1CLBA

Determination of the solution structure of apo calbindin d9k by nmr spectroscopy
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
b'KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Determination of the solution structure of Apo calbindin D9k by NMR spectroscopy.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1995-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1clbA00
4P5OE 1SR6C 1AUIB 2LMVA 5HYDA 1H8BA 3JVTC 1QX7A 1TIZA 1B7TY 4ORBB 1B4CA 1QLSA 2OPOA 5CSFA 1NCXA 4N5XA 3AAKA 2WOSA 1BOCA 1CMFA 3H4SE 5FYXA 4XJKB 2AMIA 4DCKA 3OX6A 4GGFA 4M2QA 1F55A 1OZSA 1Q80A 1DGUA 1KK7Z 1L2OB 2D8NA 3I5GC 4QJ4B 4MSPA 1BT6A 5CSIA 2L4HA 1G8IA 1Y1UA 1QVIZ 1UURA 2LAPA 2M7NA 2MAZA 4PDZA 2M3WA 3TDUA 1NX3A 3LCPC 1DGVA 2KNEA 1A2XA 3LK0A 5AXIA 3BUOB 2KDHA 5JJGA 1AK8A 1S5GY 1KK8C 1YVHA 2ZN8A 2H61C 3CLNA 3LK1A 4GUKA 1KFUL 3PN7C 4YGDB 2KSPA 1K90D 1DJIA 1RROA 1UP5A 2H2KA 2ZNDA 3HCMA 1RTP1 1WDCC 2JXLA 1DTLA 3EK8A 1EH2A 3DF0B 4YI8A 4CPVA 2WCEA 2GGMA 3WNXB 4OR9B 1A75A 1JC2A 2P6BB 1K93D 1KFXL 3BYAA 5I2LA 1GGWA 2LMTA 3CTNA 1TN4A 4NDCA 2OS8C 2NCOA 1CDMA 2E30A 2O60A 1XFUO 1S6JA 2MRDA 1OSAA 3TUYB 1A29A 3D10A 2LV7A 3KO0A 4PCWA 1UHJA 2KYCA 2R2IA 1SW8A 3FS7A 1NUBA 1TOPA 2FCDA 4ORCB 5DKNA 1JFKA 2FCEA 1UHIA 5HLOA 1WRZA 2K7BA 3I5FB 1PVBA 4HRGA 1KCYA 1GGZA 4MVFA 4DS7A 3OB2B 1IKUA 1W7JB 1BJFA 4L9MA 1SY9A 2PRUA 1RK9A 1AP4A 1QLKA 2LHIA 4OVNF 5KU1A 1J7PA 3RLZA 2WORA 1S6CA 4IL1A 2V53A 1FW4A 1WRKA 2ZNEA 4GPLB 4AQIA 1SK6D 1NP8A 2LLTA 2Y4QA 2L0PA 4PHNA 1A75B 1R2UA 1TCFA 1TNWA 1K9KA 1SCMB 2K7DA 2KYFA 2MHHA 1TNQA 2OTGC 4I5KA 3TS5C 1B1GA 1L7ZA 2NZ0A 2I18A 4JQ0D 5I8NA 1KWOC 2L5XB 1E8AA 2JT0A 2BE4A 4FTGA 4BY4A 5IBWA 4MRXA 1B7TZ 4PHJA 2SCPA 3NSIA 1V1GA 1PULA 1CDNA 1UUSA 3VRPA 2JOJA 4M2OA 1QS7A 1M46A 1YUUA 2LP3A 1JSAA 1NIWA 3ZWHA 2CCMA 2I94A 2KFGA 1NWDA 1JF0A 2F33A 3GK4X 1DJYA 2KQ6A 1JF2A 2H61A 2KBMA 3NSOA 1SYMA 2Y1MA 3BUXB 1B8CA 4E68A 2LANA 2HETA 3WHTB 1CDPA 1CTRA 2EGDA 4DIRA 1C7VA 1FF1A 4QJ3B 3FIAA 3VROA 5D69A 5DKRA 1ZACA 2LVKA 1TTXA 3BOWB 1S5GZ 3ICBA 1S3PA 2MJWB 3WHUB 4U8DA 4CFQA 1YX7A 4ZCUA 3BUNB 5HKZA 4CLNA 1B47A 5HKYA 1ODBA 2KI4C 2G2BA 1QXPA 2BBNA 3IQOA 5CSNA 4MRYA 2G9BA 1BLQA 1KQMC 1CNPA 4MZJA 2WCFA 3IF7A 2GV5A 3E3RA 3SG6A 4GGNA 4MBEA 2JU0A 2KAVA 1PALA 3EVUA 2KGBC 1YUSA 1KFUS 1J55A 1EXRA 2F3YA 4AQJA 2KBIA 2F8PA 2JZIA 1N65A 2M1KB 2JNFA 3D0YA 1H4BA 1UWOA 1KFXS 2M8UA 1W7IB 1DJGA 1RECA 1TRFA 2PASA 2PMYA 1YUTA 1K2HA 5HKWA 2ZKMX 2LLSA 1IRJA 1YX8A 4MZLA 2NCPA 1XA5A 5PALA 1QV1A 1YR5A 1SBJA 1XYDA 5CSJA 5HLVA 1DF0A 3JTDB 1J7OA 2JTTA 1CDLA 1U5IA 2L98A 1FI5A 1SMGA 2M29A 2Q4UA 1NPQA 4I5LB 3SG4A 1WRLA 2COLB 1MR8A 1CFFA 4WQ2A 1G33A 2BL0C 4F0ZB 4WRIA 3NXAA 4XYNA 1XK4C 3KPXA 1JBAA 2HPSA 4YGEB 1CFDA 3VRRA 1K96A 2BECA 2FJUB 4NDBA 5I2QA 4HRHA 2LE9B 3OP0A 5GQQC 1NX0A 1TCOB 1D1OA 3ZNIA 3SJSA 2B1UA 3TZ1A 1NCZA 1HT9A 2FOTA 1OZOA 2M0RA 1J1EA 2M97A 3I5IC 1B8LA 1CLLA 1DJWA 1AJ4A 1WY9A 2E6WA 2EC6B 1LKJA 2KHNA 2L4IA 1YRTB 2LUCA 2M1UA 1ALWA 3A8RA 1F4OA 1CM4A 1RWYA 2JWWA 2L50A 1KWOB 1DF0B 1L2OC 3BUMB 1BMOA 1CKKA 4USLA 3RM1A 1CMGA 1SL9A 3PLFB 2CBLA 4MN0A 2CTNA 1OOJA 4PALA 1EG4A 4AOMA 1FBVA 2KFFA 3LL8B 2A4JA 4YGBB 1WLZA 5KTYA 1CB1A 4HSZA 1K9UA 1OMRA 5AERA 2LUXA 2ZRSA 3AKAA 2M7LA 1Y1XA 2KI6C 2KI6D 2KOTA 1KK7Y 2K2AA 2NXQA 4N1FA 3EVVA 3OHMB 1CLMA 1X02A 3EKJA 2AAOA 3SG2A 4YRUA 4BY5A 1IH0A 1QVIY 3LLEA 5ER5A 2VRGA 2LVJA 1BG1A 2PALA 1SNLA 3BUWB 1IG5A 1QJTA 1DJXA 3O4YA 4PHKA 1LA0A 1TNXA 2JTZA 1NSHA 1A4PA 5TNCA 1MQ1A 3TUYC 2PVBA 4C0JA 1NYAA 2AUCA 1PVAA 1KQMB 2L51A 3TDIA 3SG3A 5AANA 1OMVA 3AKBA 4CFRA 1SR6B 4N1GA 3SG5A 2BKIB 1DT7B 2QACA 3EKHA 3JVTB 3NSLA 1DJZA 1SL7A 5I2OA 5K89A 1FPWA 3I5FC 2K61A 3DVKA 1CLBA 1Y1AA 1DJHA 4WQ3A 1ZUZA 4YGAA 1WLMA 3M0WA 1V1FA 3FWBA 5DKQA 2LLUA 1FI6A 3CR4X 2BCXA 2HQ8A 3I5HC 4C0KA 4CIDA 2Y5IA 1KSMA 1SPYA 2LP2A 4HREE 1G4YR 4PHMA 3I5GB 1KQVA 3PFVA 4FQOA 4MEWA 1QIVA 4XJKA 5CPVA 3PALA 4NDDA 4ZCVA 4YBHB 3MSEB 3PM8A 1DMOA 1PK0D 1UHNA 2JT8A 3IQQA 4YI9A 1AVSA 2ISDA 2F2PA 1SCVA 5KSZA 2JULA 1KK8B 2JQ6A 1XFVO 1A03A 1QIWA 3OB1B 1C7WA 1EJ3A 2QPTA 1S26D 3F45A 2JRFA 3PN7B 1NX1A 2BL0B 3PSRA 1JWDA 3CR5X 1F8HA 2ZN9A 3CR2A 2HF5A 1WDCB 5BPJA 1IJ6A 2PSRA 1J7QA 3VRNA 2K2FA 4GBAA 2LM5A 1PRWA 3DVEA 4ORAB 3GOFA 1N0YA 1HQVA 1F4QA 3SIAA 2CNPA 1CM1A 1MUXA 1B9AA 2OS8B 1OMDA 1ZOTB 2WNDA 3DF0A 1C07A 1BU3A 1M31A 2KFHA 3I5IB 1J1DA 1DVIA 1XVJA 1YRUB 2CT9A 3SIBA 1XFYO 1KSOA 3SG7A 3KHEA 3VRQA 1QTXA 2BCBA 1EL4A 3QRXA 5AFPA 1QATA 4ETOA 1LINA 1BR4B 1MF8B 2JC2A 3O2PA 3D0YB 2BCAA 1J7RA 1YVLA 1K94A 1YTZC 2M49B 2Y1NA 3DVJA 2LCPA 2NLNA 4UPGA 3A4UB 3C1VA 1ZMZA 4I5NB 1QX5B 2F3ZA 3NSKA 4GNKB 1MXLC 1NCYA 3KF9A 4PE1A 5D7FA 2M9GA 1AHRA 2MLFC 3PATA 3KEVA 1UHHA 2KQYA 2L2EA 2OTGB 1XFXO 4OCIA 4PE0A 3TS5B 2EHBA 1IQ3A 1Y6WA 4QJ5B 1CFPA 3GK1A 3WXAA 2SASA 4TNCA 1ZFSA 2K8MB 1U5IB 3TDZA 2BKHB 2MBXA 3BXKA 1EG3A 1XFWO 2JT3A 3CS1A 1S36A 4GAOA 1RFJA 3CWGA 4YGCB 1NX2A 1TNPA 1IWQA 2TN4A 3JTDC 2I2RE 1PSBA 1K8UA 3AAJA 4OV2A 5B8IB 3O6BA 1SKTA 4I5JA 4Q04A 2WCBA 2IS9A 1AJ5A 2CXJA 4MLWA 2LMUA 2LVVA 1VRKA 3K21A 1MWNA 1IJ5A 2KAYA 4JWQA 1XFZO 4R1EA 2LNKA 2MLEC 1N2DA 5ER4X 4P2YB 1M45A 1SRAA 4GGFC 1M63B 1MXEA 4JPZB 1K95A 2I7AA 1R6PA 1K9PA 4ICBA 3BQ3A 2JXCA 1LVCD 3DD4A 3I5HB 4A4BA 1PSRA 1BF5A 3FWCA 2KI4B 4A4CA 2EC6C 2RGIA 2LC5A 1M39A 3EK7A 3BOWA 2DOQA 2LHLA 2KGRA 5JOLA 3EK4A 1F70A 2BBMA 2GGZA 1OQPA 1IQ5A 1GJYA 2Q91A 4OKHA 1CFCA 1XK4A 1Y0VH 1JUOA 2O5GA 3CZTX 3O78A 1BODA 3DVMA 4PE7A 4D1EA 3EVRA 1GQMA 4DRWA 2ZRTA 2JPTA 4C0LA 1XO5A 3GK2A 1SL8A 1BR1B 1SCMC 2K7OA 5G08A 5AEQA 1MHOA 2K0JA 1LXFC 2MA2A 2ZFDA 3OX5A 5F6TA 4MZKA 2KAXA 1UHKA 1ALVA 2JNXA 5J3XA 1LA3A 3HX4A 1QASA 2F2OA 1F54A 1OE9B 4DUQA 4M2PA 4PE4A 1S1EA 3VGOA 4NQGA 1RJVA 1IGVA 1QX2A 1S6IA 2WC8A 2HQWA 2K7CA 1B8RA 2LVIA 2BE6A 1JFJA 1YURA 3CGAA 1QV0A 1F71A 4GFTA
chains in the Genus database with same CATH superfamily
1LS8A 4P5OE 1SR6C 1AUIB 2LMVA 5FI2A 3S0BA 5HYDA 3D73A 1H8BA 3JVTC 1QX7A 1TIZA 1B7TY 4ORBB 1B4CA 1QLSA 2BAPA 2OPOA 3R1PA 1NCXA 5CSFA 4N5XA 3AAKA 2WOSA 1BOCA 2JPOA 1TWOA 3OBVA 1CMFA 5I94A 3H4SE 5FYXA 4XJKB 2AMIA 4DCKA 2WCKA 3OX6A 4GGFA 4M2QA 1F55A 1OZSA 1Q80A 3BFHA 1DGUA 1KK7Z 1L2OB 2D8NA 3I5GC 4QJ4B 4MSPA 1BT6A 5CSIA 2L4HA 1G8IA 1Y1UA 3FE9A 1QVIZ 1UURA 2LAPA 2M7NA 2MAZA 3CDNA 4PDZA 2M3WA 3TDUA 1NX3A 3LCPC 1DGVA 2KNEA 1A2XA 3LK0A 4PT1A 5AXIA 3BUOB 2KDHA 5JJGA 1C3ZA 1AK8A 1S5GY 1KK8C 1YVHA 2ZN8A 2H61C 3CLNA 3LK1A 4GUKA 2FJYA 1KFUL 3PN7C 4YGDB 2KSPA 1K90D 3O4XA 1DJIA 1RROA 1UP5A 2H2KA 2ZNDA 3HCMA 1RTP1 1WDCC 2JXLA 1DTLA 3EK8A 2L2CA 1EH2A 3DF0B 4YI8A 4INWA 4CPVA 2WCEA 2GGMA 3WNXB 1T14A 1A75A 4OR9B 1JC2A 2P6BB 1K93D 1KFXL 3BYAA 5I2LA 3V2LA 1GGWA 2LMTA 3BFBA 3CTNA 1TN4A 4NDCA 2OS8C 2NCOA 1CDMA 2E30A 2O60A 1XFUO 1S6JA 2GTEA 2MRDA 3SS3A 1OSAA 3TUYB 1A29A 3D10A 2LV7A 3KO0A 4PCWA 5FI7A 1UHJA 2KYCA 2R2IA 1SW8A 3FS7A 1NUBA 1TOPA 2FCDA 4ORCB 5DKNA 1JFKA 2FCEA 1UHIA 5HLOA 1WRZA 2K7BA 3BFAA 1PVBA 3B88A 3I5FB 4HRGA 1KCYA 1GGZA 4MVFA 4DS7A 3OB2B 1IKUA 3R72A 1W7JB 1BJFA 4L9MA 1SY9A 2PQLA 1RK9A 2ERBA 2PRUA 1QLKA 2LHIA 1AP4A 4OVNF 5KU1A 1J7PA 3RLZA 2WORA 1S6CA 4IL1A 3FE8A 2V53A 1FW4A 1WRKA 2ZNEA 4GPLB 4AQIA 3Q8IA 1SK6D 1NP8A 2LLTA 2Y4QA 2L0PA 4PHNA 1A75B 1R2UA 1TCFA 1TNWA 1K9KA 1SCMB 2K7DA 2KYFA 2MHHA 1TNQA 2OTGC 4I5KA 3TS5C 1B1GA 1L7ZA 4F7FA 2NZ0A 3CZ2A 2I18A 4JQ0D 5I8NA 1KWOC 3B6XA 2L5XB 1E8AA 2JT0A 2BE4A 4FTGA 3CABA 1DELA 4BY4A 4MRXA 5IBWA 1B7TZ 4PHJA 2SCPA 3NSIA 1V1GA 1PULA 1CDNA 1UUSA 3VRPA 2JOJA 4M2OA 1QS7A 1M46A 1YUUA 2LP3A 1JSAA 1NIWA 3ZWHA 2CCMA 2I94A 2KFGA 1DEKA 5FI6A 1XFRA 1NWDA 1JF0A 2F33A 3GK4X 1DJYA 2KQ6A 1JF2A 2H61A 2KBMA 3NSOA 1SYMA 2H8VA 2Y1MA 3BUXB 1B8CA 4E68A 2LANA 1OOIX 4FQTA 2HETA 3WHTB 1CDPA 2P70A 1CTRA 2EGDA 4DIRA 1C7VA 1FF1A 4QJ3B 3FIAA 3VROA 5D69A 5DKRA 1ZACA 2LVKA 1TTXA 3BOWB 1S5GZ 3ICBA 1S3PA 2MJWB 3WHUB 4U8DA 5EL2A 4CFQA 1YX7A 4ZCUA 3BUNB 5HKZA 4CLNA 1B47A 5HKYA 1ODBA 2KI4C 2G2BA 1QXPA 2BBNA 3IQOA 5CSNA 4MRYA 2G9BA 1BLQA 1KQMC 1CNPA 4MZJA 2WCFA 3IF7A 2GV5A 3E3RA 3DXLA 3SG6A 4GGNA 2QEVA 4MBEA 2JU0A 2KAVA 1PALA 3EVUA 2QEHA 2KGBC 4INXA 1YUSA 1KFUS 1J55A 1EXRA 2F3YA 4JD9A 4AQJA 2KBIA 2F8PA 2JZIA 1N65A 1C3YA 2M1KB 2JNFA 3D0YA 1DQEA 1H4BA 1QWVA 1UWOA 2WC6A 1KFXS 2M8UA 1W7IB 1DJGA 3FE6A 1RECA 1TRFA 2PASA 2PMYA 1YUTA 1K2HA 5HKWA 2ZKMX 2LLSA 1IRJA 1YX8A 4MZLA 2NCPA 1XA5A 5PALA 1QV1A 1YR5A 1SBJA 1XYDA 3R1OA 5CSJA 5HLVA 1DF0A 3JTDB 1J7OA 2JTTA 1CDLA 1U5IA 2L98A 1FI5A 1SMGA 2M29A 2Q4UA 1NPQA 4I5LB 3SG4A 1WRLA 2COLB 1OOHA 1MR8A 1CFFA 4WQ2A 1G33A 2BL0C 4F0ZB 4WRIA 3NXAA 4XYNA 3S0AA 1XK4C 3KPXA 1JBAA 2HPSA 4YGEB 1CFDA 1SSEB 3VRRA 1K96A 2BECA 2FJUB 2P71A 4NDBA 5I2QA 4HRHA 1TUZA 2LE9B 3OGNA 3OP0A 5GQQC 1NX0A 1TCOB 1D1OA 3ZNIA 3SJSA 2B1UA 3TZ1A 1NCZA 1HT9A 2FOTA 1OZOA 2M0RA 1J1EA 2M97A 2WCLA 3I5IC 1B8LA 1CLLA 1DJWA 1AJ4A 1WY9A 2E6WA 2EC6B 1LKJA 2KHNA 2L4IA 1YRTB 2LUCA 2M1UA 1ALWA 3A8RA 1F4OA 1CM4A 2WCHA 1RWYA 2JWWA 2L50A 3SS4A 1KWOB 1DF0B 1L2OC 3BUMB 3S0GA 1BMOA 1CKKA 2L5YA 4USLA 3RM1A 1CMGA 1SL9A 3PLFB 2CBLA 4MN0A 2CTNA 1OOJA 4PALA 1EG4A 4AOMA 5HL1A 1FBVA 2KFFA 3LL8B 2A4JA 4YGBB 1WLZA 5KTYA 1CB1A 4HSZA 1K9UA 1OMRA 5AERA 2LUXA 2ZRSA 3AKAA 2M7LA 1Y1XA 2KI6C 2KI6D 1Z2CB 1IIOA 2KOTA 1KK7Y 2K2AA 2NXQA 4N1FA 3EVVA 3OHMB 1CLMA 1X02A 3EKJA 2AAOA 3SG2A 4YRUA 4BY5A 1IH0A 1QVIY 3LLEA 3B86A 5ER5A 2VRGA 2LVJA 1ORGA 1BG1A 2PALA 1P28A 1SNLA 3BUWB 3DZTA 3SS5A 1IG5A 1QJTA 2QEOA 3R1VA 1DJXA 1OW4A 3O4YA 4PHKA 1LA0A 2KPHA 1TNXA 2JTZA 3S0DA 1NSHA 1A4PA 5TNCA 1MQ1A 3TUYC 3PM2A 2PVBA 4C0JA 1NYAA 3CZ0A 3S0EA 2AUCA 1PVAA 1DC1A 1KQMB 2L51A 3TDIA 2BNXA 3N7HA 3SG3A 5AANA 1OMVA 3L4LA 3AKBA 4CFRA 1SR6B 4N1GA 1GM0A 3SG5A 2BKIB 1DT7B 2QACA 3EKHA 3JVTB 3NSLA 1DJZA 1SL7A 2K60A 5I2OA 5K89A 1FPWA 3I5FC 3K1EA 2K61A 3DVKA 1CLBA 3CYZA 1Y1AA 1DJHA 4WQ3A 1ZUZA 4YGAA 1WLMA 3M0WA 1V1FA 3FWBA 5DKQA 2LLUA 1FI6A 3CR4X 3D74A 2BCXA 1TUJA 2HQ8A 3I5HC 4C0KA 4CIDA 2Y5IA 1KSMA 1SPYA 2LP2A 4HREE 1G4YR 4PHMA 3I5GB 3VB1A 1KQVA 3PFVA 3RZSA 4FQOA 4MEWA 1QIVA 4XJKA 5CPVA 3PALA 4NDDA 4ZCVA 4YBHB 3MSEB 3PM8A 1DMOA 1PK0D 1UHNA 2JT8A 3IQQA 4YI9A 1AVSA 2ISDA 1Z4HA 2F2PA 1SCVA 5KSZA 2JULA 1KK8B 2JQ6A 1XFVO 1A03A 1QIWA 3OB1B 3QMEA 1C7WA 1EJ3A 2QPTA 1S26D 3F45A 2JRFA 3PN7B 1NX1A 2BL0B 3PSRA 1JWDA 3CR5X 3PJIA 1F8HA 2ZN9A 3CR2A 2HF5A 1WDCB 5BPJA 1IJ6A 1OOFA 2PSRA 1J7QA 3VRNA 2K2FA 3NHIA 4GBAA 2LM5A 1PRWA 3DVEA 2KLDA 4ORAB 3GOFA 1N0YA 1HQVA 1F4QA 3SIAA 2CNPA 1CM1A 1MUXA 1B9AA 2OS8B 1OMDA 1ZOTB 2WNDA 3DF0A 3D77A 1BU3A 1M31A 1C07A 2KFHA 3I5IB 1J1DA 1DVIA 1XVJA 1YRUB 2CT9A 3SIBA 3UNWA 1XFYO 1KSOA 3SG7A 3KHEA 3VRQA 3IVTA 1QTXA 2BCBA 1EL4A 3QRXA 5AFPA 1QATA 4ETOA 1LINA 3DYEA 1BR4B 1MF8B 2JC2A 2WCMA 3O2PA 3D0YB 2BCAA 1J7RA 1YVLA 1K94A 1YTZC 2M49B 2Y1NA 3DVJA 2LCPA 2NLNA 4UPGA 2QDIA 3A4UB 3C1VA 1ZMZA 4I5NB 1QX5B 2F3ZA 3NSKA 4GNKB 1MXLC 1NCYA 3KF9A 4PE1A 5D7FA 1OOGA 2M9GA 1AHRA 2MLFC 3PATA 3KEVA 1UHHA 2KQYA 2L2EA 2OTGB 1XFXO 4OCIA 4PE0A 3TS5B 2EHBA 1IQ3A 1Y6WA 2YGUA 4QJ5B 1CFPA 3GK1A 3WXAA 2SASA 4TNCA 1ZFSA 2K8MB 1U5IB 2WC5A 3TDZA 2BKHB 2MBXA 3BXKA 1EG3A 1XFWO 3S0FA 2JT3A 3BJHA 3CS1A 1S36A 4GAOA 1RFJA 3CWGA 4YGCB 1NX2A 1TNPA 3UO9A 1IWQA 2TN4A 3JTDC 5D3OA 2I2RE 1PSBA 3CZ1A 1K8UA 3AAJA 4OV2A 5DICA 5B8IB 3O6BA 1SKTA 4I5JA 4Q04A 2WCBA 2IS9A 3L47A 3D76A 1AJ5A 2CXJA 4IJ7A 4MLWA 1W9ZA 2LMUA 2LVVA 1VRKA 3K21A 1MWNA 1IJ5A 2KAYA 4JWQA 1XFZO 2KLEA 4R1EA 2LNKA 3NGVA 2MLEC 1N2DA 5ER4X 4P2YB 1M45A 1SRAA 4GGFC 1M63B 1MXEA 4JPZB 1K95A 2I7AA 1R6PA 1K9PA 4ICBA 3BQ3A 2JXCA 1LVCD 3DD4A 3I5HB 4A4BA 1PSRA 3L4AA 1BF5A 3D78A 2KI4B 3FWCA 4A4CA 2EC6C 2RGIA 2LC5A 1M39A 3EK7A 3BOWA 2DOQA 2LHLA 2KGRA 5JOLA 3EK4A 1F70A 2BBMA 3B87A 2GGZA 1OQPA 1IQ5A 1GJYA 2Q91A 4OKHA 1CFCA 1XK4A 1Y0VH 1JUOA 2O5GA 3B7AA 3CZTX 4KYNA 3O78A 1BODA 3DVMA 4PE7A 4D1EA 2PYQA 3EVRA 1GQMA 4DRWA 3EG5B 2ZRTA 2JPTA 4C0LA 1XO5A 3GK2A 3D75A 1SL8A 1BR1B 1SCMC 2K7OA 5G08A 5AEQA 1MHOA 2K0JA 1LXFC 2MA2A 2ZFDA 3OX5A 5F6TA 4MZKA 2KAXA 1UHKA 1ALVA 2WCJA 2JNXA 4JKTA 5J3XA 1LA3A 3HX4A 4OZDA 1QASA 2F2OA 1F54A 1OE9B 4DUQA 4M2PA 4PE4A 1S1EA 3VGOA 4NQGA 1RJVA 3NHTA 1IGVA 2QEBA 1QX2A 1S6IA 2WC8A 2HQWA 2K7CA 1B8RA 2LVIA 2BE6A 1JFJA 1YURA 3CGAA 1QV0A 3DY9A 1F71A 4GFTA
chains in the Genus database with same CATH topology
4P5OE 1SR6C 1AUIB 2LMVA 5HYDA 1H8BA 3JVTC 1QX7A 1TIZA 1B7TY 4ORBB 1B4CA 1QLSA 2OPOA 5CSFA 1NCXA 4N5XA 3AAKA 2WOSA 1BOCA 1CMFA 3H4SE 5FYXA 4XJKB 2AMIA 4DCKA 3OX6A 4GGFA 4M2QA 1F55A 1OZSA 1Q80A 1DGUA 1KK7Z 1L2OB 2D8NA 3I5GC 4QJ4B 4MSPA 1BT6A 5CSIA 2L4HA 1G8IA 1Y1UA 1QVIZ 1UURA 2LAPA 2M7NA 2MAZA 4PDZA 2M3WA 3TDUA 1NX3A 3LCPC 1DGVA 2KNEA 1A2XA 3LK0A 5AXIA 3BUOB 2KDHA 5JJGA 1AK8A 1S5GY 1KK8C 1YVHA 2ZN8A 2H61C 3CLNA 3LK1A 4GUKA 1KFUL 3PN7C 4YGDB 2KSPA 1K90D 1DJIA 1RROA 1UP5A 2H2KA 2ZNDA 3HCMA 1RTP1 1WDCC 2JXLA 1DTLA 3EK8A 1EH2A 3DF0B 4YI8A 4CPVA 2WCEA 2GGMA 3WNXB 4OR9B 1A75A 1JC2A 2P6BB 1K93D 1KFXL 3BYAA 5I2LA 1GGWA 2LMTA 3CTNA 1TN4A 4NDCA 2OS8C 2NCOA 1CDMA 2E30A 2O60A 1XFUO 1S6JA 2MRDA 1OSAA 3TUYB 1A29A 3D10A 2LV7A 3KO0A 4PCWA 1UHJA 2KYCA 2R2IA 1SW8A 3FS7A 1NUBA 1TOPA 2FCDA 4ORCB 5DKNA 1JFKA 2FCEA 1UHIA 5HLOA 1WRZA 2K7BA 3I5FB 1PVBA 4HRGA 1KCYA 1GGZA 4MVFA 4DS7A 3OB2B 1IKUA 1W7JB 1BJFA 4L9MA 1SY9A 2PRUA 1RK9A 1AP4A 1QLKA 2LHIA 4OVNF 5KU1A 1J7PA 3RLZA 2WORA 1S6CA 4IL1A 2V53A 1FW4A 1WRKA 2ZNEA 4GPLB 4AQIA 1SK6D 1NP8A 2LLTA 2Y4QA 2L0PA 4PHNA 1A75B 1R2UA 1TCFA 1TNWA 1K9KA 1SCMB 2K7DA 2KYFA 2MHHA 1TNQA 2OTGC 4I5KA 3TS5C 1B1GA 1L7ZA 2NZ0A 2I18A 4JQ0D 5I8NA 1KWOC 2L5XB 1E8AA 2JT0A 2BE4A 4FTGA 4BY4A 5IBWA 4MRXA 1B7TZ 4PHJA 2SCPA 3NSIA 1V1GA 1PULA 1CDNA 1UUSA 3VRPA 2JOJA 4M2OA 1QS7A 1M46A 1YUUA 2LP3A 1JSAA 1NIWA 3ZWHA 2CCMA 2I94A 2KFGA 1NWDA 1JF0A 2F33A 3GK4X 1DJYA 2KQ6A 1JF2A 2H61A 2KBMA 3NSOA 1SYMA 2Y1MA 3BUXB 1B8CA 4E68A 2LANA 2HETA 3WHTB 1CDPA 1CTRA 2EGDA 4DIRA 1C7VA 1FF1A 4QJ3B 3FIAA 3VROA 5D69A 5DKRA 1ZACA 2LVKA 1TTXA 3BOWB 1S5GZ 3ICBA 1S3PA 2MJWB 3WHUB 4U8DA 4CFQA 1YX7A 4ZCUA 3BUNB 5HKZA 4CLNA 1B47A 5HKYA 1ODBA 2KI4C 2G2BA 1QXPA 2BBNA 3IQOA 5CSNA 4MRYA 2G9BA 1BLQA 1KQMC 1CNPA 4MZJA 2WCFA 3IF7A 2GV5A 3E3RA 3SG6A 4GGNA 4MBEA 2JU0A 2KAVA 1PALA 3EVUA 2KGBC 1YUSA 1KFUS 1J55A 1EXRA 2F3YA 4AQJA 2KBIA 2F8PA 2JZIA 1N65A 2M1KB 2JNFA 3D0YA 1H4BA 1UWOA 1KFXS 2M8UA 1W7IB 1DJGA 1RECA 1TRFA 2PASA 2PMYA 1YUTA 1K2HA 5HKWA 2ZKMX 2LLSA 1IRJA 1YX8A 4MZLA 2NCPA 1XA5A 5PALA 1QV1A 1YR5A 1SBJA 1XYDA 5CSJA 5HLVA 1DF0A 3JTDB 1J7OA 2JTTA 1CDLA 1U5IA 2L98A 1FI5A 1SMGA 2M29A 2Q4UA 1NPQA 4I5LB 3SG4A 1WRLA 2COLB 1MR8A 1CFFA 4WQ2A 1G33A 2BL0C 4F0ZB 4WRIA 3NXAA 4XYNA 1XK4C 3KPXA 1JBAA 2HPSA 4YGEB 1CFDA 3VRRA 1K96A 2BECA 2FJUB 4NDBA 5I2QA 4HRHA 2LE9B 3OP0A 5GQQC 1NX0A 1TCOB 1D1OA 3ZNIA 3SJSA 2B1UA 3TZ1A 1NCZA 1HT9A 2FOTA 1OZOA 2M0RA 1J1EA 2M97A 3I5IC 1B8LA 1CLLA 1DJWA 1AJ4A 1WY9A 2E6WA 2EC6B 1LKJA 2KHNA 2L4IA 1YRTB 2LUCA 2M1UA 1ALWA 3A8RA 1F4OA 1CM4A 1RWYA 2JWWA 2L50A 1KWOB 1DF0B 1L2OC 3BUMB 1BMOA 1CKKA 4USLA 3RM1A 1CMGA 1SL9A 3PLFB 2CBLA 4MN0A 2CTNA 1OOJA 4PALA 1EG4A 4AOMA 1FBVA 2KFFA 3LL8B 2A4JA 4YGBB 1WLZA 5KTYA 1CB1A 4HSZA 1K9UA 1OMRA 5AERA 2LUXA 2ZRSA 3AKAA 2M7LA 1Y1XA 2KI6C 2KI6D 2KOTA 1KK7Y 2K2AA 2NXQA 4N1FA 3EVVA 3OHMB 1CLMA 1X02A 3EKJA 2AAOA 3SG2A 4YRUA 4BY5A 1IH0A 1QVIY 3LLEA 5ER5A 2VRGA 2LVJA 1BG1A 2PALA 1SNLA 3BUWB 1IG5A 1QJTA 1DJXA 3O4YA 4PHKA 1LA0A 1TNXA 2JTZA 1NSHA 1A4PA 5TNCA 1MQ1A 3TUYC 2PVBA 4C0JA 1NYAA 2AUCA 1PVAA 1KQMB 2L51A 3TDIA 3SG3A 5AANA 1OMVA 3AKBA 4CFRA 1SR6B 4N1GA 3SG5A 2BKIB 1DT7B 2QACA 3EKHA 3JVTB 3NSLA 1DJZA 1SL7A 5I2OA 5K89A 1FPWA 3I5FC 2K61A 3DVKA 1CLBA 1Y1AA 1DJHA 4WQ3A 1ZUZA 4YGAA 1WLMA 3M0WA 1V1FA 3FWBA 5DKQA 2LLUA 1FI6A 3CR4X 2BCXA 2HQ8A 3I5HC 4C0KA 4CIDA 2Y5IA 1KSMA 1SPYA 2LP2A 4HREE 1G4YR 4PHMA 3I5GB 1KQVA 3PFVA 4FQOA 4MEWA 1QIVA 4XJKA 5CPVA 3PALA 4NDDA 4ZCVA 4YBHB 3MSEB 3PM8A 1DMOA 1PK0D 1UHNA 2JT8A 3IQQA 4YI9A 1AVSA 2ISDA 2F2PA 1SCVA 5KSZA 2JULA 1KK8B 2JQ6A 1XFVO 1A03A 1QIWA 3OB1B 1C7WA 1EJ3A 2QPTA 1S26D 3F45A 2JRFA 3PN7B 1NX1A 2BL0B 3PSRA 1JWDA 3CR5X 1F8HA 2ZN9A 3CR2A 2HF5A 1WDCB 5BPJA 1IJ6A 2PSRA 1J7QA 3VRNA 2K2FA 4GBAA 2LM5A 1PRWA 3DVEA 4ORAB 3GOFA 1N0YA 1HQVA 1F4QA 3SIAA 2CNPA 1CM1A 1MUXA 1B9AA 2OS8B 1OMDA 1ZOTB 2WNDA 3DF0A 1C07A 1BU3A 1M31A 2KFHA 3I5IB 1J1DA 1DVIA 1XVJA 1YRUB 2CT9A 3SIBA 1XFYO 1KSOA 3SG7A 3KHEA 3VRQA 1QTXA 2BCBA 1EL4A 3QRXA 5AFPA 1QATA 4ETOA 1LINA 1BR4B 1MF8B 2JC2A 3O2PA 3D0YB 2BCAA 1J7RA 1YVLA 1K94A 1YTZC 2M49B 2Y1NA 3DVJA 2LCPA 2NLNA 4UPGA 3A4UB 3C1VA 1ZMZA 4I5NB 1QX5B 2F3ZA 3NSKA 4GNKB 1MXLC 1NCYA 3KF9A 4PE1A 5D7FA 2M9GA 1AHRA 2MLFC 3PATA 3KEVA 1UHHA 2KQYA 2L2EA 2OTGB 1XFXO 4OCIA 4PE0A 3TS5B 2EHBA 1IQ3A 1Y6WA 4QJ5B 1CFPA 3GK1A 3WXAA 2SASA 4TNCA 1ZFSA 2K8MB 1U5IB 3TDZA 2BKHB 2MBXA 3BXKA 1EG3A 1XFWO 2JT3A 3CS1A 1S36A 4GAOA 1RFJA 3CWGA 4YGCB 1NX2A 1TNPA 1IWQA 2TN4A 3JTDC 2I2RE 1PSBA 1K8UA 3AAJA 4OV2A 5B8IB 3O6BA 1SKTA 4I5JA 4Q04A 2WCBA 2IS9A 1AJ5A 2CXJA 4MLWA 2LMUA 2LVVA 1VRKA 3K21A 1MWNA 1IJ5A 2KAYA 4JWQA 1XFZO 4R1EA 2LNKA 2MLEC 1N2DA 5ER4X 4P2YB 1M45A 1SRAA 4GGFC 1M63B 1MXEA 4JPZB 1K95A 2I7AA 1R6PA 1K9PA 4ICBA 3BQ3A 2JXCA 1LVCD 3DD4A 3I5HB 4A4BA 1PSRA 1BF5A 3FWCA 2KI4B 4A4CA 2EC6C 2RGIA 2LC5A 1M39A 3EK7A 3BOWA 2DOQA 2LHLA 2KGRA 5JOLA 3EK4A 1F70A 2BBMA 2GGZA 1OQPA 1IQ5A 1GJYA 2Q91A 4OKHA 1CFCA 1XK4A 1Y0VH 1JUOA 2O5GA 3CZTX 3O78A 1BODA 3DVMA 4PE7A 4D1EA 3EVRA 1GQMA 4DRWA 2ZRTA 2JPTA 4C0LA 1XO5A 3GK2A 1SL8A 1BR1B 1SCMC 2K7OA 5G08A 5AEQA 1MHOA 2K0JA 1LXFC 2MA2A 2ZFDA 3OX5A 5F6TA 4MZKA 2KAXA 1UHKA 1ALVA 2JNXA 5J3XA 1LA3A 3HX4A 1QASA 2F2OA 1F54A 1OE9B 4DUQA 4M2PA 4PE4A 1S1EA 3VGOA 4NQGA 1RJVA 1IGVA 1QX2A 1S6IA 2WC8A 2HQWA 2K7CA 1B8RA 2LVIA 2BE6A 1JFJA 1YURA 3CGAA 1QV0A 1F71A 4GFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O E;  1SR6 C;  1AUI B;  2LMV A;  5HYD A;  1H8B A;  3JVT C;  1QX7 A;  1TIZ A;  1B7T Y;  4ORB B;  1B4C A;  1QLS A;  2OPO A;  5CSF A;  1NCX A;  4N5X A;  3AAK A;  2WOS A;  1BOC A;  1CMF A;  3H4S E;  5FYX A;  4XJK B;  2AMI A;  4DCK A;  3OX6 A;  4GGF A;  4M2Q A;  1F55 A;  1OZS A;  1Q80 A;  1DGU A;  1KK7 Z;  1L2O B;  2D8N A;  3I5G C;  4QJ4 B;  4MSP A;  1BT6 A;  5CSI A;  2L4H A;  1G8I A;  1Y1U A;  1QVI Z;  1UUR A;  2LAP A;  2M7N A;  2MAZ A;  4PDZ A;  2M3W A;  3TDU A;  1NX3 A;  3LCP C;  1DGV A;  2KNE A;  1A2X A;  3LK0 A;  5AXI A;  3BUO B;  2KDH A;  5JJG A;  1AK8 A;  1S5G Y;  1KK8 C;  1YVH A;  2ZN8 A;  2H61 C;  3CLN A;  3LK1 A;  4GUK A;  1KFU L;  3PN7 C;  4YGD B;  2KSP A;  1K90 D;  1DJI A;  1RRO A;  1UP5 A;  2H2K A;  2ZND A;  3HCM A;  1RTP 1;  1WDC C;  2JXL A;  1DTL A;  3EK8 A;  1EH2 A;  3DF0 B;  4YI8 A;  4CPV A;  2WCE A;  2GGM A;  3WNX B;  4OR9 B;  1A75 A;  1JC2 A;  2P6B B;  1K93 D;  1KFX L;  3BYA A;  5I2L A;  1GGW A;  2LMT A;  3CTN A;  1TN4 A;  4NDC A;  2OS8 C;  2NCO A;  1CDM A;  2E30 A;  2O60 A;  1XFU O;  1S6J A;  2MRD A;  1OSA A;  3TUY B;  1A29 A;  3D10 A;  2LV7 A;  3KO0 A;  4PCW A;  1UHJ A;  2KYC A;  2R2I A;  1SW8 A;  3FS7 A;  1NUB A;  1TOP A;  2FCD A;  4ORC B;  5DKN A;  1JFK A;  2FCE A;  1UHI A;  5HLO A;  1WRZ A;  2K7B A;  3I5F B;  1PVB A;  4HRG A;  1KCY A;  1GGZ A;  4MVF A;  4DS7 A;  3OB2 B;  1IKU A;  1W7J B;  1BJF A;  4L9M A;  1SY9 A;  2PRU A;  1RK9 A;  1AP4 A;  1QLK A;  2LHI A;  4OVN F;  5KU1 A;  1J7P A;  3RLZ A;  2WOR A;  1S6C A;  4IL1 A;  2V53 A;  1FW4 A;  1WRK A;  2ZNE A;  4GPL B;  4AQI A;  1SK6 D;  1NP8 A;  2LLT A;  2Y4Q A;  2L0P A;  4PHN A;  1A75 B;  1R2U A;  1TCF A;  1TNW A;  1K9K A;  1SCM B;  2K7D A;  2KYF A;  2MHH A;  1TNQ A;  2OTG C;  4I5K A;  3TS5 C;  1B1G A;  1L7Z A;  2NZ0 A;  2I18 A;  4JQ0 D;  5I8N A;  1KWO C;  2L5X B;  1E8A A;  2JT0 A;  2BE4 A;  4FTG A;  4BY4 A;  5IBW A;  4MRX A;  1B7T Z;  4PHJ A;  2SCP A;  3NSI A;  1V1G A;  1PUL A;  1CDN A;  1UUS A;  3VRP A;  2JOJ A;  4M2O A;  1QS7 A;  1M46 A;  1YUU A;  2LP3 A;  1JSA A;  1NIW A;  3ZWH A;  2CCM A;  2I94 A;  2KFG A;  1NWD A;  1JF0 A;  2F33 A;  3GK4 X;  1DJY A;  2KQ6 A;  1JF2 A;  2H61 A;  2KBM A;  3NSO A;  1SYM A;  2Y1M A;  3BUX B;  1B8C A;  4E68 A;  2LAN A;  2HET A;  3WHT B;  1CDP A;  1CTR A;  2EGD A;  4DIR A;  1C7V A;  1FF1 A;  4QJ3 B;  3FIA A;  3VRO A;  5D69 A;  5DKR A;  1ZAC A;  2LVK A;  1TTX A;  3BOW B;  1S5G Z;  3ICB A;  1S3P A;  2MJW B;  3WHU B;  4U8D A;  4CFQ A;  1YX7 A;  4ZCU A;  3BUN B;  5HKZ A;  4CLN A;  1B47 A;  5HKY A;  1ODB A;  2KI4 C;  2G2B A;  1QXP A;  2BBN A;  3IQO A;  5CSN A;  4MRY A;  2G9B A;  1BLQ A;  1KQM C;  1CNP A;  4MZJ A;  2WCF A;  3IF7 A;  2GV5 A;  3E3R A;  3SG6 A;  4GGN A;  4MBE A;  2JU0 A;  2KAV A;  1PAL A;  3EVU A;  2KGB C;  1YUS A;  1KFU S;  1J55 A;  1EXR A;  2F3Y A;  4AQJ A;  2KBI A;  2F8P A;  2JZI A;  1N65 A;  2M1K B;  2JNF A;  3D0Y A;  1H4B A;  1UWO A;  1KFX S;  2M8U A;  1W7I B;  1DJG A;  1REC A;  1TRF A;  2PAS A;  2PMY A;  1YUT A;  1K2H A;  5HKW A;  2ZKM X;  2LLS A;  1IRJ A;  1YX8 A;  4MZL A;  2NCP A;  1XA5 A;  5PAL A;  1QV1 A;  1YR5 A;  1SBJ A;  1XYD A;  5CSJ A;  5HLV A;  1DF0 A;  3JTD B;  1J7O A;  2JTT A;  1CDL A;  1U5I A;  2L98 A;  1FI5 A;  1SMG A;  2M29 A;  2Q4U A;  1NPQ A;  4I5L B;  3SG4 A;  1WRL A;  2COL B;  1MR8 A;  1CFF A;  4WQ2 A;  1G33 A;  2BL0 C;  4F0Z B;  4WRI A;  3NXA A;  4XYN A;  1XK4 C;  3KPX A;  1JBA A;  2HPS A;  4YGE B;  1CFD A;  3VRR A;  1K96 A;  2BEC A;  2FJU B;  4NDB A;  5I2Q A;  4HRH A;  2LE9 B;  3OP0 A;  5GQQ C;  1NX0 A;  1TCO B;  1D1O A;  3ZNI A;  3SJS A;  2B1U A;  3TZ1 A;  1NCZ A;  1HT9 A;  2FOT A;  1OZO A;  2M0R A;  1J1E A;  2M97 A;  3I5I C;  1B8L A;  1CLL A;  1DJW A;  1AJ4 A;  1WY9 A;  2E6W A;  2EC6 B;  1LKJ A;  2KHN A;  2L4I A;  1YRT B;  2LUC A;  2M1U A;  1ALW A;  3A8R A;  1F4O A;  1CM4 A;  1RWY A;  2JWW A;  2L50 A;  1KWO B;  1DF0 B;  1L2O C;  3BUM B;  1BMO A;  1CKK A;  4USL A;  3RM1 A;  1CMG A;  1SL9 A;  3PLF B;  2CBL A;  4MN0 A;  2CTN A;  1OOJ A;  4PAL A;  1EG4 A;  4AOM A;  1FBV A;  2KFF A;  3LL8 B;  2A4J A;  4YGB B;  1WLZ A;  5KTY A;  1CB1 A;  4HSZ A;  1K9U A;  1OMR A;  5AER A;  2LUX A;  2ZRS A;  3AKA A;  2M7L A;  1Y1X A;  2KI6 C;  2KI6 D;  2KOT A;  1KK7 Y;  2K2A A;  2NXQ A;  4N1F A;  3EVV A;  3OHM B;  1CLM A;  1X02 A;  3EKJ A;  2AAO A;  3SG2 A;  4YRU A;  4BY5 A;  1IH0 A;  1QVI Y;  3LLE A;  5ER5 A;  2VRG A;  2LVJ A;  1BG1 A;  2PAL A;  1SNL A;  3BUW B;  1IG5 A;  1QJT A;  1DJX A;  3O4Y A;  4PHK A;  1LA0 A;  1TNX A;  2JTZ A;  1NSH A;  1A4P A;  5TNC A;  1MQ1 A;  3TUY C;  2PVB A;  4C0J A;  1NYA A;  2AUC A;  1PVA A;  1KQM B;  2L51 A;  3TDI A;  3SG3 A;  5AAN A;  1OMV A;  3AKB A;  4CFR A;  1SR6 B;  4N1G A;  3SG5 A;  2BKI B;  1DT7 B;  2QAC A;  3EKH A;  3JVT B;  3NSL A;  1DJZ A;  1SL7 A;  5I2O A;  5K89 A;  1FPW A;  3I5F C;  2K61 A;  3DVK A;  1CLB A;  1Y1A A;  1DJH A;  4WQ3 A;  1ZUZ A;  4YGA A;  1WLM A;  3M0W A;  1V1F A;  3FWB A;  5DKQ A;  2LLU A;  1FI6 A;  3CR4 X;  2BCX A;  2HQ8 A;  3I5H C;  4C0K A;  4CID A;  2Y5I A;  1KSM A;  1SPY A;  2LP2 A;  4HRE E;  1G4Y R;  4PHM A;  3I5G B;  1KQV A;  3PFV A;  4FQO A;  4MEW A;  1QIV A;  4XJK A;  5CPV A;  3PAL A;  4NDD A;  4ZCV A;  4YBH B;  3MSE B;  3PM8 A;  1DMO A;  1PK0 D;  1UHN A;  2JT8 A;  3IQQ A;  4YI9 A;  1AVS A;  2ISD A;  2F2P A;  1SCV A;  5KSZ A;  2JUL A;  1KK8 B;  2JQ6 A;  1XFV O;  1A03 A;  1QIW A;  3OB1 B;  1C7W A;  1EJ3 A;  2QPT A;  1S26 D;  3F45 A;  2JRF A;  3PN7 B;  1NX1 A;  2BL0 B;  3PSR A;  1JWD A;  3CR5 X;  1F8H A;  2ZN9 A;  3CR2 A;  2HF5 A;  1WDC B;  5BPJ A;  1IJ6 A;  2PSR A;  1J7Q A;  3VRN A;  2K2F A;  4GBA A;  2LM5 A;  1PRW A;  3DVE A;  4ORA B;  3GOF A;  1N0Y A;  1HQV A;  1F4Q A;  3SIA A;  2CNP A;  1CM1 A;  1MUX A;  1B9A A;  2OS8 B;  1OMD A;  1ZOT B;  2WND A;  3DF0 A;  1C07 A;  1BU3 A;  1M31 A;  2KFH A;  3I5I B;  1J1D A;  1DVI A;  1XVJ A;  1YRU B;  2CT9 A;  3SIB A;  1XFY O;  1KSO A;  3SG7 A;  3KHE A;  3VRQ A;  1QTX A;  2BCB A;  1EL4 A;  3QRX A;  5AFP A;  1QAT A;  4ETO A;  1LIN A;  1BR4 B;  1MF8 B;  2JC2 A;  3O2P A;  3D0Y B;  2BCA A;  1J7R A;  1YVL A;  1K94 A;  1YTZ C;  2M49 B;  2Y1N A;  3DVJ A;  2LCP A;  2NLN A;  4UPG A;  3A4U B;  3C1V A;  1ZMZ A;  4I5N B;  1QX5 B;  2F3Z A;  3NSK A;  4GNK B;  1MXL C;  1NCY A;  3KF9 A;  4PE1 A;  5D7F A;  2M9G A;  1AHR A;  2MLF C;  3PAT A;  3KEV A;  1UHH A;  2KQY A;  2L2E A;  2OTG B;  1XFX O;  4OCI A;  4PE0 A;  3TS5 B;  2EHB A;  1IQ3 A;  1Y6W A;  4QJ5 B;  1CFP A;  3GK1 A;  3WXA A;  2SAS A;  4TNC A;  1ZFS A;  2K8M B;  1U5I B;  3TDZ A;  2BKH B;  2MBX A;  3BXK A;  1EG3 A;  1XFW O;  2JT3 A;  3CS1 A;  1S36 A;  4GAO A;  1RFJ A;  3CWG A;  4YGC B;  1NX2 A;  1TNP A;  1IWQ A;  2TN4 A;  3JTD C;  2I2R E;  1PSB A;  1K8U A;  3AAJ A;  4OV2 A;  5B8I B;  3O6B A;  1SKT A;  4I5J A;  4Q04 A;  2WCB A;  2IS9 A;  1AJ5 A;  2CXJ A;  4MLW A;  2LMU A;  2LVV A;  1VRK A;  3K21 A;  1MWN A;  1IJ5 A;  2KAY A;  4JWQ A;  1XFZ O;  4R1E A;  2LNK A;  2MLE C;  1N2D A;  5ER4 X;  4P2Y B;  1M45 A;  1SRA A;  4GGF C;  1M63 B;  1MXE A;  4JPZ B;  1K95 A;  2I7A A;  1R6P A;  1K9P A;  4ICB A;  3BQ3 A;  2JXC A;  1LVC D;  3DD4 A;  3I5H B;  4A4B A;  1PSR A;  1BF5 A;  3FWC A;  2KI4 B;  4A4C A;  2EC6 C;  2RGI A;  2LC5 A;  1M39 A;  3EK7 A;  3BOW A;  2DOQ A;  2LHL A;  2KGR A;  5JOL A;  3EK4 A;  1F70 A;  2BBM A;  2GGZ A;  1OQP A;  1IQ5 A;  1GJY A;  2Q91 A;  4OKH A;  1CFC A;  1XK4 A;  1Y0V H;  1JUO A;  2O5G A;  3CZT X;  3O78 A;  1BOD A;  3DVM A;  4PE7 A;  4D1E A;  3EVR A;  1GQM A;  4DRW A;  2ZRT A;  2JPT A;  4C0L A;  1XO5 A;  3GK2 A;  1SL8 A;  1BR1 B;  1SCM C;  2K7O A;  5G08 A;  5AEQ A;  1MHO A;  2K0J A;  1LXF C;  2MA2 A;  2ZFD A;  3OX5 A;  5F6T A;  4MZK A;  2KAX A;  1UHK A;  1ALV A;  2JNX A;  5J3X A;  1LA3 A;  3HX4 A;  1QAS A;  2F2O A;  1F54 A;  1OE9 B;  4DUQ A;  4M2P A;  4PE4 A;  1S1E A;  3VGO A;  4NQG A;  1RJV A;  1IGV A;  1QX2 A;  1S6I A;  2WC8 A;  2HQW A;  2K7C A;  1B8R A;  2LVI A;  2BE6 A;  1JFJ A;  1YUR A;  3CGA A;  1QV0 A;  1F71 A;  4GFT A; 
#chains in the Genus database with same CATH topology
 1LS8 A;  4P5O E;  1SR6 C;  1AUI B;  2LMV A;  5FI2 A;  3S0B A;  5HYD A;  3D73 A;  1H8B A;  3JVT C;  1QX7 A;  1TIZ A;  1B7T Y;  4ORB B;  1B4C A;  1QLS A;  2BAP A;  2OPO A;  3R1P A;  1NCX A;  5CSF A;  4N5X A;  3AAK A;  2WOS A;  1BOC A;  2JPO A;  1TWO A;  3OBV A;  1CMF A;  5I94 A;  3H4S E;  5FYX A;  4XJK B;  2AMI A;  4DCK A;  2WCK A;  3OX6 A;  4GGF A;  4M2Q A;  1F55 A;  1OZS A;  1Q80 A;  3BFH A;  1DGU A;  1KK7 Z;  1L2O B;  2D8N A;  3I5G C;  4QJ4 B;  4MSP A;  1BT6 A;  5CSI A;  2L4H A;  1G8I A;  1Y1U A;  3FE9 A;  1QVI Z;  1UUR A;  2LAP A;  2M7N A;  2MAZ A;  3CDN A;  4PDZ A;  2M3W A;  3TDU A;  1NX3 A;  3LCP C;  1DGV A;  2KNE A;  1A2X A;  3LK0 A;  4PT1 A;  5AXI A;  3BUO B;  2KDH A;  5JJG A;  1C3Z A;  1AK8 A;  1S5G Y;  1KK8 C;  1YVH A;  2ZN8 A;  2H61 C;  3CLN A;  3LK1 A;  4GUK A;  2FJY A;  1KFU L;  3PN7 C;  4YGD B;  2KSP A;  1K90 D;  3O4X A;  1DJI A;  1RRO A;  1UP5 A;  2H2K A;  2ZND A;  3HCM A;  1RTP 1;  1WDC C;  2JXL A;  1DTL A;  3EK8 A;  2L2C A;  1EH2 A;  3DF0 B;  4YI8 A;  4INW A;  4CPV A;  2WCE A;  2GGM A;  3WNX B;  1T14 A;  1A75 A;  4OR9 B;  1JC2 A;  2P6B B;  1K93 D;  1KFX L;  3BYA A;  5I2L A;  3V2L A;  1GGW A;  2LMT A;  3BFB A;  3CTN A;  1TN4 A;  4NDC A;  2OS8 C;  2NCO A;  1CDM A;  2E30 A;  2O60 A;  1XFU O;  1S6J A;  2GTE A;  2MRD A;  3SS3 A;  1OSA A;  3TUY B;  1A29 A;  3D10 A;  2LV7 A;  3KO0 A;  4PCW A;  5FI7 A;  1UHJ A;  2KYC A;  2R2I A;  1SW8 A;  3FS7 A;  1NUB A;  1TOP A;  2FCD A;  4ORC B;  5DKN A;  1JFK A;  2FCE A;  1UHI A;  5HLO A;  1WRZ A;  2K7B A;  3BFA A;  1PVB A;  3B88 A;  3I5F B;  4HRG A;  1KCY A;  1GGZ A;  4MVF A;  4DS7 A;  3OB2 B;  1IKU A;  3R72 A;  1W7J B;  1BJF A;  4L9M A;  1SY9 A;  2PQL A;  1RK9 A;  2ERB A;  2PRU A;  1QLK A;  2LHI A;  1AP4 A;  4OVN F;  5KU1 A;  1J7P A;  3RLZ A;  2WOR A;  1S6C A;  4IL1 A;  3FE8 A;  2V53 A;  1FW4 A;  1WRK A;  2ZNE A;  4GPL B;  4AQI A;  3Q8I A;  1SK6 D;  1NP8 A;  2LLT A;  2Y4Q A;  2L0P A;  4PHN A;  1A75 B;  1R2U A;  1TCF A;  1TNW A;  1K9K A;  1SCM B;  2K7D A;  2KYF A;  2MHH A;  1TNQ A;  2OTG C;  4I5K A;  3TS5 C;  1B1G A;  1L7Z A;  4F7F A;  2NZ0 A;  3CZ2 A;  2I18 A;  4JQ0 D;  5I8N A;  1KWO C;  3B6X A;  2L5X B;  1E8A A;  2JT0 A;  2BE4 A;  4FTG A;  3CAB A;  1DEL A;  4BY4 A;  4MRX A;  5IBW A;  1B7T Z;  4PHJ A;  2SCP A;  3NSI A;  1V1G A;  1PUL A;  1CDN A;  1UUS A;  3VRP A;  2JOJ A;  4M2O A;  1QS7 A;  1M46 A;  1YUU A;  2LP3 A;  1JSA A;  1NIW A;  3ZWH A;  2CCM A;  2I94 A;  2KFG A;  1DEK A;  5FI6 A;  1XFR A;  1NWD A;  1JF0 A;  2F33 A;  3GK4 X;  1DJY A;  2KQ6 A;  1JF2 A;  2H61 A;  2KBM A;  3NSO A;  1SYM A;  2H8V A;  2Y1M A;  3BUX B;  1B8C A;  4E68 A;  2LAN A;  1OOI X;  4FQT A;  2HET A;  3WHT B;  1CDP A;  2P70 A;  1CTR A;  2EGD A;  4DIR A;  1C7V A;  1FF1 A;  4QJ3 B;  3FIA A;  3VRO A;  5D69 A;  5DKR A;  1ZAC A;  2LVK A;  1TTX A;  3BOW B;  1S5G Z;  3ICB A;  1S3P A;  2MJW B;  3WHU B;  4U8D A;  5EL2 A;  4CFQ A;  1YX7 A;  4ZCU A;  3BUN B;  5HKZ A;  4CLN A;  1B47 A;  5HKY A;  1ODB A;  2KI4 C;  2G2B A;  1QXP A;  2BBN A;  3IQO A;  5CSN A;  4MRY A;  2G9B A;  1BLQ A;  1KQM C;  1CNP A;  4MZJ A;  2WCF A;  3IF7 A;  2GV5 A;  3E3R A;  3DXL A;  3SG6 A;  4GGN A;  2QEV A;  4MBE A;  2JU0 A;  2KAV A;  1PAL A;  3EVU A;  2QEH A;  2KGB C;  4INX A;  1YUS A;  1KFU S;  1J55 A;  1EXR A;  2F3Y A;  4JD9 A;  4AQJ A;  2KBI A;  2F8P A;  2JZI A;  1N65 A;  1C3Y A;  2M1K B;  2JNF A;  3D0Y A;  1DQE A;  1H4B A;  1QWV A;  1UWO A;  2WC6 A;  1KFX S;  2M8U A;  1W7I B;  1DJG A;  3FE6 A;  1REC A;  1TRF A;  2PAS A;  2PMY A;  1YUT A;  1K2H A;  5HKW A;  2ZKM X;  2LLS A;  1IRJ A;  1YX8 A;  4MZL A;  2NCP A;  1XA5 A;  5PAL A;  1QV1 A;  1YR5 A;  1SBJ A;  1XYD A;  3R1O A;  5CSJ A;  5HLV A;  1DF0 A;  3JTD B;  1J7O A;  2JTT A;  1CDL A;  1U5I A;  2L98 A;  1FI5 A;  1SMG A;  2M29 A;  2Q4U A;  1NPQ A;  4I5L B;  3SG4 A;  1WRL A;  2COL B;  1OOH A;  1MR8 A;  1CFF A;  4WQ2 A;  1G33 A;  2BL0 C;  4F0Z B;  4WRI A;  3NXA A;  4XYN A;  3S0A A;  1XK4 C;  3KPX A;  1JBA A;  2HPS A;  4YGE B;  1CFD A;  1SSE B;  3VRR A;  1K96 A;  2BEC A;  2FJU B;  2P71 A;  4NDB A;  5I2Q A;  4HRH A;  1TUZ A;  2LE9 B;  3OGN A;  3OP0 A;  5GQQ C;  1NX0 A;  1TCO B;  1D1O A;  3ZNI A;  3SJS A;  2B1U A;  3TZ1 A;  1NCZ A;  1HT9 A;  2FOT A;  1OZO A;  2M0R A;  1J1E A;  2M97 A;  2WCL A;  3I5I C;  1B8L A;  1CLL A;  1DJW A;  1AJ4 A;  1WY9 A;  2E6W A;  2EC6 B;  1LKJ A;  2KHN A;  2L4I A;  1YRT B;  2LUC A;  2M1U A;  1ALW A;  3A8R A;  1F4O A;  1CM4 A;  2WCH A;  1RWY A;  2JWW A;  2L50 A;  3SS4 A;  1KWO B;  1DF0 B;  1L2O C;  3BUM B;  3S0G A;  1BMO A;  1CKK A;  2L5Y A;  4USL A;  3RM1 A;  1CMG A;  1SL9 A;  3PLF B;  2CBL A;  4MN0 A;  2CTN A;  1OOJ A;  4PAL A;  1EG4 A;  4AOM A;  5HL1 A;  1FBV A;  2KFF A;  3LL8 B;  2A4J A;  4YGB B;  1WLZ A;  5KTY A;  1CB1 A;  4HSZ A;  1K9U A;  1OMR A;  5AER A;  2LUX A;  2ZRS A;  3AKA A;  2M7L A;  1Y1X A;  2KI6 C;  2KI6 D;  1Z2C B;  1IIO A;  2KOT A;  1KK7 Y;  2K2A A;  2NXQ A;  4N1F A;  3EVV A;  3OHM B;  1CLM A;  1X02 A;  3EKJ A;  2AAO A;  3SG2 A;  4YRU A;  4BY5 A;  1IH0 A;  1QVI Y;  3LLE A;  3B86 A;  5ER5 A;  2VRG A;  2LVJ A;  1ORG A;  1BG1 A;  2PAL A;  1P28 A;  1SNL A;  3BUW B;  3DZT A;  3SS5 A;  1IG5 A;  1QJT A;  2QEO A;  3R1V A;  1DJX A;  1OW4 A;  3O4Y A;  4PHK A;  1LA0 A;  2KPH A;  1TNX A;  2JTZ A;  3S0D A;  1NSH A;  1A4P A;  5TNC A;  1MQ1 A;  3TUY C;  3PM2 A;  2PVB A;  4C0J A;  1NYA A;  3CZ0 A;  3S0E A;  2AUC A;  1PVA A;  1DC1 A;  1KQM B;  2L51 A;  3TDI A;  2BNX A;  3N7H A;  3SG3 A;  5AAN A;  1OMV A;  3L4L A;  3AKB A;  4CFR A;  1SR6 B;  4N1G A;  1GM0 A;  3SG5 A;  2BKI B;  1DT7 B;  2QAC A;  3EKH A;  3JVT B;  3NSL A;  1DJZ A;  1SL7 A;  2K60 A;  5I2O A;  5K89 A;  1FPW A;  3I5F C;  3K1E A;  2K61 A;  3DVK A;  1CLB A;  3CYZ A;  1Y1A A;  1DJH A;  4WQ3 A;  1ZUZ A;  4YGA A;  1WLM A;  3M0W A;  1V1F A;  3FWB A;  5DKQ A;  2LLU A;  1FI6 A;  3CR4 X;  3D74 A;  2BCX A;  1TUJ A;  2HQ8 A;  3I5H C;  4C0K A;  4CID A;  2Y5I A;  1KSM A;  1SPY A;  2LP2 A;  4HRE E;  1G4Y R;  4PHM A;  3I5G B;  3VB1 A;  1KQV A;  3PFV A;  3RZS A;  4FQO A;  4MEW A;  1QIV A;  4XJK A;  5CPV A;  3PAL A;  4NDD A;  4ZCV A;  4YBH B;  3MSE B;  3PM8 A;  1DMO A;  1PK0 D;  1UHN A;  2JT8 A;  3IQQ A;  4YI9 A;  1AVS A;  2ISD A;  1Z4H A;  2F2P A;  1SCV A;  5KSZ A;  2JUL A;  1KK8 B;  2JQ6 A;  1XFV O;  1A03 A;  1QIW A;  3OB1 B;  3QME A;  1C7W A;  1EJ3 A;  2QPT A;  1S26 D;  3F45 A;  2JRF A;  3PN7 B;  1NX1 A;  2BL0 B;  3PSR A;  1JWD A;  3CR5 X;  3PJI A;  1F8H A;  2ZN9 A;  3CR2 A;  2HF5 A;  1WDC B;  5BPJ A;  1IJ6 A;  1OOF A;  2PSR A;  1J7Q A;  3VRN A;  2K2F A;  3NHI A;  4GBA A;  2LM5 A;  1PRW A;  3DVE A;  2KLD A;  4ORA B;  3GOF A;  1N0Y A;  1HQV A;  1F4Q A;  3SIA A;  2CNP A;  1CM1 A;  1MUX A;  1B9A A;  2OS8 B;  1OMD A;  1ZOT B;  2WND A;  3DF0 A;  3D77 A;  1BU3 A;  1M31 A;  1C07 A;  2KFH A;  3I5I B;  1J1D A;  1DVI A;  1XVJ A;  1YRU B;  2CT9 A;  3SIB A;  3UNW A;  1XFY O;  1KSO A;  3SG7 A;  3KHE A;  3VRQ A;  3IVT A;  1QTX A;  2BCB A;  1EL4 A;  3QRX A;  5AFP A;  1QAT A;  4ETO A;  1LIN A;  3DYE A;  1BR4 B;  1MF8 B;  2JC2 A;  2WCM A;  3O2P A;  3D0Y B;  2BCA A;  1J7R A;  1YVL A;  1K94 A;  1YTZ C;  2M49 B;  2Y1N A;  3DVJ A;  2LCP A;  2NLN A;  4UPG A;  2QDI A;  3A4U B;  3C1V A;  1ZMZ A;  4I5N B;  1QX5 B;  2F3Z A;  3NSK A;  4GNK B;  1MXL C;  1NCY A;  3KF9 A;  4PE1 A;  5D7F A;  1OOG A;  2M9G A;  1AHR A;  2MLF C;  3PAT A;  3KEV A;  1UHH A;  2KQY A;  2L2E A;  2OTG B;  1XFX O;  4OCI A;  4PE0 A;  3TS5 B;  2EHB A;  1IQ3 A;  1Y6W A;  2YGU A;  4QJ5 B;  1CFP A;  3GK1 A;  3WXA A;  2SAS A;  4TNC A;  1ZFS A;  2K8M B;  1U5I B;  2WC5 A;  3TDZ A;  2BKH B;  2MBX A;  3BXK A;  1EG3 A;  1XFW O;  3S0F A;  2JT3 A;  3BJH A;  3CS1 A;  1S36 A;  4GAO A;  1RFJ A;  3CWG A;  4YGC B;  1NX2 A;  1TNP A;  3UO9 A;  1IWQ A;  2TN4 A;  3JTD C;  5D3O A;  2I2R E;  1PSB A;  3CZ1 A;  1K8U A;  3AAJ A;  4OV2 A;  5DIC A;  5B8I B;  3O6B A;  1SKT A;  4I5J A;  4Q04 A;  2WCB A;  2IS9 A;  3L47 A;  3D76 A;  1AJ5 A;  2CXJ A;  4IJ7 A;  4MLW A;  1W9Z A;  2LMU A;  2LVV A;  1VRK A;  3K21 A;  1MWN A;  1IJ5 A;  2KAY A;  4JWQ A;  1XFZ O;  2KLE A;  4R1E A;  2LNK A;  3NGV A;  2MLE C;  1N2D A;  5ER4 X;  4P2Y B;  1M45 A;  1SRA A;  4GGF C;  1M63 B;  1MXE A;  4JPZ B;  1K95 A;  2I7A A;  1R6P A;  1K9P A;  4ICB A;  3BQ3 A;  2JXC A;  1LVC D;  3DD4 A;  3I5H B;  4A4B A;  1PSR A;  3L4A A;  1BF5 A;  3D78 A;  2KI4 B;  3FWC A;  4A4C A;  2EC6 C;  2RGI A;  2LC5 A;  1M39 A;  3EK7 A;  3BOW A;  2DOQ A;  2LHL A;  2KGR A;  5JOL A;  3EK4 A;  1F70 A;  2BBM A;  3B87 A;  2GGZ A;  1OQP A;  1IQ5 A;  1GJY A;  2Q91 A;  4OKH A;  1CFC A;  1XK4 A;  1Y0V H;  1JUO A;  2O5G A;  3B7A A;  3CZT X;  4KYN A;  3O78 A;  1BOD A;  3DVM A;  4PE7 A;  4D1E A;  2PYQ A;  3EVR A;  1GQM A;  4DRW A;  3EG5 B;  2ZRT A;  2JPT A;  4C0L A;  1XO5 A;  3GK2 A;  3D75 A;  1SL8 A;  1BR1 B;  1SCM C;  2K7O A;  5G08 A;  5AEQ A;  1MHO A;  2K0J A;  1LXF C;  2MA2 A;  2ZFD A;  3OX5 A;  5F6T A;  4MZK A;  2KAX A;  1UHK A;  1ALV A;  2WCJ A;  2JNX A;  4JKT A;  5J3X A;  1LA3 A;  3HX4 A;  4OZD A;  1QAS A;  2F2O A;  1F54 A;  1OE9 B;  4DUQ A;  4M2P A;  4PE4 A;  1S1E A;  3VGO A;  4NQG A;  1RJV A;  3NHT A;  1IGV A;  2QEB A;  1QX2 A;  1S6I A;  2WC8 A;  2HQW A;  2K7C A;  1B8R A;  2LVI A;  2BE6 A;  1JFJ A;  1YUR A;  3CGA A;  1QV0 A;  3DY9 A;  1F71 A;  4GFT A; 
#chains in the Genus database with same CATH homology
 4P5O E;  1SR6 C;  1AUI B;  2LMV A;  5HYD A;  1H8B A;  3JVT C;  1QX7 A;  1TIZ A;  1B7T Y;  4ORB B;  1B4C A;  1QLS A;  2OPO A;  5CSF A;  1NCX A;  4N5X A;  3AAK A;  2WOS A;  1BOC A;  1CMF A;  3H4S E;  5FYX A;  4XJK B;  2AMI A;  4DCK A;  3OX6 A;  4GGF A;  4M2Q A;  1F55 A;  1OZS A;  1Q80 A;  1DGU A;  1KK7 Z;  1L2O B;  2D8N A;  3I5G C;  4QJ4 B;  4MSP A;  1BT6 A;  5CSI A;  2L4H A;  1G8I A;  1Y1U A;  1QVI Z;  1UUR A;  2LAP A;  2M7N A;  2MAZ A;  4PDZ A;  2M3W A;  3TDU A;  1NX3 A;  3LCP C;  1DGV A;  2KNE A;  1A2X A;  3LK0 A;  5AXI A;  3BUO B;  2KDH A;  5JJG A;  1AK8 A;  1S5G Y;  1KK8 C;  1YVH A;  2ZN8 A;  2H61 C;  3CLN A;  3LK1 A;  4GUK A;  1KFU L;  3PN7 C;  4YGD B;  2KSP A;  1K90 D;  1DJI A;  1RRO A;  1UP5 A;  2H2K A;  2ZND A;  3HCM A;  1RTP 1;  1WDC C;  2JXL A;  1DTL A;  3EK8 A;  1EH2 A;  3DF0 B;  4YI8 A;  4CPV A;  2WCE A;  2GGM A;  3WNX B;  4OR9 B;  1A75 A;  1JC2 A;  2P6B B;  1K93 D;  1KFX L;  3BYA A;  5I2L A;  1GGW A;  2LMT A;  3CTN A;  1TN4 A;  4NDC A;  2OS8 C;  2NCO A;  1CDM A;  2E30 A;  2O60 A;  1XFU O;  1S6J A;  2MRD A;  1OSA A;  3TUY B;  1A29 A;  3D10 A;  2LV7 A;  3KO0 A;  4PCW A;  1UHJ A;  2KYC A;  2R2I A;  1SW8 A;  3FS7 A;  1NUB A;  1TOP A;  2FCD A;  4ORC B;  5DKN A;  1JFK A;  2FCE A;  1UHI A;  5HLO A;  1WRZ A;  2K7B A;  3I5F B;  1PVB A;  4HRG A;  1KCY A;  1GGZ A;  4MVF A;  4DS7 A;  3OB2 B;  1IKU A;  1W7J B;  1BJF A;  4L9M A;  1SY9 A;  2PRU A;  1RK9 A;  1AP4 A;  1QLK A;  2LHI A;  4OVN F;  5KU1 A;  1J7P A;  3RLZ A;  2WOR A;  1S6C A;  4IL1 A;  2V53 A;  1FW4 A;  1WRK A;  2ZNE A;  4GPL B;  4AQI A;  1SK6 D;  1NP8 A;  2LLT A;  2Y4Q A;  2L0P A;  4PHN A;  1A75 B;  1R2U A;  1TCF A;  1TNW A;  1K9K A;  1SCM B;  2K7D A;  2KYF A;  2MHH A;  1TNQ A;  2OTG C;  4I5K A;  3TS5 C;  1B1G A;  1L7Z A;  2NZ0 A;  2I18 A;  4JQ0 D;  5I8N A;  1KWO C;  2L5X B;  1E8A A;  2JT0 A;  2BE4 A;  4FTG A;  4BY4 A;  5IBW A;  4MRX A;  1B7T Z;  4PHJ A;  2SCP A;  3NSI A;  1V1G A;  1PUL A;  1CDN A;  1UUS A;  3VRP A;  2JOJ A;  4M2O A;  1QS7 A;  1M46 A;  1YUU A;  2LP3 A;  1JSA A;  1NIW A;  3ZWH A;  2CCM A;  2I94 A;  2KFG A;  1NWD A;  1JF0 A;  2F33 A;  3GK4 X;  1DJY A;  2KQ6 A;  1JF2 A;  2H61 A;  2KBM A;  3NSO A;  1SYM A;  2Y1M A;  3BUX B;  1B8C A;  4E68 A;  2LAN A;  2HET A;  3WHT B;  1CDP A;  1CTR A;  2EGD A;  4DIR A;  1C7V A;  1FF1 A;  4QJ3 B;  3FIA A;  3VRO A;  5D69 A;  5DKR A;  1ZAC A;  2LVK A;  1TTX A;  3BOW B;  1S5G Z;  3ICB A;  1S3P A;  2MJW B;  3WHU B;  4U8D A;  4CFQ A;  1YX7 A;  4ZCU A;  3BUN B;  5HKZ A;  4CLN A;  1B47 A;  5HKY A;  1ODB A;  2KI4 C;  2G2B A;  1QXP A;  2BBN A;  3IQO A;  5CSN A;  4MRY A;  2G9B A;  1BLQ A;  1KQM C;  1CNP A;  4MZJ A;  2WCF A;  3IF7 A;  2GV5 A;  3E3R A;  3SG6 A;  4GGN A;  4MBE A;  2JU0 A;  2KAV A;  1PAL A;  3EVU A;  2KGB C;  1YUS A;  1KFU S;  1J55 A;  1EXR A;  2F3Y A;  4AQJ A;  2KBI A;  2F8P A;  2JZI A;  1N65 A;  2M1K B;  2JNF A;  3D0Y A;  1H4B A;  1UWO A;  1KFX S;  2M8U A;  1W7I B;  1DJG A;  1REC A;  1TRF A;  2PAS A;  2PMY A;  1YUT A;  1K2H A;  5HKW A;  2ZKM X;  2LLS A;  1IRJ A;  1YX8 A;  4MZL A;  2NCP A;  1XA5 A;  5PAL A;  1QV1 A;  1YR5 A;  1SBJ A;  1XYD A;  5CSJ A;  5HLV A;  1DF0 A;  3JTD B;  1J7O A;  2JTT A;  1CDL A;  1U5I A;  2L98 A;  1FI5 A;  1SMG A;  2M29 A;  2Q4U A;  1NPQ A;  4I5L B;  3SG4 A;  1WRL A;  2COL B;  1MR8 A;  1CFF A;  4WQ2 A;  1G33 A;  2BL0 C;  4F0Z B;  4WRI A;  3NXA A;  4XYN A;  1XK4 C;  3KPX A;  1JBA A;  2HPS A;  4YGE B;  1CFD A;  3VRR A;  1K96 A;  2BEC A;  2FJU B;  4NDB A;  5I2Q A;  4HRH A;  2LE9 B;  3OP0 A;  5GQQ C;  1NX0 A;  1TCO B;  1D1O A;  3ZNI A;  3SJS A;  2B1U A;  3TZ1 A;  1NCZ A;  1HT9 A;  2FOT A;  1OZO A;  2M0R A;  1J1E A;  2M97 A;  3I5I C;  1B8L A;  1CLL A;  1DJW A;  1AJ4 A;  1WY9 A;  2E6W A;  2EC6 B;  1LKJ A;  2KHN A;  2L4I A;  1YRT B;  2LUC A;  2M1U A;  1ALW A;  3A8R A;  1F4O A;  1CM4 A;  1RWY A;  2JWW A;  2L50 A;  1KWO B;  1DF0 B;  1L2O C;  3BUM B;  1BMO A;  1CKK A;  4USL A;  3RM1 A;  1CMG A;  1SL9 A;  3PLF B;  2CBL A;  4MN0 A;  2CTN A;  1OOJ A;  4PAL A;  1EG4 A;  4AOM A;  1FBV A;  2KFF A;  3LL8 B;  2A4J A;  4YGB B;  1WLZ A;  5KTY A;  1CB1 A;  4HSZ A;  1K9U A;  1OMR A;  5AER A;  2LUX A;  2ZRS A;  3AKA A;  2M7L A;  1Y1X A;  2KI6 C;  2KI6 D;  2KOT A;  1KK7 Y;  2K2A A;  2NXQ A;  4N1F A;  3EVV A;  3OHM B;  1CLM A;  1X02 A;  3EKJ A;  2AAO A;  3SG2 A;  4YRU A;  4BY5 A;  1IH0 A;  1QVI Y;  3LLE A;  5ER5 A;  2VRG A;  2LVJ A;  1BG1 A;  2PAL A;  1SNL A;  3BUW B;  1IG5 A;  1QJT A;  1DJX A;  3O4Y A;  4PHK A;  1LA0 A;  1TNX A;  2JTZ A;  1NSH A;  1A4P A;  5TNC A;  1MQ1 A;  3TUY C;  2PVB A;  4C0J A;  1NYA A;  2AUC A;  1PVA A;  1KQM B;  2L51 A;  3TDI A;  3SG3 A;  5AAN A;  1OMV A;  3AKB A;  4CFR A;  1SR6 B;  4N1G A;  3SG5 A;  2BKI B;  1DT7 B;  2QAC A;  3EKH A;  3JVT B;  3NSL A;  1DJZ A;  1SL7 A;  5I2O A;  5K89 A;  1FPW A;  3I5F C;  2K61 A;  3DVK A;  1CLB A;  1Y1A A;  1DJH A;  4WQ3 A;  1ZUZ A;  4YGA A;  1WLM A;  3M0W A;  1V1F A;  3FWB A;  5DKQ A;  2LLU A;  1FI6 A;  3CR4 X;  2BCX A;  2HQ8 A;  3I5H C;  4C0K A;  4CID A;  2Y5I A;  1KSM A;  1SPY A;  2LP2 A;  4HRE E;  1G4Y R;  4PHM A;  3I5G B;  1KQV A;  3PFV A;  4FQO A;  4MEW A;  1QIV A;  4XJK A;  5CPV A;  3PAL A;  4NDD A;  4ZCV A;  4YBH B;  3MSE B;  3PM8 A;  1DMO A;  1PK0 D;  1UHN A;  2JT8 A;  3IQQ A;  4YI9 A;  1AVS A;  2ISD A;  2F2P A;  1SCV A;  5KSZ A;  2JUL A;  1KK8 B;  2JQ6 A;  1XFV O;  1A03 A;  1QIW A;  3OB1 B;  1C7W A;  1EJ3 A;  2QPT A;  1S26 D;  3F45 A;  2JRF A;  3PN7 B;  1NX1 A;  2BL0 B;  3PSR A;  1JWD A;  3CR5 X;  1F8H A;  2ZN9 A;  3CR2 A;  2HF5 A;  1WDC B;  5BPJ A;  1IJ6 A;  2PSR A;  1J7Q A;  3VRN A;  2K2F A;  4GBA A;  2LM5 A;  1PRW A;  3DVE A;  4ORA B;  3GOF A;  1N0Y A;  1HQV A;  1F4Q A;  3SIA A;  2CNP A;  1CM1 A;  1MUX A;  1B9A A;  2OS8 B;  1OMD A;  1ZOT B;  2WND A;  3DF0 A;  1C07 A;  1BU3 A;  1M31 A;  2KFH A;  3I5I B;  1J1D A;  1DVI A;  1XVJ A;  1YRU B;  2CT9 A;  3SIB A;  1XFY O;  1KSO A;  3SG7 A;  3KHE A;  3VRQ A;  1QTX A;  2BCB A;  1EL4 A;  3QRX A;  5AFP A;  1QAT A;  4ETO A;  1LIN A;  1BR4 B;  1MF8 B;  2JC2 A;  3O2P A;  3D0Y B;  2BCA A;  1J7R A;  1YVL A;  1K94 A;  1YTZ C;  2M49 B;  2Y1N A;  3DVJ A;  2LCP A;  2NLN A;  4UPG A;  3A4U B;  3C1V A;  1ZMZ A;  4I5N B;  1QX5 B;  2F3Z A;  3NSK A;  4GNK B;  1MXL C;  1NCY A;  3KF9 A;  4PE1 A;  5D7F A;  2M9G A;  1AHR A;  2MLF C;  3PAT A;  3KEV A;  1UHH A;  2KQY A;  2L2E A;  2OTG B;  1XFX O;  4OCI A;  4PE0 A;  3TS5 B;  2EHB A;  1IQ3 A;  1Y6W A;  4QJ5 B;  1CFP A;  3GK1 A;  3WXA A;  2SAS A;  4TNC A;  1ZFS A;  2K8M B;  1U5I B;  3TDZ A;  2BKH B;  2MBX A;  3BXK A;  1EG3 A;  1XFW O;  2JT3 A;  3CS1 A;  1S36 A;  4GAO A;  1RFJ A;  3CWG A;  4YGC B;  1NX2 A;  1TNP A;  1IWQ A;  2TN4 A;  3JTD C;  2I2R E;  1PSB A;  1K8U A;  3AAJ A;  4OV2 A;  5B8I B;  3O6B A;  1SKT A;  4I5J A;  4Q04 A;  2WCB A;  2IS9 A;  1AJ5 A;  2CXJ A;  4MLW A;  2LMU A;  2LVV A;  1VRK A;  3K21 A;  1MWN A;  1IJ5 A;  2KAY A;  4JWQ A;  1XFZ O;  4R1E A;  2LNK A;  2MLE C;  1N2D A;  5ER4 X;  4P2Y B;  1M45 A;  1SRA A;  4GGF C;  1M63 B;  1MXE A;  4JPZ B;  1K95 A;  2I7A A;  1R6P A;  1K9P A;  4ICB A;  3BQ3 A;  2JXC A;  1LVC D;  3DD4 A;  3I5H B;  4A4B A;  1PSR A;  1BF5 A;  3FWC A;  2KI4 B;  4A4C A;  2EC6 C;  2RGI A;  2LC5 A;  1M39 A;  3EK7 A;  3BOW A;  2DOQ A;  2LHL A;  2KGR A;  5JOL A;  3EK4 A;  1F70 A;  2BBM A;  2GGZ A;  1OQP A;  1IQ5 A;  1GJY A;  2Q91 A;  4OKH A;  1CFC A;  1XK4 A;  1Y0V H;  1JUO A;  2O5G A;  3CZT X;  3O78 A;  1BOD A;  3DVM A;  4PE7 A;  4D1E A;  3EVR A;  1GQM A;  4DRW A;  2ZRT A;  2JPT A;  4C0L A;  1XO5 A;  3GK2 A;  1SL8 A;  1BR1 B;  1SCM C;  2K7O A;  5G08 A;  5AEQ A;  1MHO A;  2K0J A;  1LXF C;  2MA2 A;  2ZFD A;  3OX5 A;  5F6T A;  4MZK A;  2KAX A;  1UHK A;  1ALV A;  2JNX A;  5J3X A;  1LA3 A;  3HX4 A;  1QAS A;  2F2O A;  1F54 A;  1OE9 B;  4DUQ A;  4M2P A;  4PE4 A;  1S1E A;  3VGO A;  4NQG A;  1RJV A;  1IGV A;  1QX2 A;  1S6I A;  2WC8 A;  2HQW A;  2K7C A;  1B8R A;  2LVI A;  2BE6 A;  1JFJ A;  1YUR A;  3CGA A;  1QV0 A;  1F71 A;  4GFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...