP A;  2WOS A;  4HRH A;  3I5F C;  2H61 C;  4OR9 B;  1BMO A;  1TNP A;  1S36 A;  2KDH A;  2B1U A;  3NSI A;  3VRR A;  3RLZ A;  1CMF A;  2JWW A;  3O6B A;  1YVL A;  3PAT A;  2F3Y A;  1SR6 B;  4YBH B;  1K9K A;  2AAO A;  3BUM B;  2KAV A;  1A29 A;  1R2U A;  3O4Y A;  1WY9 A;  2GGM A;  2KQY A;  1NCY A;  1DGV A;  2AMI A;  4IL1 A;  1CLM A;  4YGE B;  5AXI A;  4PDZ A;  2M9G A;  1PVB A;  1OMR A;  1UUR A;  3LL8 B;  1W7I B;  3CZT X;  3K21 A;  1RTP 1;  1K96 A;  4JWQ A;  1OOJ A;  3LLE A;  4M2P A;  4MZK A;  1NP8 A;  1S3P A;  2ZRT A;  5F6T A;  1SMG A;  4CFQ A;  4MBE A;  2EHB A;  1QX7 A;  3AAK A;  5GQQ C;  1SR6 C;  1JWD A;  1CKK A;  1Q80 A;  2BL0 C;  4UPG A;  3ICB A;  1MWN A;  1QIW A;  2NZ0 A;  1W7J B;  3TDI A;  2WCF A;  5AFP A;  3EVR A;  3SG4 A;  4U8D A;  2LVJ A;  1OE9 B;  3HX4 A;  1C07 A;  5CSF A;  3WNX B;  4GAO A;  2KI4 C;  2PMY A;  3IQQ A;  4GGN A;  3BXK A;  1UHN A;  1M46 A;  2M3W A;  3RM1 A;  1FI6 A;  3DF0 B;  2GGZ A;  2QPT A;  2JU0 A;  2K2F A;  2M49 B;  2HF5 A;  2F2O A;  1A2X A;  3BOW A;  1J7Q A;  1KSM A;  4YI9 A;  5K89 A;  1K90 D;  2QAC A;  2LVV A;  1RRO A;  1QJT A;  1E8A A;  2OS8 B;  1H8B A;  1XYD A;  2L4I A;  3JVT B;  1B1G A;  1KFU S;  1SPY A;  1BOD A;  1CFC A;  2HPS A;  3LK0 A;  3EK7 A;  2FJU B;  4MN0 A;  1J1E A;  1JUO A;  1TOP A;  1UUS A;  1MHO A;  2H61 A;  4PHN A;  3WXA A;  2IS9 A;  3EVV A;  4MZL A;  2G9B A;  3GOF A;  2LMT A;  2ZKM X;  1ZAC A;  1FW4 A;  1TN4 A;  4BY5 A;  3FS7 A;  4YRU A;  1SCV A;  2BCX A;  5DKR A;  2PRU A;  3SJS A;  5D7F A;  5I8N A;  2O60 A;  1B7T Y;  1PVA A;  2Q91 A;  3DVE A;  1OMV A;  1CFD A;  1LIN A;  1UHJ A;  4MRX A;  4MSP A;  2ZN9 A;  5DKQ A;  1ALV A;  3TUY C;  2OS8 C;  1GQM A;  5HLV A;  3JVT C;  1CDM A;  1F4O A;  4NDC A;  2ISD A;  1KSO A;  1A75 A;  2K7B A;  3I5G B;  4XYN A;  2KOT A;  1B7T Z;  2LUC A;  3O2P A;  3AAJ A;  1IKU A;  2LP2 A;  1XFW O;  2MRD A;  4ICB A;  5HKY A;  1QS7 A;  1KFX L;  3BUX B;  4USL A;  5AAN A;  1CNP A;  2COL B;  2I94 A;  1BR4 B;  4I5J A;  1TIZ A;  1HQV A;  1ZUZ A;  3DVK A;  1EG4 A;  3BUN B;  1V1F A;  1QX2 A;  2LAN A;  1NCX A;  1GGW A;  2ZNE A;  1NX0 A;  1QIV A;  1AP4 A;  2JZI A;  2KFG A;  4ORC B;  1LKJ A;  1SNL A;  1KK8 B;  4GGF C;  3I5G C;  2PAL A;  1DJG A;  3SG5 A;  2ZFD A;  4TNC A;  1UHH A;  2MBX A;  2OTG B;  3WHT B;  3SG3 A;  1F54 A;  3NSL A;  1MR8 A;  1PUL A;  3CS1 A;  5IBW A;  1CLB A;  1C7V A;  1NSH A;  1KK7 Z;  4L9M A;  3CR2 A;  2M7L A;  1S5G Y;  2K7C A;  1XVJ A;  2KYF A;  5FYX A;  3CR5 X;  2GV5 A;  1QV1 A;  1SKT A;  5JJG A;  1YX8 A;  4NQG A;  4P2Y B;  1G33 A;  1S6J A;  1YUS A;  1TNX A;  3TZ1 A;  1IRJ A;  1ZMZ A;  4JPZ B;  3DD4 A;  2L51 A;  4CID A;  2H2K A;  1S5G Z;  1KK8 C;  3HCM A;  4BY4 A;  5ER5 A;  2BL0 B;  3TDZ A;  1QX5 B;  2BCA A;  1R6P A;  1WRL A;  2OTG C;  1XFV O;  4I5K A;  4QJ4 B;  1NWD A;  1TRF A;  1OZS A;  5AER A;  1XFZ O;  2LV7 A;  1SCM C;  3DF0 A;  1CDN A;  4MLW A;  3PN7 B;  3CWG A;  3VRN A;  2KI4 B;  4CPV A;  2JPT A;  4MZJ A;  4WQ2 A;  3SG6 A;  1Y1X A;  1XO5 A;  3GK1 A;  1WRZ A;  5ER4 X;  1YUT A;  2KFH A;  1U5I B;  1H4B A;  2L50 A;  1CDL A;  2M1U A;  1NX1 A;  3M0W A;  4JQ0 D;  1A03 A;  1IQ3 A;  1XFX O;  1UHI A;  2WC8 A;  1L7Z A;  2KNE A;  3NSO A;  1XK4 C;  2JT3 A;  2P6B B;  2F2P A;  1TCF A;  1TNW A;  4AQJ A;  1AK8 A;  1SBJ A;  3BQ3 A;  2MJW B;  2WND A;  2D8N A;  3D0Y B;  1OSA A;  3PN7 C;  3OHM B;  4GPL B;  4DCK A;  1M45 A;  2LVI A;  3GK2 A;  3KHE A;  1AJ4 A;  1UWO A;  2Q4U A;  1JSA A;  2LLS A;  1AUI B;  2LLU A;  2JC2 A;  2K7O A;  5TNC A;  5HYD A;  2FCE A;  4A4B A;  4GGF A;  1DJX A;  1BLQ A;  2L98 A;  1TNQ A;  3CLN A;  1FI5 A;  4WQ3 A;  2KGB C;  2ZRS A;  5CSN A;  1M31 A;  3TUY B;  4ETO A;  1BG1 A;  1J7P A;  3OB1 B;  4N1G A;  1QLS A;  4GFT A;  1DJY A;  2Y1M A;  3KPX A;  3E3R A;  1RJV A;  2KBM A;  3A8R A;  1S6C A;  5CSJ A;  5I2L A;  4DS7 A;  3PAL A;  4QJ3 B;  1F71 A;  5HKZ A;  3SIB A;  3EKJ A;  2JNX A;  1VRK A;  2LCP A;  2KI6 D;  2LC5 A;  4C0J A;  3D10 A;  1IG5 A;  2EC6 B;  3SIA A;  2LMV A;  2WCB A;  4M2Q A;  5CSI A;  3OX6 A;  1S26 D;  1JFJ A;  5J3X A;  1BOC A;  2L0P A;  4ORB B;  1B8R A;  1L2O B;  1NYA A;  1G8I A;  1K9U A;  5I2O A;  3LCP C;  1K94 A;  1QXP A;  1SK6 D;  3SG7 A;  1LA3 A;  2I18 A;  3H4S E;  2LVK A;  5HKW A;  4F0Z B;  1DGU A;  1CM1 A;  3DVM A;  4Q04 A;  3FWC A;  1SW8 A;  1PAL A;  4N1F A;  3C1V A;  1CTR A;  2JTZ A;  3GK4 X;  2HET A;  1KQM B;  2CXJ A;  1MXE A;  1Y6W A;  1YR5 A;  2EC6 C;  2HQ8 A;  2NCP A;  3AKA A;  3EK8 A;  4XJK B;  1JC2 A;  1M63 B;  1KQV A;  5KSZ A;  3TS5 B;  1BR1 B;  2FOT A;  1PRW A;  2PSR A;  1DMO A;  2MLF C;  1FBV A;  1L2O C;  1N2D A;  1WDC B;  2M97 A;  4PE7 A;  4I5N B;  1EG3 A;  2I7A A;  2WCE A;  1X02 A;  1XK4 A;  4OVN F;  2BBM A;  3I5H B;  4E68 A;  1KK7 Y;  2M8U A;  2PAS A;  1NX2 A;  1K95 A;  1YRT B;  4YGA A;  1PSB A;  1S1E A;  3PSR A;  3VRO A;  3BYA A;  2LM5 A;  1SY9 A;  1QAS A;  5KTY A;  1F4Q A;  3KF9 A;  1DTL A;  3MSE B;  1V1G A;  1B47 A;  2F8P A;  1KWO B;  1SCM B;  1F8H A;  2JOJ A;  3OB2 B;  1KQM C;  4YGD B;  1DJI A;  2NLN A;  4MVF A;  5CPV A;  2K2A A;  3KO0 A;  2L2E A;  1IJ5 A;  3DVJ A;  1U5I A;  1SL9 A;  3BUO B;  3TS5 C;  1B8L A;  1Y1U A;  4N5X A;  2WOR A;  4M2O A;  2JNF A;  2KYC A;  3CTN A;  4MEW A;  1WDC C;  1DF0 B;  4MRY A;  2M29 A;  2Y4Q A;  1CM4 A;  2KBI A;  3I5H C;  1QAT A;  2CTN A;  4C0K A;  1FF1 A;  5DKN A;  1BU3 A;  4CFR A;  1IH0 A;  4GUK A;  2MHH A;  2MA2 A;  1NCZ A;  2KSP A;  3D0Y A;  1CLL A;  4AOM A;  2E30 A;  2LHL A;  5KU1 A;  2Y1N A;  1KWO C;  2KAX A;  2NXQ A;  3EKH A;  4D1E A;  1N65 A;  1EH2 A;  2TN4 A;  1GJY A;  1EXR A;  4YGB B;  1YVH A;  3KEV A;  2V53 A;  1G4Y R;  2M7N A;  3JTD B;  1K93 D;  1JF2 A;  2JUL A;  2KGR A;  3F45 A;  1F55 A;  1WLZ A;  3ZNI A;  3IQO A;  3A4U B;  1BJF A;  2KHN A;  1J1D A;  4DIR A;  1N0Y A;  3OX5 A;  1YRU B;  1QTX A;  1DJH A;  1C7W A;  1UP5 A;  1Y0V H;  4FQO A;  2LLT A;  2LNK A;  1M39 A;  3IF7 A;  1J7O A;  5BPJ A;  2O5G A;  3I5I C;  4NDB A;  4P5O E;  1CFP A;  1PK0 D;  1XFY O;  2SAS A;  1WLM A;  2JXL A;  2LAP A;  3FWB A;  2KI6 C;  4PHJ A;  1CB1 A;  2CT9 A;  1DJZ A;  3JTD C;  1DJW A;  1D1O A;  1REC A;  2M1K B;  1IQ5 A;  2K61 A;  1EL4 A;  3OP0 A;  3NXA A;  1CFF A;  2I2R E;  2F33 A;  2MLE C;  2Y5I A;  5G08 A;  4YI8 A;  1DT7 B;  2JTT A;  1SRA A;  1MUX A;  4YGC B;  2NCO A;  4PAL A;  3O78 A;  5D69 A;  4OCI A;  4OV2 A;  1B4C A;  5B8I B;  1JF0 A;  2JRF A;  2LE9 B;  3PLF B;  3PM8 A;  1KFX S;  1CMG A;  2RGI A;  4XJK A;  1NPQ A;  2BE6 A;  3EK4 A;  2JT0 A;  2BKI B;  3PFV A;  1KCY A;  1MF8 B;  2L5X B;  1BF5 A;  2R2I A;  1OQP A;  1QLK A;  1OMD A;  1QV0 A;  2ZND A;  1F70 A;  5HLO A;  2PVB A;  3ZWH A;  1YX7 A;  1TCO B;  4PE0 A;  2KQ6 A;  2LUX A;  2MAZ A;  2JT8 A;  1FPW A;  2CNP A;  1IGV A;  4GNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...