1UWOA

Calcium form of human s100b, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100B
publication title A novel calcium-sensitive switch revealed by the structure of human S100B in the calcium-bound form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uwoA00
3CLNA 3EKJA 1TNQA 1WLMA 1OSAA 2ZN8A 3EVVA 1J7RA 3EVRA 3GK4X 4YI8A 5AXIA 1BLQA 1JWDA 1J1DA 4PE1A 1M46A 4YGEB 1SBJA 1F4QA 1UHJA 1G33A 2M29A 3GK2A 2LANA 1B4CA 1AJ4A 2CNPA 2CXJA 1CNPA 2KGRA 2ZRSA 1LVCD 2IS9A 1SR6C 2NCOA 1D1OA 1QLSA 1A4PA 1N2DA 4GBAA 5DKQA 3HCMA 4CIDA 1MWNA 1Y6WA 2L0PA 1IJ6A 5I2QA 2V53A 5DKRA 2JT0A 1DJWA 1IKUA 1KFUS 1OMDA 2JXCA 2JT3A 5AANA 2MA2A 1KK8C 1YUSA 2KFFA 2BE6A 1QIVA 1SL8A 4TNCA 1JSAA 2HPSA 2NCPA 3DVJA 1Y1AA 2NXQA 3WHTB 3D0YA 4M2QA 2BKHB 2OS8B 5GQQC 3CR5X 4FQOA 2KFHA 4ZCUA 5CSFA 3VGOA 3KEVA 4GGFC 1BJFA 2P6BB 1CFFA 1K93D 1JBAA 1FF1A 2MRDA 5B8IB 1IH0A 4M2OA 3OHMB 3DVEA 1M63B 1WDCB 3KF9A 1KSOA 3RLZA 3C1VA 3BUOB 1XYDA 2Y1NA 1CLMA 2O5GA 1S6JA 1XFXO 1EJ3A 1K94A 2F3YA 2WCBA 1UHNA 1Y1XA 1MHOA 1B1GA 2LV7A 4P5OE 2PMYA 1KQVA 1G4YR 1QLKA 1DJXA 1Y0VH 1QVIY 1EL4A 1TNPA 2LVIA 3SG5A 3DF0A 4U8DA 1RJVA 2I2RE 3BUXB 3ICBA 4DRWA 2M97A 1A03A 2AUCA 2ZN9A 4OR9B 3WXAA 3PM8A 1PVAA 4AQIA 4CFQA 4QJ4B 3BUNB 3K21A 2ZNDA 2JZIA 2BCAA 3IQOA 1TCFA 1UHHA 2QPTA 2I18A 1SY9A 1NCZA 4ORAB 2M3WA 4XJKA 2EC6B 4QJ3B 1AUIB 1YUTA 5ER4X 1MR8A 2FOTA 1DJYA 1AHRA 1IRJA 3GK1A 1OMVA 3CWGA 1HQVA 1QV0A 3PN7C 5F6TA 4FTGA 1B47A 5G08A 2KI4C 1SW8A 1S36A 3HX4A 2L50A 1SCMB 2KNEA 1DF0A 4PHKA 2KYCA 1LKJA 1NX3A 1LXFC 4GGNA 1JC2A 1FI5A 1NPQA 1TOPA 4HREE 4WQ3A 1X02A 3EK4A 2O60A 3BOWB 1A75B 5IBWA 1QS7A 3FS7A 1F8HA 2JT8A 1NIWA 2KFGA 2CCMA 2WCFA 1SL7A 2Y4QA 1WRZA 4HRHA 2MHHA 1S1EA 4YBHB 3I5HC 2ZFDA 1CMFA 3FWBA 4MEWA 1EXRA 1QTXA 4WQ2A 4OCIA 1RROA 1MQ1A 1SL9A 1GQMA 2K0JA 2NZ0A 1K2HA 1KCYA 1EG4A 5HLOA 3ZNIA 2JWWA 4ORCB 2KGBC 1S6CA 1SR6B 4YI9A 5FYXA 2L2EA 3PLFB 3VRPA 3IQQA 1BF5A 4YGAA 1PALA 2BCXA 2TN4A 1RTP1 1J7QA 1FW4A 1M45A 1XK4C 2G9BA 3CTNA 2K7BA 1W7JB 3NSOA 1QX2A 1CDMA 2GV5A 3CZTX 1YVHA 2RGIA 3M0WA 3OX6A 1BR4B 1QATA 3A8RA 4MBEA 4PE0A 1L7ZA 5CSJA 2KHNA 1ZMZA 2KSPA 1NUBA 4MZLA 4QJ5B 1TCOB 1GGWA 2KBMA 2PASA 2KAYA 3LK0A 5I2LA 4BY5A 1YX7A 1KK8B 1YTZC 2H61A 1YVLA 4PALA 2LC5A 2M7NA 2LLUA 4N5XA 1R2UA 1M31A 2CT9A 1NX2A 3PFVA 1XVJA 2M1UA 4NQGA 2LCPA 4I5JA 1XFVO 1SRAA 2LP3A 1KFXL 3LLEA 2DOQA 2LVVA 2JNFA 3OP0A 2EGDA 2HF5A 3PALA 2KBIA 2GGMA 1MF8B 1N65A 3I5FB 3RM1A 1IQ3A 1IQ5A 2LHIA 4GNKB 1LINA 2LAPA 2Y1MA 1UUSA 2WCEA 5HYDA 1OZSA 1PSRA 2M9GA 4PE7A 1MXLC 2MAZA 3TZ1A 3MSEB 2LLTA 2LVJA 1NSHA 3SIAA 2LLSA 4WRIA 1HT9A 1Q80A 2LNKA 1E8AA 2VRGA 4OKHA 1EH2A 1UHIA 4USLA 5TNCA 3SJSA 3JVTC 1KSMA 1V1GA 1IJ5A 3NXAA 5CSIA 4A4CA 1B8CA 5ER5A 3D0YB 2A4JA 1B8RA 2SCPA 3SG3A 1SKTA 2F2OA 2MLFC 2BL0C 1ALVA 1KWOC 1K8UA 1XA5A 1CTRA 1S5GZ 2FCDA 2JNXA 4M2PA 3VRRA 1BT6A 3CGAA 5KTYA 2LUXA 4NDBA 1LA3A 1L2OC 4JWQA 2E30A 2M49B 4PCWA 2KI6D 3SG6A 4C0LA 1A29A 2Y5IA 4I5LB 2LVKA 1KK7Z 5HLVA 1BOCA 1KQMC 1FI6A 2BECA 2MJWB 1YR5A 1K90D 3NSLA 2M8UA 1VRKA 2K8MB 1WDCC 3I5IB 1CDNA 2L98A 1XFUO 1RECA 2GGZA 4BY4A 3JTDB 4MN0A 1AK8A 4D1EA 1SCVA 1KFXS 1RWYA 3LK1A 1K9KA 3KHEA 1CM1A 1SYMA 1JFJA 1CFDA 4CPVA 1SMGA 3SG4A 1YUUA 1ZFSA 1GJYA 2JULA 2OTGC 1FBVA 3WNXB 1NWDA 2R2IA 3LL8B 2K7DA 1C7WA 2KI6C 1BR1B 2KYFA 1CLBA 1WLZA 1G8IA 3A4UB 1F54A 1A2XA 3OX5A 1CDLA 1CB1A 2LE9B 3BOWA 3OB1B 2JPTA 1S26D 1GGZA 4MZJA 1PK0D 4R1EA 3TS5C 1BODA 1PULA 1AVSA 2LHLA 3SG2A 1CFPA 3CS1A 4CFRA 3E3RA 1QIWA 1YRUB 1M39A 1OE9B 1S3PA 5CPVA 4ICBA 1F4OA 1MUXA 2K7CA 3FIAA 4XJKB 5AFPA 1CM4A 3PSRA 1ODBA 2KDHA 2L4IA 1DGUA 2NLNA 3O2PA 1B9AA 1YRTB 2JQ6A 2Q91A 2M0RA 1WRKA 2PVBA 2F8PA 3TUYC 1DJZA 2HQWA 5J3XA 4MSPA 2F33A 1QX7A 2KQ6A 4PHNA 2JOJA 3CR2A 5I8NA 1J7PA 2PRUA 5AERA 2B1UA 4HRGA 1LA0A 1V1FA 3KO0A 1NCXA 3I5GC 2FCEA 3AAKA 4NDCA 2WORA 4XYNA 2E6WA 2WNDA 3O6BA 4E68A 2LMUA 3FWCA 3BXKA 2BE4A 3VRNA 3ZWHA 2BKIB 5BPJA 3TDIA 1BMOA 3TDUA 2K7OA 2I94A 5JOLA 1FPWA 2BBNA 1U5IB 1XFZO 1J1EA 1QXPA 4JPZB 2M7LA 1SK6D 5D69A 5PALA 4GUKA 2K2FA 3AKAA 1RK9A 2BBMA 1K96A 2MBXA 1UHKA 3DVMA 4YGBB 2L4HA 1ZUZA 2PALA 4P2YB 4AQJA 2JU0A 1OMRA 4GGFA 1CLLA 4JQ0D 1F70A 2HETA 2EHBA 2JXLA 4L9MA 1H4BA 2PSRA 1YX8A 1UP5A 3OB2B 1OQPA 4I5NB 1BU3A 4ETOA 2LMTA 3VRQA 4YRUA 3AKBA 4OV2A 2SASA 3JVTB 3VROA 4GFTA 2MLEC 1JUOA 1S5GY 2KQYA 4DUQA 2AMIA 2K61A 2JTZA 1C07A 3LCPC 2JC2A 4N1GA 1TRFA 3BUMB 1KK7Y 4MLWA 1YURA 2CTNA 5HKWA 2H61C 1AJ5A 3TDZA 1DMOA 4MZKA 2H2KA 2Q4UA 2BL0B 3EK7A 5HKYA 1KWOB 4IL1A 5JJGA 2ZRTA 2OS8C 2M1KB 1PRWA 2COLB 4DS7A 1NP8A 1L2OB 4MRYA 1ALWA 3I5FC 3BYAA 1XFWO 1Y1UA 3QRXA 3SG7A 5AEQA 4GPLB 1KQMB 3SIBA 4OVNF 4DCKA 4HSZA 1EG3A 3O4YA 2HQ8A 3CR4X 1XO5A 1K9UA 1NX1A 1N0YA 2FJUB 3PATA 4YGCB 3BQ3A 1WRLA 2BCBA 5I2OA 1F71A 4I5KA 2LM5A 3EK8A 4F0ZB 3DVKA 1DJHA 2WC8A 1J55A 1DJGA 2LMVA 3H4SE 4A4BA 1R6PA 1TTXA 2OTGB 2CBLA 1K9PA 4ZCVA 4C0JA 3GOFA 1F55A 1NYAA 1B8LA 3PN7B 1RFJA 4GAOA 1CDPA 3D10A 1UURA 3NSKA 2F3ZA 2KI4B 4MVFA 3KPXA 1MXEA 1CFCA 4UPGA 3TS5B 1SNLA 3BUWB 1SPYA 1TNWA 3DF0B 1S6IA 4PHJA 1TNXA 2JTTA 1A75A 2I7AA 3I5IC 1DTLA 1ZACA 2JRFA 2D8NA 1J7OA 1K95A 4MRXA 1DT7B 3JTDC 2LUCA 1IGVA 1H8BA 1DGVA 1QVIZ 2L51A 3EVUA 1B7TY 5D7FA 5KSZA 1WY9A 4PE4A 2EC6C 1OZOA 4C0KA 2QACA 2KAXA 2AAOA 1W7IB 5K89A 1TN4A 3AAJA 2L5XB 3I5HB 3TUYB 1QX5B 5HKZA 1KFUL 4ORBB 1JF2A 2K2AA 2LP2A 1PVBA 1BG1A 3EKHA 1DJIA 3DD4A 3F45A 4AOMA 1QJTA 1XFYO 3O78A 1QASA 2F2PA 1XK4A 1NX0A 1ZOTB 1DVIA 1CKKA 1UWOA 1SCMC 2KOTA 1B7TZ 3I5GB 2ZNEA 3NSIA 4YGDB 5CSNA 2KAVA 4CLNA 1CMGA 1DF0B 1OOJA 4DIRA 1IWQA 3WHUB 2OPOA 1QV1A 4Q04A 1JFKA 2G2BA 5DKNA 4PDZA 4N1FA 1JF0A 1PSBA 2ZKMX 4PHMA 1U5IA 1NCYA 3IF7A 4NDDA 1TIZA 1IG5A 5KU1A 2WOSA 2ISDA 1AP4A 1C7VA
chains in the Genus database with same CATH superfamily
3CLNA 3EKJA 1TNQA 1WLMA 1OSAA 2ZN8A 3EVVA 1J7RA 3EVRA 3GK4X 3DY9A 4YI8A 5AXIA 1BLQA 1JWDA 1OOHA 3D76A 1J1DA 4PE1A 1M46A 3BFBA 4YGEB 1SBJA 3DZTA 1F4QA 1UHJA 1G33A 2M29A 3GK2A 5HL1A 2LANA 1B4CA 1AJ4A 2CNPA 1TUZA 2CXJA 1CNPA 4DRWA 2KGRA 2GTEA 3CDNA 2ZRSA 1LVCD 2IS9A 1SR6C 2NCOA 1D1OA 1QLSA 1A4PA 1N2DA 3R1OA 4GBAA 5DKQA 3HCMA 4INXA 4CIDA 1MWNA 1Y6WA 2L0PA 1IJ6A 5I2QA 2V53A 5DKRA 2JT0A 1DJWA 1IKUA 1KFUS 2QEOA 1OMDA 2JXCA 2JT3A 5AANA 2MA2A 1KK8C 1YUSA 2KFFA 2BE6A 1QIVA 1SL8A 4TNCA 1JSAA 2HPSA 2NCPA 2QEVA 3DVJA 1Y1AA 2NXQA 3WHTB 3D0YA 4M2QA 2BKHB 2OS8B 5GQQC 3CR5X 4FQOA 2KFHA 2L2CA 4ZCUA 5CSFA 3S0BA 3VGOA 3KEVA 4GGFC 1BJFA 3D77A 2P6BB 1CFFA 1K93D 1OOFA 1JBAA 1FF1A 2MRDA 5B8IB 1IH0A 4M2OA 3OHMB 3DVEA 1M63B 1WDCB 3KF9A 1KSOA 3RLZA 3C1VA 3SS4A 3BUOB 1XYDA 2Y1NA 1CLMA 2O5GA 1S6JA 1XFXO 1EJ3A 3FE9A 1W9ZA 1K94A 2F3YA 2WCBA 1UHNA 1Y1XA 1MHOA 1B1GA 2LV7A 4P5OE 2PMYA 2PQLA 3R1VA 1KQVA 1G4YR 1QLKA 4F7FA 1DJXA 1Y0VH 1QVIY 3L4AA 1EL4A 2KPHA 1TNPA 2LVIA 2WCHA 3DF0A 4U8DA 1RJVA 2I2RE 3BUXB 3ICBA 3SG5A 2M97A 1A03A 2AUCA 2ZN9A 4OR9B 3WXAA 3PM8A 1PVAA 4AQIA 4CFQA 1XFRA 4QJ4B 3BUNB 3K21A 1OOIX 2JZIA 2ZNDA 2BCAA 3IQOA 1TCFA 1UHHA 2QPTA 2I18A 1SY9A 1NCZA 3BJHA 3O4XA 4ORAB 2M3WA 4XJKA 2EC6B 4QJ3B 1AUIB 1YUTA 5ER4X 1MR8A 2FOTA 1DJYA 1AHRA 1IRJA 3GK1A 1OMVA 3CWGA 1C3ZA 1HQVA 1QV0A 3PN7C 5F6TA 4FTGA 3VB1A 1B47A 5G08A 2KI4C 1SW8A 1S36A 3HX4A 2L50A 1SCMB 2KNEA 1DF0A 4PHKA 2KYCA 1LKJA 1NX3A 1LXFC 4GGNA 1JC2A 1FI5A 1NPQA 1TOPA 4HREE 4WQ3A 1X02A 3EK4A 2O60A 3BOWB 1A75B 1SSEB 5IBWA 3CZ1A 1QS7A 3FS7A 1F8HA 2JT8A 1NIWA 2KFGA 1ORGA 2CCMA 2WCFA 1SL7A 2Y4QA 1WRZA 2QDIA 4CLNA 3IVTA 4HRHA 2MHHA 1TUJA 1S1EA 4YBHB 3I5HC 2ZFDA 1CMFA 3FWBA 1DELA 4MEWA 5DICA 1EXRA 1QTXA 4WQ2A 4OCIA 1RROA 1MQ1A 1SL9A 1GQMA 2K0JA 2NZ0A 1K2HA 1KCYA 1EG4A 5HLOA 3ZNIA 2JWWA 4ORCB 2KGBC 1S6CA 1SR6B 3D75A 4YI9A 2L2EA 3PLFB 5FYXA 3IQQA 3VRPA 1BF5A 4YGAA 1PALA 2BCXA 2TN4A 1RTP1 1J7QA 1FW4A 1M45A 1XK4C 2G9BA 3N7HA 3CTNA 2K7BA 1W7JB 3NSOA 1QX2A 1CDMA 2GV5A 3CZTX 1YVHA 2RGIA 3M0WA 3OX6A 1BR4B 1QATA 3A8RA 4MBEA 4PE0A 1GM0A 1L7ZA 5CSJA 2KHNA 1ZMZA 2KSPA 1NUBA 3Q8IA 4MZLA 4QJ5B 1TCOB 1GGWA 2KBMA 2PASA 2KAYA 3LK0A 5I2LA 4BY5A 1YX7A 1KK8B 1YTZC 2H61A 1YVLA 4PALA 2LC5A 2M7NA 2QEHA 2LLUA 2WCJA 4N5XA 1R2UA 1M31A 2CT9A 1NX2A 3PFVA 1XVJA 2M1UA 4NQGA 2LCPA 4I5JA 1XFVO 1SRAA 2LP3A 1KFXL 3LLEA 5FI6A 2DOQA 2LVVA 2JNFA 3OP0A 2EGDA 2HF5A 3PALA 2KBIA 2GGMA 1MF8B 1N65A 3I5FB 3RM1A 1IQ3A 1IQ5A 2LHIA 4GNKB 1LINA 2LAPA 2Y1MA 4IJ7A 3SS3A 1UUSA 2WCEA 2QEBA 5HYDA 1OZSA 1PSRA 2M9GA 4PE7A 1MXLC 2MAZA 3TZ1A 3MSEB 2LLTA 2LVJA 1NSHA 3SIAA 3K1EA 2LLSA 4WRIA 1HT9A 1Q80A 2LNKA 1E8AA 2VRGA 4OKHA 1EH2A 1UHIA 2PYQA 4USLA 5TNCA 3SJSA 3JVTC 1KSMA 1V1GA 1IJ5A 3NXAA 5CSIA 3NHIA 2KLDA 4A4CA 3B87A 1B8CA 3EG5B 5ER5A 3D0YB 2A4JA 1B8RA 2SCPA 3SG3A 1SKTA 2F2OA 2MLFC 2BL0C 5FI7A 1ALVA 1KWOC 2KLEA 1K8UA 1XA5A 1CTRA 1S5GZ 2FCDA 2JNXA 4M2PA 3VRRA 1BT6A 3CGAA 5KTYA 2LUXA 4NDBA 1LA3A 1L2OC 4JWQA 2E30A 2M49B 4PCWA 2KI6D 3SG6A 2BAPA 1A29A 2Y5IA 4I5LB 4C0LA 2LVKA 1KK7Z 1T14A 5HLVA 1KQMC 1BOCA 1FI6A 2BECA 2MJWB 1YR5A 1K90D 3NSLA 2H8VA 1VRKA 2K8MB 1WDCC 2M8UA 3I5IB 1CDNA 1DQEA 3QMEA 2L98A 1XFUO 1RECA 2GGZA 4BY4A 3JTDB 4MN0A 1AK8A 4FQTA 4D1EA 1SCVA 1KFXS 1RWYA 3R1PA 3LK1A 1K9KA 3KHEA 1CM1A 1SYMA 1JFJA 1CFDA 4CPVA 1SMGA 3SG4A 3DYEA 1YUUA 1ZFSA 1GJYA 2JULA 2L5YA 2OTGC 2P71A 3B6XA 1FBVA 3WNXB 1NWDA 2R2IA 3LL8B 2K7DA 1C7WA 2KI6C 3S0DA 1BR1B 2KYFA 1CLBA 1WLZA 1G8IA 1IIOA 3A4UB 1F54A 1A2XA 3OX5A 1CDLA 1CB1A 2LE9B 3BOWA 3OB1B 2JPTA 1S26D 1GGZA 4MZJA 1PK0D 4R1EA 3TS5C 1BODA 1PULA 1AVSA 2LHLA 3SG2A 1CFPA 3CS1A 4CFRA 3E3RA 1QIWA 1YRUB 1M39A 1OE9B 3PJIA 1S3PA 5CPVA 1TWOA 4ICBA 1F4OA 1MUXA 2K7CA 3V2LA 3FIAA 4XJKB 5AFPA 1CM4A 3PSRA 1ODBA 2KDHA 2L4IA 1DGUA 2NLNA 3D73A 1B9AA 3O2PA 3PM2A 3S0EA 1YRTB 2JQ6A 2Q91A 2M0RA 2WCKA 1WRKA 2PVBA 2F8PA 3TUYC 1DJZA 2HQWA 3CABA 5J3XA 4MSPA 2F33A 1QX7A 2KQ6A 1Z2CB 1DC1A 1QWVA 2JOJA 4PHNA 3NHTA 1C3YA 3CR2A 5FI2A 5I8NA 1J7PA 2PRUA 1OOGA 2B1UA 4HRGA 1LA0A 1V1FA 3KO0A 1NCXA 5AERA 3RZSA 3I5GC 2FCEA 1OW4A 3AAKA 3CYZA 2WORA 4NDCA 4XYNA 2E6WA 2WNDA 3O6BA 4E68A 2LMUA 3FWCA 3BXKA 3S0GA 2BE4A 3VRNA 3ZWHA 4KYNA 2BKIB 5BPJA 3TDIA 1BMOA 3TDUA 2K7OA 2WCLA 2I94A 5JOLA 1FPWA 1XFZO 1U5IB 2BBNA 1J1EA 1QXPA 4JPZB 2M7LA 1SK6D 5D69A 5PALA 4INWA 2P70A 4GUKA 2K2FA 3S0FA 3L4LA 3AKAA 1RK9A 2BBMA 2JPOA 1K96A 2MBXA 1UHKA 3DVMA 4YGBB 2L4HA 1ZUZA 2PALA 4P2YB 4AQJA 1P28A 2JU0A 3OBVA 1OMRA 4GGFA 1CLLA 4JQ0D 1F70A 2HETA 2EHBA 2JXLA 4L9MA 1H4BA 2PSRA 1YX8A 1UP5A 3OB2B 1OQPA 4I5NB 1BU3A 4ETOA 2LMTA 3VRQA 4YRUA 3AKBA 4OV2A 2SASA 3JVTB 3VROA 4GFTA 4JKTA 2MLEC 1JUOA 1S5GY 2KQYA 4DUQA 2AMIA 2K61A 2JTZA 2WCMA 3DXLA 2WC6A 1C07A 3LCPC 3SS5A 3L47A 2JC2A 4N1GA 1TRFA 3BUMB 1KK7Y 4MLWA 1YURA 2CTNA 5HKWA 2H61C 1AJ5A 3TDZA 3UNWA 4MZKA 2H2KA 1DMOA 2Q4UA 2BL0B 3EK7A 5HKYA 1KWOB 4IL1A 5JJGA 2ZRTA 2OS8C 2M1KB 1PRWA 2COLB 4DS7A 2ERBA 1NP8A 1L2OB 4MRYA 1ALWA 3I5FC 3BYAA 1XFWO 1Y1UA 3QRXA 3SG7A 5AEQA 4GPLB 1KQMB 3SIBA 4OVNF 4DCKA 4HSZA 1EG3A 3O4YA 4OZDA 2HQ8A 4PT1A 3CR4X 1XO5A 1K9UA 1NX1A 1N0YA 2FJUB 3PATA 3B7AA 4YGCB 2BNXA 3B88A 3BQ3A 1WRLA 2BCBA 5I2OA 1F71A 4I5KA 2LM5A 3EK8A 2FJYA 2YGUA 4F0ZB 3DVKA 1DJHA 2WC8A 3UO9A 1J55A 1DJGA 2LMVA 3H4SE 2K60A 4A4BA 1R6PA 1TTXA 2OTGB 2CBLA 1K9PA 3BFAA 4ZCVA 1LS8A 4C0JA 2WC5A 3GOFA 1NYAA 1B8LA 3PN7B 1F55A 1RFJA 3FE8A 4GAOA 1CDPA 3D10A 1UURA 3NSKA 2F3ZA 2KI4B 4MVFA 3KPXA 1MXEA 5EL2A 1CFCA 4UPGA 3TS5B 1SNLA 3BUWB 1SPYA 1TNWA 4JD9A 3DF0B 1S6IA 4PHJA 1TNXA 2JTTA 1A75A 2I7AA 3I5IC 1DTLA 1ZACA 2JRFA 5D3OA 2D8NA 1J7OA 1K95A 1Z4HA 3D74A 4MRXA 1DT7B 3JTDC 2LUCA 1IGVA 1H8BA 1DGVA 1QVIZ 2L51A 3CZ0A 3EVUA 1B7TY 5D7FA 3D78A 5KSZA 1WY9A 3S0AA 4PE4A 2EC6C 1OZOA 4C0KA 2QACA 2KAXA 3CZ2A 2AAOA 1W7IB 1DEKA 5K89A 1TN4A 3AAJA 2L5XB 3I5HB 3TUYB 1QX5B 5HKZA 1KFUL 4ORBB 1JF2A 2K2AA 2LP2A 1PVBA 1BG1A 3EKHA 1DJIA 3DD4A 3F45A 4AOMA 1QJTA 1XFYO 3O78A 3FE6A 1QASA 2F2PA 3BFHA 1XK4A 1NX0A 1ZOTB 1DVIA 1CKKA 1UWOA 1SCMC 2KOTA 1B7TZ 3B86A 2ZNEA 3I5GB 3NSIA 4YGDB 2KAVA 3OGNA 5CSNA 1CMGA 1DF0B 1OOJA 4DIRA 1IWQA 3WHUB 2OPOA 1QV1A 5I94A 4Q04A 1JFKA 2G2BA 5DKNA 4PDZA 4N1FA 1JF0A 1PSBA 2ZKMX 4PHMA 1U5IA 1NCYA 3IF7A 3NGVA 1TIZA 4NDDA 1IG5A 3R72A 2WOSA 2ISDA 5KU1A 1AP4A 1C7VA
chains in the Genus database with same CATH topology
3CLNA 3EKJA 1TNQA 1WLMA 1OSAA 2ZN8A 3EVVA 1J7RA 3EVRA 3GK4X 4YI8A 5AXIA 1BLQA 1JWDA 1J1DA 4PE1A 1M46A 4YGEB 1SBJA 1F4QA 1UHJA 1G33A 2M29A 3GK2A 2LANA 1B4CA 1AJ4A 2CNPA 2CXJA 1CNPA 2KGRA 2ZRSA 1LVCD 2IS9A 1SR6C 2NCOA 1D1OA 1QLSA 1A4PA 1N2DA 4GBAA 5DKQA 3HCMA 4CIDA 1MWNA 1Y6WA 2L0PA 1IJ6A 5I2QA 2V53A 5DKRA 2JT0A 1DJWA 1IKUA 1KFUS 1OMDA 2JXCA 2JT3A 5AANA 2MA2A 1KK8C 1YUSA 2KFFA 2BE6A 1QIVA 1SL8A 4TNCA 1JSAA 2HPSA 2NCPA 3DVJA 1Y1AA 2NXQA 3WHTB 3D0YA 4M2QA 2BKHB 2OS8B 5GQQC 3CR5X 4FQOA 2KFHA 4ZCUA 5CSFA 3VGOA 3KEVA 4GGFC 1BJFA 2P6BB 1CFFA 1K93D 1JBAA 1FF1A 2MRDA 5B8IB 1IH0A 4M2OA 3OHMB 3DVEA 1M63B 1WDCB 3KF9A 1KSOA 3RLZA 3C1VA 3BUOB 1XYDA 2Y1NA 1CLMA 2O5GA 1S6JA 1XFXO 1EJ3A 1K94A 2F3YA 2WCBA 1UHNA 1Y1XA 1MHOA 1B1GA 2LV7A 4P5OE 2PMYA 1KQVA 1G4YR 1QLKA 1DJXA 1Y0VH 1QVIY 1EL4A 1TNPA 2LVIA 3SG5A 3DF0A 4U8DA 1RJVA 2I2RE 3BUXB 3ICBA 4DRWA 2M97A 1A03A 2AUCA 2ZN9A 4OR9B 3WXAA 3PM8A 1PVAA 4AQIA 4CFQA 4QJ4B 3BUNB 3K21A 2ZNDA 2JZIA 2BCAA 3IQOA 1TCFA 1UHHA 2QPTA 2I18A 1SY9A 1NCZA 4ORAB 2M3WA 4XJKA 2EC6B 4QJ3B 1AUIB 1YUTA 5ER4X 1MR8A 2FOTA 1DJYA 1AHRA 1IRJA 3GK1A 1OMVA 3CWGA 1HQVA 1QV0A 3PN7C 5F6TA 4FTGA 1B47A 5G08A 2KI4C 1SW8A 1S36A 3HX4A 2L50A 1SCMB 2KNEA 1DF0A 4PHKA 2KYCA 1LKJA 1NX3A 1LXFC 4GGNA 1JC2A 1FI5A 1NPQA 1TOPA 4HREE 4WQ3A 1X02A 3EK4A 2O60A 3BOWB 1A75B 5IBWA 1QS7A 3FS7A 1F8HA 2JT8A 1NIWA 2KFGA 2CCMA 2WCFA 1SL7A 2Y4QA 1WRZA 4HRHA 2MHHA 1S1EA 4YBHB 3I5HC 2ZFDA 1CMFA 3FWBA 4MEWA 1EXRA 1QTXA 4WQ2A 4OCIA 1RROA 1MQ1A 1SL9A 1GQMA 2K0JA 2NZ0A 1K2HA 1KCYA 1EG4A 5HLOA 3ZNIA 2JWWA 4ORCB 2KGBC 1S6CA 1SR6B 4YI9A 5FYXA 2L2EA 3PLFB 3VRPA 3IQQA 1BF5A 4YGAA 1PALA 2BCXA 2TN4A 1RTP1 1J7QA 1FW4A 1M45A 1XK4C 2G9BA 3CTNA 2K7BA 1W7JB 3NSOA 1QX2A 1CDMA 2GV5A 3CZTX 1YVHA 2RGIA 3M0WA 3OX6A 1BR4B 1QATA 3A8RA 4MBEA 4PE0A 1L7ZA 5CSJA 2KHNA 1ZMZA 2KSPA 1NUBA 4MZLA 4QJ5B 1TCOB 1GGWA 2KBMA 2PASA 2KAYA 3LK0A 5I2LA 4BY5A 1YX7A 1KK8B 1YTZC 2H61A 1YVLA 4PALA 2LC5A 2M7NA 2LLUA 4N5XA 1R2UA 1M31A 2CT9A 1NX2A 3PFVA 1XVJA 2M1UA 4NQGA 2LCPA 4I5JA 1XFVO 1SRAA 2LP3A 1KFXL 3LLEA 2DOQA 2LVVA 2JNFA 3OP0A 2EGDA 2HF5A 3PALA 2KBIA 2GGMA 1MF8B 1N65A 3I5FB 3RM1A 1IQ3A 1IQ5A 2LHIA 4GNKB 1LINA 2LAPA 2Y1MA 1UUSA 2WCEA 5HYDA 1OZSA 1PSRA 2M9GA 4PE7A 1MXLC 2MAZA 3TZ1A 3MSEB 2LLTA 2LVJA 1NSHA 3SIAA 2LLSA 4WRIA 1HT9A 1Q80A 2LNKA 1E8AA 2VRGA 4OKHA 1EH2A 1UHIA 4USLA 5TNCA 3SJSA 3JVTC 1KSMA 1V1GA 1IJ5A 3NXAA 5CSIA 4A4CA 1B8CA 5ER5A 3D0YB 2A4JA 1B8RA 2SCPA 3SG3A 1SKTA 2F2OA 2MLFC 2BL0C 1ALVA 1KWOC 1K8UA 1XA5A 1CTRA 1S5GZ 2FCDA 2JNXA 4M2PA 3VRRA 1BT6A 3CGAA 5KTYA 2LUXA 4NDBA 1LA3A 1L2OC 4JWQA 2E30A 2M49B 4PCWA 2KI6D 3SG6A 4C0LA 1A29A 2Y5IA 4I5LB 2LVKA 1KK7Z 5HLVA 1BOCA 1KQMC 1FI6A 2BECA 2MJWB 1YR5A 1K90D 3NSLA 2M8UA 1VRKA 2K8MB 1WDCC 3I5IB 1CDNA 2L98A 1XFUO 1RECA 2GGZA 4BY4A 3JTDB 4MN0A 1AK8A 4D1EA 1SCVA 1KFXS 1RWYA 3LK1A 1K9KA 3KHEA 1CM1A 1SYMA 1JFJA 1CFDA 4CPVA 1SMGA 3SG4A 1YUUA 1ZFSA 1GJYA 2JULA 2OTGC 1FBVA 3WNXB 1NWDA 2R2IA 3LL8B 2K7DA 1C7WA 2KI6C 1BR1B 2KYFA 1CLBA 1WLZA 1G8IA 3A4UB 1F54A 1A2XA 3OX5A 1CDLA 1CB1A 2LE9B 3BOWA 3OB1B 2JPTA 1S26D 1GGZA 4MZJA 1PK0D 4R1EA 3TS5C 1BODA 1PULA 1AVSA 2LHLA 3SG2A 1CFPA 3CS1A 4CFRA 3E3RA 1QIWA 1YRUB 1M39A 1OE9B 1S3PA 5CPVA 4ICBA 1F4OA 1MUXA 2K7CA 3FIAA 4XJKB 5AFPA 1CM4A 3PSRA 1ODBA 2KDHA 2L4IA 1DGUA 2NLNA 3O2PA 1B9AA 1YRTB 2JQ6A 2Q91A 2M0RA 1WRKA 2PVBA 2F8PA 3TUYC 1DJZA 2HQWA 5J3XA 4MSPA 2F33A 1QX7A 2KQ6A 4PHNA 2JOJA 3CR2A 5I8NA 1J7PA 2PRUA 5AERA 2B1UA 4HRGA 1LA0A 1V1FA 3KO0A 1NCXA 3I5GC 2FCEA 3AAKA 4NDCA 2WORA 4XYNA 2E6WA 2WNDA 3O6BA 4E68A 2LMUA 3FWCA 3BXKA 2BE4A 3VRNA 3ZWHA 2BKIB 5BPJA 3TDIA 1BMOA 3TDUA 2K7OA 2I94A 5JOLA 1FPWA 2BBNA 1U5IB 1XFZO 1J1EA 1QXPA 4JPZB 2M7LA 1SK6D 5D69A 5PALA 4GUKA 2K2FA 3AKAA 1RK9A 2BBMA 1K96A 2MBXA 1UHKA 3DVMA 4YGBB 2L4HA 1ZUZA 2PALA 4P2YB 4AQJA 2JU0A 1OMRA 4GGFA 1CLLA 4JQ0D 1F70A 2HETA 2EHBA 2JXLA 4L9MA 1H4BA 2PSRA 1YX8A 1UP5A 3OB2B 1OQPA 4I5NB 1BU3A 4ETOA 2LMTA 3VRQA 4YRUA 3AKBA 4OV2A 2SASA 3JVTB 3VROA 4GFTA 2MLEC 1JUOA 1S5GY 2KQYA 4DUQA 2AMIA 2K61A 2JTZA 1C07A 3LCPC 2JC2A 4N1GA 1TRFA 3BUMB 1KK7Y 4MLWA 1YURA 2CTNA 5HKWA 2H61C 1AJ5A 3TDZA 1DMOA 4MZKA 2H2KA 2Q4UA 2BL0B 3EK7A 5HKYA 1KWOB 4IL1A 5JJGA 2ZRTA 2OS8C 2M1KB 1PRWA 2COLB 4DS7A 1NP8A 1L2OB 4MRYA 1ALWA 3I5FC 3BYAA 1XFWO 1Y1UA 3QRXA 3SG7A 5AEQA 4GPLB 1KQMB 3SIBA 4OVNF 4DCKA 4HSZA 1EG3A 3O4YA 2HQ8A 3CR4X 1XO5A 1K9UA 1NX1A 1N0YA 2FJUB 3PATA 4YGCB 3BQ3A 1WRLA 2BCBA 5I2OA 1F71A 4I5KA 2LM5A 3EK8A 4F0ZB 3DVKA 1DJHA 2WC8A 1J55A 1DJGA 2LMVA 3H4SE 4A4BA 1R6PA 1TTXA 2OTGB 2CBLA 1K9PA 4ZCVA 4C0JA 3GOFA 1F55A 1NYAA 1B8LA 3PN7B 1RFJA 4GAOA 1CDPA 3D10A 1UURA 3NSKA 2F3ZA 2KI4B 4MVFA 3KPXA 1MXEA 1CFCA 4UPGA 3TS5B 1SNLA 3BUWB 1SPYA 1TNWA 3DF0B 1S6IA 4PHJA 1TNXA 2JTTA 1A75A 2I7AA 3I5IC 1DTLA 1ZACA 2JRFA 2D8NA 1J7OA 1K95A 4MRXA 1DT7B 3JTDC 2LUCA 1IGVA 1H8BA 1DGVA 1QVIZ 2L51A 3EVUA 1B7TY 5D7FA 5KSZA 1WY9A 4PE4A 2EC6C 1OZOA 4C0KA 2QACA 2KAXA 2AAOA 1W7IB 5K89A 1TN4A 3AAJA 2L5XB 3I5HB 3TUYB 1QX5B 5HKZA 1KFUL 4ORBB 1JF2A 2K2AA 2LP2A 1PVBA 1BG1A 3EKHA 1DJIA 3DD4A 3F45A 4AOMA 1QJTA 1XFYO 3O78A 1QASA 2F2PA 1XK4A 1NX0A 1ZOTB 1DVIA 1CKKA 1UWOA 1SCMC 2KOTA 1B7TZ 3I5GB 2ZNEA 3NSIA 4YGDB 5CSNA 2KAVA 4CLNA 1CMGA 1DF0B 1OOJA 4DIRA 1IWQA 3WHUB 2OPOA 1QV1A 4Q04A 1JFKA 2G2BA 5DKNA 4PDZA 4N1FA 1JF0A 1PSBA 2ZKMX 4PHMA 1U5IA 1NCYA 3IF7A 4NDDA 1TIZA 1IG5A 5KU1A 2WOSA 2ISDA 1AP4A 1C7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLN A;  3EKJ A;  1TNQ A;  1WLM A;  1OSA A;  2ZN8 A;  3EVV A;  1J7R A;  3EVR A;  3GK4 X;  4YI8 A;  5AXI A;  1BLQ A;  1JWD A;  1J1D A;  4PE1 A;  1M46 A;  4YGE B;  1SBJ A;  1F4Q A;  1UHJ A;  1G33 A;  2M29 A;  3GK2 A;  2LAN A;  1B4C A;  1AJ4 A;  2CNP A;  2CXJ A;  1CNP A;  2KGR A;  2ZRS A;  1LVC D;  2IS9 A;  1SR6 C;  2NCO A;  1D1O A;  1QLS A;  1A4P A;  1N2D A;  4GBA A;  5DKQ A;  3HCM A;  4CID A;  1MWN A;  1Y6W A;  2L0P A;  1IJ6 A;  5I2Q A;  2V53 A;  5DKR A;  2JT0 A;  1DJW A;  1IKU A;  1KFU S;  1OMD A;  2JXC A;  2JT3 A;  5AAN A;  2MA2 A;  1KK8 C;  1YUS A;  2KFF A;  2BE6 A;  1QIV A;  1SL8 A;  4TNC A;  1JSA A;  2HPS A;  2NCP A;  3DVJ A;  1Y1A A;  2NXQ A;  3WHT B;  3D0Y A;  4M2Q A;  2BKH B;  2OS8 B;  5GQQ C;  3CR5 X;  4FQO A;  2KFH A;  4ZCU A;  5CSF A;  3VGO A;  3KEV A;  4GGF C;  1BJF A;  2P6B B;  1CFF A;  1K93 D;  1JBA A;  1FF1 A;  2MRD A;  5B8I B;  1IH0 A;  4M2O A;  3OHM B;  3DVE A;  1M63 B;  1WDC B;  3KF9 A;  1KSO A;  3RLZ A;  3C1V A;  3BUO B;  1XYD A;  2Y1N A;  1CLM A;  2O5G A;  1S6J A;  1XFX O;  1EJ3 A;  1K94 A;  2F3Y A;  2WCB A;  1UHN A;  1Y1X A;  1MHO A;  1B1G A;  2LV7 A;  4P5O E;  2PMY A;  1KQV A;  1G4Y R;  1QLK A;  1DJX A;  1Y0V H;  1QVI Y;  1EL4 A;  1TNP A;  2LVI A;  3SG5 A;  3DF0 A;  4U8D A;  1RJV A;  2I2R E;  3BUX B;  3ICB A;  4DRW A;  2M97 A;  1A03 A;  2AUC A;  2ZN9 A;  4OR9 B;  3WXA A;  3PM8 A;  1PVA A;  4AQI A;  4CFQ A;  4QJ4 B;  3BUN B;  3K21 A;  2ZND A;  2JZI A;  2BCA A;  3IQO A;  1TCF A;  1UHH A;  2QPT A;  2I18 A;  1SY9 A;  1NCZ A;  4ORA B;  2M3W A;  4XJK A;  2EC6 B;  4QJ3 B;  1AUI B;  1YUT A;  5ER4 X;  1MR8 A;  2FOT A;  1DJY A;  1AHR A;  1IRJ A;  3GK1 A;  1OMV A;  3CWG A;  1HQV A;  1QV0 A;  3PN7 C;  5F6T A;  4FTG A;  1B47 A;  5G08 A;  2KI4 C;  1SW8 A;  1S36 A;  3HX4 A;  2L50 A;  1SCM B;  2KNE A;  1DF0 A;  4PHK A;  2KYC A;  1LKJ A;  1NX3 A;  1LXF C;  4GGN A;  1JC2 A;  1FI5 A;  1NPQ A;  1TOP A;  4HRE E;  4WQ3 A;  1X02 A;  3EK4 A;  2O60 A;  3BOW B;  1A75 B;  5IBW A;  1QS7 A;  3FS7 A;  1F8H A;  2JT8 A;  1NIW A;  2KFG A;  2CCM A;  2WCF A;  1SL7 A;  2Y4Q A;  1WRZ A;  4HRH A;  2MHH A;  1S1E A;  4YBH B;  3I5H C;  2ZFD A;  1CMF A;  3FWB A;  4MEW A;  1EXR A;  1QTX A;  4WQ2 A;  4OCI A;  1RRO A;  1MQ1 A;  1SL9 A;  1GQM A;  2K0J A;  2NZ0 A;  1K2H A;  1KCY A;  1EG4 A;  5HLO A;  3ZNI A;  2JWW A;  4ORC B;  2KGB C;  1S6C A;  1SR6 B;  4YI9 A;  5FYX A;  2L2E A;  3PLF B;  3VRP A;  3IQQ A;  1BF5 A;  4YGA A;  1PAL A;  2BCX A;  2TN4 A;  1RTP 1;  1J7Q A;  1FW4 A;  1M45 A;  1XK4 C;  2G9B A;  3CTN A;  2K7B A;  1W7J B;  3NSO A;  1QX2 A;  1CDM A;  2GV5 A;  3CZT X;  1YVH A;  2RGI A;  3M0W A;  3OX6 A;  1BR4 B;  1QAT A;  3A8R A;  4MBE A;  4PE0 A;  1L7Z A;  5CSJ A;  2KHN A;  1ZMZ A;  2KSP A;  1NUB A;  4MZL A;  4QJ5 B;  1TCO B;  1GGW A;  2KBM A;  2PAS A;  2KAY A;  3LK0 A;  5I2L A;  4BY5 A;  1YX7 A;  1KK8 B;  1YTZ C;  2H61 A;  1YVL A;  4PAL A;  2LC5 A;  2M7N A;  2LLU A;  4N5X A;  1R2U A;  1M31 A;  2CT9 A;  1NX2 A;  3PFV A;  1XVJ A;  2M1U A;  4NQG A;  2LCP A;  4I5J A;  1XFV O;  1SRA A;  2LP3 A;  1KFX L;  3LLE A;  2DOQ A;  2LVV A;  2JNF A;  3OP0 A;  2EGD A;  2HF5 A;  3PAL A;  2KBI A;  2GGM A;  1MF8 B;  1N65 A;  3I5F B;  3RM1 A;  1IQ3 A;  1IQ5 A;  2LHI A;  4GNK B;  1LIN A;  2LAP A;  2Y1M A;  1UUS A;  2WCE A;  5HYD A;  1OZS A;  1PSR A;  2M9G A;  4PE7 A;  1MXL C;  2MAZ A;  3TZ1 A;  3MSE B;  2LLT A;  2LVJ A;  1NSH A;  3SIA A;  2LLS A;  4WRI A;  1HT9 A;  1Q80 A;  2LNK A;  1E8A A;  2VRG A;  4OKH A;  1EH2 A;  1UHI A;  4USL A;  5TNC A;  3SJS A;  3JVT C;  1KSM A;  1V1G A;  1IJ5 A;  3NXA A;  5CSI A;  4A4C A;  1B8C A;  5ER5 A;  3D0Y B;  2A4J A;  1B8R A;  2SCP A;  3SG3 A;  1SKT A;  2F2O A;  2MLF C;  2BL0 C;  1ALV A;  1KWO C;  1K8U A;  1XA5 A;  1CTR A;  1S5G Z;  2FCD A;  2JNX A;  4M2P A;  3VRR A;  1BT6 A;  3CGA A;  5KTY A;  2LUX A;  4NDB A;  1LA3 A;  1L2O C;  4JWQ A;  2E30 A;  2M49 B;  4PCW A;  2KI6 D;  3SG6 A;  4C0L A;  1A29 A;  2Y5I A;  4I5L B;  2LVK A;  1KK7 Z;  5HLV A;  1BOC A;  1KQM C;  1FI6 A;  2BEC A;  2MJW B;  1YR5 A;  1K90 D;  3NSL A;  2M8U A;  1VRK A;  2K8M B;  1WDC C;  3I5I B;  1CDN A;  2L98 A;  1XFU O;  1REC A;  2GGZ A;  4BY4 A;  3JTD B;  4MN0 A;  1AK8 A;  4D1E A;  1SCV A;  1KFX S;  1RWY A;  3LK1 A;  1K9K A;  3KHE A;  1CM1 A;  1SYM A;  1JFJ A;  1CFD A;  4CPV A;  1SMG A;  3SG4 A;  1YUU A;  1ZFS A;  1GJY A;  2JUL A;  2OTG C;  1FBV A;  3WNX B;  1NWD A;  2R2I A;  3LL8 B;  2K7D A;  1C7W A;  2KI6 C;  1BR1 B;  2KYF A;  1CLB A;  1WLZ A;  1G8I A;  3A4U B;  1F54 A;  1A2X A;  3OX5 A;  1CDL A;  1CB1 A;  2LE9 B;  3BOW A;  3OB1 B;  2JPT A;  1S26 D;  1GGZ A;  4MZJ A;  1PK0 D;  4R1E A;  3TS5 C;  1BOD A;  1PUL A;  1AVS A;  2LHL A;  3SG2 A;  1CFP A;  3CS1 A;  4CFR A;  3E3R A;  1QIW A;  1YRU B;  1M39 A;  1OE9 B;  1S3P A;  5CPV A;  4ICB A;  1F4O A;  1MUX A;  2K7C A;  3FIA A;  4XJK B;  5AFP A;  1CM4 A;  3PSR A;  1ODB A;  2KDH A;  2L4I A;  1DGU A;  2NLN A;  3O2P A;  1B9A A;  1YRT B;  2JQ6 A;  2Q91 A;  2M0R A;  1WRK A;  2PVB A;  2F8P A;  3TUY C;  1DJZ A;  2HQW A;  5J3X A;  4MSP A;  2F33 A;  1QX7 A;  2KQ6 A;  4PHN A;  2JOJ A;  3CR2 A;  5I8N A;  1J7P A;  2PRU A;  5AER A;  2B1U A;  4HRG A;  1LA0 A;  1V1F A;  3KO0 A;  1NCX A;  3I5G C;  2FCE A;  3AAK A;  4NDC A;  2WOR A;  4XYN A;  2E6W A;  2WND A;  3O6B A;  4E68 A;  2LMU A;  3FWC A;  3BXK A;  2BE4 A;  3VRN A;  3ZWH A;  2BKI B;  5BPJ A;  3TDI A;  1BMO A;  3TDU A;  2K7O A;  2I94 A;  5JOL A;  1FPW A;  2BBN A;  1U5I B;  1XFZ O;  1J1E A;  1QXP A;  4JPZ B;  2M7L A;  1SK6 D;  5D69 A;  5PAL A;  4GUK A;  2K2F A;  3AKA A;  1RK9 A;  2BBM A;  1K96 A;  2MBX A;  1UHK A;  3DVM A;  4YGB B;  2L4H A;  1ZUZ A;  2PAL A;  4P2Y B;  4AQJ A;  2JU0 A;  1OMR A;  4GGF A;  1CLL A;  4JQ0 D;  1F70 A;  2HET A;  2EHB A;  2JXL A;  4L9M A;  1H4B A;  2PSR A;  1YX8 A;  1UP5 A;  3OB2 B;  1OQP A;  4I5N B;  1BU3 A;  4ETO A;  2LMT A;  3VRQ A;  4YRU A;  3AKB A;  4OV2 A;  2SAS A;  3JVT B;  3VRO A;  4GFT A;  2MLE C;  1JUO A;  1S5G Y;  2KQY A;  4DUQ A;  2AMI A;  2K61 A;  2JTZ A;  1C07 A;  3LCP C;  2JC2 A;  4N1G A;  1TRF A;  3BUM B;  1KK7 Y;  4MLW A;  1YUR A;  2CTN A;  5HKW A;  2H61 C;  1AJ5 A;  3TDZ A;  1DMO A;  4MZK A;  2H2K A;  2Q4U A;  2BL0 B;  3EK7 A;  5HKY A;  1KWO B;  4IL1 A;  5JJG A;  2ZRT A;  2OS8 C;  2M1K B;  1PRW A;  2COL B;  4DS7 A;  1NP8 A;  1L2O B;  4MRY A;  1ALW A;  3I5F C;  3BYA A;  1XFW O;  1Y1U A;  3QRX A;  3SG7 A;  5AEQ A;  4GPL B;  1KQM B;  3SIB A;  4OVN F;  4DCK A;  4HSZ A;  1EG3 A;  3O4Y A;  2HQ8 A;  3CR4 X;  1XO5 A;  1K9U A;  1NX1 A;  1N0Y A;  2FJU B;  3PAT A;  4YGC B;  3BQ3 A;  1WRL A;  2BCB A;  5I2O A;  1F71 A;  4I5K A;  2LM5 A;  3EK8 A;  4F0Z B;  3DVK A;  1DJH A;  2WC8 A;  1J55 A;  1DJG A;  2LMV A;  3H4S E;  4A4B A;  1R6P A;  1TTX A;  2OTG B;  2CBL A;  1K9P A;  4ZCV A;  4C0J A;  3GOF A;  1F55 A;  1NYA A;  1B8L A;  3PN7 B;  1RFJ A;  4GAO A;  1CDP A;  3D10 A;  1UUR A;  3NSK A;  2F3Z A;  2KI4 B;  4MVF A;  3KPX A;  1MXE A;  1CFC A;  4UPG A;  3TS5 B;  1SNL A;  3BUW B;  1SPY A;  1TNW A;  3DF0 B;  1S6I A;  4PHJ A;  1TNX A;  2JTT A;  1A75 A;  2I7A A;  3I5I C;  1DTL A;  1ZAC A;  2JRF A;  2D8N A;  1J7O A;  1K95 A;  4MRX A;  1DT7 B;  3JTD C;  2LUC A;  1IGV A;  1H8B A;  1DGV A;  1QVI Z;  2L51 A;  3EVU A;  1B7T Y;  5D7F A;  5KSZ A;  1WY9 A;  4PE4 A;  2EC6 C;  1OZO A;  4C0K A;  2QAC A;  2KAX A;  2AAO A;  1W7I B;  5K89 A;  1TN4 A;  3AAJ A;  2L5X B;  3I5H B;  3TUY B;  1QX5 B;  5HKZ A;  1KFU L;  4ORB B;  1JF2 A;  2K2A A;  2LP2 A;  1PVB A;  1BG1 A;  3EKH A;  1DJI A;  3DD4 A;  3F45 A;  4AOM A;  1QJT A;  1XFY O;  3O78 A;  1QAS A;  2F2P A;  1XK4 A;  1NX0 A;  1ZOT B;  1DVI A;  1CKK A;  1UWO A;  1SCM C;  2KOT A;  1B7T Z;  3I5G B;  2ZNE A;  3NSI A;  4YGD B;  5CSN A;  2KAV A;  4CLN A;  1CMG A;  1DF0 B;  1OOJ A;  4DIR A;  1IWQ A;  3WHU B;  2OPO A;  1QV1 A;  4Q04 A;  1JFK A;  2G2B A;  5DKN A;  4PDZ A;  4N1F A;  1JF0 A;  1PSB A;  2ZKM X;  4PHM A;  1U5I A;  1NCY A;  3IF7 A;  4NDD A;  1TIZ A;  1IG5 A;  5KU1 A;  2WOS A;  2ISD A;  1AP4 A;  1C7V A; 
#chains in the Genus database with same CATH topology
 3CLN A;  3EKJ A;  1TNQ A;  1WLM A;  1OSA A;  2ZN8 A;  3EVV A;  1J7R A;  3EVR A;  3GK4 X;  3DY9 A;  4YI8 A;  5AXI A;  1BLQ A;  1JWD A;  1OOH A;  3D76 A;  1J1D A;  4PE1 A;  1M46 A;  3BFB A;  4YGE B;  1SBJ A;  3DZT A;  1F4Q A;  1UHJ A;  1G33 A;  2M29 A;  3GK2 A;  5HL1 A;  2LAN A;  1B4C A;  1AJ4 A;  2CNP A;  1TUZ A;  2CXJ A;  1CNP A;  4DRW A;  2KGR A;  2GTE A;  3CDN A;  2ZRS A;  1LVC D;  2IS9 A;  1SR6 C;  2NCO A;  1D1O A;  1QLS A;  1A4P A;  1N2D A;  3R1O A;  4GBA A;  5DKQ A;  3HCM A;  4INX A;  4CID A;  1MWN A;  1Y6W A;  2L0P A;  1IJ6 A;  5I2Q A;  2V53 A;  5DKR A;  2JT0 A;  1DJW A;  1IKU A;  1KFU S;  2QEO A;  1OMD A;  2JXC A;  2JT3 A;  5AAN A;  2MA2 A;  1KK8 C;  1YUS A;  2KFF A;  2BE6 A;  1QIV A;  1SL8 A;  4TNC A;  1JSA A;  2HPS A;  2NCP A;  2QEV A;  3DVJ A;  1Y1A A;  2NXQ A;  3WHT B;  3D0Y A;  4M2Q A;  2BKH B;  2OS8 B;  5GQQ C;  3CR5 X;  4FQO A;  2KFH A;  2L2C A;  4ZCU A;  5CSF A;  3S0B A;  3VGO A;  3KEV A;  4GGF C;  1BJF A;  3D77 A;  2P6B B;  1CFF A;  1K93 D;  1OOF A;  1JBA A;  1FF1 A;  2MRD A;  5B8I B;  1IH0 A;  4M2O A;  3OHM B;  3DVE A;  1M63 B;  1WDC B;  3KF9 A;  1KSO A;  3RLZ A;  3C1V A;  3SS4 A;  3BUO B;  1XYD A;  2Y1N A;  1CLM A;  2O5G A;  1S6J A;  1XFX O;  1EJ3 A;  3FE9 A;  1W9Z A;  1K94 A;  2F3Y A;  2WCB A;  1UHN A;  1Y1X A;  1MHO A;  1B1G A;  2LV7 A;  4P5O E;  2PMY A;  2PQL A;  3R1V A;  1KQV A;  1G4Y R;  1QLK A;  4F7F A;  1DJX A;  1Y0V H;  1QVI Y;  3L4A A;  1EL4 A;  2KPH A;  1TNP A;  2LVI A;  2WCH A;  3DF0 A;  4U8D A;  1RJV A;  2I2R E;  3BUX B;  3ICB A;  3SG5 A;  2M97 A;  1A03 A;  2AUC A;  2ZN9 A;  4OR9 B;  3WXA A;  3PM8 A;  1PVA A;  4AQI A;  4CFQ A;  1XFR A;  4QJ4 B;  3BUN B;  3K21 A;  1OOI X;  2JZI A;  2ZND A;  2BCA A;  3IQO A;  1TCF A;  1UHH A;  2QPT A;  2I18 A;  1SY9 A;  1NCZ A;  3BJH A;  3O4X A;  4ORA B;  2M3W A;  4XJK A;  2EC6 B;  4QJ3 B;  1AUI B;  1YUT A;  5ER4 X;  1MR8 A;  2FOT A;  1DJY A;  1AHR A;  1IRJ A;  3GK1 A;  1OMV A;  3CWG A;  1C3Z A;  1HQV A;  1QV0 A;  3PN7 C;  5F6T A;  4FTG A;  3VB1 A;  1B47 A;  5G08 A;  2KI4 C;  1SW8 A;  1S36 A;  3HX4 A;  2L50 A;  1SCM B;  2KNE A;  1DF0 A;  4PHK A;  2KYC A;  1LKJ A;  1NX3 A;  1LXF C;  4GGN A;  1JC2 A;  1FI5 A;  1NPQ A;  1TOP A;  4HRE E;  4WQ3 A;  1X02 A;  3EK4 A;  2O60 A;  3BOW B;  1A75 B;  1SSE B;  5IBW A;  3CZ1 A;  1QS7 A;  3FS7 A;  1F8H A;  2JT8 A;  1NIW A;  2KFG A;  1ORG A;  2CCM A;  2WCF A;  1SL7 A;  2Y4Q A;  1WRZ A;  2QDI A;  4CLN A;  3IVT A;  4HRH A;  2MHH A;  1TUJ A;  1S1E A;  4YBH B;  3I5H C;  2ZFD A;  1CMF A;  3FWB A;  1DEL A;  4MEW A;  5DIC A;  1EXR A;  1QTX A;  4WQ2 A;  4OCI A;  1RRO A;  1MQ1 A;  1SL9 A;  1GQM A;  2K0J A;  2NZ0 A;  1K2H A;  1KCY A;  1EG4 A;  5HLO A;  3ZNI A;  2JWW A;  4ORC B;  2KGB C;  1S6C A;  1SR6 B;  3D75 A;  4YI9 A;  2L2E A;  3PLF B;  5FYX A;  3IQQ A;  3VRP A;  1BF5 A;  4YGA A;  1PAL A;  2BCX A;  2TN4 A;  1RTP 1;  1J7Q A;  1FW4 A;  1M45 A;  1XK4 C;  2G9B A;  3N7H A;  3CTN A;  2K7B A;  1W7J B;  3NSO A;  1QX2 A;  1CDM A;  2GV5 A;  3CZT X;  1YVH A;  2RGI A;  3M0W A;  3OX6 A;  1BR4 B;  1QAT A;  3A8R A;  4MBE A;  4PE0 A;  1GM0 A;  1L7Z A;  5CSJ A;  2KHN A;  1ZMZ A;  2KSP A;  1NUB A;  3Q8I A;  4MZL A;  4QJ5 B;  1TCO B;  1GGW A;  2KBM A;  2PAS A;  2KAY A;  3LK0 A;  5I2L A;  4BY5 A;  1YX7 A;  1KK8 B;  1YTZ C;  2H61 A;  1YVL A;  4PAL A;  2LC5 A;  2M7N A;  2QEH A;  2LLU A;  2WCJ A;  4N5X A;  1R2U A;  1M31 A;  2CT9 A;  1NX2 A;  3PFV A;  1XVJ A;  2M1U A;  4NQG A;  2LCP A;  4I5J A;  1XFV O;  1SRA A;  2LP3 A;  1KFX L;  3LLE A;  5FI6 A;  2DOQ A;  2LVV A;  2JNF A;  3OP0 A;  2EGD A;  2HF5 A;  3PAL A;  2KBI A;  2GGM A;  1MF8 B;  1N65 A;  3I5F B;  3RM1 A;  1IQ3 A;  1IQ5 A;  2LHI A;  4GNK B;  1LIN A;  2LAP A;  2Y1M A;  4IJ7 A;  3SS3 A;  1UUS A;  2WCE A;  2QEB A;  5HYD A;  1OZS A;  1PSR A;  2M9G A;  4PE7 A;  1MXL C;  2MAZ A;  3TZ1 A;  3MSE B;  2LLT A;  2LVJ A;  1NSH A;  3SIA A;  3K1E A;  2LLS A;  4WRI A;  1HT9 A;  1Q80 A;  2LNK A;  1E8A A;  2VRG A;  4OKH A;  1EH2 A;  1UHI A;  2PYQ A;  4USL A;  5TNC A;  3SJS A;  3JVT C;  1KSM A;  1V1G A;  1IJ5 A;  3NXA A;  5CSI A;  3NHI A;  2KLD A;  4A4C A;  3B87 A;  1B8C A;  3EG5 B;  5ER5 A;  3D0Y B;  2A4J A;  1B8R A;  2SCP A;  3SG3 A;  1SKT A;  2F2O A;  2MLF C;  2BL0 C;  5FI7 A;  1ALV A;  1KWO C;  2KLE A;  1K8U A;  1XA5 A;  1CTR A;  1S5G Z;  2FCD A;  2JNX A;  4M2P A;  3VRR A;  1BT6 A;  3CGA A;  5KTY A;  2LUX A;  4NDB A;  1LA3 A;  1L2O C;  4JWQ A;  2E30 A;  2M49 B;  4PCW A;  2KI6 D;  3SG6 A;  2BAP A;  1A29 A;  2Y5I A;  4I5L B;  4C0L A;  2LVK A;  1KK7 Z;  1T14 A;  5HLV A;  1KQM C;  1BOC A;  1FI6 A;  2BEC A;  2MJW B;  1YR5 A;  1K90 D;  3NSL A;  2H8V A;  1VRK A;  2K8M B;  1WDC C;  2M8U A;  3I5I B;  1CDN A;  1DQE A;  3QME A;  2L98 A;  1XFU O;  1REC A;  2GGZ A;  4BY4 A;  3JTD B;  4MN0 A;  1AK8 A;  4FQT A;  4D1E A;  1SCV A;  1KFX S;  1RWY A;  3R1P A;  3LK1 A;  1K9K A;  3KHE A;  1CM1 A;  1SYM A;  1JFJ A;  1CFD A;  4CPV A;  1SMG A;  3SG4 A;  3DYE A;  1YUU A;  1ZFS A;  1GJY A;  2JUL A;  2L5Y A;  2OTG C;  2P71 A;  3B6X A;  1FBV A;  3WNX B;  1NWD A;  2R2I A;  3LL8 B;  2K7D A;  1C7W A;  2KI6 C;  3S0D A;  1BR1 B;  2KYF A;  1CLB A;  1WLZ A;  1G8I A;  1IIO A;  3A4U B;  1F54 A;  1A2X A;  3OX5 A;  1CDL A;  1CB1 A;  2LE9 B;  3BOW A;  3OB1 B;  2JPT A;  1S26 D;  1GGZ A;  4MZJ A;  1PK0 D;  4R1E A;  3TS5 C;  1BOD A;  1PUL A;  1AVS A;  2LHL A;  3SG2 A;  1CFP A;  3CS1 A;  4CFR A;  3E3R A;  1QIW A;  1YRU B;  1M39 A;  1OE9 B;  3PJI A;  1S3P A;  5CPV A;  1TWO A;  4ICB A;  1F4O A;  1MUX A;  2K7C A;  3V2L A;  3FIA A;  4XJK B;  5AFP A;  1CM4 A;  3PSR A;  1ODB A;  2KDH A;  2L4I A;  1DGU A;  2NLN A;  3D73 A;  1B9A A;  3O2P A;  3PM2 A;  3S0E A;  1YRT B;  2JQ6 A;  2Q91 A;  2M0R A;  2WCK A;  1WRK A;  2PVB A;  2F8P A;  3TUY C;  1DJZ A;  2HQW A;  3CAB A;  5J3X A;  4MSP A;  2F33 A;  1QX7 A;  2KQ6 A;  1Z2C B;  1DC1 A;  1QWV A;  2JOJ A;  4PHN A;  3NHT A;  1C3Y A;  3CR2 A;  5FI2 A;  5I8N A;  1J7P A;  2PRU A;  1OOG A;  2B1U A;  4HRG A;  1LA0 A;  1V1F A;  3KO0 A;  1NCX A;  5AER A;  3RZS A;  3I5G C;  2FCE A;  1OW4 A;  3AAK A;  3CYZ A;  2WOR A;  4NDC A;  4XYN A;  2E6W A;  2WND A;  3O6B A;  4E68 A;  2LMU A;  3FWC A;  3BXK A;  3S0G A;  2BE4 A;  3VRN A;  3ZWH A;  4KYN A;  2BKI B;  5BPJ A;  3TDI A;  1BMO A;  3TDU A;  2K7O A;  2WCL A;  2I94 A;  5JOL A;  1FPW A;  1XFZ O;  1U5I B;  2BBN A;  1J1E A;  1QXP A;  4JPZ B;  2M7L A;  1SK6 D;  5D69 A;  5PAL A;  4INW A;  2P70 A;  4GUK A;  2K2F A;  3S0F A;  3L4L A;  3AKA A;  1RK9 A;  2BBM A;  2JPO A;  1K96 A;  2MBX A;  1UHK A;  3DVM A;  4YGB B;  2L4H A;  1ZUZ A;  2PAL A;  4P2Y B;  4AQJ A;  1P28 A;  2JU0 A;  3OBV A;  1OMR A;  4GGF A;  1CLL A;  4JQ0 D;  1F70 A;  2HET A;  2EHB A;  2JXL A;  4L9M A;  1H4B A;  2PSR A;  1YX8 A;  1UP5 A;  3OB2 B;  1OQP A;  4I5N B;  1BU3 A;  4ETO A;  2LMT A;  3VRQ A;  4YRU A;  3AKB A;  4OV2 A;  2SAS A;  3JVT B;  3VRO A;  4GFT A;  4JKT A;  2MLE C;  1JUO A;  1S5G Y;  2KQY A;  4DUQ A;  2AMI A;  2K61 A;  2JTZ A;  2WCM A;  3DXL A;  2WC6 A;  1C07 A;  3LCP C;  3SS5 A;  3L47 A;  2JC2 A;  4N1G A;  1TRF A;  3BUM B;  1KK7 Y;  4MLW A;  1YUR A;  2CTN A;  5HKW A;  2H61 C;  1AJ5 A;  3TDZ A;  3UNW A;  4MZK A;  2H2K A;  1DMO A;  2Q4U A;  2BL0 B;  3EK7 A;  5HKY A;  1KWO B;  4IL1 A;  5JJG A;  2ZRT A;  2OS8 C;  2M1K B;  1PRW A;  2COL B;  4DS7 A;  2ERB A;  1NP8 A;  1L2O B;  4MRY A;  1ALW A;  3I5F C;  3BYA A;  1XFW O;  1Y1U A;  3QRX A;  3SG7 A;  5AEQ A;  4GPL B;  1KQM B;  3SIB A;  4OVN F;  4DCK A;  4HSZ A;  1EG3 A;  3O4Y A;  4OZD A;  2HQ8 A;  4PT1 A;  3CR4 X;  1XO5 A;  1K9U A;  1NX1 A;  1N0Y A;  2FJU B;  3PAT A;  3B7A A;  4YGC B;  2BNX A;  3B88 A;  3BQ3 A;  1WRL A;  2BCB A;  5I2O A;  1F71 A;  4I5K A;  2LM5 A;  3EK8 A;  2FJY A;  2YGU A;  4F0Z B;  3DVK A;  1DJH A;  2WC8 A;  3UO9 A;  1J55 A;  1DJG A;  2LMV A;  3H4S E;  2K60 A;  4A4B A;  1R6P A;  1TTX A;  2OTG B;  2CBL A;  1K9P A;  3BFA A;  4ZCV A;  1LS8 A;  4C0J A;  2WC5 A;  3GOF A;  1NYA A;  1B8L A;  3PN7 B;  1F55 A;  1RFJ A;  3FE8 A;  4GAO A;  1CDP A;  3D10 A;  1UUR A;  3NSK A;  2F3Z A;  2KI4 B;  4MVF A;  3KPX A;  1MXE A;  5EL2 A;  1CFC A;  4UPG A;  3TS5 B;  1SNL A;  3BUW B;  1SPY A;  1TNW A;  4JD9 A;  3DF0 B;  1S6I A;  4PHJ A;  1TNX A;  2JTT A;  1A75 A;  2I7A A;  3I5I C;  1DTL A;  1ZAC A;  2JRF A;  5D3O A;  2D8N A;  1J7O A;  1K95 A;  1Z4H A;  3D74 A;  4MRX A;  1DT7 B;  3JTD C;  2LUC A;  1IGV A;  1H8B A;  1DGV A;  1QVI Z;  2L51 A;  3CZ0 A;  3EVU A;  1B7T Y;  5D7F A;  3D78 A;  5KSZ A;  1WY9 A;  3S0A A;  4PE4 A;  2EC6 C;  1OZO A;  4C0K A;  2QAC A;  2KAX A;  3CZ2 A;  2AAO A;  1W7I B;  1DEK A;  5K89 A;  1TN4 A;  3AAJ A;  2L5X B;  3I5H B;  3TUY B;  1QX5 B;  5HKZ A;  1KFU L;  4ORB B;  1JF2 A;  2K2A A;  2LP2 A;  1PVB A;  1BG1 A;  3EKH A;  1DJI A;  3DD4 A;  3F45 A;  4AOM A;  1QJT A;  1XFY O;  3O78 A;  3FE6 A;  1QAS A;  2F2P A;  3BFH A;  1XK4 A;  1NX0 A;  1ZOT B;  1DVI A;  1CKK A;  1UWO A;  1SCM C;  2KOT A;  1B7T Z;  3B86 A;  2ZNE A;  3I5G B;  3NSI A;  4YGD B;  2KAV A;  3OGN A;  5CSN A;  1CMG A;  1DF0 B;  1OOJ A;  4DIR A;  1IWQ A;  3WHU B;  2OPO A;  1QV1 A;  5I94 A;  4Q04 A;  1JFK A;  2G2B A;  5DKN A;  4PDZ A;  4N1F A;  1JF0 A;  1PSB A;  2ZKM X;  4PHM A;  1U5I A;  1NCY A;  3IF7 A;  3NGV A;  1TIZ A;  4NDD A;  1IG5 A;  3R72 A;  2WOS A;  2ISD A;  5KU1 A;  1AP4 A;  1C7V A; 
#chains in the Genus database with same CATH homology
 3CLN A;  3EKJ A;  1TNQ A;  1WLM A;  1OSA A;  2ZN8 A;  3EVV A;  1J7R A;  3EVR A;  3GK4 X;  4YI8 A;  5AXI A;  1BLQ A;  1JWD A;  1J1D A;  4PE1 A;  1M46 A;  4YGE B;  1SBJ A;  1F4Q A;  1UHJ A;  1G33 A;  2M29 A;  3GK2 A;  2LAN A;  1B4C A;  1AJ4 A;  2CNP A;  2CXJ A;  1CNP A;  2KGR A;  2ZRS A;  1LVC D;  2IS9 A;  1SR6 C;  2NCO A;  1D1O A;  1QLS A;  1A4P A;  1N2D A;  4GBA A;  5DKQ A;  3HCM A;  4CID A;  1MWN A;  1Y6W A;  2L0P A;  1IJ6 A;  5I2Q A;  2V53 A;  5DKR A;  2JT0 A;  1DJW A;  1IKU A;  1KFU S;  1OMD A;  2JXC A;  2JT3 A;  5AAN A;  2MA2 A;  1KK8 C;  1YUS A;  2KFF A;  2BE6 A;  1QIV A;  1SL8 A;  4TNC A;  1JSA A;  2HPS A;  2NCP A;  3DVJ A;  1Y1A A;  2NXQ A;  3WHT B;  3D0Y A;  4M2Q A;  2BKH B;  2OS8 B;  5GQQ C;  3CR5 X;  4FQO A;  2KFH A;  4ZCU A;  5CSF A;  3VGO A;  3KEV A;  4GGF C;  1BJF A;  2P6B B;  1CFF A;  1K93 D;  1JBA A;  1FF1 A;  2MRD A;  5B8I B;  1IH0 A;  4M2O A;  3OHM B;  3DVE A;  1M63 B;  1WDC B;  3KF9 A;  1KSO A;  3RLZ A;  3C1V A;  3BUO B;  1XYD A;  2Y1N A;  1CLM A;  2O5G A;  1S6J A;  1XFX O;  1EJ3 A;  1K94 A;  2F3Y A;  2WCB A;  1UHN A;  1Y1X A;  1MHO A;  1B1G A;  2LV7 A;  4P5O E;  2PMY A;  1KQV A;  1G4Y R;  1QLK A;  1DJX A;  1Y0V H;  1QVI Y;  1EL4 A;  1TNP A;  2LVI A;  3SG5 A;  3DF0 A;  4U8D A;  1RJV A;  2I2R E;  3BUX B;  3ICB A;  4DRW A;  2M97 A;  1A03 A;  2AUC A;  2ZN9 A;  4OR9 B;  3WXA A;  3PM8 A;  1PVA A;  4AQI A;  4CFQ A;  4QJ4 B;  3BUN B;  3K21 A;  2ZND A;  2JZI A;  2BCA A;  3IQO A;  1TCF A;  1UHH A;  2QPT A;  2I18 A;  1SY9 A;  1NCZ A;  4ORA B;  2M3W A;  4XJK A;  2EC6 B;  4QJ3 B;  1AUI B;  1YUT A;  5ER4 X;  1MR8 A;  2FOT A;  1DJY A;  1AHR A;  1IRJ A;  3GK1 A;  1OMV A;  3CWG A;  1HQV A;  1QV0 A;  3PN7 C;  5F6T A;  4FTG A;  1B47 A;  5G08 A;  2KI4 C;  1SW8 A;  1S36 A;  3HX4 A;  2L50 A;  1SCM B;  2KNE A;  1DF0 A;  4PHK A;  2KYC A;  1LKJ A;  1NX3 A;  1LXF C;  4GGN A;  1JC2 A;  1FI5 A;  1NPQ A;  1TOP A;  4HRE E;  4WQ3 A;  1X02 A;  3EK4 A;  2O60 A;  3BOW B;  1A75 B;  5IBW A;  1QS7 A;  3FS7 A;  1F8H A;  2JT8 A;  1NIW A;  2KFG A;  2CCM A;  2WCF A;  1SL7 A;  2Y4Q A;  1WRZ A;  4HRH A;  2MHH A;  1S1E A;  4YBH B;  3I5H C;  2ZFD A;  1CMF A;  3FWB A;  4MEW A;  1EXR A;  1QTX A;  4WQ2 A;  4OCI A;  1RRO A;  1MQ1 A;  1SL9 A;  1GQM A;  2K0J A;  2NZ0 A;  1K2H A;  1KCY A;  1EG4 A;  5HLO A;  3ZNI A;  2JWW A;  4ORC B;  2KGB C;  1S6C A;  1SR6 B;  4YI9 A;  5FYX A;  2L2E A;  3PLF B;  3VRP A;  3IQQ A;  1BF5 A;  4YGA A;  1PAL A;  2BCX A;  2TN4 A;  1RTP 1;  1J7Q A;  1FW4 A;  1M45 A;  1XK4 C;  2G9B A;  3CTN A;  2K7B A;  1W7J B;  3NSO A;  1QX2 A;  1CDM A;  2GV5 A;  3CZT X;  1YVH A;  2RGI A;  3M0W A;  3OX6 A;  1BR4 B;  1QAT A;  3A8R A;  4MBE A;  4PE0 A;  1L7Z A;  5CSJ A;  2KHN A;  1ZMZ A;  2KSP A;  1NUB A;  4MZL A;  4QJ5 B;  1TCO B;  1GGW A;  2KBM A;  2PAS A;  2KAY A;  3LK0 A;  5I2L A;  4BY5 A;  1YX7 A;  1KK8 B;  1YTZ C;  2H61 A;  1YVL A;  4PAL A;  2LC5 A;  2M7N A;  2LLU A;  4N5X A;  1R2U A;  1M31 A;  2CT9 A;  1NX2 A;  3PFV A;  1XVJ A;  2M1U A;  4NQG A;  2LCP A;  4I5J A;  1XFV O;  1SRA A;  2LP3 A;  1KFX L;  3LLE A;  2DOQ A;  2LVV A;  2JNF A;  3OP0 A;  2EGD A;  2HF5 A;  3PAL A;  2KBI A;  2GGM A;  1MF8 B;  1N65 A;  3I5F B;  3RM1 A;  1IQ3 A;  1IQ5 A;  2LHI A;  4GNK B;  1LIN A;  2LAP A;  2Y1M A;  1UUS A;  2WCE A;  5HYD A;  1OZS A;  1PSR A;  2M9G A;  4PE7 A;  1MXL C;  2MAZ A;  3TZ1 A;  3MSE B;  2LLT A;  2LVJ A;  1NSH A;  3SIA A;  2LLS A;  4WRI A;  1HT9 A;  1Q80 A;  2LNK A;  1E8A A;  2VRG A;  4OKH A;  1EH2 A;  1UHI A;  4USL A;  5TNC A;  3SJS A;  3JVT C;  1KSM A;  1V1G A;  1IJ5 A;  3NXA A;  5CSI A;  4A4C A;  1B8C A;  5ER5 A;  3D0Y B;  2A4J A;  1B8R A;  2SCP A;  3SG3 A;  1SKT A;  2F2O A;  2MLF C;  2BL0 C;  1ALV A;  1KWO C;  1K8U A;  1XA5 A;  1CTR A;  1S5G Z;  2FCD A;  2JNX A;  4M2P A;  3VRR A;  1BT6 A;  3CGA A;  5KTY A;  2LUX A;  4NDB A;  1LA3 A;  1L2O C;  4JWQ A;  2E30 A;  2M49 B;  4PCW A;  2KI6 D;  3SG6 A;  4C0L A;  1A29 A;  2Y5I A;  4I5L B;  2LVK A;  1KK7 Z;  5HLV A;  1BOC A;  1KQM C;  1FI6 A;  2BEC A;  2MJW B;  1YR5 A;  1K90 D;  3NSL A;  2M8U A;  1VRK A;  2K8M B;  1WDC C;  3I5I B;  1CDN A;  2L98 A;  1XFU O;  1REC A;  2GGZ A;  4BY4 A;  3JTD B;  4MN0 A;  1AK8 A;  4D1E A;  1SCV A;  1KFX S;  1RWY A;  3LK1 A;  1K9K A;  3KHE A;  1CM1 A;  1SYM A;  1JFJ A;  1CFD A;  4CPV A;  1SMG A;  3SG4 A;  1YUU A;  1ZFS A;  1GJY A;  2JUL A;  2OTG C;  1FBV A;  3WNX B;  1NWD A;  2R2I A;  3LL8 B;  2K7D A;  1C7W A;  2KI6 C;  1BR1 B;  2KYF A;  1CLB A;  1WLZ A;  1G8I A;  3A4U B;  1F54 A;  1A2X A;  3OX5 A;  1CDL A;  1CB1 A;  2LE9 B;  3BOW A;  3OB1 B;  2JPT A;  1S26 D;  1GGZ A;  4MZJ A;  1PK0 D;  4R1E A;  3TS5 C;  1BOD A;  1PUL A;  1AVS A;  2LHL A;  3SG2 A;  1CFP A;  3CS1 A;  4CFR A;  3E3R A;  1QIW A;  1YRU B;  1M39 A;  1OE9 B;  1S3P A;  5CPV A;  4ICB A;  1F4O A;  1MUX A;  2K7C A;  3FIA A;  4XJK B;  5AFP A;  1CM4 A;  3PSR A;  1ODB A;  2KDH A;  2L4I A;  1DGU A;  2NLN A;  3O2P A;  1B9A A;  1YRT B;  2JQ6 A;  2Q91 A;  2M0R A;  1WRK A;  2PVB A;  2F8P A;  3TUY C;  1DJZ A;  2HQW A;  5J3X A;  4MSP A;  2F33 A;  1QX7 A;  2KQ6 A;  4PHN A;  2JOJ A;  3CR2 A;  5I8N A;  1J7P A;  2PRU A;  5AER A;  2B1U A;  4HRG A;  1LA0 A;  1V1F A;  3KO0 A;  1NCX A;  3I5G C;  2FCE A;  3AAK A;  4NDC A;  2WOR A;  4XYN A;  2E6W A;  2WND A;  3O6B A;  4E68 A;  2LMU A;  3FWC A;  3BXK A;  2BE4 A;  3VRN A;  3ZWH A;  2BKI B;  5BPJ A;  3TDI A;  1BMO A;  3TDU A;  2K7O A;  2I94 A;  5JOL A;  1FPW A;  2BBN A;  1U5I B;  1XFZ O;  1J1E A;  1QXP A;  4JPZ B;  2M7L A;  1SK6 D;  5D69 A;  5PAL A;  4GUK A;  2K2F A;  3AKA A;  1RK9 A;  2BBM A;  1K96 A;  2MBX A;  1UHK A;  3DVM A;  4YGB B;  2L4H A;  1ZUZ A;  2PAL A;  4P2Y B;  4AQJ A;  2JU0 A;  1OMR A;  4GGF A;  1CLL A;  4JQ0 D;  1F70 A;  2HET A;  2EHB A;  2JXL A;  4L9M A;  1H4B A;  2PSR A;  1YX8 A;  1UP5 A;  3OB2 B;  1OQP A;  4I5N B;  1BU3 A;  4ETO A;  2LMT A;  3VRQ A;  4YRU A;  3AKB A;  4OV2 A;  2SAS A;  3JVT B;  3VRO A;  4GFT A;  2MLE C;  1JUO A;  1S5G Y;  2KQY A;  4DUQ A;  2AMI A;  2K61 A;  2JTZ A;  1C07 A;  3LCP C;  2JC2 A;  4N1G A;  1TRF A;  3BUM B;  1KK7 Y;  4MLW A;  1YUR A;  2CTN A;  5HKW A;  2H61 C;  1AJ5 A;  3TDZ A;  1DMO A;  4MZK A;  2H2K A;  2Q4U A;  2BL0 B;  3EK7 A;  5HKY A;  1KWO B;  4IL1 A;  5JJG A;  2ZRT A;  2OS8 C;  2M1K B;  1PRW A;  2COL B;  4DS7 A;  1NP8 A;  1L2O B;  4MRY A;  1ALW A;  3I5F C;  3BYA A;  1XFW O;  1Y1U A;  3QRX A;  3SG7 A;  5AEQ A;  4GPL B;  1KQM B;  3SIB A;  4OVN F;  4DCK A;  4HSZ A;  1EG3 A;  3O4Y A;  2HQ8 A;  3CR4 X;  1XO5 A;  1K9U A;  1NX1 A;  1N0Y A;  2FJU B;  3PAT A;  4YGC B;  3BQ3 A;  1WRL A;  2BCB A;  5I2O A;  1F71 A;  4I5K A;  2LM5 A;  3EK8 A;  4F0Z B;  3DVK A;  1DJH A;  2WC8 A;  1J55 A;  1DJG A;  2LMV A;  3H4S E;  4A4B A;  1R6P A;  1TTX A;  2OTG B;  2CBL A;  1K9P A;  4ZCV A;  4C0J A;  3GOF A;  1F55 A;  1NYA A;  1B8L A;  3PN7 B;  1RFJ A;  4GAO A;  1CDP A;  3D10 A;  1UUR A;  3NSK A;  2F3Z A;  2KI4 B;  4MVF A;  3KPX A;  1MXE A;  1CFC A;  4UPG A;  3TS5 B;  1SNL A;  3BUW B;  1SPY A;  1TNW A;  3DF0 B;  1S6I A;  4PHJ A;  1TNX A;  2JTT A;  1A75 A;  2I7A A;  3I5I C;  1DTL A;  1ZAC A;  2JRF A;  2D8N A;  1J7O A;  1K95 A;  4MRX A;  1DT7 B;  3JTD C;  2LUC A;  1IGV A;  1H8B A;  1DGV A;  1QVI Z;  2L51 A;  3EVU A;  1B7T Y;  5D7F A;  5KSZ A;  1WY9 A;  4PE4 A;  2EC6 C;  1OZO A;  4C0K A;  2QAC A;  2KAX A;  2AAO A;  1W7I B;  5K89 A;  1TN4 A;  3AAJ A;  2L5X B;  3I5H B;  3TUY B;  1QX5 B;  5HKZ A;  1KFU L;  4ORB B;  1JF2 A;  2K2A A;  2LP2 A;  1PVB A;  1BG1 A;  3EKH A;  1DJI A;  3DD4 A;  3F45 A;  4AOM A;  1QJT A;  1XFY O;  3O78 A;  1QAS A;  2F2P A;  1XK4 A;  1NX0 A;  1ZOT B;  1DVI A;  1CKK A;  1UWO A;  1SCM C;  2KOT A;  1B7T Z;  3I5G B;  2ZNE A;  3NSI A;  4YGD B;  5CSN A;  2KAV A;  4CLN A;  1CMG A;  1DF0 B;  1OOJ A;  4DIR A;  1IWQ A;  3WHU B;  2OPO A;  1QV1 A;  4Q04 A;  1JFK A;  2G2B A;  5DKN A;  4PDZ A;  4N1F A;  1JF0 A;  1PSB A;  2ZKM X;  4PHM A;  1U5I A;  1NCY A;  3IF7 A;  4NDD A;  1TIZ A;  1IG5 A;  5KU1 A;  2WOS A;  2ISD A;  1AP4 A;  1C7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...