1CLBA

Determination of the solution structure of apo calbindin d9k by nmr spectroscopy
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
publication title Determination of the solution structure of Apo calbindin D9k by NMR spectroscopy.
pubmed doi rcsb
source organism Bos taurus
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1995-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1clbA00
3SJSA 4YI9A 2SASA 1CDMA 2LP2A 4YGDB 1N2DA 1KWOB 1UHIA 3IQOA 4U8DA 1YRTB 2WORA 2CCMA 1PULA 5PALA 1V1GA 5CSJA 1JC2A 4Q04A 3BUOB 3OHMB 3SIAA 1QV1A 1QLSA 2JT0A 3JVTB 4TNCA 2LVKA 2LLTA 5KTYA 1AK8A 1X02A 3KF9A 2F3ZA 3OX6A 4M2QA 1H4BA 4JQ0D 2L98A 1EJ3A 2OS8C 1OMVA 2JU0A 3NSLA 3MSEB 3KPXA 1A75A 2GV5A 1CM4A 2TN4A 1ODBA 1SBJA 1RROA 4MLWA 1A4PA 3TDZA 2NZ0A 2FCDA 2COLB 1AVSA 1J1EA 1AJ5A 2KHNA 2P6BB 3D0YB 1SKTA 4PCWA 1J7OA 2PALA 3PFVA 1KK7Z 2CT9A 2JULA 2JXLA 3CR4X 2JT3A 2L5XB 2KQYA 3GOFA 5KSZA 1MR8A 1J7RA 1DJGA 2JQ6A 2KDHA 1XFWO 1NX3A 1AHRA 1WY9A 3FS7A 3LL8B 1YUTA 1RK9A 1SCMB 3JTDC 4DIRA 4NQGA 1DVIA 3A4UB 3VGOA 5CSIA 2HF5A 4BY5A 1GJYA 3JTDB 1MQ1A 1SCVA 3GK1A 5ER4X 1K9UA 2LP3A 1F71A 2PASA 1YUSA 2PRUA 2M3WA 1OZOA 4NDDA 5AFPA 1RFJA 3FIAA 1JBAA 1K8UA 1J1DA 2KYFA 1QV0A 1WLMA 1WRZA 3OB1B 1LA0A 2H2KA 3PSRA 1QX5B 1UHHA 2G9BA 1XA5A 4P2YB 2F2PA 2BE6A 2K7CA 4WQ2A 2ISDA 1JFKA 2NCOA 3I5GB 4PE4A 2EC6C 3KEVA 2LUCA 2HQWA 1VRKA 2PVBA 1B7TY 3NSIA 4ZCUA 1BR4B 2ZN9A 1WLZA 1B9AA 3EK7A 4DCKA 4A4CA 1S6IA 1XFXO 2FCEA 4HSZA 1NUBA 2MRDA 2KBIA 1DF0A 2PSRA 4HREE 2M7LA 4DUQA 1L2OB 2KGBC 3I5FB 5IBWA 1BODA 3O2PA 1M39A 1Y6WA 4USLA 1XK4A 1U5IB 5K89A 1F4QA 2WC8A 2MJWB 3CS1A 2K7BA 4ORBB 1QVIY 2WCBA 2OPOA 2KQ6A 4I5JA 1Y0VH 2JOJA 1ZACA 1DJZA 3DF0B 3K21A 3RM1A 4CFRA 1QX2A 2L50A 5I2OA 1CDNA 1F70A 5HKZA 4MVFA 1BU3A 4WRIA 2KGRA 2BCXA 1ZUZA 4YBHB 1NCZA 1IH0A 1UUSA 1TNWA 3O4YA 4GAOA 2Q91A 4UPGA 1MF8B 2MBXA 1QIWA 1RTP1 2R2IA 1K94A 1CTRA 1OE9B 1SW8A 3LLEA 1IJ6A 2JXCA 2EHBA 1MXLC 4MZKA 3ZWHA 4ETOA 1PSRA 1ALVA 1IRJA 1KWOC 3BOWA 4PHKA 5I8NA 4F0ZB 1SL7A 2MHHA 1XFZO 4DRWA 1CB1A 4BY4A 5BPJA 1A2XA 1N0YA 1FI6A 1M31A 2CBLA 1PALA 1UP5A 3JVTC 2EGDA 4ZCVA 5KU1A 3I5HB 1Q80A 1B8CA 3SIBA 4P5OE 5I2QA 1KFUL 2L4IA 4N1GA 1MUXA 3D10A 2M1UA 3EVRA 3OP0A 2VRGA 2MLEC 1DMOA 4CIDA 1J55A 1BR1B 1NX1A 3LK0A 1CDLA 2JPTA 4I5NB 4GGFC 1B4CA 1UURA 1EL4A 3IQQA 4MSPA 2FJUB 4XYNA 3VRQA 1CNPA 2LHLA 5HKYA 1G4YR 2KAVA 2G2BA 1FPWA 3PN7B 2M1KB 3M0WA 1C7VA 1WRKA 1K96A 4R1EA 1XFUO 2LM5A 1UWOA 1K90D 1RJVA 1B7TZ 1CDPA 5D69A 1A75B 2I7AA 1JUOA 1KSMA 3SG2A 1FI5A 2LMVA 1IQ5A 5HKWA 1XVJA 1DJXA 2GGZA 2KAXA 1TIZA 3C1VA 4PE1A 3TDUA 1K9KA 4PHMA 1FBVA 4GPLB 1SCMC 1S5GY 4YGCB 1AP4A 3LK1A 1LXFC 1Y1XA 1JF0A 3CR5X 2JT8A 2KFFA 2BKIB 1YVLA 4AQJA 2KFHA 2BE4A 3O6BA 2L51A 2I94A 1QVIZ 1K93D 1M46A 2KI4C 2BCAA 2JTZA 1SMGA 3AKAA 1XFVO 1GGWA 4N5XA 5JOLA 2JRFA 2M9GA 2KI4B 1UHKA 2KOTA 1PSBA 2KFGA 3BQ3A 3NSOA 2H61C 1YR5A 1KQVA 1QASA 4JPZB 1TOPA 3VRPA 2K0JA 3EKJA 3DVJA 1D1OA 1F4OA 1R6PA 1XO5A 2WCFA 3SG7A 5D7FA 4ORAB 1BF5A 3GK4X 2BBMA 1UHJA 3CWGA 3I5GC 1DT7B 4C0JA 1TNXA 3OX5A 3PATA 2BL0C 3ZNIA 2L2EA 3AKBA 4ICBA 1NSHA 3CTNA 2Y4QA 3CGAA 3F45A 4MZJA 1TTXA 1H8BA 4MBEA 1C7WA 1SRAA 2BL0B 1B47A 3HCMA 2ZN8A 2KSPA 1MWNA 1YURA 1YVHA 2A4JA 4MEWA 4YGEB 1JFJA 5FYXA 1KCYA 1DTLA 2LUXA 4QJ3B 1L2OC 2L0PA 3I5FC 1QIVA 3EK8A 5CSNA 1L7ZA 1CFCA 1OMRA 3VROA 5DKQA 1DJIA 1JWDA 2KI6D 4GBAA 1G8IA 2CTNA 2K8MB 1LA3A 4A4BA 1YRUB 3WNXB 1NCYA 1E8AA 1DF0B 1SR6B 4MRXA 1DJHA 1LINA 1M45A 3HX4A 1EG4A 1MXEA 4PE0A 1CLBA 2F33A 1QXPA 2M0RA 1TRFA 2Y1MA 1KQMC 2AUCA 1ALWA 4YRUA 3VRRA 1TNPA 3BUNB 1U5IA 1KQMB 4DS7A 2K2AA 2JC2A 4AOMA 1XFYO 1CLMA 3TDIA 2ZFDA 4FTGA 1QJTA 2AAOA 3GK2A 2WNDA 4HRGA 3RLZA 1S5GZ 4GUKA 3EVUA 1KFXS 1V1FA 2I18A 4OCIA 5J3XA 1J7QA 1NX2A 2LV7A 2LMUA 3CLNA 5G08A 2I2RE 1KK8C 1AJ4A 2MA2A 3BUWB 3OB2B 3BUXB 2E30A 1SYMA 4AQIA 2MAZA 2OTGC 3WXAA 5B8IB 1XYDA 4PE7A 2B1UA 1KK8B 2M8UA 1OOJA 1OZSA 2ZRSA 2NXQA 3I5HC 1A03A 1FW4A 2OTGB 1JF2A 1IWQA 4XJKA 5HYDA 1YX7A 3FWCA 3QRXA 1QLKA 3BOWB 2LVVA 3I5IC 4OVNF 1DGVA 1BMOA 1YTZC 1TCFA 4MRYA 4OV2A 2ZRTA 4QJ4B 5CSFA 4E68A 1R2UA 2LLSA 3I5IB 5DKNA 3WHTB 3BUMB 1LVCD 3PN7C 2Y1NA 1JSAA 5GQQC 2KYCA 4CFQA 2ZNDA 1CFDA 4NDBA 1W7IB 1IGVA 3NXAA 3AAKA 1MHOA 1S6CA 3TS5C 1B8RA 2M29A 1NPQA 2QACA 1CMFA 3TS5B 1SK6D 1GQMA 2QPTA 4YGAA 1B1GA 5AERA 1Y1AA 3SG6A 2F3YA 4GGFA 2Y5IA 2V53A 3DVEA 1TNQA 2LVJA 1HT9A 1QTXA 2M49B 5TNCA 4CPVA 2JZIA 5ER5A 1BG1A 2KNEA 3DVMA 3NSKA 3D0YA 2OS8B 1PRWA 4CLNA 4PALA 3PM8A 3TZ1A 2M7NA 2HPSA 2D8NA 1C07A 1BOCA 1FF1A 2E6WA 1CMGA 2LANA 5HLVA 1OSAA 2WCEA 2LVIA 2FOTA 3DD4A 1A29A 4C0LA 1SPYA 3E3RA 1QS7A 5AEQA 1S6JA 2WOSA 4GNKB 1NP8A 2IS9A 1K9PA 3AAJA 1PVBA 2F2OA 3CZTX 1CKKA 2JNFA 1KSOA 4I5KA 2CXJA 2KBMA 3BXKA 4YI8A 2JNXA 2MLFC 1K95A 4PDZA 2NCPA 1SY9A 1IKUA 2LNKA 2BCBA 4N1FA 3SG4A 2HETA 2JTTA 1K2HA 2Q4UA 2H61A 2BBNA 1BJFA 4PHJA 2DOQA 1TCOB 2ZNEA 2LE9B 1CLLA 2ZKMX 2LCPA 3LCPC 1DJYA 4D1EA 1QX7A 1IJ5A 1SL8A 1UHNA 4QJ5B 1YUUA 4PHNA 4I5LB 3PLFB 1S26D 2NLNA 3BYAA 1CM1A 1B8LA 4NDCA 3IF7A 1PVAA 2O60A 1SR6C 1LKJA 2LAPA 2SCPA 2LMTA 1N65A 4M2PA 2AMIA 3TUYC 1YX8A 1OQPA 3O78A 4GFTA 1SNLA 1XK4C 3KO0A 1BLQA 1IQ3A 1WRLA 4ORCB 1CFPA 4MN0A 3EVVA 3TUYB 1S36A 2K7OA 2K61A 3H4SE 1AUIB 2EC6B 5DKRA 1KK7Y 4OKHA 4WQ3A 1RWYA 1WDCC 1ZFSA 1DGUA 1RECA 3DVKA 3A8RA 3KHEA 1SL9A 1DJWA 1M63B 4MZLA 1BT6A 3EKHA 3SG5A 2GGMA 1WDCB 2K2FA 5CPVA 5I2LA 2L4HA 5F6TA 3DF0A 1Y1UA 1NYAA 2F8PA 4GGNA 3SG3A 3FWBA 5AANA 5JJGA 1CFFA 1GGZA 4YGBB 1NX0A 4JWQA 1IG5A 1S3PA 1QATA 1F8HA 1OMDA 1TN4A 2KAYA 3EK4A 5HLOA 2M97A 4FQOA 1EH2A 2LLUA 2PMYA 2LC5A 2O5GA 1KFUS 3CR2A 1PK0D 2HQ8A 2BECA 4L9MA 1F55A 2LHIA 1W7JB 3PALA 1EG3A 4C0KA 1F54A 3WHUB 1HQVA 1ZOTB 1J7PA 1NWDA 2BKHB 2JWWA 1EXRA 2RGIA 4M2OA 4XJKB 3VRNA 1NIWA 1S1EA 1NCXA 4IL1A 1G33A 4OR9B 1ZMZA 2CNPA 1KFXL 3ICBA 2K7DA 4HRHA 5AXIA 2KI6C
chains in the Genus database with same CATH superfamily
3PJIA 3SJSA 4YI9A 2SASA 1CDMA 2LP2A 4YGDB 1N2DA 1KWOB 1UHIA 3IQOA 4U8DA 1YRTB 2PQLA 2WORA 2CCMA 1PULA 5PALA 1V1GA 5CSJA 1JC2A 4Q04A 3BUOB 3OHMB 3B87A 1QV1A 1Z2CB 3FE8A 3SIAA 1QLSA 2JT0A 3JVTB 4TNCA 5DICA 2LVKA 2LLTA 5G08A 5KTYA 3D76A 1AK8A 1X02A 3KF9A 2F3ZA 3OX6A 4M2QA 1H4BA 4JQ0D 2L98A 1EJ3A 2OS8C 1OMVA 2JU0A 3NSLA 3MSEB 3CYZA 1A75A 3KPXA 2GV5A 1CM4A 2TN4A 1ODBA 1SBJA 1RROA 4MLWA 1A4PA 3TDZA 2NZ0A 2FCDA 2COLB 1AVSA 1J1EA 1AJ5A 2KHNA 2P6BB 3D0YB 1SKTA 4PCWA 3SS4A 1J7OA 2PALA 3PFVA 1KK7Z 2CT9A 2L5YA 2JULA 2JXLA 3CR4X 2JT3A 3R72A 2L5XB 2KQYA 3GOFA 3L47A 5KSZA 1MR8A 1J7RA 5I94A 1DJGA 2JQ6A 2KDHA 3OBVA 1XFWO 1NX3A 1AHRA 1WY9A 3FS7A 3LL8B 1YUTA 1RK9A 2P71A 1SCMB 3JTDC 4DIRA 4NQGA 1DVIA 3A4UB 3VGOA 5CSIA 4JKTA 2HF5A 4BY5A 2WCMA 3DXLA 1GJYA 2QDIA 3JTDB 1MQ1A 1SCVA 3GK1A 5ER4X 1IIOA 1K9UA 2LP3A 1F71A 2L2CA 2PASA 1YUSA 2PRUA 2JPOA 2QEHA 2M3WA 1OZOA 4NDDA 5AFPA 1RFJA 3FIAA 1JBAA 1K8UA 1J1DA 2KYFA 2WCHA 1QV0A 1WLMA 1WRZA 3OB1B 1LA0A 2H2KA 1DELA 3S0DA 3PSRA 1GM0A 1QX5B 1UHHA 1DQEA 2G9BA 1XA5A 4P2YB 3BFHA 2F2PA 2BE6A 2K7CA 4WQ2A 2ISDA 1JFKA 2NCOA 3I5GB 4PE4A 2EC6C 3KEVA 2LUCA 2HQWA 1VRKA 2PVBA 1B7TY 3OGNA 3NSIA 4ZCUA 1BR4B 2ZN9A 1WLZA 1B9AA 3EK7A 4DCKA 1OOFA 4A4CA 1S6IA 1XFXO 2FCEA 3DYEA 1TUZA 4HSZA 1NUBA 2MRDA 2KBIA 1DF0A 2PSRA 4HREE 2M7LA 4DUQA 1L2OB 1LS8A 2KGBC 3I5FB 5IBWA 1BODA 3O2PA 1M39A 1Y6WA 4USLA 1XK4A 1U5IB 5K89A 3L4AA 4F7FA 1F4QA 2WC8A 2MJWB 3CS1A 2K7BA 4ORBB 3S0FA 3D78A 1OW4A 1QVIY 2WCBA 2OPOA 2KQ6A 4I5JA 4KYNA 1Y0VH 2JOJA 2QEVA 1ZACA 1DJZA 3DF0B 3DY9A 3K21A 3RM1A 2P70A 1QX2A 2L50A 4CFRA 5I2OA 1CDNA 5D3OA 2KLDA 1F70A 5HKZA 4MVFA 1BU3A 4WRIA 2KGRA 2BCXA 1ZUZA 4YBHB 1NCZA 1IH0A 1UUSA 1TNWA 2QEBA 3O4YA 3PM2A 4GAOA 2Q91A 5EL2A 1MF8B 4UPGA 3B88A 2MBXA 1QIWA 1RTP1 2R2IA 1K94A 1CTRA 1OE9B 1SW8A 3RZSA 3LLEA 1IJ6A 4INXA 2JXCA 2EHBA 1MXLC 4MZKA 3ZWHA 4ETOA 1PSRA 1ALVA 1IRJA 1KWOC 3BOWA 4PHKA 5I8NA 4F0ZB 1SL7A 2MHHA 1XFZO 4DRWA 1CB1A 4BY4A 5BPJA 1A2XA 1N0YA 1FI6A 1M31A 1W9ZA 2CBLA 1PALA 1UP5A 3JVTC 2EGDA 4ZCVA 5KU1A 3I5HB 1Q80A 1B8CA 3SIBA 4P5OE 5I2QA 1KFUL 2L4IA 4N1GA 1MUXA 3D10A 2M1UA 3EVRA 3OP0A 2VRGA 2MLEC 1XFRA 4CIDA 1J55A 1BR1B 1NX1A 1DMOA 3LK0A 1CDLA 2JPTA 4I5NB 4GGFC 1ORGA 1B4CA 1UURA 1EL4A 3IQQA 4MSPA 2FJUB 4XYNA 3VRQA 1CNPA 2LHLA 5HKYA 1G4YR 2KAVA 2G2BA 1FPWA 3PN7B 2M1KB 3M0WA 1C7VA 1OOHA 1K96A 1WRKA 4R1EA 1XFUO 2LM5A 3CZ0A 1UWOA 1K90D 1RJVA 1B7TZ 1TWOA 1CDPA 5D69A 1A75B 2I7AA 3CZ2A 1JUOA 1KSMA 3SG2A 1FI5A 2LMVA 1IQ5A 5HKWA 1XVJA 1DJXA 2GGZA 5FI2A 2KAXA 1TIZA 3C1VA 4PE1A 3TDUA 1K9KA 4PHMA 1FBVA 4GPLB 1SCMC 1S5GY 4YGCB 1AP4A 3LK1A 1LXFC 1Y1XA 1JF0A 3CR5X 2JT8A 2KFFA 2BKIB 1YVLA 4AQJA 2KFHA 2BE4A 3O6BA 2L51A 2I94A 1QVIZ 1K93D 1M46A 2KI4C 2BCAA 2JTZA 1SMGA 3CABA 3AKAA 1XFVO 1GGWA 2BAPA 4N5XA 5JOLA 2JRFA 2M9GA 2KI4B 1UHKA 2KOTA 1PSBA 2KFGA 3BQ3A 3NSOA 2H61C 1YR5A 1KQVA 1QASA 4JPZB 1TOPA 3BFAA 3VRPA 2K0JA 3EKJA 3DVJA 1D1OA 1F4OA 1R6PA 1XO5A 2WCFA 2WCLA 3SG7A 5D7FA 4ORAB 1BF5A 3GK4X 2BBMA 3BJHA 1UHJA 3CWGA 3I5GC 1DT7B 4C0JA 1TNXA 3OX5A 3PATA 3S0AA 1C3ZA 1SSEB 2BL0C 2K60A 3ZNIA 2L2EA 3AKBA 4ICBA 1NSHA 3CTNA 2Y4QA 3CGAA 3D73A 3F45A 4MZJA 1TTXA 1H8BA 4MBEA 1C7WA 1SRAA 2BL0B 5HL1A 1B47A 3HCMA 2ZN8A 2KSPA 1MWNA 1YURA 1YVHA 2A4JA 4MEWA 4YGEB 1JFJA 5FYXA 1KCYA 1DTLA 3UO9A 2LUXA 4QJ3B 1L2OC 2L0PA 3R1OA 3I5FC 1QIVA 3EK8A 5CSNA 1L7ZA 1CFCA 1OMRA 3VROA 5DKQA 1DJIA 1JWDA 2KI6D 3B86A 4GBAA 1G8IA 2CTNA 2K8MB 1LA3A 1P28A 4A4BA 2KPHA 3VB1A 1YRUB 3WNXB 1NCYA 1E8AA 3B7AA 1DF0B 1SR6B 4MRXA 1DJHA 1LINA 1M45A 3HX4A 1EG4A 1MXEA 4PE0A 4JD9A 1CLBA 2F33A 1QXPA 2M0RA 1TRFA 2Y1MA 1KQMC 2AUCA 1ALWA 3FE9A 4YRUA 3VRRA 1TNPA 3BUNB 3B6XA 1U5IA 1KQMB 4DS7A 3N7HA 2K2AA 2JC2A 4AOMA 1XFYO 1CLMA 3TDIA 2KLEA 2ZFDA 4FTGA 1QJTA 2AAOA 3GK2A 3IVTA 2WNDA 4HRGA 3RLZA 1S5GZ 4GUKA 3EVUA 1KFXS 1V1FA 2I18A 4OCIA 5J3XA 1J7QA 1NX2A 2LV7A 2LMUA 3CLNA 5FI7A 2I2RE 1KK8C 1AJ4A 2MA2A 3BUWB 3OB2B 3BUXB 2E30A 1SYMA 4AQIA 2MAZA 3CZ1A 2PYQA 2OTGC 4IJ7A 3WXAA 5B8IB 1XYDA 4PE7A 2B1UA 1KK8B 2M8UA 1OOJA 1OZSA 2ZRSA 2NXQA 3I5HC 1A03A 1FW4A 2OTGB 1JF2A 1IWQA 4XJKA 5HYDA 1YX7A 3FWCA 3QRXA 3UNWA 1QLKA 3BOWB 2LVVA 3I5IC 4OVNF 1DGVA 1BMOA 1YTZC 1TCFA 4MRYA 4OV2A 2ZRTA 4QJ4B 5CSFA 4E68A 1R2UA 2LLSA 2FJYA 3I5IB 5DKNA 3WHTB 3BUMB 1LVCD 2WC5A 2WC6A 3PN7C 2Y1NA 1Z4HA 1JSAA 5GQQC 2KYCA 4CFQA 2ZNDA 1CFDA 4NDBA 3NHIA 1W7IB 3O4XA 1IGVA 3NXAA 3AAKA 1MHOA 1S6CA 1OOIX 3TS5C 1B8RA 2M29A 1NPQA 2QACA 1CMFA 3TS5B 3S0BA 1SK6D 1GQMA 2QPTA 4YGAA 1B1GA 5AERA 1Y1AA 3SG6A 2F3YA 4GGFA 2Y5IA 2V53A 3DVEA 1TNQA 2ERBA 2LVJA 1HT9A 1QTXA 3Q8IA 2M49B 3FE6A 5TNCA 4CPVA 2JZIA 5ER5A 1BG1A 2KNEA 3DVMA 3NSKA 3D0YA 2OS8B 1PRWA 4CLNA 4PALA 3PM8A 3TZ1A 2M7NA 2HPSA 2D8NA 3QMEA 1C07A 2YGUA 1BOCA 1FF1A 1DEKA 2E6WA 1CMGA 2LANA 5HLVA 1OSAA 2WCEA 2LVIA 4FQTA 2FOTA 4OZDA 3DD4A 3NGVA 2BNXA 1A29A 4C0LA 1SPYA 3E3RA 1QS7A 5AEQA 1S6JA 2WOSA 4GNKB 1NP8A 2IS9A 1K9PA 4INWA 3AAJA 1PVBA 2F2OA 3CZTX 1CKKA 2JNFA 1KSOA 4I5KA 2CXJA 2KBMA 3BXKA 4YI8A 4PT1A 2JNXA 3SS5A 2MLFC 1K95A 4PDZA 5FI6A 2WCJA 2NCPA 1SY9A 1IKUA 2LNKA 2BCBA 4N1FA 3SG4A 2HETA 2JTTA 1K2HA 2Q4UA 2H61A 2BBNA 1BJFA 4PHJA 2DOQA 1TCOB 2ZNEA 2LE9B 1CLLA 2ZKMX 2LCPA 3LCPC 1DJYA 4D1EA 1QX7A 1IJ5A 1SL8A 1UHNA 4QJ5B 3R1PA 3K1EA 1YUUA 3D75A 4PHNA 4I5LB 3PLFB 1S26D 2NLNA 3BYAA 1CM1A 1B8LA 4NDCA 3IF7A 1PVAA 2O60A 1SR6C 1LKJA 2LAPA 2SCPA 1DC1A 2LMTA 1N65A 3V2LA 4M2PA 2AMIA 3S0GA 1OOGA 1OQPA 1YX8A 3O78A 4GFTA 1SNLA 3TUYC 1XK4C 3D77A 3KO0A 1BLQA 1IQ3A 1WRLA 4ORCB 1CFPA 4MN0A 3EVVA 3TUYB 1S36A 2K7OA 2K61A 3H4SE 1AUIB 2EC6B 5DKRA 1KK7Y 2QEOA 4OKHA 4WQ3A 1RWYA 3R1VA 1WDCC 1ZFSA 3L4LA 1DGUA 1RECA 3DVKA 3A8RA 3KHEA 1SL9A 1DJWA 1M63B 4MZLA 1BT6A 2GTEA 3EKHA 3SG5A 3NHTA 1C3YA 2GGMA 1WDCB 2K2FA 5CPVA 5I2LA 2L4HA 5F6TA 3EG5B 3DF0A 1Y1UA 1NYAA 2F8PA 4GGNA 1TUJA 3SG3A 3FWBA 5AANA 5JJGA 3D74A 1CFFA 1GGZA 4YGBB 1QWVA 1NX0A 4JWQA 2H8VA 1IG5A 1S3PA 1QATA 1T14A 1F8HA 1OMDA 1TN4A 2KAYA 3EK4A 5HLOA 2M97A 2WCKA 4FQOA 1EH2A 2LLUA 2PMYA 3DZTA 3CDNA 2LC5A 2O5GA 1KFUS 3CR2A 1PK0D 2HQ8A 2BECA 4L9MA 1F55A 2LHIA 1W7JB 3PALA 1EG3A 4C0KA 1F54A 3WHUB 1HQVA 1ZOTB 1J7PA 1NWDA 2BKHB 2JWWA 1EXRA 2RGIA 4M2OA 4XJKB 3SS3A 3VRNA 1NIWA 1S1EA 1NCXA 4IL1A 1G33A 4OR9B 1ZMZA 2CNPA 1KFXL 3ICBA 3BFBA 2K7DA 4HRHA 5AXIA 2KI6C 3S0EA
chains in the Genus database with same CATH topology
3SJSA 4YI9A 2SASA 1CDMA 2LP2A 4YGDB 1N2DA 1KWOB 1UHIA 3IQOA 4U8DA 1YRTB 2WORA 2CCMA 1PULA 5PALA 1V1GA 5CSJA 1JC2A 4Q04A 3BUOB 3OHMB 3SIAA 1QV1A 1QLSA 2JT0A 3JVTB 4TNCA 2LVKA 2LLTA 5KTYA 1AK8A 1X02A 3KF9A 2F3ZA 3OX6A 4M2QA 1H4BA 4JQ0D 2L98A 1EJ3A 2OS8C 1OMVA 2JU0A 3NSLA 3MSEB 3KPXA 1A75A 2GV5A 1CM4A 2TN4A 1ODBA 1SBJA 1RROA 4MLWA 1A4PA 3TDZA 2NZ0A 2FCDA 2COLB 1AVSA 1J1EA 1AJ5A 2KHNA 2P6BB 3D0YB 1SKTA 4PCWA 1J7OA 2PALA 3PFVA 1KK7Z 2CT9A 2JULA 2JXLA 3CR4X 2JT3A 2L5XB 2KQYA 3GOFA 5KSZA 1MR8A 1J7RA 1DJGA 2JQ6A 2KDHA 1XFWO 1NX3A 1AHRA 1WY9A 3FS7A 3LL8B 1YUTA 1RK9A 1SCMB 3JTDC 4DIRA 4NQGA 1DVIA 3A4UB 3VGOA 5CSIA 2HF5A 4BY5A 1GJYA 3JTDB 1MQ1A 1SCVA 3GK1A 5ER4X 1K9UA 2LP3A 1F71A 2PASA 1YUSA 2PRUA 2M3WA 1OZOA 4NDDA 5AFPA 1RFJA 3FIAA 1JBAA 1K8UA 1J1DA 2KYFA 1QV0A 1WLMA 1WRZA 3OB1B 1LA0A 2H2KA 3PSRA 1QX5B 1UHHA 2G9BA 1XA5A 4P2YB 2F2PA 2BE6A 2K7CA 4WQ2A 2ISDA 1JFKA 2NCOA 3I5GB 4PE4A 2EC6C 3KEVA 2LUCA 2HQWA 1VRKA 2PVBA 1B7TY 3NSIA 4ZCUA 1BR4B 2ZN9A 1WLZA 1B9AA 3EK7A 4DCKA 4A4CA 1S6IA 1XFXO 2FCEA 4HSZA 1NUBA 2MRDA 2KBIA 1DF0A 2PSRA 4HREE 2M7LA 4DUQA 1L2OB 2KGBC 3I5FB 5IBWA 1BODA 3O2PA 1M39A 1Y6WA 4USLA 1XK4A 1U5IB 5K89A 1F4QA 2WC8A 2MJWB 3CS1A 2K7BA 4ORBB 1QVIY 2WCBA 2OPOA 2KQ6A 4I5JA 1Y0VH 2JOJA 1ZACA 1DJZA 3DF0B 3K21A 3RM1A 4CFRA 1QX2A 2L50A 5I2OA 1CDNA 1F70A 5HKZA 4MVFA 1BU3A 4WRIA 2KGRA 2BCXA 1ZUZA 4YBHB 1NCZA 1IH0A 1UUSA 1TNWA 3O4YA 4GAOA 2Q91A 4UPGA 1MF8B 2MBXA 1QIWA 1RTP1 2R2IA 1K94A 1CTRA 1OE9B 1SW8A 3LLEA 1IJ6A 2JXCA 2EHBA 1MXLC 4MZKA 3ZWHA 4ETOA 1PSRA 1ALVA 1IRJA 1KWOC 3BOWA 4PHKA 5I8NA 4F0ZB 1SL7A 2MHHA 1XFZO 4DRWA 1CB1A 4BY4A 5BPJA 1A2XA 1N0YA 1FI6A 1M31A 2CBLA 1PALA 1UP5A 3JVTC 2EGDA 4ZCVA 5KU1A 3I5HB 1Q80A 1B8CA 3SIBA 4P5OE 5I2QA 1KFUL 2L4IA 4N1GA 1MUXA 3D10A 2M1UA 3EVRA 3OP0A 2VRGA 2MLEC 1DMOA 4CIDA 1J55A 1BR1B 1NX1A 3LK0A 1CDLA 2JPTA 4I5NB 4GGFC 1B4CA 1UURA 1EL4A 3IQQA 4MSPA 2FJUB 4XYNA 3VRQA 1CNPA 2LHLA 5HKYA 1G4YR 2KAVA 2G2BA 1FPWA 3PN7B 2M1KB 3M0WA 1C7VA 1WRKA 1K96A 4R1EA 1XFUO 2LM5A 1UWOA 1K90D 1RJVA 1B7TZ 1CDPA 5D69A 1A75B 2I7AA 1JUOA 1KSMA 3SG2A 1FI5A 2LMVA 1IQ5A 5HKWA 1XVJA 1DJXA 2GGZA 2KAXA 1TIZA 3C1VA 4PE1A 3TDUA 1K9KA 4PHMA 1FBVA 4GPLB 1SCMC 1S5GY 4YGCB 1AP4A 3LK1A 1LXFC 1Y1XA 1JF0A 3CR5X 2JT8A 2KFFA 2BKIB 1YVLA 4AQJA 2KFHA 2BE4A 3O6BA 2L51A 2I94A 1QVIZ 1K93D 1M46A 2KI4C 2BCAA 2JTZA 1SMGA 3AKAA 1XFVO 1GGWA 4N5XA 5JOLA 2JRFA 2M9GA 2KI4B 1UHKA 2KOTA 1PSBA 2KFGA 3BQ3A 3NSOA 2H61C 1YR5A 1KQVA 1QASA 4JPZB 1TOPA 3VRPA 2K0JA 3EKJA 3DVJA 1D1OA 1F4OA 1R6PA 1XO5A 2WCFA 3SG7A 5D7FA 4ORAB 1BF5A 3GK4X 2BBMA 1UHJA 3CWGA 3I5GC 1DT7B 4C0JA 1TNXA 3OX5A 3PATA 2BL0C 3ZNIA 2L2EA 3AKBA 4ICBA 1NSHA 3CTNA 2Y4QA 3CGAA 3F45A 4MZJA 1TTXA 1H8BA 4MBEA 1C7WA 1SRAA 2BL0B 1B47A 3HCMA 2ZN8A 2KSPA 1MWNA 1YURA 1YVHA 2A4JA 4MEWA 4YGEB 1JFJA 5FYXA 1KCYA 1DTLA 2LUXA 4QJ3B 1L2OC 2L0PA 3I5FC 1QIVA 3EK8A 5CSNA 1L7ZA 1CFCA 1OMRA 3VROA 5DKQA 1DJIA 1JWDA 2KI6D 4GBAA 1G8IA 2CTNA 2K8MB 1LA3A 4A4BA 1YRUB 3WNXB 1NCYA 1E8AA 1DF0B 1SR6B 4MRXA 1DJHA 1LINA 1M45A 3HX4A 1EG4A 1MXEA 4PE0A 1CLBA 2F33A 1QXPA 2M0RA 1TRFA 2Y1MA 1KQMC 2AUCA 1ALWA 4YRUA 3VRRA 1TNPA 3BUNB 1U5IA 1KQMB 4DS7A 2K2AA 2JC2A 4AOMA 1XFYO 1CLMA 3TDIA 2ZFDA 4FTGA 1QJTA 2AAOA 3GK2A 2WNDA 4HRGA 3RLZA 1S5GZ 4GUKA 3EVUA 1KFXS 1V1FA 2I18A 4OCIA 5J3XA 1J7QA 1NX2A 2LV7A 2LMUA 3CLNA 5G08A 2I2RE 1KK8C 1AJ4A 2MA2A 3BUWB 3OB2B 3BUXB 2E30A 1SYMA 4AQIA 2MAZA 2OTGC 3WXAA 5B8IB 1XYDA 4PE7A 2B1UA 1KK8B 2M8UA 1OOJA 1OZSA 2ZRSA 2NXQA 3I5HC 1A03A 1FW4A 2OTGB 1JF2A 1IWQA 4XJKA 5HYDA 1YX7A 3FWCA 3QRXA 1QLKA 3BOWB 2LVVA 3I5IC 4OVNF 1DGVA 1BMOA 1YTZC 1TCFA 4MRYA 4OV2A 2ZRTA 4QJ4B 5CSFA 4E68A 1R2UA 2LLSA 3I5IB 5DKNA 3WHTB 3BUMB 1LVCD 3PN7C 2Y1NA 1JSAA 5GQQC 2KYCA 4CFQA 2ZNDA 1CFDA 4NDBA 1W7IB 1IGVA 3NXAA 3AAKA 1MHOA 1S6CA 3TS5C 1B8RA 2M29A 1NPQA 2QACA 1CMFA 3TS5B 1SK6D 1GQMA 2QPTA 4YGAA 1B1GA 5AERA 1Y1AA 3SG6A 2F3YA 4GGFA 2Y5IA 2V53A 3DVEA 1TNQA 2LVJA 1HT9A 1QTXA 2M49B 5TNCA 4CPVA 2JZIA 5ER5A 1BG1A 2KNEA 3DVMA 3NSKA 3D0YA 2OS8B 1PRWA 4CLNA 4PALA 3PM8A 3TZ1A 2M7NA 2HPSA 2D8NA 1C07A 1BOCA 1FF1A 2E6WA 1CMGA 2LANA 5HLVA 1OSAA 2WCEA 2LVIA 2FOTA 3DD4A 1A29A 4C0LA 1SPYA 3E3RA 1QS7A 5AEQA 1S6JA 2WOSA 4GNKB 1NP8A 2IS9A 1K9PA 3AAJA 1PVBA 2F2OA 3CZTX 1CKKA 2JNFA 1KSOA 4I5KA 2CXJA 2KBMA 3BXKA 4YI8A 2JNXA 2MLFC 1K95A 4PDZA 2NCPA 1SY9A 1IKUA 2LNKA 2BCBA 4N1FA 3SG4A 2HETA 2JTTA 1K2HA 2Q4UA 2H61A 2BBNA 1BJFA 4PHJA 2DOQA 1TCOB 2ZNEA 2LE9B 1CLLA 2ZKMX 2LCPA 3LCPC 1DJYA 4D1EA 1QX7A 1IJ5A 1SL8A 1UHNA 4QJ5B 1YUUA 4PHNA 4I5LB 3PLFB 1S26D 2NLNA 3BYAA 1CM1A 1B8LA 4NDCA 3IF7A 1PVAA 2O60A 1SR6C 1LKJA 2LAPA 2SCPA 2LMTA 1N65A 4M2PA 2AMIA 3TUYC 1YX8A 1OQPA 3O78A 4GFTA 1SNLA 1XK4C 3KO0A 1BLQA 1IQ3A 1WRLA 4ORCB 1CFPA 4MN0A 3EVVA 3TUYB 1S36A 2K7OA 2K61A 3H4SE 1AUIB 2EC6B 5DKRA 1KK7Y 4OKHA 4WQ3A 1RWYA 1WDCC 1ZFSA 1DGUA 1RECA 3DVKA 3A8RA 3KHEA 1SL9A 1DJWA 1M63B 4MZLA 1BT6A 3EKHA 3SG5A 2GGMA 1WDCB 2K2FA 5CPVA 5I2LA 2L4HA 5F6TA 3DF0A 1Y1UA 1NYAA 2F8PA 4GGNA 3SG3A 3FWBA 5AANA 5JJGA 1CFFA 1GGZA 4YGBB 1NX0A 4JWQA 1IG5A 1S3PA 1QATA 1F8HA 1OMDA 1TN4A 2KAYA 3EK4A 5HLOA 2M97A 4FQOA 1EH2A 2LLUA 2PMYA 2LC5A 2O5GA 1KFUS 3CR2A 1PK0D 2HQ8A 2BECA 4L9MA 1F55A 2LHIA 1W7JB 3PALA 1EG3A 4C0KA 1F54A 3WHUB 1HQVA 1ZOTB 1J7PA 1NWDA 2BKHB 2JWWA 1EXRA 2RGIA 4M2OA 4XJKB 3VRNA 1NIWA 1S1EA 1NCXA 4IL1A 1G33A 4OR9B 1ZMZA 2CNPA 1KFXL 3ICBA 2K7DA 4HRHA 5AXIA 2KI6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJS A;  4YI9 A;  2SAS A;  1CDM A;  2LP2 A;  4YGD B;  1N2D A;  1KWO B;  1UHI A;  3IQO A;  4U8D A;  1YRT B;  2WOR A;  2CCM A;  1PUL A;  5PAL A;  1V1G A;  5CSJ A;  1JC2 A;  4Q04 A;  3BUO B;  3OHM B;  3SIA A;  1QV1 A;  1QLS A;  2JT0 A;  3JVT B;  4TNC A;  2LVK A;  2LLT A;  5KTY A;  1AK8 A;  1X02 A;  3KF9 A;  2F3Z A;  3OX6 A;  4M2Q A;  1H4B A;  4JQ0 D;  2L98 A;  1EJ3 A;  2OS8 C;  1OMV A;  2JU0 A;  3NSL A;  3MSE B;  3KPX A;  1A75 A;  2GV5 A;  1CM4 A;  2TN4 A;  1ODB A;  1SBJ A;  1RRO A;  4MLW A;  1A4P A;  3TDZ A;  2NZ0 A;  2FCD A;  2COL B;  1AVS A;  1J1E A;  1AJ5 A;  2KHN A;  2P6B B;  3D0Y B;  1SKT A;  4PCW A;  1J7O A;  2PAL A;  3PFV A;  1KK7 Z;  2CT9 A;  2JUL A;  2JXL A;  3CR4 X;  2JT3 A;  2L5X B;  2KQY A;  3GOF A;  5KSZ A;  1MR8 A;  1J7R A;  1DJG A;  2JQ6 A;  2KDH A;  1XFW O;  1NX3 A;  1AHR A;  1WY9 A;  3FS7 A;  3LL8 B;  1YUT A;  1RK9 A;  1SCM B;  3JTD C;  4DIR A;  4NQG A;  1DVI A;  3A4U B;  3VGO A;  5CSI A;  2HF5 A;  4BY5 A;  1GJY A;  3JTD B;  1MQ1 A;  1SCV A;  3GK1 A;  5ER4 X;  1K9U A;  2LP3 A;  1F71 A;  2PAS A;  1YUS A;  2PRU A;  2M3W A;  1OZO A;  4NDD A;  5AFP A;  1RFJ A;  3FIA A;  1JBA A;  1K8U A;  1J1D A;  2KYF A;  1QV0 A;  1WLM A;  1WRZ A;  3OB1 B;  1LA0 A;  2H2K A;  3PSR A;  1QX5 B;  1UHH A;  2G9B A;  1XA5 A;  4P2Y B;  2F2P A;  2BE6 A;  2K7C A;  4WQ2 A;  2ISD A;  1JFK A;  2NCO A;  3I5G B;  4PE4 A;  2EC6 C;  3KEV A;  2LUC A;  2HQW A;  1VRK A;  2PVB A;  1B7T Y;  3NSI A;  4ZCU A;  1BR4 B;  2ZN9 A;  1WLZ A;  1B9A A;  3EK7 A;  4DCK A;  4A4C A;  1S6I A;  1XFX O;  2FCE A;  4HSZ A;  1NUB A;  2MRD A;  2KBI A;  1DF0 A;  2PSR A;  4HRE E;  2M7L A;  4DUQ A;  1L2O B;  2KGB C;  3I5F B;  5IBW A;  1BOD A;  3O2P A;  1M39 A;  1Y6W A;  4USL A;  1XK4 A;  1U5I B;  5K89 A;  1F4Q A;  2WC8 A;  2MJW B;  3CS1 A;  2K7B A;  4ORB B;  1QVI Y;  2WCB A;  2OPO A;  2KQ6 A;  4I5J A;  1Y0V H;  2JOJ A;  1ZAC A;  1DJZ A;  3DF0 B;  3K21 A;  3RM1 A;  4CFR A;  1QX2 A;  2L50 A;  5I2O A;  1CDN A;  1F70 A;  5HKZ A;  4MVF A;  1BU3 A;  4WRI A;  2KGR A;  2BCX A;  1ZUZ A;  4YBH B;  1NCZ A;  1IH0 A;  1UUS A;  1TNW A;  3O4Y A;  4GAO A;  2Q91 A;  4UPG A;  1MF8 B;  2MBX A;  1QIW A;  1RTP 1;  2R2I A;  1K94 A;  1CTR A;  1OE9 B;  1SW8 A;  3LLE A;  1IJ6 A;  2JXC A;  2EHB A;  1MXL C;  4MZK A;  3ZWH A;  4ETO A;  1PSR A;  1ALV A;  1IRJ A;  1KWO C;  3BOW A;  4PHK A;  5I8N A;  4F0Z B;  1SL7 A;  2MHH A;  1XFZ O;  4DRW A;  1CB1 A;  4BY4 A;  5BPJ A;  1A2X A;  1N0Y A;  1FI6 A;  1M31 A;  2CBL A;  1PAL A;  1UP5 A;  3JVT C;  2EGD A;  4ZCV A;  5KU1 A;  3I5H B;  1Q80 A;  1B8C A;  3SIB A;  4P5O E;  5I2Q A;  1KFU L;  2L4I A;  4N1G A;  1MUX A;  3D10 A;  2M1U A;  3EVR A;  3OP0 A;  2VRG A;  2MLE C;  1DMO A;  4CID A;  1J55 A;  1BR1 B;  1NX1 A;  3LK0 A;  1CDL A;  2JPT A;  4I5N B;  4GGF C;  1B4C A;  1UUR A;  1EL4 A;  3IQQ A;  4MSP A;  2FJU B;  4XYN A;  3VRQ A;  1CNP A;  2LHL A;  5HKY A;  1G4Y R;  2KAV A;  2G2B A;  1FPW A;  3PN7 B;  2M1K B;  3M0W A;  1C7V A;  1WRK A;  1K96 A;  4R1E A;  1XFU O;  2LM5 A;  1UWO A;  1K90 D;  1RJV A;  1B7T Z;  1CDP A;  5D69 A;  1A75 B;  2I7A A;  1JUO A;  1KSM A;  3SG2 A;  1FI5 A;  2LMV A;  1IQ5 A;  5HKW A;  1XVJ A;  1DJX A;  2GGZ A;  2KAX A;  1TIZ A;  3C1V A;  4PE1 A;  3TDU A;  1K9K A;  4PHM A;  1FBV A;  4GPL B;  1SCM C;  1S5G Y;  4YGC B;  1AP4 A;  3LK1 A;  1LXF C;  1Y1X A;  1JF0 A;  3CR5 X;  2JT8 A;  2KFF A;  2BKI B;  1YVL A;  4AQJ A;  2KFH A;  2BE4 A;  3O6B A;  2L51 A;  2I94 A;  1QVI Z;  1K93 D;  1M46 A;  2KI4 C;  2BCA A;  2JTZ A;  1SMG A;  3AKA A;  1XFV O;  1GGW A;  4N5X A;  5JOL A;  2JRF A;  2M9G A;  2KI4 B;  1UHK A;  2KOT A;  1PSB A;  2KFG A;  3BQ3 A;  3NSO A;  2H61 C;  1YR5 A;  1KQV A;  1QAS A;  4JPZ B;  1TOP A;  3VRP A;  2K0J A;  3EKJ A;  3DVJ A;  1D1O A;  1F4O A;  1R6P A;  1XO5 A;  2WCF A;  3SG7 A;  5D7F A;  4ORA B;  1BF5 A;  3GK4 X;  2BBM A;  1UHJ A;  3CWG A;  3I5G C;  1DT7 B;  4C0J A;  1TNX A;  3OX5 A;  3PAT A;  2BL0 C;  3ZNI A;  2L2E A;  3AKB A;  4ICB A;  1NSH A;  3CTN A;  2Y4Q A;  3CGA A;  3F45 A;  4MZJ A;  1TTX A;  1H8B A;  4MBE A;  1C7W A;  1SRA A;  2BL0 B;  1B47 A;  3HCM A;  2ZN8 A;  2KSP A;  1MWN A;  1YUR A;  1YVH A;  2A4J A;  4MEW A;  4YGE B;  1JFJ A;  5FYX A;  1KCY A;  1DTL A;  2LUX A;  4QJ3 B;  1L2O C;  2L0P A;  3I5F C;  1QIV A;  3EK8 A;  5CSN A;  1L7Z A;  1CFC A;  1OMR A;  3VRO A;  5DKQ A;  1DJI A;  1JWD A;  2KI6 D;  4GBA A;  1G8I A;  2CTN A;  2K8M B;  1LA3 A;  4A4B A;  1YRU B;  3WNX B;  1NCY A;  1E8A A;  1DF0 B;  1SR6 B;  4MRX A;  1DJH A;  1LIN A;  1M45 A;  3HX4 A;  1EG4 A;  1MXE A;  4PE0 A;  1CLB A;  2F33 A;  1QXP A;  2M0R A;  1TRF A;  2Y1M A;  1KQM C;  2AUC A;  1ALW A;  4YRU A;  3VRR A;  1TNP A;  3BUN B;  1U5I A;  1KQM B;  4DS7 A;  2K2A A;  2JC2 A;  4AOM A;  1XFY O;  1CLM A;  3TDI A;  2ZFD A;  4FTG A;  1QJT A;  2AAO A;  3GK2 A;  2WND A;  4HRG A;  3RLZ A;  1S5G Z;  4GUK A;  3EVU A;  1KFX S;  1V1F A;  2I18 A;  4OCI A;  5J3X A;  1J7Q A;  1NX2 A;  2LV7 A;  2LMU A;  3CLN A;  5G08 A;  2I2R E;  1KK8 C;  1AJ4 A;  2MA2 A;  3BUW B;  3OB2 B;  3BUX B;  2E30 A;  1SYM A;  4AQI A;  2MAZ A;  2OTG C;  3WXA A;  5B8I B;  1XYD A;  4PE7 A;  2B1U A;  1KK8 B;  2M8U A;  1OOJ A;  1OZS A;  2ZRS A;  2NXQ A;  3I5H C;  1A03 A;  1FW4 A;  2OTG B;  1JF2 A;  1IWQ A;  4XJK A;  5HYD A;  1YX7 A;  3FWC A;  3QRX A;  1QLK A;  3BOW B;  2LVV A;  3I5I C;  4OVN F;  1DGV A;  1BMO A;  1YTZ C;  1TCF A;  4MRY A;  4OV2 A;  2ZRT A;  4QJ4 B;  5CSF A;  4E68 A;  1R2U A;  2LLS A;  3I5I B;  5DKN A;  3WHT B;  3BUM B;  1LVC D;  3PN7 C;  2Y1N A;  1JSA A;  5GQQ C;  2KYC A;  4CFQ A;  2ZND A;  1CFD A;  4NDB A;  1W7I B;  1IGV A;  3NXA A;  3AAK A;  1MHO A;  1S6C A;  3TS5 C;  1B8R A;  2M29 A;  1NPQ A;  2QAC A;  1CMF A;  3TS5 B;  1SK6 D;  1GQM A;  2QPT A;  4YGA A;  1B1G A;  5AER A;  1Y1A A;  3SG6 A;  2F3Y A;  4GGF A;  2Y5I A;  2V53 A;  3DVE A;  1TNQ A;  2LVJ A;  1HT9 A;  1QTX A;  2M49 B;  5TNC A;  4CPV A;  2JZI A;  5ER5 A;  1BG1 A;  2KNE A;  3DVM A;  3NSK A;  3D0Y A;  2OS8 B;  1PRW A;  4CLN A;  4PAL A;  3PM8 A;  3TZ1 A;  2M7N A;  2HPS A;  2D8N A;  1C07 A;  1BOC A;  1FF1 A;  2E6W A;  1CMG A;  2LAN A;  5HLV A;  1OSA A;  2WCE A;  2LVI A;  2FOT A;  3DD4 A;  1A29 A;  4C0L A;  1SPY A;  3E3R A;  1QS7 A;  5AEQ A;  1S6J A;  2WOS A;  4GNK B;  1NP8 A;  2IS9 A;  1K9P A;  3AAJ A;  1PVB A;  2F2O A;  3CZT X;  1CKK A;  2JNF A;  1KSO A;  4I5K A;  2CXJ A;  2KBM A;  3BXK A;  4YI8 A;  2JNX A;  2MLF C;  1K95 A;  4PDZ A;  2NCP A;  1SY9 A;  1IKU A;  2LNK A;  2BCB A;  4N1F A;  3SG4 A;  2HET A;  2JTT A;  1K2H A;  2Q4U A;  2H61 A;  2BBN A;  1BJF A;  4PHJ A;  2DOQ A;  1TCO B;  2ZNE A;  2LE9 B;  1CLL A;  2ZKM X;  2LCP A;  3LCP C;  1DJY A;  4D1E A;  1QX7 A;  1IJ5 A;  1SL8 A;  1UHN A;  4QJ5 B;  1YUU A;  4PHN A;  4I5L B;  3PLF B;  1S26 D;  2NLN A;  3BYA A;  1CM1 A;  1B8L A;  4NDC A;  3IF7 A;  1PVA A;  2O60 A;  1SR6 C;  1LKJ A;  2LAP A;  2SCP A;  2LMT A;  1N65 A;  4M2P A;  2AMI A;  3TUY C;  1YX8 A;  1OQP A;  3O78 A;  4GFT A;  1SNL A;  1XK4 C;  3KO0 A;  1BLQ A;  1IQ3 A;  1WRL A;  4ORC B;  1CFP A;  4MN0 A;  3EVV A;  3TUY B;  1S36 A;  2K7O A;  2K61 A;  3H4S E;  1AUI B;  2EC6 B;  5DKR A;  1KK7 Y;  4OKH A;  4WQ3 A;  1RWY A;  1WDC C;  1ZFS A;  1DGU A;  1REC A;  3DVK A;  3A8R A;  3KHE A;  1SL9 A;  1DJW A;  1M63 B;  4MZL A;  1BT6 A;  3EKH A;  3SG5 A;  2GGM A;  1WDC B;  2K2F A;  5CPV A;  5I2L A;  2L4H A;  5F6T A;  3DF0 A;  1Y1U A;  1NYA A;  2F8P A;  4GGN A;  3SG3 A;  3FWB A;  5AAN A;  5JJG A;  1CFF A;  1GGZ A;  4YGB B;  1NX0 A;  4JWQ A;  1IG5 A;  1S3P A;  1QAT A;  1F8H A;  1OMD A;  1TN4 A;  2KAY A;  3EK4 A;  5HLO A;  2M97 A;  4FQO A;  1EH2 A;  2LLU A;  2PMY A;  2LC5 A;  2O5G A;  1KFU S;  3CR2 A;  1PK0 D;  2HQ8 A;  2BEC A;  4L9M A;  1F55 A;  2LHI A;  1W7J B;  3PAL A;  1EG3 A;  4C0K A;  1F54 A;  3WHU B;  1HQV A;  1ZOT B;  1J7P A;  1NWD A;  2BKH B;  2JWW A;  1EXR A;  2RGI A;  4M2O A;  4XJK B;  3VRN A;  1NIW A;  1S1E A;  1NCX A;  4IL1 A;  1G33 A;  4OR9 B;  1ZMZ A;  2CNP A;  1KFX L;  3ICB A;  2K7D A;  4HRH A;  5AXI A;  2KI6 C; 
#chains in the Genus database with same CATH topology
 3PJI A;  3SJS A;  4YI9 A;  2SAS A;  1CDM A;  2LP2 A;  4YGD B;  1N2D A;  1KWO B;  1UHI A;  3IQO A;  4U8D A;  1YRT B;  2PQL A;  2WOR A;  2CCM A;  1PUL A;  5PAL A;  1V1G A;  5CSJ A;  1JC2 A;  4Q04 A;  3BUO B;  3OHM B;  3B87 A;  1QV1 A;  1Z2C B;  3FE8 A;  3SIA A;  1QLS A;  2JT0 A;  3JVT B;  4TNC A;  5DIC A;  2LVK A;  2LLT A;  5G08 A;  5KTY A;  3D76 A;  1AK8 A;  1X02 A;  3KF9 A;  2F3Z A;  3OX6 A;  4M2Q A;  1H4B A;  4JQ0 D;  2L98 A;  1EJ3 A;  2OS8 C;  1OMV A;  2JU0 A;  3NSL A;  3MSE B;  3CYZ A;  1A75 A;  3KPX A;  2GV5 A;  1CM4 A;  2TN4 A;  1ODB A;  1SBJ A;  1RRO A;  4MLW A;  1A4P A;  3TDZ A;  2NZ0 A;  2FCD A;  2COL B;  1AVS A;  1J1E A;  1AJ5 A;  2KHN A;  2P6B B;  3D0Y B;  1SKT A;  4PCW A;  3SS4 A;  1J7O A;  2PAL A;  3PFV A;  1KK7 Z;  2CT9 A;  2L5Y A;  2JUL A;  2JXL A;  3CR4 X;  2JT3 A;  3R72 A;  2L5X B;  2KQY A;  3GOF A;  3L47 A;  5KSZ A;  1MR8 A;  1J7R A;  5I94 A;  1DJG A;  2JQ6 A;  2KDH A;  3OBV A;  1XFW O;  1NX3 A;  1AHR A;  1WY9 A;  3FS7 A;  3LL8 B;  1YUT A;  1RK9 A;  2P71 A;  1SCM B;  3JTD C;  4DIR A;  4NQG A;  1DVI A;  3A4U B;  3VGO A;  5CSI A;  4JKT A;  2HF5 A;  4BY5 A;  2WCM A;  3DXL A;  1GJY A;  2QDI A;  3JTD B;  1MQ1 A;  1SCV A;  3GK1 A;  5ER4 X;  1IIO A;  1K9U A;  2LP3 A;  1F71 A;  2L2C A;  2PAS A;  1YUS A;  2PRU A;  2JPO A;  2QEH A;  2M3W A;  1OZO A;  4NDD A;  5AFP A;  1RFJ A;  3FIA A;  1JBA A;  1K8U A;  1J1D A;  2KYF A;  2WCH A;  1QV0 A;  1WLM A;  1WRZ A;  3OB1 B;  1LA0 A;  2H2K A;  1DEL A;  3S0D A;  3PSR A;  1GM0 A;  1QX5 B;  1UHH A;  1DQE A;  2G9B A;  1XA5 A;  4P2Y B;  3BFH A;  2F2P A;  2BE6 A;  2K7C A;  4WQ2 A;  2ISD A;  1JFK A;  2NCO A;  3I5G B;  4PE4 A;  2EC6 C;  3KEV A;  2LUC A;  2HQW A;  1VRK A;  2PVB A;  1B7T Y;  3OGN A;  3NSI A;  4ZCU A;  1BR4 B;  2ZN9 A;  1WLZ A;  1B9A A;  3EK7 A;  4DCK A;  1OOF A;  4A4C A;  1S6I A;  1XFX O;  2FCE A;  3DYE A;  1TUZ A;  4HSZ A;  1NUB A;  2MRD A;  2KBI A;  1DF0 A;  2PSR A;  4HRE E;  2M7L A;  4DUQ A;  1L2O B;  1LS8 A;  2KGB C;  3I5F B;  5IBW A;  1BOD A;  3O2P A;  1M39 A;  1Y6W A;  4USL A;  1XK4 A;  1U5I B;  5K89 A;  3L4A A;  4F7F A;  1F4Q A;  2WC8 A;  2MJW B;  3CS1 A;  2K7B A;  4ORB B;  3S0F A;  3D78 A;  1OW4 A;  1QVI Y;  2WCB A;  2OPO A;  2KQ6 A;  4I5J A;  4KYN A;  1Y0V H;  2JOJ A;  2QEV A;  1ZAC A;  1DJZ A;  3DF0 B;  3DY9 A;  3K21 A;  3RM1 A;  2P70 A;  1QX2 A;  2L50 A;  4CFR A;  5I2O A;  1CDN A;  5D3O A;  2KLD A;  1F70 A;  5HKZ A;  4MVF A;  1BU3 A;  4WRI A;  2KGR A;  2BCX A;  1ZUZ A;  4YBH B;  1NCZ A;  1IH0 A;  1UUS A;  1TNW A;  2QEB A;  3O4Y A;  3PM2 A;  4GAO A;  2Q91 A;  5EL2 A;  1MF8 B;  4UPG A;  3B88 A;  2MBX A;  1QIW A;  1RTP 1;  2R2I A;  1K94 A;  1CTR A;  1OE9 B;  1SW8 A;  3RZS A;  3LLE A;  1IJ6 A;  4INX A;  2JXC A;  2EHB A;  1MXL C;  4MZK A;  3ZWH A;  4ETO A;  1PSR A;  1ALV A;  1IRJ A;  1KWO C;  3BOW A;  4PHK A;  5I8N A;  4F0Z B;  1SL7 A;  2MHH A;  1XFZ O;  4DRW A;  1CB1 A;  4BY4 A;  5BPJ A;  1A2X A;  1N0Y A;  1FI6 A;  1M31 A;  1W9Z A;  2CBL A;  1PAL A;  1UP5 A;  3JVT C;  2EGD A;  4ZCV A;  5KU1 A;  3I5H B;  1Q80 A;  1B8C A;  3SIB A;  4P5O E;  5I2Q A;  1KFU L;  2L4I A;  4N1G A;  1MUX A;  3D10 A;  2M1U A;  3EVR A;  3OP0 A;  2VRG A;  2MLE C;  1XFR A;  4CID A;  1J55 A;  1BR1 B;  1NX1 A;  1DMO A;  3LK0 A;  1CDL A;  2JPT A;  4I5N B;  4GGF C;  1ORG A;  1B4C A;  1UUR A;  1EL4 A;  3IQQ A;  4MSP A;  2FJU B;  4XYN A;  3VRQ A;  1CNP A;  2LHL A;  5HKY A;  1G4Y R;  2KAV A;  2G2B A;  1FPW A;  3PN7 B;  2M1K B;  3M0W A;  1C7V A;  1OOH A;  1K96 A;  1WRK A;  4R1E A;  1XFU O;  2LM5 A;  3CZ0 A;  1UWO A;  1K90 D;  1RJV A;  1B7T Z;  1TWO A;  1CDP A;  5D69 A;  1A75 B;  2I7A A;  3CZ2 A;  1JUO A;  1KSM A;  3SG2 A;  1FI5 A;  2LMV A;  1IQ5 A;  5HKW A;  1XVJ A;  1DJX A;  2GGZ A;  5FI2 A;  2KAX A;  1TIZ A;  3C1V A;  4PE1 A;  3TDU A;  1K9K A;  4PHM A;  1FBV A;  4GPL B;  1SCM C;  1S5G Y;  4YGC B;  1AP4 A;  3LK1 A;  1LXF C;  1Y1X A;  1JF0 A;  3CR5 X;  2JT8 A;  2KFF A;  2BKI B;  1YVL A;  4AQJ A;  2KFH A;  2BE4 A;  3O6B A;  2L51 A;  2I94 A;  1QVI Z;  1K93 D;  1M46 A;  2KI4 C;  2BCA A;  2JTZ A;  1SMG A;  3CAB A;  3AKA A;  1XFV O;  1GGW A;  2BAP A;  4N5X A;  5JOL A;  2JRF A;  2M9G A;  2KI4 B;  1UHK A;  2KOT A;  1PSB A;  2KFG A;  3BQ3 A;  3NSO A;  2H61 C;  1YR5 A;  1KQV A;  1QAS A;  4JPZ B;  1TOP A;  3BFA A;  3VRP A;  2K0J A;  3EKJ A;  3DVJ A;  1D1O A;  1F4O A;  1R6P A;  1XO5 A;  2WCF A;  2WCL A;  3SG7 A;  5D7F A;  4ORA B;  1BF5 A;  3GK4 X;  2BBM A;  3BJH A;  1UHJ A;  3CWG A;  3I5G C;  1DT7 B;  4C0J A;  1TNX A;  3OX5 A;  3PAT A;  3S0A A;  1C3Z A;  1SSE B;  2BL0 C;  2K60 A;  3ZNI A;  2L2E A;  3AKB A;  4ICB A;  1NSH A;  3CTN A;  2Y4Q A;  3CGA A;  3D73 A;  3F45 A;  4MZJ A;  1TTX A;  1H8B A;  4MBE A;  1C7W A;  1SRA A;  2BL0 B;  5HL1 A;  1B47 A;  3HCM A;  2ZN8 A;  2KSP A;  1MWN A;  1YUR A;  1YVH A;  2A4J A;  4MEW A;  4YGE B;  1JFJ A;  5FYX A;  1KCY A;  1DTL A;  3UO9 A;  2LUX A;  4QJ3 B;  1L2O C;  2L0P A;  3R1O A;  3I5F C;  1QIV A;  3EK8 A;  5CSN A;  1L7Z A;  1CFC A;  1OMR A;  3VRO A;  5DKQ A;  1DJI A;  1JWD A;  2KI6 D;  3B86 A;  4GBA A;  1G8I A;  2CTN A;  2K8M B;  1LA3 A;  1P28 A;  4A4B A;  2KPH A;  3VB1 A;  1YRU B;  3WNX B;  1NCY A;  1E8A A;  3B7A A;  1DF0 B;  1SR6 B;  4MRX A;  1DJH A;  1LIN A;  1M45 A;  3HX4 A;  1EG4 A;  1MXE A;  4PE0 A;  4JD9 A;  1CLB A;  2F33 A;  1QXP A;  2M0R A;  1TRF A;  2Y1M A;  1KQM C;  2AUC A;  1ALW A;  3FE9 A;  4YRU A;  3VRR A;  1TNP A;  3BUN B;  3B6X A;  1U5I A;  1KQM B;  4DS7 A;  3N7H A;  2K2A A;  2JC2 A;  4AOM A;  1XFY O;  1CLM A;  3TDI A;  2KLE A;  2ZFD A;  4FTG A;  1QJT A;  2AAO A;  3GK2 A;  3IVT A;  2WND A;  4HRG A;  3RLZ A;  1S5G Z;  4GUK A;  3EVU A;  1KFX S;  1V1F A;  2I18 A;  4OCI A;  5J3X A;  1J7Q A;  1NX2 A;  2LV7 A;  2LMU A;  3CLN A;  5FI7 A;  2I2R E;  1KK8 C;  1AJ4 A;  2MA2 A;  3BUW B;  3OB2 B;  3BUX B;  2E30 A;  1SYM A;  4AQI A;  2MAZ A;  3CZ1 A;  2PYQ A;  2OTG C;  4IJ7 A;  3WXA A;  5B8I B;  1XYD A;  4PE7 A;  2B1U A;  1KK8 B;  2M8U A;  1OOJ A;  1OZS A;  2ZRS A;  2NXQ A;  3I5H C;  1A03 A;  1FW4 A;  2OTG B;  1JF2 A;  1IWQ A;  4XJK A;  5HYD A;  1YX7 A;  3FWC A;  3QRX A;  3UNW A;  1QLK A;  3BOW B;  2LVV A;  3I5I C;  4OVN F;  1DGV A;  1BMO A;  1YTZ C;  1TCF A;  4MRY A;  4OV2 A;  2ZRT A;  4QJ4 B;  5CSF A;  4E68 A;  1R2U A;  2LLS A;  2FJY A;  3I5I B;  5DKN A;  3WHT B;  3BUM B;  1LVC D;  2WC5 A;  2WC6 A;  3PN7 C;  2Y1N A;  1Z4H A;  1JSA A;  5GQQ C;  2KYC A;  4CFQ A;  2ZND A;  1CFD A;  4NDB A;  3NHI A;  1W7I B;  3O4X A;  1IGV A;  3NXA A;  3AAK A;  1MHO A;  1S6C A;  1OOI X;  3TS5 C;  1B8R A;  2M29 A;  1NPQ A;  2QAC A;  1CMF A;  3TS5 B;  3S0B A;  1SK6 D;  1GQM A;  2QPT A;  4YGA A;  1B1G A;  5AER A;  1Y1A A;  3SG6 A;  2F3Y A;  4GGF A;  2Y5I A;  2V53 A;  3DVE A;  1TNQ A;  2ERB A;  2LVJ A;  1HT9 A;  1QTX A;  3Q8I A;  2M49 B;  3FE6 A;  5TNC A;  4CPV A;  2JZI A;  5ER5 A;  1BG1 A;  2KNE A;  3DVM A;  3NSK A;  3D0Y A;  2OS8 B;  1PRW A;  4CLN A;  4PAL A;  3PM8 A;  3TZ1 A;  2M7N A;  2HPS A;  2D8N A;  3QME A;  1C07 A;  2YGU A;  1BOC A;  1FF1 A;  1DEK A;  2E6W A;  1CMG A;  2LAN A;  5HLV A;  1OSA A;  2WCE A;  2LVI A;  4FQT A;  2FOT A;  4OZD A;  3DD4 A;  3NGV A;  2BNX A;  1A29 A;  4C0L A;  1SPY A;  3E3R A;  1QS7 A;  5AEQ A;  1S6J A;  2WOS A;  4GNK B;  1NP8 A;  2IS9 A;  1K9P A;  4INW A;  3AAJ A;  1PVB A;  2F2O A;  3CZT X;  1CKK A;  2JNF A;  1KSO A;  4I5K A;  2CXJ A;  2KBM A;  3BXK A;  4YI8 A;  4PT1 A;  2JNX A;  3SS5 A;  2MLF C;  1K95 A;  4PDZ A;  5FI6 A;  2WCJ A;  2NCP A;  1SY9 A;  1IKU A;  2LNK A;  2BCB A;  4N1F A;  3SG4 A;  2HET A;  2JTT A;  1K2H A;  2Q4U A;  2H61 A;  2BBN A;  1BJF A;  4PHJ A;  2DOQ A;  1TCO B;  2ZNE A;  2LE9 B;  1CLL A;  2ZKM X;  2LCP A;  3LCP C;  1DJY A;  4D1E A;  1QX7 A;  1IJ5 A;  1SL8 A;  1UHN A;  4QJ5 B;  3R1P A;  3K1E A;  1YUU A;  3D75 A;  4PHN A;  4I5L B;  3PLF B;  1S26 D;  2NLN A;  3BYA A;  1CM1 A;  1B8L A;  4NDC A;  3IF7 A;  1PVA A;  2O60 A;  1SR6 C;  1LKJ A;  2LAP A;  2SCP A;  1DC1 A;  2LMT A;  1N65 A;  3V2L A;  4M2P A;  2AMI A;  3S0G A;  1OOG A;  1OQP A;  1YX8 A;  3O78 A;  4GFT A;  1SNL A;  3TUY C;  1XK4 C;  3D77 A;  3KO0 A;  1BLQ A;  1IQ3 A;  1WRL A;  4ORC B;  1CFP A;  4MN0 A;  3EVV A;  3TUY B;  1S36 A;  2K7O A;  2K61 A;  3H4S E;  1AUI B;  2EC6 B;  5DKR A;  1KK7 Y;  2QEO A;  4OKH A;  4WQ3 A;  1RWY A;  3R1V A;  1WDC C;  1ZFS A;  3L4L A;  1DGU A;  1REC A;  3DVK A;  3A8R A;  3KHE A;  1SL9 A;  1DJW A;  1M63 B;  4MZL A;  1BT6 A;  2GTE A;  3EKH A;  3SG5 A;  3NHT A;  1C3Y A;  2GGM A;  1WDC B;  2K2F A;  5CPV A;  5I2L A;  2L4H A;  5F6T A;  3EG5 B;  3DF0 A;  1Y1U A;  1NYA A;  2F8P A;  4GGN A;  1TUJ A;  3SG3 A;  3FWB A;  5AAN A;  5JJG A;  3D74 A;  1CFF A;  1GGZ A;  4YGB B;  1QWV A;  1NX0 A;  4JWQ A;  2H8V A;  1IG5 A;  1S3P A;  1QAT A;  1T14 A;  1F8H A;  1OMD A;  1TN4 A;  2KAY A;  3EK4 A;  5HLO A;  2M97 A;  2WCK A;  4FQO A;  1EH2 A;  2LLU A;  2PMY A;  3DZT A;  3CDN A;  2LC5 A;  2O5G A;  1KFU S;  3CR2 A;  1PK0 D;  2HQ8 A;  2BEC A;  4L9M A;  1F55 A;  2LHI A;  1W7J B;  3PAL A;  1EG3 A;  4C0K A;  1F54 A;  3WHU B;  1HQV A;  1ZOT B;  1J7P A;  1NWD A;  2BKH B;  2JWW A;  1EXR A;  2RGI A;  4M2O A;  4XJK B;  3SS3 A;  3VRN A;  1NIW A;  1S1E A;  1NCX A;  4IL1 A;  1G33 A;  4OR9 B;  1ZMZ A;  2CNP A;  1KFX L;  3ICB A;  3BFB A;  2K7D A;  4HRH A;  5AXI A;  2KI6 C;  3S0E A; 
#chains in the Genus database with same CATH homology
 3SJS A;  4YI9 A;  2SAS A;  1CDM A;  2LP2 A;  4YGD B;  1N2D A;  1KWO B;  1UHI A;  3IQO A;  4U8D A;  1YRT B;  2WOR A;  2CCM A;  1PUL A;  5PAL A;  1V1G A;  5CSJ A;  1JC2 A;  4Q04 A;  3BUO B;  3OHM B;  3SIA A;  1QV1 A;  1QLS A;  2JT0 A;  3JVT B;  4TNC A;  2LVK A;  2LLT A;  5KTY A;  1AK8 A;  1X02 A;  3KF9 A;  2F3Z A;  3OX6 A;  4M2Q A;  1H4B A;  4JQ0 D;  2L98 A;  1EJ3 A;  2OS8 C;  1OMV A;  2JU0 A;  3NSL A;  3MSE B;  3KPX A;  1A75 A;  2GV5 A;  1CM4 A;  2TN4 A;  1ODB A;  1SBJ A;  1RRO A;  4MLW A;  1A4P A;  3TDZ A;  2NZ0 A;  2FCD A;  2COL B;  1AVS A;  1J1E A;  1AJ5 A;  2KHN A;  2P6B B;  3D0Y B;  1SKT A;  4PCW A;  1J7O A;  2PAL A;  3PFV A;  1KK7 Z;  2CT9 A;  2JUL A;  2JXL A;  3CR4 X;  2JT3 A;  2L5X B;  2KQY A;  3GOF A;  5KSZ A;  1MR8 A;  1J7R A;  1DJG A;  2JQ6 A;  2KDH A;  1XFW O;  1NX3 A;  1AHR A;  1WY9 A;  3FS7 A;  3LL8 B;  1YUT A;  1RK9 A;  1SCM B;  3JTD C;  4DIR A;  4NQG A;  1DVI A;  3A4U B;  3VGO A;  5CSI A;  2HF5 A;  4BY5 A;  1GJY A;  3JTD B;  1MQ1 A;  1SCV A;  3GK1 A;  5ER4 X;  1K9U A;  2LP3 A;  1F71 A;  2PAS A;  1YUS A;  2PRU A;  2M3W A;  1OZO A;  4NDD A;  5AFP A;  1RFJ A;  3FIA A;  1JBA A;  1K8U A;  1J1D A;  2KYF A;  1QV0 A;  1WLM A;  1WRZ A;  3OB1 B;  1LA0 A;  2H2K A;  3PSR A;  1QX5 B;  1UHH A;  2G9B A;  1XA5 A;  4P2Y B;  2F2P A;  2BE6 A;  2K7C A;  4WQ2 A;  2ISD A;  1JFK A;  2NCO A;  3I5G B;  4PE4 A;  2EC6 C;  3KEV A;  2LUC A;  2HQW A;  1VRK A;  2PVB A;  1B7T Y;  3NSI A;  4ZCU A;  1BR4 B;  2ZN9 A;  1WLZ A;  1B9A A;  3EK7 A;  4DCK A;  4A4C A;  1S6I A;  1XFX O;  2FCE A;  4HSZ A;  1NUB A;  2MRD A;  2KBI A;  1DF0 A;  2PSR A;  4HRE E;  2M7L A;  4DUQ A;  1L2O B;  2KGB C;  3I5F B;  5IBW A;  1BOD A;  3O2P A;  1M39 A;  1Y6W A;  4USL A;  1XK4 A;  1U5I B;  5K89 A;  1F4Q A;  2WC8 A;  2MJW B;  3CS1 A;  2K7B A;  4ORB B;  1QVI Y;  2WCB A;  2OPO A;  2KQ6 A;  4I5J A;  1Y0V H;  2JOJ A;  1ZAC A;  1DJZ A;  3DF0 B;  3K21 A;  3RM1 A;  4CFR A;  1QX2 A;  2L50 A;  5I2O A;  1CDN A;  1F70 A;  5HKZ A;  4MVF A;  1BU3 A;  4WRI A;  2KGR A;  2BCX A;  1ZUZ A;  4YBH B;  1NCZ A;  1IH0 A;  1UUS A;  1TNW A;  3O4Y A;  4GAO A;  2Q91 A;  4UPG A;  1MF8 B;  2MBX A;  1QIW A;  1RTP 1;  2R2I A;  1K94 A;  1CTR A;  1OE9 B;  1SW8 A;  3LLE A;  1IJ6 A;  2JXC A;  2EHB A;  1MXL C;  4MZK A;  3ZWH A;  4ETO A;  1PSR A;  1ALV A;  1IRJ A;  1KWO C;  3BOW A;  4PHK A;  5I8N A;  4F0Z B;  1SL7 A;  2MHH A;  1XFZ O;  4DRW A;  1CB1 A;  4BY4 A;  5BPJ A;  1A2X A;  1N0Y A;  1FI6 A;  1M31 A;  2CBL A;  1PAL A;  1UP5 A;  3JVT C;  2EGD A;  4ZCV A;  5KU1 A;  3I5H B;  1Q80 A;  1B8C A;  3SIB A;  4P5O E;  5I2Q A;  1KFU L;  2L4I A;  4N1G A;  1MUX A;  3D10 A;  2M1U A;  3EVR A;  3OP0 A;  2VRG A;  2MLE C;  1DMO A;  4CID A;  1J55 A;  1BR1 B;  1NX1 A;  3LK0 A;  1CDL A;  2JPT A;  4I5N B;  4GGF C;  1B4C A;  1UUR A;  1EL4 A;  3IQQ A;  4MSP A;  2FJU B;  4XYN A;  3VRQ A;  1CNP A;  2LHL A;  5HKY A;  1G4Y R;  2KAV A;  2G2B A;  1FPW A;  3PN7 B;  2M1K B;  3M0W A;  1C7V A;  1WRK A;  1K96 A;  4R1E A;  1XFU O;  2LM5 A;  1UWO A;  1K90 D;  1RJV A;  1B7T Z;  1CDP A;  5D69 A;  1A75 B;  2I7A A;  1JUO A;  1KSM A;  3SG2 A;  1FI5 A;  2LMV A;  1IQ5 A;  5HKW A;  1XVJ A;  1DJX A;  2GGZ A;  2KAX A;  1TIZ A;  3C1V A;  4PE1 A;  3TDU A;  1K9K A;  4PHM A;  1FBV A;  4GPL B;  1SCM C;  1S5G Y;  4YGC B;  1AP4 A;  3LK1 A;  1LXF C;  1Y1X A;  1JF0 A;  3CR5 X;  2JT8 A;  2KFF A;  2BKI B;  1YVL A;  4AQJ A;  2KFH A;  2BE4 A;  3O6B A;  2L51 A;  2I94 A;  1QVI Z;  1K93 D;  1M46 A;  2KI4 C;  2BCA A;  2JTZ A;  1SMG A;  3AKA A;  1XFV O;  1GGW A;  4N5X A;  5JOL A;  2JRF A;  2M9G A;  2KI4 B;  1UHK A;  2KOT A;  1PSB A;  2KFG A;  3BQ3 A;  3NSO A;  2H61 C;  1YR5 A;  1KQV A;  1QAS A;  4JPZ B;  1TOP A;  3VRP A;  2K0J A;  3EKJ A;  3DVJ A;  1D1O A;  1F4O A;  1R6P A;  1XO5 A;  2WCF A;  3SG7 A;  5D7F A;  4ORA B;  1BF5 A;  3GK4 X;  2BBM A;  1UHJ A;  3CWG A;  3I5G C;  1DT7 B;  4C0J A;  1TNX A;  3OX5 A;  3PAT A;  2BL0 C;  3ZNI A;  2L2E A;  3AKB A;  4ICB A;  1NSH A;  3CTN A;  2Y4Q A;  3CGA A;  3F45 A;  4MZJ A;  1TTX A;  1H8B A;  4MBE A;  1C7W A;  1SRA A;  2BL0 B;  1B47 A;  3HCM A;  2ZN8 A;  2KSP A;  1MWN A;  1YUR A;  1YVH A;  2A4J A;  4MEW A;  4YGE B;  1JFJ A;  5FYX A;  1KCY A;  1DTL A;  2LUX A;  4QJ3 B;  1L2O C;  2L0P A;  3I5F C;  1QIV A;  3EK8 A;  5CSN A;  1L7Z A;  1CFC A;  1OMR A;  3VRO A;  5DKQ A;  1DJI A;  1JWD A;  2KI6 D;  4GBA A;  1G8I A;  2CTN A;  2K8M B;  1LA3 A;  4A4B A;  1YRU B;  3WNX B;  1NCY A;  1E8A A;  1DF0 B;  1SR6 B;  4MRX A;  1DJH A;  1LIN A;  1M45 A;  3HX4 A;  1EG4 A;  1MXE A;  4PE0 A;  1CLB A;  2F33 A;  1QXP A;  2M0R A;  1TRF A;  2Y1M A;  1KQM C;  2AUC A;  1ALW A;  4YRU A;  3VRR A;  1TNP A;  3BUN B;  1U5I A;  1KQM B;  4DS7 A;  2K2A A;  2JC2 A;  4AOM A;  1XFY O;  1CLM A;  3TDI A;  2ZFD A;  4FTG A;  1QJT A;  2AAO A;  3GK2 A;  2WND A;  4HRG A;  3RLZ A;  1S5G Z;  4GUK A;  3EVU A;  1KFX S;  1V1F A;  2I18 A;  4OCI A;  5J3X A;  1J7Q A;  1NX2 A;  2LV7 A;  2LMU A;  3CLN A;  5G08 A;  2I2R E;  1KK8 C;  1AJ4 A;  2MA2 A;  3BUW B;  3OB2 B;  3BUX B;  2E30 A;  1SYM A;  4AQI A;  2MAZ A;  2OTG C;  3WXA A;  5B8I B;  1XYD A;  4PE7 A;  2B1U A;  1KK8 B;  2M8U A;  1OOJ A;  1OZS A;  2ZRS A;  2NXQ A;  3I5H C;  1A03 A;  1FW4 A;  2OTG B;  1JF2 A;  1IWQ A;  4XJK A;  5HYD A;  1YX7 A;  3FWC A;  3QRX A;  1QLK A;  3BOW B;  2LVV A;  3I5I C;  4OVN F;  1DGV A;  1BMO A;  1YTZ C;  1TCF A;  4MRY A;  4OV2 A;  2ZRT A;  4QJ4 B;  5CSF A;  4E68 A;  1R2U A;  2LLS A;  3I5I B;  5DKN A;  3WHT B;  3BUM B;  1LVC D;  3PN7 C;  2Y1N A;  1JSA A;  5GQQ C;  2KYC A;  4CFQ A;  2ZND A;  1CFD A;  4NDB A;  1W7I B;  1IGV A;  3NXA A;  3AAK A;  1MHO A;  1S6C A;  3TS5 C;  1B8R A;  2M29 A;  1NPQ A;  2QAC A;  1CMF A;  3TS5 B;  1SK6 D;  1GQM A;  2QPT A;  4YGA A;  1B1G A;  5AER A;  1Y1A A;  3SG6 A;  2F3Y A;  4GGF A;  2Y5I A;  2V53 A;  3DVE A;  1TNQ A;  2LVJ A;  1HT9 A;  1QTX A;  2M49 B;  5TNC A;  4CPV A;  2JZI A;  5ER5 A;  1BG1 A;  2KNE A;  3DVM A;  3NSK A;  3D0Y A;  2OS8 B;  1PRW A;  4CLN A;  4PAL A;  3PM8 A;  3TZ1 A;  2M7N A;  2HPS A;  2D8N A;  1C07 A;  1BOC A;  1FF1 A;  2E6W A;  1CMG A;  2LAN A;  5HLV A;  1OSA A;  2WCE A;  2LVI A;  2FOT A;  3DD4 A;  1A29 A;  4C0L A;  1SPY A;  3E3R A;  1QS7 A;  5AEQ A;  1S6J A;  2WOS A;  4GNK B;  1NP8 A;  2IS9 A;  1K9P A;  3AAJ A;  1PVB A;  2F2O A;  3CZT X;  1CKK A;  2JNF A;  1KSO A;  4I5K A;  2CXJ A;  2KBM A;  3BXK A;  4YI8 A;  2JNX A;  2MLF C;  1K95 A;  4PDZ A;  2NCP A;  1SY9 A;  1IKU A;  2LNK A;  2BCB A;  4N1F A;  3SG4 A;  2HET A;  2JTT A;  1K2H A;  2Q4U A;  2H61 A;  2BBN A;  1BJF A;  4PHJ A;  2DOQ A;  1TCO B;  2ZNE A;  2LE9 B;  1CLL A;  2ZKM X;  2LCP A;  3LCP C;  1DJY A;  4D1E A;  1QX7 A;  1IJ5 A;  1SL8 A;  1UHN A;  4QJ5 B;  1YUU A;  4PHN A;  4I5L B;  3PLF B;  1S26 D;  2NLN A;  3BYA A;  1CM1 A;  1B8L A;  4NDC A;  3IF7 A;  1PVA A;  2O60 A;  1SR6 C;  1LKJ A;  2LAP A;  2SCP A;  2LMT A;  1N65 A;  4M2P A;  2AMI A;  3TUY C;  1YX8 A;  1OQP A;  3O78 A;  4GFT A;  1SNL A;  1XK4 C;  3KO0 A;  1BLQ A;  1IQ3 A;  1WRL A;  4ORC B;  1CFP A;  4MN0 A;  3EVV A;  3TUY B;  1S36 A;  2K7O A;  2K61 A;  3H4S E;  1AUI B;  2EC6 B;  5DKR A;  1KK7 Y;  4OKH A;  4WQ3 A;  1RWY A;  1WDC C;  1ZFS A;  1DGU A;  1REC A;  3DVK A;  3A8R A;  3KHE A;  1SL9 A;  1DJW A;  1M63 B;  4MZL A;  1BT6 A;  3EKH A;  3SG5 A;  2GGM A;  1WDC B;  2K2F A;  5CPV A;  5I2L A;  2L4H A;  5F6T A;  3DF0 A;  1Y1U A;  1NYA A;  2F8P A;  4GGN A;  3SG3 A;  3FWB A;  5AAN A;  5JJG A;  1CFF A;  1GGZ A;  4YGB B;  1NX0 A;  4JWQ A;  1IG5 A;  1S3P A;  1QAT A;  1F8H A;  1OMD A;  1TN4 A;  2KAY A;  3EK4 A;  5HLO A;  2M97 A;  4FQO A;  1EH2 A;  2LLU A;  2PMY A;  2LC5 A;  2O5G A;  1KFU S;  3CR2 A;  1PK0 D;  2HQ8 A;  2BEC A;  4L9M A;  1F55 A;  2LHI A;  1W7J B;  3PAL A;  1EG3 A;  4C0K A;  1F54 A;  3WHU B;  1HQV A;  1ZOT B;  1J7P A;  1NWD A;  2BKH B;  2JWW A;  1EXR A;  2RGI A;  4M2O A;  4XJK B;  3VRN A;  1NIW A;  1S1E A;  1NCX A;  4IL1 A;  1G33 A;  4OR9 B;  1ZMZ A;  2CNP A;  1KFX L;  3ICB A;  2K7D A;  4HRH A;  5AXI A;  2KI6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...