1CLBA

Determination of the solution structure of apo calbindin d9k by nmr spectroscopy
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Determination of the solution structure of Apo calbindin D9k by NMR spectroscopy.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1995-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1clbA00
3TDZA 4PE1A 4QJ3B 1A03A 3JVTC 1JC2A 1SYMA 1NCXA 2ZFDA 1B1GA 1A2XA 4A4BA 4JPZB 1RTP1 2KSPA 2E6WA 2CCMA 3IQOA 3IQQA 5D69A 3NXAA 4U8DA 1ZOTB 4OKHA 1XK4C 2RGIA 2Y4QA 1YUSA 1XA5A 1JF2A 3BUXB 5F6TA 1BLQA 1XFYO 1NPQA 2K2AA 1XFXO 1OMVA 4YGCB 1XO5A 3CTNA 4YI8A 1CFPA 1IQ3A 1XVJA 5HKZA 2K7DA 3PATA 2MRDA 1KSMA 2AMIA 1J7QA 1L2OC 2ZRTA 1ODBA 3SG2A 1YVLA 3VGOA 4AQIA 1DJWA 2KAXA 2NCPA 1QX5B 1FBVA 3I5HB 3FWBA 1K9KA 1EH2A 2PALA 5PALA 3A4UB 4YGEB 1CMFA 2K61A 1M63B 1WDCC 1IJ5A 1DJGA 1HQVA 3LL8B 3PM8A 1B4CA 1YX7A 2L51A 1DVIA 1JWDA 3PFVA 2CT9A 1B47A 5DKQA 3HCMA 1QASA 2LM5A 1DGUA 1A75A 1B7TZ 1QX7A 1PULA 4PE4A 1VRKA 2M0RA 3TS5B 1J7OA 2QPTA 2JNFA 1IQ5A 1S6CA 4ZCUA 1AP4A 1SKTA 3CWGA 5FYXA 1LINA 1TIZA 3GK1A 1AVSA 1QTXA 4L9MA 1XFVO 3AKAA 2JOJA 2Q4UA 1YTZC 3BOWB 3SIAA 2O5GA 1DT7B 4YGAA 2MBXA 3CLNA 3DD4A 3EVVA 1XFWO 2JTTA 1V1GA 3OP0A 1CDLA 4M2QA 1FPWA 3SG3A 3IF7A 2MA2A 2QACA 1CLLA 1S5GZ 2LMUA 2A4JA 5AEQA 1QLSA 2LMVA 2BCBA 1SNLA 1WLMA 1CMGA 1S3PA 2M8UA 1NCYA 3EK7A 4A4CA 3ZNIA 3I5HC 4HRHA 3VRPA 3EVRA 4GAOA 2KQYA 3F45A 2OTGB 3DVKA 1S36A 3I5IB 3WHUB 4DUQA 2LP3A 3NSIA 1Y0VH 4DCKA 1TNXA 2LE9B 4PALA 2JT3A 1SCMB 1QLKA 1SY9A 1DF0A 1UHIA 5HKYA 1AK8A 4MZJA 4PCWA 2BL0B 1DJHA 4CFRA 1N2DA 1DJXA 3ICBA 1IRJA 1K93D 2JT0A 1RROA 2L50A 1MR8A 2JU0A 2IS9A 1F4OA 2KFGA 3TS5C 1BMOA 3D10A 4N1GA 1KQMB 1PVBA 2H61C 2KYCA 4NDBA 1GJYA 1JUOA 1QVIY 3WHTB 1H8BA 4I5NB 2HF5A 3EK8A 5I8NA 2M49B 1NX3A 2LAPA 2EC6C 2E30A 2FOTA 5CPVA 3SIBA 4AQJA 5KU1A 1D1OA 3NSLA 1U5IB 3CS1A 4N1FA 1F71A 2Q91A 2KNEA 4WRIA 3EKJA 1AJ4A 2G9BA 4DIRA 1ZUZA 2CBLA 2G2BA 5K89A 4JWQA 1SPYA 3DVJA 2KFHA 1OSAA 1Y6WA 1UP5A 1AJ5A 4D1EA 1KWOB 2K0JA 4OR9B 2KFFA 1QJTA 1LA0A 1B7TY 2ZKMX 1K9PA 3DF0A 3VRQA 2OTGC 3I5IC 4PHMA 3EK4A 1KFXS 1KFXL 1SCMC 1CFCA 1NSHA 1QIVA 1QATA 3FWCA 2GGZA 2BL0C 4NDDA 1NX1A 1NX2A 1B8CA 2M1UA 3O4YA 2JRFA 3D0YB 4WQ3A 1CKKA 2FCDA 4ETOA 1R2UA 2JC2A 1RK9A 2WCFA 2JWWA 1MXLC 2SCPA 1SBJA 5J3XA 4C0LA 1NIWA 1QV0A 2L98A 1EL4A 5ER4X 1S5GY 1KQMC 3SG6A 2WNDA 2B1UA 2KGBC 4BY5A 1LXFC 4N5XA 1NCZA 2LCPA 2M29A 4PE7A 1BODA 2L2EA 2M7NA 3O78A 4XJKA 1NUBA 3I5GB 1GGWA 4ICBA 3OX6A 1KK8B 3EKHA 2EHBA 1BOCA 2WORA 1XFZO 5ER5A 1JSAA 2BECA 1RECA 1RWYA 1GQMA 2K7CA 3OX5A 2TN4A 2WCEA 4I5JA 2KOTA 3M0WA 1C07A 4MVFA 4MRXA 1SL7A 4FTGA 4F0ZB 1CNPA 5AANA 4DS7A 3VRNA 1MWNA 1AUIB 1NX0A 2K8MB 1H4BA 1BR1B 1PVAA 1S1EA 2WOSA 4M2OA 1XFUO 1QX2A 1WRKA 3E3RA 4R1EA 1OOJA 1W7IB 1C7VA 1YVHA 5CSJA 1KWOC 1XK4A 1DJIA 1KSOA 2KI4B 4UPGA 4DRWA 5HLOA 1TN4A 2F2PA 2NXQA 1CM4A 1IH0A 5CSFA 1BU3A 1YR5A 2EC6B 1WLZA 1CB1A 1WRZA 3CR4X 1B8LA 3CR2A 1A4PA 5KTYA 1BF5A 1Y1AA 2H2KA 2LC5A 2PASA 3EVUA 2OS8B 3PLFB 2VRGA 3VRRA 3BUOB 2JTZA 1W7JB 1LA3A 1OMRA 4GUKA 1OQPA 4MZKA 1IKUA 3CGAA 1UUSA 2ZN8A 2JXCA 2GV5A 1S26D 5AXIA 2LLUA 2KI6D 1M39A 2LHIA 5I2LA 4PHKA 3SG5A 2M9GA 3RM1A 2FCEA 1G8IA 3BQ3A 1CFDA 2KDHA 2HQWA 3JTDB 5DKNA 4MEWA 2K7OA 3KO0A 3I5FB 5KSZA 4Q04A 3I5GC 2K7BA 1KK8C 5TNCA 4GGFC 1K8UA 4FQOA 2GGMA 2MHHA 3OHMB 5CSNA 2CTNA 2LLTA 3ZWHA 2KQ6A 1S6JA 1RJVA 3TZ1A 2LVIA 5G08A 1TCFA 2COLB 3GK4X 3WXAA 4AOMA 1HT9A 3A8RA 4NQGA 2KAVA 4NDCA 1A75B 1CLBA 4ORAB 1CLMA 2KI4C 3KHEA 1N0YA 1ALVA 2DOQA 1KCYA 4IL1A 2AAOA 1J55A 2LVKA 2Y5IA 5CSIA 2V53A 1KFUS 1KFUL 1A29A 4GGNA 4GNKB 2L5XB 2BCAA 1JFKA 2OS8C 1SRAA 3LK1A 2P6BB 2KAYA 1FW4A 4HREE 1SL8A 2HQ8A 4MSPA 3FS7A 2F2OA 2ZNDA 2LNKA 1NP8A 1YUUA 1KK7Z 2ZN9A 5I2QA 1IGVA 1SK6D 2F3YA 1YRUB 3JTDC 2NZ0A 2LVJA 4CIDA 1DGVA 3I5FC 1JF0A 2BE6A 1FI6A 3BUWB 4QJ4B 1QV1A 2LUCA 1F8HA 1NWDA 1UWOA 2BBNA 2PRUA 4OV2A 1WY9A 1JBAA 1K9UA 1K95A 2KI6C 3KF9A 1F70A 2BKIB 3LCPC 2MJWB 3BYAA 3DVEA 4ZCVA 3O2PA 1DF0B 4YI9A 1X02A 3O6BA 1G4YR 2H61A 3MSEB 5IBWA 4OCIA 1UHKA 1K94A 1IWQA 3NSOA 2EGDA 4M2PA 2JXLA 5HLVA 1TNPA 2PMYA 1BJFA 2Y1MA 5HKWA 1ZACA 4TNCA 1N65A 2I2RE 1UHHA 3K21A 2D8NA 3BOWA 4YRUA 1YX8A 1CFFA 4I5LB 2OPOA 4C0KA 3TDIA 1BG1A 1AHRA 1EG4A 1F4QA 2KBIA 2O60A 1RFJA 5JOLA 3H4SE 5BPJA 1SR6B 2HPSA 1Y1XA 4JQ0D 4MZLA 1DTLA 1B9AA 5HYDA 2BCXA 4BY4A 3OB2B 1QVIZ 1OZSA 4YBHB 3AAJA 1UHJA 1ALWA 3PN7B 2LV7A 1DJYA 1M31A 4YGBB 4CPVA 1CDMA 1J7RA 1L7ZA 4MLWA 3PSRA 1K2HA 2I94A 2PVBA 3HX4A 2KYFA 1E8AA 1UURA 2KBMA 1YRTB 4MRYA 2K2FA 1PK0D 5AFPA 1EG3A 1NYAA 3DF0B 3CR5X 4E68A 3TDUA 5JJGA 1J1DA 2F33A 3DVMA 1CTRA 1IJ6A 1ZFSA 2MLFC 3PALA 4C0JA 2NCOA 2SASA 1TTXA 1OMDA 4HSZA 1MQ1A 1F54A 1YURA 1C7WA 3TUYB 1CDNA 2I7AA 3LK0A 3GK2A 4MN0A 2LP2A 3GOFA 1KQVA 2MLEC 2LMTA 1TCOB 3SJSA 1CM1A 2KGRA 1QXPA 1M45A 1J7PA 1MXEA 1CDPA 1U5IA 2AUCA 1KK7Y 2JQ6A 2LHLA 2M1KB 4ORCB 3SG4A 1S6IA 2ISDA 2BKHB 3CZTX 1TNQA 4XJKB 2JPTA 1QIWA 2JULA 3AAKA 1MF8B 5GQQC 1SR6C 4YGDB 1LVCD 2Y1NA 3BXKA 1QS7A 2NLNA 2CNPA 1K96A 1G33A 3OB1B 2M7LA 3JVTB 3NSKA 1GGZA 1BT6A 4MBEA 1V1FA 2L4IA 4ORBB 2JZIA 3BUMB 4I5KA 2KHNA 1DMOA 2M3WA 1XYDA 3PN7C 1J1EA 2LVVA 1B8RA 4OVNF 2F8PA 4GFTA 1TNWA 2L4HA 3KPXA 1PALA 2LUXA 1M46A 4GBAA 1PRWA 2I18A 2ZNEA 1Q80A 1SL9A 4GPLB 1IG5A 3LLEA 4WQ2A 3VROA 4P5OE 2FJUB 4PE0A 3D0YA 3QRXA 1R6PA 1TOPA 3FIAA 2F3ZA 3AKBA 2BE4A 1PSBA 2L0PA 2LANA 2WCBA 1BR4B 4HRGA 1OE9B 1FI5A 3TUYC 2JNXA 1Y1UA 2R2IA 1L2OB 4CFQA 1FF1A 4PHNA 1UHNA 2PSRA 3C1VA 2MAZA 3SG7A 5B8IB 4QJ5B 1PSRA 1F55A 4P2YB 5I2OA 3WNXB 1DJZA 5AERA 1MUXA 5D7FA 4XYNA 4PDZA 4USLA 1EXRA 1LKJA 2ZRSA 2LLSA 1TRFA 5DKRA 3KEVA 1MHOA 4CLNA 2CXJA 2BBMA 1K90D 2HETA 4GGFA 2M97A 1YUTA 2JT8A 1OZOA 1ZMZA 1JFJA 1SCVA 3BUNB 2WC8A 1WDCB 4PHJA 1SW8A 1EJ3A 3RLZA 1WRLA 1SMGA
chains in the Genus database with same CATH superfamily
3TDZA 4PE1A 4QJ3B 1A03A 3JVTC 1JC2A 1SYMA 1NCXA 2ZFDA 1B1GA 1A2XA 4A4BA 4JPZB 1RTP1 2KSPA 2E6WA 2CCMA 3IQOA 5I94A 1DC1A 3IQQA 5D69A 3NXAA 3PJIA 1ZOTB 4U8DA 3CYZA 4OKHA 1XK4C 2RGIA 2Y4QA 1YUSA 1XA5A 1JF2A 3BUXB 3D77A 5F6TA 1BLQA 1XFYO 3V2LA 1NPQA 2K2AA 1XFXO 1OMVA 4YGCB 1XO5A 3CTNA 4YI8A 1CFPA 1IQ3A 1XVJA 5HKZA 2K7DA 3PATA 2MRDA 1KSMA 2AMIA 1J7QA 1L2OC 2ZRTA 3DYEA 1ODBA 3SG2A 1YVLA 3VGOA 4AQIA 1DJWA 2KAXA 2NCPA 1QX5B 1FBVA 3I5HB 3FWBA 1K9KA 1EH2A 2PALA 2K60A 5PALA 3A4UB 4YGEB 1CMFA 2K61A 1M63B 1WDCC 1IJ5A 1DJGA 3BFBA 1HQVA 3LL8B 3PM8A 1B4CA 1YX7A 2L51A 1DVIA 1JWDA 3PFVA 2CT9A 1B47A 5DKQA 3HCMA 1QASA 2LM5A 1DGUA 1A75A 1B7TZ 1QX7A 1PULA 4PE4A 1VRKA 2M0RA 3TS5B 1J7OA 2QPTA 2JNFA 5EL2A 1IQ5A 1S6CA 4ZCUA 3N7HA 1SKTA 3CWGA 5FYXA 1AP4A 1LINA 1TIZA 3GK1A 3RZSA 1AVSA 2QEVA 1QTXA 4L9MA 1XFVO 2KPHA 3AKAA 2JOJA 2Q4UA 1YTZC 3BOWB 3SIAA 2O5GA 1DT7B 4YGAA 2MBXA 3CLNA 3DD4A 3EVVA 1XFWO 2JTTA 1V1GA 3OP0A 2H8VA 1CDLA 1DELA 4M2QA 2QEOA 1FPWA 3SG3A 2YGUA 3IF7A 3S0GA 2MA2A 2QACA 1CLLA 1S5GZ 2LMUA 2A4JA 5AEQA 1QLSA 2BAPA 3DY9A 3R1VA 2LMVA 2BCBA 1SNLA 1WLMA 1CMGA 1S3PA 2M8UA 1NCYA 3EK7A 3R1PA 3R72A 3S0BA 4A4CA 3ZNIA 3I5HC 4HRHA 3VRPA 3EVRA 4GAOA 2KQYA 3F45A 2OTGB 3DVKA 1S36A 3I5IB 3B88A 3WHUB 4DUQA 2LP3A 3NSIA 1Y0VH 4DCKA 1TNXA 2LE9B 1W9ZA 2JT3A 1SCMB 1QLKA 4PALA 1SY9A 1DF0A 1UHIA 5HKYA 1AK8A 4MZJA 4PCWA 2BL0B 1DJHA 4CFRA 3IVTA 1N2DA 1DJXA 3ICBA 1IRJA 1DEKA 1K93D 2JT0A 2WCLA 1RROA 2L50A 1MR8A 2JU0A 2WC6A 2IS9A 4IJ7A 1F4OA 2KFGA 3CABA 3L4AA 1BMOA 3D10A 4N1GA 3TS5C 1KQMB 1PVBA 2H61C 2KYCA 4NDBA 1GJYA 1JUOA 1QVIY 3WHTB 5HL1A 1H8BA 4I5NB 2HF5A 1ORGA 3EK8A 5I8NA 2M49B 3L4LA 1NX3A 1Z4HA 2LAPA 2EC6C 2E30A 2FOTA 5CPVA 3SIBA 4AQJA 5KU1A 1D1OA 3NSLA 1U5IB 3CS1A 4N1FA 5FI7A 3NGVA 1F71A 2Q91A 2QEBA 2KNEA 4WRIA 3EKJA 1AJ4A 3EG5B 2P71A 2G9BA 3FE9A 4DIRA 1ZUZA 2CBLA 2G2BA 2JPOA 1OW4A 4JWQA 5K89A 3S0AA 1SPYA 1T14A 3DVJA 2KFHA 2KLEA 1OSAA 1Y6WA 1UP5A 1AJ5A 4D1EA 2QEHA 3BJHA 1KWOB 2K0JA 4OR9B 2KFFA 1QJTA 1LA0A 1B7TY 2ZKMX 3B6XA 1K9PA 3PM2A 3DF0A 3VRQA 2OTGC 3I5IC 3DXLA 4PHMA 3SS4A 3EK4A 1KFXS 1KFXL 3D75A 1P28A 1SCMC 1CFCA 3CZ0A 1NSHA 3S0DA 1QIVA 1QATA 3FWCA 2GGZA 1C3ZA 2BL0C 4NDDA 1NX1A 1NX2A 1B8CA 2M1UA 3O4YA 2JRFA 3D0YB 4WQ3A 1CKKA 2FCDA 4ETOA 1R2UA 3S0EA 2JC2A 1GM0A 1RK9A 2WCFA 2JWWA 1MXLC 2SCPA 1SBJA 5J3XA 4C0LA 1NIWA 1QV0A 2L98A 1EL4A 5ER4X 1S5GY 1KQMC 3SG6A 2WNDA 2B1UA 2KGBC 4BY5A 1LXFC 4N5XA 1NCZA 2LCPA 2M29A 3BFAA 4PE7A 2L2EA 1BODA 2M7NA 3O78A 4XJKA 1NUBA 3I5GB 1GGWA 4ICBA 3OX6A 1KK8B 3EKHA 1C3YA 3FE8A 2EHBA 1BOCA 2WORA 1XFZO 5ER5A 1JSAA 2BECA 1RECA 1RWYA 1GQMA 2K7CA 3OX5A 2TN4A 2WCEA 4I5JA 2KOTA 3M0WA 1C07A 4MVFA 3UNWA 4MRXA 1SL7A 4FTGA 4F0ZB 1CNPA 5AANA 4INWA 4DS7A 3VRNA 1MWNA 1AUIB 1NX0A 2K8MB 1H4BA 4OZDA 1BR1B 1PVAA 1S1EA 2WOSA 4M2OA 1XFUO 1QX2A 1WRKA 3E3RA 4R1EA 1OOJA 1W7IB 2PQLA 1C7VA 1YVHA 3CZ1A 5CSJA 1KWOC 1XK4A 1DJIA 1KSOA 2KI4B 4UPGA 4PT1A 4DRWA 5FI6A 2BNXA 5HLOA 1TN4A 2F2PA 2NXQA 1CM4A 4KYNA 1IH0A 5CSFA 1BU3A 1YR5A 2EC6B 1WLZA 1CB1A 1WRZA 3CR4X 3DZTA 1B8LA 3CR2A 1A4PA 1TUJA 5KTYA 1BF5A 1Y1AA 2H2KA 2LC5A 2PASA 3EVUA 2OS8B 3PLFB 2VRGA 3VRRA 3BUOB 2JTZA 1W7JB 1LA3A 1OMRA 3BFHA 1OQPA 4GUKA 4MZKA 1IKUA 3CGAA 1UUSA 2ZN8A 2JXCA 2GV5A 1S26D 5AXIA 2LLUA 2KI6D 1M39A 2LHIA 5I2LA 4PHKA 3SG5A 1TWOA 2M9GA 3RM1A 2FCEA 1G8IA 3BQ3A 1CFDA 2KDHA 2HQWA 3JTDB 5DKNA 4MEWA 2K7OA 3KO0A 3I5FB 5KSZA 4Q04A 3I5GC 2K7BA 1KK8C 2QDIA 5D3OA 5TNCA 4GGFC 1K8UA 4FQOA 2GGMA 2MHHA 3OHMB 5CSNA 2CTNA 2LLTA 3ZWHA 2KQ6A 1S6JA 3OGNA 1RJVA 3TZ1A 2LVIA 5G08A 1TCFA 2COLB 3GK4X 3WXAA 4AOMA 1HT9A 3A8RA 4NQGA 2KAVA 4NDCA 1A75B 1CLBA 3CZ2A 4ORAB 1CLMA 2KI4C 3KHEA 1N0YA 1ALVA 2DOQA 1KCYA 4IL1A 1OOFA 2AAOA 1J55A 2LVKA 2L5YA 2Y5IA 5CSIA 2V53A 1KFUS 1KFUL 2GTEA 1A29A 4GGNA 4GNKB 2L5XB 2BCAA 1JFKA 2WCJA 2OS8C 1SRAA 3LK1A 2P6BB 2P70A 2KAYA 1FW4A 4HREE 1SL8A 2HQ8A 4MSPA 3FS7A 2F2OA 2ZNDA 2LNKA 1NP8A 1YUUA 1KK7Z 2ZN9A 5I2QA 1IGVA 1SK6D 2F3YA 1YRUB 2WCHA 3JTDC 4F7FA 2NZ0A 2LVJA 2WCKA 2ERBA 4CIDA 1DGVA 3I5FC 2WC5A 1JF0A 2BE6A 1FI6A 3BUWB 4QJ4B 1QV1A 2LUCA 1F8HA 1NWDA 1UWOA 2BBNA 2PRUA 1DQEA 4OV2A 1WY9A 1JBAA 1K9UA 1K95A 2KI6C 3KF9A 1F70A 2BKIB 3LCPC 2MJWB 3BYAA 3DVEA 4ZCVA 3O2PA 1DF0B 4YI9A 1X02A 3O6BA 1G4YR 2H61A 3MSEB 5IBWA 2L2CA 5FI2A 4OCIA 1UHKA 1K94A 1IWQA 1SSEB 3NSOA 4INXA 2EGDA 4M2PA 2JXLA 5HLVA 1TNPA 2PMYA 1BJFA 2Y1MA 5HKWA 1ZACA 4TNCA 1N65A 2I2RE 1UHHA 3K21A 2D8NA 2WCMA 3BOWA 1YX8A 4YRUA 1CFFA 4I5LB 2OPOA 4C0KA 3TDIA 1BG1A 1AHRA 1EG4A 1F4QA 2KBIA 2O60A 1RFJA 5JOLA 3H4SE 5BPJA 1SR6B 3SS5A 2HPSA 1Y1XA 4JQ0D 4MZLA 1DTLA 1B9AA 5HYDA 2BCXA 4BY4A 1OOGA 1QVIZ 3OB2B 1OZSA 4YBHB 3AAJA 1UHJA 1ALWA 3PN7B 2LV7A 1DJYA 1M31A 4YGBB 4CPVA 2FJYA 1CDMA 1J7RA 1L7ZA 4MLWA 3PSRA 4FQTA 1K2HA 2I94A 2PVBA 3HX4A 1TUZA 2KYFA 1E8AA 1UURA 2KBMA 3NHIA 1YRTB 4MRYA 2K2FA 1PK0D 1LS8A 1EG3A 5AFPA 3B7AA 1NYAA 3DF0B 3CR5X 4E68A 3TDUA 5JJGA 1J1DA 2F33A 3DVMA 1CTRA 1IJ6A 1ZFSA 2MLFC 3D74A 3PALA 2NCOA 1Z2CB 2SASA 3CDNA 4C0JA 1TTXA 1OMDA 4HSZA 1MQ1A 1F54A 1YURA 1C7WA 3TUYB 1CDNA 2I7AA 3LK0A 3GK2A 3SS3A 3D78A 4MN0A 2LP2A 3GOFA 3D76A 3OBVA 2MLEC 1KQVA 2LMTA 1TCOB 3SJSA 3Q8IA 1CM1A 1OOIX 2KGRA 1QXPA 1M45A 1J7PA 1MXEA 1CDPA 1U5IA 2AUCA 1KK7Y 2JQ6A 2LHLA 2M1KB 4JD9A 4ORCB 3SG4A 5DICA 1S6IA 2ISDA 2BKHB 3CZTX 1TNQA 4XJKB 2JPTA 1QIWA 2JULA 3AAKA 1MF8B 3O4XA 5GQQC 1IIOA 1SR6C 4YGDB 1LVCD 2Y1NA 3BXKA 1QS7A 2NLNA 2CNPA 1K96A 1G33A 3K1EA 3OB1B 3VB1A 2M7LA 3JVTB 3NSKA 1GGZA 1BT6A 4MBEA 1V1FA 2L4IA 4ORBB 2JZIA 3BUMB 4I5KA 2KHNA 1DMOA 2M3WA 3FE6A 1XYDA 3PN7C 1J1EA 2LVVA 1B8RA 4OVNF 2F8PA 4GFTA 1TNWA 2L4HA 3KPXA 1PALA 1QWVA 1M46A 2LUXA 4GBAA 4JKTA 1PRWA 2I18A 2ZNEA 3NHTA 3R1OA 1Q80A 1SL9A 4GPLB 1IG5A 3LLEA 4WQ2A 3VROA 4P5OE 2FJUB 4PE0A 3D0YA 3QRXA 1R6PA 1TOPA 3FIAA 2F3ZA 3AKBA 2BE4A 1PSBA 2L0PA 2LANA 2WCBA 3L47A 1BR4B 4HRGA 1OE9B 1FI5A 3TUYC 2JNXA 1Y1UA 2R2IA 1L2OB 4CFQA 3UO9A 4PHNA 1FF1A 1UHNA 2PSRA 3C1VA 2MAZA 3SG7A 5B8IB 4QJ5B 1XFRA 1PSRA 1F55A 4P2YB 5I2OA 3WNXB 1DJZA 5AERA 1MUXA 5D7FA 4XYNA 4PDZA 4USLA 1EXRA 1LKJA 1OOHA 2ZRSA 2LLSA 3B87A 1TRFA 5DKRA 3KEVA 1MHOA 4CLNA 2CXJA 2BBMA 1K90D 3B86A 2HETA 4GGFA 3S0FA 2M97A 1YUTA 3D73A 2JT8A 1OZOA 1ZMZA 1JFJA 1SCVA 3BUNB 2WC8A 1WDCB 2PYQA 4PHJA 3QMEA 1SW8A 1EJ3A 2KLDA 3RLZA 1WRLA 1SMGA
chains in the Genus database with same CATH topology
3TDZA 4PE1A 4QJ3B 1A03A 3JVTC 1JC2A 1SYMA 1NCXA 2ZFDA 1B1GA 1A2XA 4A4BA 4JPZB 1RTP1 2KSPA 2E6WA 2CCMA 3IQOA 3IQQA 5D69A 3NXAA 4U8DA 1ZOTB 4OKHA 1XK4C 2RGIA 2Y4QA 1YUSA 1XA5A 1JF2A 3BUXB 5F6TA 1BLQA 1XFYO 1NPQA 2K2AA 1XFXO 1OMVA 4YGCB 1XO5A 3CTNA 4YI8A 1CFPA 1IQ3A 1XVJA 5HKZA 2K7DA 3PATA 2MRDA 1KSMA 2AMIA 1J7QA 1L2OC 2ZRTA 1ODBA 3SG2A 1YVLA 3VGOA 4AQIA 1DJWA 2KAXA 2NCPA 1QX5B 1FBVA 3I5HB 3FWBA 1K9KA 1EH2A 2PALA 5PALA 3A4UB 4YGEB 1CMFA 2K61A 1M63B 1WDCC 1IJ5A 1DJGA 1HQVA 3LL8B 3PM8A 1B4CA 1YX7A 2L51A 1DVIA 1JWDA 3PFVA 2CT9A 1B47A 5DKQA 3HCMA 1QASA 2LM5A 1DGUA 1A75A 1B7TZ 1QX7A 1PULA 4PE4A 1VRKA 2M0RA 3TS5B 1J7OA 2QPTA 2JNFA 1IQ5A 1S6CA 4ZCUA 1AP4A 1SKTA 3CWGA 5FYXA 1LINA 1TIZA 3GK1A 1AVSA 1QTXA 4L9MA 1XFVO 3AKAA 2JOJA 2Q4UA 1YTZC 3BOWB 3SIAA 2O5GA 1DT7B 4YGAA 2MBXA 3CLNA 3DD4A 3EVVA 1XFWO 2JTTA 1V1GA 3OP0A 1CDLA 4M2QA 1FPWA 3SG3A 3IF7A 2MA2A 2QACA 1CLLA 1S5GZ 2LMUA 2A4JA 5AEQA 1QLSA 2LMVA 2BCBA 1SNLA 1WLMA 1CMGA 1S3PA 2M8UA 1NCYA 3EK7A 4A4CA 3ZNIA 3I5HC 4HRHA 3VRPA 3EVRA 4GAOA 2KQYA 3F45A 2OTGB 3DVKA 1S36A 3I5IB 3WHUB 4DUQA 2LP3A 3NSIA 1Y0VH 4DCKA 1TNXA 2LE9B 4PALA 2JT3A 1SCMB 1QLKA 1SY9A 1DF0A 1UHIA 5HKYA 1AK8A 4MZJA 4PCWA 2BL0B 1DJHA 4CFRA 1N2DA 1DJXA 3ICBA 1IRJA 1K93D 2JT0A 1RROA 2L50A 1MR8A 2JU0A 2IS9A 1F4OA 2KFGA 3TS5C 1BMOA 3D10A 4N1GA 1KQMB 1PVBA 2H61C 2KYCA 4NDBA 1GJYA 1JUOA 1QVIY 3WHTB 1H8BA 4I5NB 2HF5A 3EK8A 5I8NA 2M49B 1NX3A 2LAPA 2EC6C 2E30A 2FOTA 5CPVA 3SIBA 4AQJA 5KU1A 1D1OA 3NSLA 1U5IB 3CS1A 4N1FA 1F71A 2Q91A 2KNEA 4WRIA 3EKJA 1AJ4A 2G9BA 4DIRA 1ZUZA 2CBLA 2G2BA 5K89A 4JWQA 1SPYA 3DVJA 2KFHA 1OSAA 1Y6WA 1UP5A 1AJ5A 4D1EA 1KWOB 2K0JA 4OR9B 2KFFA 1QJTA 1LA0A 1B7TY 2ZKMX 1K9PA 3DF0A 3VRQA 2OTGC 3I5IC 4PHMA 3EK4A 1KFXS 1KFXL 1SCMC 1CFCA 1NSHA 1QIVA 1QATA 3FWCA 2GGZA 2BL0C 4NDDA 1NX1A 1NX2A 1B8CA 2M1UA 3O4YA 2JRFA 3D0YB 4WQ3A 1CKKA 2FCDA 4ETOA 1R2UA 2JC2A 1RK9A 2WCFA 2JWWA 1MXLC 2SCPA 1SBJA 5J3XA 4C0LA 1NIWA 1QV0A 2L98A 1EL4A 5ER4X 1S5GY 1KQMC 3SG6A 2WNDA 2B1UA 2KGBC 4BY5A 1LXFC 4N5XA 1NCZA 2LCPA 2M29A 4PE7A 1BODA 2L2EA 2M7NA 3O78A 4XJKA 1NUBA 3I5GB 1GGWA 4ICBA 3OX6A 1KK8B 3EKHA 2EHBA 1BOCA 2WORA 1XFZO 5ER5A 1JSAA 2BECA 1RECA 1RWYA 1GQMA 2K7CA 3OX5A 2TN4A 2WCEA 4I5JA 2KOTA 3M0WA 1C07A 4MVFA 4MRXA 1SL7A 4FTGA 4F0ZB 1CNPA 5AANA 4DS7A 3VRNA 1MWNA 1AUIB 1NX0A 2K8MB 1H4BA 1BR1B 1PVAA 1S1EA 2WOSA 4M2OA 1XFUO 1QX2A 1WRKA 3E3RA 4R1EA 1OOJA 1W7IB 1C7VA 1YVHA 5CSJA 1KWOC 1XK4A 1DJIA 1KSOA 2KI4B 4UPGA 4DRWA 5HLOA 1TN4A 2F2PA 2NXQA 1CM4A 1IH0A 5CSFA 1BU3A 1YR5A 2EC6B 1WLZA 1CB1A 1WRZA 3CR4X 1B8LA 3CR2A 1A4PA 5KTYA 1BF5A 1Y1AA 2H2KA 2LC5A 2PASA 3EVUA 2OS8B 3PLFB 2VRGA 3VRRA 3BUOB 2JTZA 1W7JB 1LA3A 1OMRA 4GUKA 1OQPA 4MZKA 1IKUA 3CGAA 1UUSA 2ZN8A 2JXCA 2GV5A 1S26D 5AXIA 2LLUA 2KI6D 1M39A 2LHIA 5I2LA 4PHKA 3SG5A 2M9GA 3RM1A 2FCEA 1G8IA 3BQ3A 1CFDA 2KDHA 2HQWA 3JTDB 5DKNA 4MEWA 2K7OA 3KO0A 3I5FB 5KSZA 4Q04A 3I5GC 2K7BA 1KK8C 5TNCA 4GGFC 1K8UA 4FQOA 2GGMA 2MHHA 3OHMB 5CSNA 2CTNA 2LLTA 3ZWHA 2KQ6A 1S6JA 1RJVA 3TZ1A 2LVIA 5G08A 1TCFA 2COLB 3GK4X 3WXAA 4AOMA 1HT9A 3A8RA 4NQGA 2KAVA 4NDCA 1A75B 1CLBA 4ORAB 1CLMA 2KI4C 3KHEA 1N0YA 1ALVA 2DOQA 1KCYA 4IL1A 2AAOA 1J55A 2LVKA 2Y5IA 5CSIA 2V53A 1KFUS 1KFUL 1A29A 4GGNA 4GNKB 2L5XB 2BCAA 1JFKA 2OS8C 1SRAA 3LK1A 2P6BB 2KAYA 1FW4A 4HREE 1SL8A 2HQ8A 4MSPA 3FS7A 2F2OA 2ZNDA 2LNKA 1NP8A 1YUUA 1KK7Z 2ZN9A 5I2QA 1IGVA 1SK6D 2F3YA 1YRUB 3JTDC 2NZ0A 2LVJA 4CIDA 1DGVA 3I5FC 1JF0A 2BE6A 1FI6A 3BUWB 4QJ4B 1QV1A 2LUCA 1F8HA 1NWDA 1UWOA 2BBNA 2PRUA 4OV2A 1WY9A 1JBAA 1K9UA 1K95A 2KI6C 3KF9A 1F70A 2BKIB 3LCPC 2MJWB 3BYAA 3DVEA 4ZCVA 3O2PA 1DF0B 4YI9A 1X02A 3O6BA 1G4YR 2H61A 3MSEB 5IBWA 4OCIA 1UHKA 1K94A 1IWQA 3NSOA 2EGDA 4M2PA 2JXLA 5HLVA 1TNPA 2PMYA 1BJFA 2Y1MA 5HKWA 1ZACA 4TNCA 1N65A 2I2RE 1UHHA 3K21A 2D8NA 3BOWA 4YRUA 1YX8A 1CFFA 4I5LB 2OPOA 4C0KA 3TDIA 1BG1A 1AHRA 1EG4A 1F4QA 2KBIA 2O60A 1RFJA 5JOLA 3H4SE 5BPJA 1SR6B 2HPSA 1Y1XA 4JQ0D 4MZLA 1DTLA 1B9AA 5HYDA 2BCXA 4BY4A 3OB2B 1QVIZ 1OZSA 4YBHB 3AAJA 1UHJA 1ALWA 3PN7B 2LV7A 1DJYA 1M31A 4YGBB 4CPVA 1CDMA 1J7RA 1L7ZA 4MLWA 3PSRA 1K2HA 2I94A 2PVBA 3HX4A 2KYFA 1E8AA 1UURA 2KBMA 1YRTB 4MRYA 2K2FA 1PK0D 5AFPA 1EG3A 1NYAA 3DF0B 3CR5X 4E68A 3TDUA 5JJGA 1J1DA 2F33A 3DVMA 1CTRA 1IJ6A 1ZFSA 2MLFC 3PALA 4C0JA 2NCOA 2SASA 1TTXA 1OMDA 4HSZA 1MQ1A 1F54A 1YURA 1C7WA 3TUYB 1CDNA 2I7AA 3LK0A 3GK2A 4MN0A 2LP2A 3GOFA 1KQVA 2MLEC 2LMTA 1TCOB 3SJSA 1CM1A 2KGRA 1QXPA 1M45A 1J7PA 1MXEA 1CDPA 1U5IA 2AUCA 1KK7Y 2JQ6A 2LHLA 2M1KB 4ORCB 3SG4A 1S6IA 2ISDA 2BKHB 3CZTX 1TNQA 4XJKB 2JPTA 1QIWA 2JULA 3AAKA 1MF8B 5GQQC 1SR6C 4YGDB 1LVCD 2Y1NA 3BXKA 1QS7A 2NLNA 2CNPA 1K96A 1G33A 3OB1B 2M7LA 3JVTB 3NSKA 1GGZA 1BT6A 4MBEA 1V1FA 2L4IA 4ORBB 2JZIA 3BUMB 4I5KA 2KHNA 1DMOA 2M3WA 1XYDA 3PN7C 1J1EA 2LVVA 1B8RA 4OVNF 2F8PA 4GFTA 1TNWA 2L4HA 3KPXA 1PALA 2LUXA 1M46A 4GBAA 1PRWA 2I18A 2ZNEA 1Q80A 1SL9A 4GPLB 1IG5A 3LLEA 4WQ2A 3VROA 4P5OE 2FJUB 4PE0A 3D0YA 3QRXA 1R6PA 1TOPA 3FIAA 2F3ZA 3AKBA 2BE4A 1PSBA 2L0PA 2LANA 2WCBA 1BR4B 4HRGA 1OE9B 1FI5A 3TUYC 2JNXA 1Y1UA 2R2IA 1L2OB 4CFQA 1FF1A 4PHNA 1UHNA 2PSRA 3C1VA 2MAZA 3SG7A 5B8IB 4QJ5B 1PSRA 1F55A 4P2YB 5I2OA 3WNXB 1DJZA 5AERA 1MUXA 5D7FA 4XYNA 4PDZA 4USLA 1EXRA 1LKJA 2ZRSA 2LLSA 1TRFA 5DKRA 3KEVA 1MHOA 4CLNA 2CXJA 2BBMA 1K90D 2HETA 4GGFA 2M97A 1YUTA 2JT8A 1OZOA 1ZMZA 1JFJA 1SCVA 3BUNB 2WC8A 1WDCB 4PHJA 1SW8A 1EJ3A 3RLZA 1WRLA 1SMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDZ A;  4PE1 A;  4QJ3 B;  1A03 A;  3JVT C;  1JC2 A;  1SYM A;  1NCX A;  2ZFD A;  1B1G A;  1A2X A;  4A4B A;  4JPZ B;  1RTP 1;  2KSP A;  2E6W A;  2CCM A;  3IQO A;  3IQQ A;  5D69 A;  3NXA A;  4U8D A;  1ZOT B;  4OKH A;  1XK4 C;  2RGI A;  2Y4Q A;  1YUS A;  1XA5 A;  1JF2 A;  3BUX B;  5F6T A;  1BLQ A;  1XFY O;  1NPQ A;  2K2A A;  1XFX O;  1OMV A;  4YGC B;  1XO5 A;  3CTN A;  4YI8 A;  1CFP A;  1IQ3 A;  1XVJ A;  5HKZ A;  2K7D A;  3PAT A;  2MRD A;  1KSM A;  2AMI A;  1J7Q A;  1L2O C;  2ZRT A;  1ODB A;  3SG2 A;  1YVL A;  3VGO A;  4AQI A;  1DJW A;  2KAX A;  2NCP A;  1QX5 B;  1FBV A;  3I5H B;  3FWB A;  1K9K A;  1EH2 A;  2PAL A;  5PAL A;  3A4U B;  4YGE B;  1CMF A;  2K61 A;  1M63 B;  1WDC C;  1IJ5 A;  1DJG A;  1HQV A;  3LL8 B;  3PM8 A;  1B4C A;  1YX7 A;  2L51 A;  1DVI A;  1JWD A;  3PFV A;  2CT9 A;  1B47 A;  5DKQ A;  3HCM A;  1QAS A;  2LM5 A;  1DGU A;  1A75 A;  1B7T Z;  1QX7 A;  1PUL A;  4PE4 A;  1VRK A;  2M0R A;  3TS5 B;  1J7O A;  2QPT A;  2JNF A;  1IQ5 A;  1S6C A;  4ZCU A;  1AP4 A;  1SKT A;  3CWG A;  5FYX A;  1LIN A;  1TIZ A;  3GK1 A;  1AVS A;  1QTX A;  4L9M A;  1XFV O;  3AKA A;  2JOJ A;  2Q4U A;  1YTZ C;  3BOW B;  3SIA A;  2O5G A;  1DT7 B;  4YGA A;  2MBX A;  3CLN A;  3DD4 A;  3EVV A;  1XFW O;  2JTT A;  1V1G A;  3OP0 A;  1CDL A;  4M2Q A;  1FPW A;  3SG3 A;  3IF7 A;  2MA2 A;  2QAC A;  1CLL A;  1S5G Z;  2LMU A;  2A4J A;  5AEQ A;  1QLS A;  2LMV A;  2BCB A;  1SNL A;  1WLM A;  1CMG A;  1S3P A;  2M8U A;  1NCY A;  3EK7 A;  4A4C A;  3ZNI A;  3I5H C;  4HRH A;  3VRP A;  3EVR A;  4GAO A;  2KQY A;  3F45 A;  2OTG B;  3DVK A;  1S36 A;  3I5I B;  3WHU B;  4DUQ A;  2LP3 A;  3NSI A;  1Y0V H;  4DCK A;  1TNX A;  2LE9 B;  4PAL A;  2JT3 A;  1SCM B;  1QLK A;  1SY9 A;  1DF0 A;  1UHI A;  5HKY A;  1AK8 A;  4MZJ A;  4PCW A;  2BL0 B;  1DJH A;  4CFR A;  1N2D A;  1DJX A;  3ICB A;  1IRJ A;  1K93 D;  2JT0 A;  1RRO A;  2L50 A;  1MR8 A;  2JU0 A;  2IS9 A;  1F4O A;  2KFG A;  3TS5 C;  1BMO A;  3D10 A;  4N1G A;  1KQM B;  1PVB A;  2H61 C;  2KYC A;  4NDB A;  1GJY A;  1JUO A;  1QVI Y;  3WHT B;  1H8B A;  4I5N B;  2HF5 A;  3EK8 A;  5I8N A;  2M49 B;  1NX3 A;  2LAP A;  2EC6 C;  2E30 A;  2FOT A;  5CPV A;  3SIB A;  4AQJ A;  5KU1 A;  1D1O A;  3NSL A;  1U5I B;  3CS1 A;  4N1F A;  1F71 A;  2Q91 A;  2KNE A;  4WRI A;  3EKJ A;  1AJ4 A;  2G9B A;  4DIR A;  1ZUZ A;  2CBL A;  2G2B A;  5K89 A;  4JWQ A;  1SPY A;  3DVJ A;  2KFH A;  1OSA A;  1Y6W A;  1UP5 A;  1AJ5 A;  4D1E A;  1KWO B;  2K0J A;  4OR9 B;  2KFF A;  1QJT A;  1LA0 A;  1B7T Y;  2ZKM X;  1K9P A;  3DF0 A;  3VRQ A;  2OTG C;  3I5I C;  4PHM A;  3EK4 A;  1KFX S;  1KFX L;  1SCM C;  1CFC A;  1NSH A;  1QIV A;  1QAT A;  3FWC A;  2GGZ A;  2BL0 C;  4NDD A;  1NX1 A;  1NX2 A;  1B8C A;  2M1U A;  3O4Y A;  2JRF A;  3D0Y B;  4WQ3 A;  1CKK A;  2FCD A;  4ETO A;  1R2U A;  2JC2 A;  1RK9 A;  2WCF A;  2JWW A;  1MXL C;  2SCP A;  1SBJ A;  5J3X A;  4C0L A;  1NIW A;  1QV0 A;  2L98 A;  1EL4 A;  5ER4 X;  1S5G Y;  1KQM C;  3SG6 A;  2WND A;  2B1U A;  2KGB C;  4BY5 A;  1LXF C;  4N5X A;  1NCZ A;  2LCP A;  2M29 A;  4PE7 A;  1BOD A;  2L2E A;  2M7N A;  3O78 A;  4XJK A;  1NUB A;  3I5G B;  1GGW A;  4ICB A;  3OX6 A;  1KK8 B;  3EKH A;  2EHB A;  1BOC A;  2WOR A;  1XFZ O;  5ER5 A;  1JSA A;  2BEC A;  1REC A;  1RWY A;  1GQM A;  2K7C A;  3OX5 A;  2TN4 A;  2WCE A;  4I5J A;  2KOT A;  3M0W A;  1C07 A;  4MVF A;  4MRX A;  1SL7 A;  4FTG A;  4F0Z B;  1CNP A;  5AAN A;  4DS7 A;  3VRN A;  1MWN A;  1AUI B;  1NX0 A;  2K8M B;  1H4B A;  1BR1 B;  1PVA A;  1S1E A;  2WOS A;  4M2O A;  1XFU O;  1QX2 A;  1WRK A;  3E3R A;  4R1E A;  1OOJ A;  1W7I B;  1C7V A;  1YVH A;  5CSJ A;  1KWO C;  1XK4 A;  1DJI A;  1KSO A;  2KI4 B;  4UPG A;  4DRW A;  5HLO A;  1TN4 A;  2F2P A;  2NXQ A;  1CM4 A;  1IH0 A;  5CSF A;  1BU3 A;  1YR5 A;  2EC6 B;  1WLZ A;  1CB1 A;  1WRZ A;  3CR4 X;  1B8L A;  3CR2 A;  1A4P A;  5KTY A;  1BF5 A;  1Y1A A;  2H2K A;  2LC5 A;  2PAS A;  3EVU A;  2OS8 B;  3PLF B;  2VRG A;  3VRR A;  3BUO B;  2JTZ A;  1W7J B;  1LA3 A;  1OMR A;  4GUK A;  1OQP A;  4MZK A;  1IKU A;  3CGA A;  1UUS A;  2ZN8 A;  2JXC A;  2GV5 A;  1S26 D;  5AXI A;  2LLU A;  2KI6 D;  1M39 A;  2LHI A;  5I2L A;  4PHK A;  3SG5 A;  2M9G A;  3RM1 A;  2FCE A;  1G8I A;  3BQ3 A;  1CFD A;  2KDH A;  2HQW A;  3JTD B;  5DKN A;  4MEW A;  2K7O A;  3KO0 A;  3I5F B;  5KSZ A;  4Q04 A;  3I5G C;  2K7B A;  1KK8 C;  5TNC A;  4GGF C;  1K8U A;  4FQO A;  2GGM A;  2MHH A;  3OHM B;  5CSN A;  2CTN A;  2LLT A;  3ZWH A;  2KQ6 A;  1S6J A;  1RJV A;  3TZ1 A;  2LVI A;  5G08 A;  1TCF A;  2COL B;  3GK4 X;  3WXA A;  4AOM A;  1HT9 A;  3A8R A;  4NQG A;  2KAV A;  4NDC A;  1A75 B;  1CLB A;  4ORA B;  1CLM A;  2KI4 C;  3KHE A;  1N0Y A;  1ALV A;  2DOQ A;  1KCY A;  4IL1 A;  2AAO A;  1J55 A;  2LVK A;  2Y5I A;  5CSI A;  2V53 A;  1KFU S;  1KFU L;  1A29 A;  4GGN A;  4GNK B;  2L5X B;  2BCA A;  1JFK A;  2OS8 C;  1SRA A;  3LK1 A;  2P6B B;  2KAY A;  1FW4 A;  4HRE E;  1SL8 A;  2HQ8 A;  4MSP A;  3FS7 A;  2F2O A;  2ZND A;  2LNK A;  1NP8 A;  1YUU A;  1KK7 Z;  2ZN9 A;  5I2Q A;  1IGV A;  1SK6 D;  2F3Y A;  1YRU B;  3JTD C;  2NZ0 A;  2LVJ A;  4CID A;  1DGV A;  3I5F C;  1JF0 A;  2BE6 A;  1FI6 A;  3BUW B;  4QJ4 B;  1QV1 A;  2LUC A;  1F8H A;  1NWD A;  1UWO A;  2BBN A;  2PRU A;  4OV2 A;  1WY9 A;  1JBA A;  1K9U A;  1K95 A;  2KI6 C;  3KF9 A;  1F70 A;  2BKI B;  3LCP C;  2MJW B;  3BYA A;  3DVE A;  4ZCV A;  3O2P A;  1DF0 B;  4YI9 A;  1X02 A;  3O6B A;  1G4Y R;  2H61 A;  3MSE B;  5IBW A;  4OCI A;  1UHK A;  1K94 A;  1IWQ A;  3NSO A;  2EGD A;  4M2P A;  2JXL A;  5HLV A;  1TNP A;  2PMY A;  1BJF A;  2Y1M A;  5HKW A;  1ZAC A;  4TNC A;  1N65 A;  2I2R E;  1UHH A;  3K21 A;  2D8N A;  3BOW A;  4YRU A;  1YX8 A;  1CFF A;  4I5L B;  2OPO A;  4C0K A;  3TDI A;  1BG1 A;  1AHR A;  1EG4 A;  1F4Q A;  2KBI A;  2O60 A;  1RFJ A;  5JOL A;  3H4S E;  5BPJ A;  1SR6 B;  2HPS A;  1Y1X A;  4JQ0 D;  4MZL A;  1DTL A;  1B9A A;  5HYD A;  2BCX A;  4BY4 A;  3OB2 B;  1QVI Z;  1OZS A;  4YBH B;  3AAJ A;  1UHJ A;  1ALW A;  3PN7 B;  2LV7 A;  1DJY A;  1M31 A;  4YGB B;  4CPV A;  1CDM A;  1J7R A;  1L7Z A;  4MLW A;  3PSR A;  1K2H A;  2I94 A;  2PVB A;  3HX4 A;  2KYF A;  1E8A A;  1UUR A;  2KBM A;  1YRT B;  4MRY A;  2K2F A;  1PK0 D;  5AFP A;  1EG3 A;  1NYA A;  3DF0 B;  3CR5 X;  4E68 A;  3TDU A;  5JJG A;  1J1D A;  2F33 A;  3DVM A;  1CTR A;  1IJ6 A;  1ZFS A;  2MLF C;  3PAL A;  4C0J A;  2NCO A;  2SAS A;  1TTX A;  1OMD A;  4HSZ A;  1MQ1 A;  1F54 A;  1YUR A;  1C7W A;  3TUY B;  1CDN A;  2I7A A;  3LK0 A;  3GK2 A;  4MN0 A;  2LP2 A;  3GOF A;  1KQV A;  2MLE C;  2LMT A;  1TCO B;  3SJS A;  1CM1 A;  2KGR A;  1QXP A;  1M45 A;  1J7P A;  1MXE A;  1CDP A;  1U5I A;  2AUC A;  1KK7 Y;  2JQ6 A;  2LHL A;  2M1K B;  4ORC B;  3SG4 A;  1S6I A;  2ISD A;  2BKH B;  3CZT X;  1TNQ A;  4XJK B;  2JPT A;  1QIW A;  2JUL A;  3AAK A;  1MF8 B;  5GQQ C;  1SR6 C;  4YGD B;  1LVC D;  2Y1N A;  3BXK A;  1QS7 A;  2NLN A;  2CNP A;  1K96 A;  1G33 A;  3OB1 B;  2M7L A;  3JVT B;  3NSK A;  1GGZ A;  1BT6 A;  4MBE A;  1V1F A;  2L4I A;  4ORB B;  2JZI A;  3BUM B;  4I5K A;  2KHN A;  1DMO A;  2M3W A;  1XYD A;  3PN7 C;  1J1E A;  2LVV A;  1B8R A;  4OVN F;  2F8P A;  4GFT A;  1TNW A;  2L4H A;  3KPX A;  1PAL A;  2LUX A;  1M46 A;  4GBA A;  1PRW A;  2I18 A;  2ZNE A;  1Q80 A;  1SL9 A;  4GPL B;  1IG5 A;  3LLE A;  4WQ2 A;  3VRO A;  4P5O E;  2FJU B;  4PE0 A;  3D0Y A;  3QRX A;  1R6P A;  1TOP A;  3FIA A;  2F3Z A;  3AKB A;  2BE4 A;  1PSB A;  2L0P A;  2LAN A;  2WCB A;  1BR4 B;  4HRG A;  1OE9 B;  1FI5 A;  3TUY C;  2JNX A;  1Y1U A;  2R2I A;  1L2O B;  4CFQ A;  1FF1 A;  4PHN A;  1UHN A;  2PSR A;  3C1V A;  2MAZ A;  3SG7 A;  5B8I B;  4QJ5 B;  1PSR A;  1F55 A;  4P2Y B;  5I2O A;  3WNX B;  1DJZ A;  5AER A;  1MUX A;  5D7F A;  4XYN A;  4PDZ A;  4USL A;  1EXR A;  1LKJ A;  2ZRS A;  2LLS A;  1TRF A;  5DKR A;  3KEV A;  1MHO A;  4CLN A;  2CXJ A;  2BBM A;  1K90 D;  2HET A;  4GGF A;  2M97 A;  1YUT A;  2JT8 A;  1OZO A;  1ZMZ A;  1JFJ A;  1SCV A;  3BUN B;  2WC8 A;  1WDC B;  4PHJ A;  1SW8 A;  1EJ3 A;  3RLZ A;  1WRL A;  1SMG A; 
#chains in the Genus database with same CATH topology
 3TDZ A;  4PE1 A;  4QJ3 B;  1A03 A;  3JVT C;  1JC2 A;  1SYM A;  1NCX A;  2ZFD A;  1B1G A;  1A2X A;  4A4B A;  4JPZ B;  1RTP 1;  2KSP A;  2E6W A;  2CCM A;  3IQO A;  5I94 A;  1DC1 A;  3IQQ A;  5D69 A;  3NXA A;  3PJI A;  1ZOT B;  4U8D A;  3CYZ A;  4OKH A;  1XK4 C;  2RGI A;  2Y4Q A;  1YUS A;  1XA5 A;  1JF2 A;  3BUX B;  3D77 A;  5F6T A;  1BLQ A;  1XFY O;  3V2L A;  1NPQ A;  2K2A A;  1XFX O;  1OMV A;  4YGC B;  1XO5 A;  3CTN A;  4YI8 A;  1CFP A;  1IQ3 A;  1XVJ A;  5HKZ A;  2K7D A;  3PAT A;  2MRD A;  1KSM A;  2AMI A;  1J7Q A;  1L2O C;  2ZRT A;  3DYE A;  1ODB A;  3SG2 A;  1YVL A;  3VGO A;  4AQI A;  1DJW A;  2KAX A;  2NCP A;  1QX5 B;  1FBV A;  3I5H B;  3FWB A;  1K9K A;  1EH2 A;  2PAL A;  2K60 A;  5PAL A;  3A4U B;  4YGE B;  1CMF A;  2K61 A;  1M63 B;  1WDC C;  1IJ5 A;  1DJG A;  3BFB A;  1HQV A;  3LL8 B;  3PM8 A;  1B4C A;  1YX7 A;  2L51 A;  1DVI A;  1JWD A;  3PFV A;  2CT9 A;  1B47 A;  5DKQ A;  3HCM A;  1QAS A;  2LM5 A;  1DGU A;  1A75 A;  1B7T Z;  1QX7 A;  1PUL A;  4PE4 A;  1VRK A;  2M0R A;  3TS5 B;  1J7O A;  2QPT A;  2JNF A;  5EL2 A;  1IQ5 A;  1S6C A;  4ZCU A;  3N7H A;  1SKT A;  3CWG A;  5FYX A;  1AP4 A;  1LIN A;  1TIZ A;  3GK1 A;  3RZS A;  1AVS A;  2QEV A;  1QTX A;  4L9M A;  1XFV O;  2KPH A;  3AKA A;  2JOJ A;  2Q4U A;  1YTZ C;  3BOW B;  3SIA A;  2O5G A;  1DT7 B;  4YGA A;  2MBX A;  3CLN A;  3DD4 A;  3EVV A;  1XFW O;  2JTT A;  1V1G A;  3OP0 A;  2H8V A;  1CDL A;  1DEL A;  4M2Q A;  2QEO A;  1FPW A;  3SG3 A;  2YGU A;  3IF7 A;  3S0G A;  2MA2 A;  2QAC A;  1CLL A;  1S5G Z;  2LMU A;  2A4J A;  5AEQ A;  1QLS A;  2BAP A;  3DY9 A;  3R1V A;  2LMV A;  2BCB A;  1SNL A;  1WLM A;  1CMG A;  1S3P A;  2M8U A;  1NCY A;  3EK7 A;  3R1P A;  3R72 A;  3S0B A;  4A4C A;  3ZNI A;  3I5H C;  4HRH A;  3VRP A;  3EVR A;  4GAO A;  2KQY A;  3F45 A;  2OTG B;  3DVK A;  1S36 A;  3I5I B;  3B88 A;  3WHU B;  4DUQ A;  2LP3 A;  3NSI A;  1Y0V H;  4DCK A;  1TNX A;  2LE9 B;  1W9Z A;  2JT3 A;  1SCM B;  1QLK A;  4PAL A;  1SY9 A;  1DF0 A;  1UHI A;  5HKY A;  1AK8 A;  4MZJ A;  4PCW A;  2BL0 B;  1DJH A;  4CFR A;  3IVT A;  1N2D A;  1DJX A;  3ICB A;  1IRJ A;  1DEK A;  1K93 D;  2JT0 A;  2WCL A;  1RRO A;  2L50 A;  1MR8 A;  2JU0 A;  2WC6 A;  2IS9 A;  4IJ7 A;  1F4O A;  2KFG A;  3CAB A;  3L4A A;  1BMO A;  3D10 A;  4N1G A;  3TS5 C;  1KQM B;  1PVB A;  2H61 C;  2KYC A;  4NDB A;  1GJY A;  1JUO A;  1QVI Y;  3WHT B;  5HL1 A;  1H8B A;  4I5N B;  2HF5 A;  1ORG A;  3EK8 A;  5I8N A;  2M49 B;  3L4L A;  1NX3 A;  1Z4H A;  2LAP A;  2EC6 C;  2E30 A;  2FOT A;  5CPV A;  3SIB A;  4AQJ A;  5KU1 A;  1D1O A;  3NSL A;  1U5I B;  3CS1 A;  4N1F A;  5FI7 A;  3NGV A;  1F71 A;  2Q91 A;  2QEB A;  2KNE A;  4WRI A;  3EKJ A;  1AJ4 A;  3EG5 B;  2P71 A;  2G9B A;  3FE9 A;  4DIR A;  1ZUZ A;  2CBL A;  2G2B A;  2JPO A;  1OW4 A;  4JWQ A;  5K89 A;  3S0A A;  1SPY A;  1T14 A;  3DVJ A;  2KFH A;  2KLE A;  1OSA A;  1Y6W A;  1UP5 A;  1AJ5 A;  4D1E A;  2QEH A;  3BJH A;  1KWO B;  2K0J A;  4OR9 B;  2KFF A;  1QJT A;  1LA0 A;  1B7T Y;  2ZKM X;  3B6X A;  1K9P A;  3PM2 A;  3DF0 A;  3VRQ A;  2OTG C;  3I5I C;  3DXL A;  4PHM A;  3SS4 A;  3EK4 A;  1KFX S;  1KFX L;  3D75 A;  1P28 A;  1SCM C;  1CFC A;  3CZ0 A;  1NSH A;  3S0D A;  1QIV A;  1QAT A;  3FWC A;  2GGZ A;  1C3Z A;  2BL0 C;  4NDD A;  1NX1 A;  1NX2 A;  1B8C A;  2M1U A;  3O4Y A;  2JRF A;  3D0Y B;  4WQ3 A;  1CKK A;  2FCD A;  4ETO A;  1R2U A;  3S0E A;  2JC2 A;  1GM0 A;  1RK9 A;  2WCF A;  2JWW A;  1MXL C;  2SCP A;  1SBJ A;  5J3X A;  4C0L A;  1NIW A;  1QV0 A;  2L98 A;  1EL4 A;  5ER4 X;  1S5G Y;  1KQM C;  3SG6 A;  2WND A;  2B1U A;  2KGB C;  4BY5 A;  1LXF C;  4N5X A;  1NCZ A;  2LCP A;  2M29 A;  3BFA A;  4PE7 A;  2L2E A;  1BOD A;  2M7N A;  3O78 A;  4XJK A;  1NUB A;  3I5G B;  1GGW A;  4ICB A;  3OX6 A;  1KK8 B;  3EKH A;  1C3Y A;  3FE8 A;  2EHB A;  1BOC A;  2WOR A;  1XFZ O;  5ER5 A;  1JSA A;  2BEC A;  1REC A;  1RWY A;  1GQM A;  2K7C A;  3OX5 A;  2TN4 A;  2WCE A;  4I5J A;  2KOT A;  3M0W A;  1C07 A;  4MVF A;  3UNW A;  4MRX A;  1SL7 A;  4FTG A;  4F0Z B;  1CNP A;  5AAN A;  4INW A;  4DS7 A;  3VRN A;  1MWN A;  1AUI B;  1NX0 A;  2K8M B;  1H4B A;  4OZD A;  1BR1 B;  1PVA A;  1S1E A;  2WOS A;  4M2O A;  1XFU O;  1QX2 A;  1WRK A;  3E3R A;  4R1E A;  1OOJ A;  1W7I B;  2PQL A;  1C7V A;  1YVH A;  3CZ1 A;  5CSJ A;  1KWO C;  1XK4 A;  1DJI A;  1KSO A;  2KI4 B;  4UPG A;  4PT1 A;  4DRW A;  5FI6 A;  2BNX A;  5HLO A;  1TN4 A;  2F2P A;  2NXQ A;  1CM4 A;  4KYN A;  1IH0 A;  5CSF A;  1BU3 A;  1YR5 A;  2EC6 B;  1WLZ A;  1CB1 A;  1WRZ A;  3CR4 X;  3DZT A;  1B8L A;  3CR2 A;  1A4P A;  1TUJ A;  5KTY A;  1BF5 A;  1Y1A A;  2H2K A;  2LC5 A;  2PAS A;  3EVU A;  2OS8 B;  3PLF B;  2VRG A;  3VRR A;  3BUO B;  2JTZ A;  1W7J B;  1LA3 A;  1OMR A;  3BFH A;  1OQP A;  4GUK A;  4MZK A;  1IKU A;  3CGA A;  1UUS A;  2ZN8 A;  2JXC A;  2GV5 A;  1S26 D;  5AXI A;  2LLU A;  2KI6 D;  1M39 A;  2LHI A;  5I2L A;  4PHK A;  3SG5 A;  1TWO A;  2M9G A;  3RM1 A;  2FCE A;  1G8I A;  3BQ3 A;  1CFD A;  2KDH A;  2HQW A;  3JTD B;  5DKN A;  4MEW A;  2K7O A;  3KO0 A;  3I5F B;  5KSZ A;  4Q04 A;  3I5G C;  2K7B A;  1KK8 C;  2QDI A;  5D3O A;  5TNC A;  4GGF C;  1K8U A;  4FQO A;  2GGM A;  2MHH A;  3OHM B;  5CSN A;  2CTN A;  2LLT A;  3ZWH A;  2KQ6 A;  1S6J A;  3OGN A;  1RJV A;  3TZ1 A;  2LVI A;  5G08 A;  1TCF A;  2COL B;  3GK4 X;  3WXA A;  4AOM A;  1HT9 A;  3A8R A;  4NQG A;  2KAV A;  4NDC A;  1A75 B;  1CLB A;  3CZ2 A;  4ORA B;  1CLM A;  2KI4 C;  3KHE A;  1N0Y A;  1ALV A;  2DOQ A;  1KCY A;  4IL1 A;  1OOF A;  2AAO A;  1J55 A;  2LVK A;  2L5Y A;  2Y5I A;  5CSI A;  2V53 A;  1KFU S;  1KFU L;  2GTE A;  1A29 A;  4GGN A;  4GNK B;  2L5X B;  2BCA A;  1JFK A;  2WCJ A;  2OS8 C;  1SRA A;  3LK1 A;  2P6B B;  2P70 A;  2KAY A;  1FW4 A;  4HRE E;  1SL8 A;  2HQ8 A;  4MSP A;  3FS7 A;  2F2O A;  2ZND A;  2LNK A;  1NP8 A;  1YUU A;  1KK7 Z;  2ZN9 A;  5I2Q A;  1IGV A;  1SK6 D;  2F3Y A;  1YRU B;  2WCH A;  3JTD C;  4F7F A;  2NZ0 A;  2LVJ A;  2WCK A;  2ERB A;  4CID A;  1DGV A;  3I5F C;  2WC5 A;  1JF0 A;  2BE6 A;  1FI6 A;  3BUW B;  4QJ4 B;  1QV1 A;  2LUC A;  1F8H A;  1NWD A;  1UWO A;  2BBN A;  2PRU A;  1DQE A;  4OV2 A;  1WY9 A;  1JBA A;  1K9U A;  1K95 A;  2KI6 C;  3KF9 A;  1F70 A;  2BKI B;  3LCP C;  2MJW B;  3BYA A;  3DVE A;  4ZCV A;  3O2P A;  1DF0 B;  4YI9 A;  1X02 A;  3O6B A;  1G4Y R;  2H61 A;  3MSE B;  5IBW A;  2L2C A;  5FI2 A;  4OCI A;  1UHK A;  1K94 A;  1IWQ A;  1SSE B;  3NSO A;  4INX A;  2EGD A;  4M2P A;  2JXL A;  5HLV A;  1TNP A;  2PMY A;  1BJF A;  2Y1M A;  5HKW A;  1ZAC A;  4TNC A;  1N65 A;  2I2R E;  1UHH A;  3K21 A;  2D8N A;  2WCM A;  3BOW A;  1YX8 A;  4YRU A;  1CFF A;  4I5L B;  2OPO A;  4C0K A;  3TDI A;  1BG1 A;  1AHR A;  1EG4 A;  1F4Q A;  2KBI A;  2O60 A;  1RFJ A;  5JOL A;  3H4S E;  5BPJ A;  1SR6 B;  3SS5 A;  2HPS A;  1Y1X A;  4JQ0 D;  4MZL A;  1DTL A;  1B9A A;  5HYD A;  2BCX A;  4BY4 A;  1OOG A;  1QVI Z;  3OB2 B;  1OZS A;  4YBH B;  3AAJ A;  1UHJ A;  1ALW A;  3PN7 B;  2LV7 A;  1DJY A;  1M31 A;  4YGB B;  4CPV A;  2FJY A;  1CDM A;  1J7R A;  1L7Z A;  4MLW A;  3PSR A;  4FQT A;  1K2H A;  2I94 A;  2PVB A;  3HX4 A;  1TUZ A;  2KYF A;  1E8A A;  1UUR A;  2KBM A;  3NHI A;  1YRT B;  4MRY A;  2K2F A;  1PK0 D;  1LS8 A;  1EG3 A;  5AFP A;  3B7A A;  1NYA A;  3DF0 B;  3CR5 X;  4E68 A;  3TDU A;  5JJG A;  1J1D A;  2F33 A;  3DVM A;  1CTR A;  1IJ6 A;  1ZFS A;  2MLF C;  3D74 A;  3PAL A;  2NCO A;  1Z2C B;  2SAS A;  3CDN A;  4C0J A;  1TTX A;  1OMD A;  4HSZ A;  1MQ1 A;  1F54 A;  1YUR A;  1C7W A;  3TUY B;  1CDN A;  2I7A A;  3LK0 A;  3GK2 A;  3SS3 A;  3D78 A;  4MN0 A;  2LP2 A;  3GOF A;  3D76 A;  3OBV A;  2MLE C;  1KQV A;  2LMT A;  1TCO B;  3SJS A;  3Q8I A;  1CM1 A;  1OOI X;  2KGR A;  1QXP A;  1M45 A;  1J7P A;  1MXE A;  1CDP A;  1U5I A;  2AUC A;  1KK7 Y;  2JQ6 A;  2LHL A;  2M1K B;  4JD9 A;  4ORC B;  3SG4 A;  5DIC A;  1S6I A;  2ISD A;  2BKH B;  3CZT X;  1TNQ A;  4XJK B;  2JPT A;  1QIW A;  2JUL A;  3AAK A;  1MF8 B;  3O4X A;  5GQQ C;  1IIO A;  1SR6 C;  4YGD B;  1LVC D;  2Y1N A;  3BXK A;  1QS7 A;  2NLN A;  2CNP A;  1K96 A;  1G33 A;  3K1E A;  3OB1 B;  3VB1 A;  2M7L A;  3JVT B;  3NSK A;  1GGZ A;  1BT6 A;  4MBE A;  1V1F A;  2L4I A;  4ORB B;  2JZI A;  3BUM B;  4I5K A;  2KHN A;  1DMO A;  2M3W A;  3FE6 A;  1XYD A;  3PN7 C;  1J1E A;  2LVV A;  1B8R A;  4OVN F;  2F8P A;  4GFT A;  1TNW A;  2L4H A;  3KPX A;  1PAL A;  1QWV A;  1M46 A;  2LUX A;  4GBA A;  4JKT A;  1PRW A;  2I18 A;  2ZNE A;  3NHT A;  3R1O A;  1Q80 A;  1SL9 A;  4GPL B;  1IG5 A;  3LLE A;  4WQ2 A;  3VRO A;  4P5O E;  2FJU B;  4PE0 A;  3D0Y A;  3QRX A;  1R6P A;  1TOP A;  3FIA A;  2F3Z A;  3AKB A;  2BE4 A;  1PSB A;  2L0P A;  2LAN A;  2WCB A;  3L47 A;  1BR4 B;  4HRG A;  1OE9 B;  1FI5 A;  3TUY C;  2JNX A;  1Y1U A;  2R2I A;  1L2O B;  4CFQ A;  3UO9 A;  4PHN A;  1FF1 A;  1UHN A;  2PSR A;  3C1V A;  2MAZ A;  3SG7 A;  5B8I B;  4QJ5 B;  1XFR A;  1PSR A;  1F55 A;  4P2Y B;  5I2O A;  3WNX B;  1DJZ A;  5AER A;  1MUX A;  5D7F A;  4XYN A;  4PDZ A;  4USL A;  1EXR A;  1LKJ A;  1OOH A;  2ZRS A;  2LLS A;  3B87 A;  1TRF A;  5DKR A;  3KEV A;  1MHO A;  4CLN A;  2CXJ A;  2BBM A;  1K90 D;  3B86 A;  2HET A;  4GGF A;  3S0F A;  2M97 A;  1YUT A;  3D73 A;  2JT8 A;  1OZO A;  1ZMZ A;  1JFJ A;  1SCV A;  3BUN B;  2WC8 A;  1WDC B;  2PYQ A;  4PHJ A;  3QME A;  1SW8 A;  1EJ3 A;  2KLD A;  3RLZ A;  1WRL A;  1SMG A; 
#chains in the Genus database with same CATH homology
 3TDZ A;  4PE1 A;  4QJ3 B;  1A03 A;  3JVT C;  1JC2 A;  1SYM A;  1NCX A;  2ZFD A;  1B1G A;  1A2X A;  4A4B A;  4JPZ B;  1RTP 1;  2KSP A;  2E6W A;  2CCM A;  3IQO A;  3IQQ A;  5D69 A;  3NXA A;  4U8D A;  1ZOT B;  4OKH A;  1XK4 C;  2RGI A;  2Y4Q A;  1YUS A;  1XA5 A;  1JF2 A;  3BUX B;  5F6T A;  1BLQ A;  1XFY O;  1NPQ A;  2K2A A;  1XFX O;  1OMV A;  4YGC B;  1XO5 A;  3CTN A;  4YI8 A;  1CFP A;  1IQ3 A;  1XVJ A;  5HKZ A;  2K7D A;  3PAT A;  2MRD A;  1KSM A;  2AMI A;  1J7Q A;  1L2O C;  2ZRT A;  1ODB A;  3SG2 A;  1YVL A;  3VGO A;  4AQI A;  1DJW A;  2KAX A;  2NCP A;  1QX5 B;  1FBV A;  3I5H B;  3FWB A;  1K9K A;  1EH2 A;  2PAL A;  5PAL A;  3A4U B;  4YGE B;  1CMF A;  2K61 A;  1M63 B;  1WDC C;  1IJ5 A;  1DJG A;  1HQV A;  3LL8 B;  3PM8 A;  1B4C A;  1YX7 A;  2L51 A;  1DVI A;  1JWD A;  3PFV A;  2CT9 A;  1B47 A;  5DKQ A;  3HCM A;  1QAS A;  2LM5 A;  1DGU A;  1A75 A;  1B7T Z;  1QX7 A;  1PUL A;  4PE4 A;  1VRK A;  2M0R A;  3TS5 B;  1J7O A;  2QPT A;  2JNF A;  1IQ5 A;  1S6C A;  4ZCU A;  1AP4 A;  1SKT A;  3CWG A;  5FYX A;  1LIN A;  1TIZ A;  3GK1 A;  1AVS A;  1QTX A;  4L9M A;  1XFV O;  3AKA A;  2JOJ A;  2Q4U A;  1YTZ C;  3BOW B;  3SIA A;  2O5G A;  1DT7 B;  4YGA A;  2MBX A;  3CLN A;  3DD4 A;  3EVV A;  1XFW O;  2JTT A;  1V1G A;  3OP0 A;  1CDL A;  4M2Q A;  1FPW A;  3SG3 A;  3IF7 A;  2MA2 A;  2QAC A;  1CLL A;  1S5G Z;  2LMU A;  2A4J A;  5AEQ A;  1QLS A;  2LMV A;  2BCB A;  1SNL A;  1WLM A;  1CMG A;  1S3P A;  2M8U A;  1NCY A;  3EK7 A;  4A4C A;  3ZNI A;  3I5H C;  4HRH A;  3VRP A;  3EVR A;  4GAO A;  2KQY A;  3F45 A;  2OTG B;  3DVK A;  1S36 A;  3I5I B;  3WHU B;  4DUQ A;  2LP3 A;  3NSI A;  1Y0V H;  4DCK A;  1TNX A;  2LE9 B;  4PAL A;  2JT3 A;  1SCM B;  1QLK A;  1SY9 A;  1DF0 A;  1UHI A;  5HKY A;  1AK8 A;  4MZJ A;  4PCW A;  2BL0 B;  1DJH A;  4CFR A;  1N2D A;  1DJX A;  3ICB A;  1IRJ A;  1K93 D;  2JT0 A;  1RRO A;  2L50 A;  1MR8 A;  2JU0 A;  2IS9 A;  1F4O A;  2KFG A;  3TS5 C;  1BMO A;  3D10 A;  4N1G A;  1KQM B;  1PVB A;  2H61 C;  2KYC A;  4NDB A;  1GJY A;  1JUO A;  1QVI Y;  3WHT B;  1H8B A;  4I5N B;  2HF5 A;  3EK8 A;  5I8N A;  2M49 B;  1NX3 A;  2LAP A;  2EC6 C;  2E30 A;  2FOT A;  5CPV A;  3SIB A;  4AQJ A;  5KU1 A;  1D1O A;  3NSL A;  1U5I B;  3CS1 A;  4N1F A;  1F71 A;  2Q91 A;  2KNE A;  4WRI A;  3EKJ A;  1AJ4 A;  2G9B A;  4DIR A;  1ZUZ A;  2CBL A;  2G2B A;  5K89 A;  4JWQ A;  1SPY A;  3DVJ A;  2KFH A;  1OSA A;  1Y6W A;  1UP5 A;  1AJ5 A;  4D1E A;  1KWO B;  2K0J A;  4OR9 B;  2KFF A;  1QJT A;  1LA0 A;  1B7T Y;  2ZKM X;  1K9P A;  3DF0 A;  3VRQ A;  2OTG C;  3I5I C;  4PHM A;  3EK4 A;  1KFX S;  1KFX L;  1SCM C;  1CFC A;  1NSH A;  1QIV A;  1QAT A;  3FWC A;  2GGZ A;  2BL0 C;  4NDD A;  1NX1 A;  1NX2 A;  1B8C A;  2M1U A;  3O4Y A;  2JRF A;  3D0Y B;  4WQ3 A;  1CKK A;  2FCD A;  4ETO A;  1R2U A;  2JC2 A;  1RK9 A;  2WCF A;  2JWW A;  1MXL C;  2SCP A;  1SBJ A;  5J3X A;  4C0L A;  1NIW A;  1QV0 A;  2L98 A;  1EL4 A;  5ER4 X;  1S5G Y;  1KQM C;  3SG6 A;  2WND A;  2B1U A;  2KGB C;  4BY5 A;  1LXF C;  4N5X A;  1NCZ A;  2LCP A;  2M29 A;  4PE7 A;  1BOD A;  2L2E A;  2M7N A;  3O78 A;  4XJK A;  1NUB A;  3I5G B;  1GGW A;  4ICB A;  3OX6 A;  1KK8 B;  3EKH A;  2EHB A;  1BOC A;  2WOR A;  1XFZ O;  5ER5 A;  1JSA A;  2BEC A;  1REC A;  1RWY A;  1GQM A;  2K7C A;  3OX5 A;  2TN4 A;  2WCE A;  4I5J A;  2KOT A;  3M0W A;  1C07 A;  4MVF A;  4MRX A;  1SL7 A;  4FTG A;  4F0Z B;  1CNP A;  5AAN A;  4DS7 A;  3VRN A;  1MWN A;  1AUI B;  1NX0 A;  2K8M B;  1H4B A;  1BR1 B;  1PVA A;  1S1E A;  2WOS A;  4M2O A;  1XFU O;  1QX2 A;  1WRK A;  3E3R A;  4R1E A;  1OOJ A;  1W7I B;  1C7V A;  1YVH A;  5CSJ A;  1KWO C;  1XK4 A;  1DJI A;  1KSO A;  2KI4 B;  4UPG A;  4DRW A;  5HLO A;  1TN4 A;  2F2P A;  2NXQ A;  1CM4 A;  1IH0 A;  5CSF A;  1BU3 A;  1YR5 A;  2EC6 B;  1WLZ A;  1CB1 A;  1WRZ A;  3CR4 X;  1B8L A;  3CR2 A;  1A4P A;  5KTY A;  1BF5 A;  1Y1A A;  2H2K A;  2LC5 A;  2PAS A;  3EVU A;  2OS8 B;  3PLF B;  2VRG A;  3VRR A;  3BUO B;  2JTZ A;  1W7J B;  1LA3 A;  1OMR A;  4GUK A;  1OQP A;  4MZK A;  1IKU A;  3CGA A;  1UUS A;  2ZN8 A;  2JXC A;  2GV5 A;  1S26 D;  5AXI A;  2LLU A;  2KI6 D;  1M39 A;  2LHI A;  5I2L A;  4PHK A;  3SG5 A;  2M9G A;  3RM1 A;  2FCE A;  1G8I A;  3BQ3 A;  1CFD A;  2KDH A;  2HQW A;  3JTD B;  5DKN A;  4MEW A;  2K7O A;  3KO0 A;  3I5F B;  5KSZ A;  4Q04 A;  3I5G C;  2K7B A;  1KK8 C;  5TNC A;  4GGF C;  1K8U A;  4FQO A;  2GGM A;  2MHH A;  3OHM B;  5CSN A;  2CTN A;  2LLT A;  3ZWH A;  2KQ6 A;  1S6J A;  1RJV A;  3TZ1 A;  2LVI A;  5G08 A;  1TCF A;  2COL B;  3GK4 X;  3WXA A;  4AOM A;  1HT9 A;  3A8R A;  4NQG A;  2KAV A;  4NDC A;  1A75 B;  1CLB A;  4ORA B;  1CLM A;  2KI4 C;  3KHE A;  1N0Y A;  1ALV A;  2DOQ A;  1KCY A;  4IL1 A;  2AAO A;  1J55 A;  2LVK A;  2Y5I A;  5CSI A;  2V53 A;  1KFU S;  1KFU L;  1A29 A;  4GGN A;  4GNK B;  2L5X B;  2BCA A;  1JFK A;  2OS8 C;  1SRA A;  3LK1 A;  2P6B B;  2KAY A;  1FW4 A;  4HRE E;  1SL8 A;  2HQ8 A;  4MSP A;  3FS7 A;  2F2O A;  2ZND A;  2LNK A;  1NP8 A;  1YUU A;  1KK7 Z;  2ZN9 A;  5I2Q A;  1IGV A;  1SK6 D;  2F3Y A;  1YRU B;  3JTD C;  2NZ0 A;  2LVJ A;  4CID A;  1DGV A;  3I5F C;  1JF0 A;  2BE6 A;  1FI6 A;  3BUW B;  4QJ4 B;  1QV1 A;  2LUC A;  1F8H A;  1NWD A;  1UWO A;  2BBN A;  2PRU A;  4OV2 A;  1WY9 A;  1JBA A;  1K9U A;  1K95 A;  2KI6 C;  3KF9 A;  1F70 A;  2BKI B;  3LCP C;  2MJW B;  3BYA A;  3DVE A;  4ZCV A;  3O2P A;  1DF0 B;  4YI9 A;  1X02 A;  3O6B A;  1G4Y R;  2H61 A;  3MSE B;  5IBW A;  4OCI A;  1UHK A;  1K94 A;  1IWQ A;  3NSO A;  2EGD A;  4M2P A;  2JXL A;  5HLV A;  1TNP A;  2PMY A;  1BJF A;  2Y1M A;  5HKW A;  1ZAC A;  4TNC A;  1N65 A;  2I2R E;  1UHH A;  3K21 A;  2D8N A;  3BOW A;  4YRU A;  1YX8 A;  1CFF A;  4I5L B;  2OPO A;  4C0K A;  3TDI A;  1BG1 A;  1AHR A;  1EG4 A;  1F4Q A;  2KBI A;  2O60 A;  1RFJ A;  5JOL A;  3H4S E;  5BPJ A;  1SR6 B;  2HPS A;  1Y1X A;  4JQ0 D;  4MZL A;  1DTL A;  1B9A A;  5HYD A;  2BCX A;  4BY4 A;  3OB2 B;  1QVI Z;  1OZS A;  4YBH B;  3AAJ A;  1UHJ A;  1ALW A;  3PN7 B;  2LV7 A;  1DJY A;  1M31 A;  4YGB B;  4CPV A;  1CDM A;  1J7R A;  1L7Z A;  4MLW A;  3PSR A;  1K2H A;  2I94 A;  2PVB A;  3HX4 A;  2KYF A;  1E8A A;  1UUR A;  2KBM A;  1YRT B;  4MRY A;  2K2F A;  1PK0 D;  5AFP A;  1EG3 A;  1NYA A;  3DF0 B;  3CR5 X;  4E68 A;  3TDU A;  5JJG A;  1J1D A;  2F33 A;  3DVM A;  1CTR A;  1IJ6 A;  1ZFS A;  2MLF C;  3PAL A;  4C0J A;  2NCO A;  2SAS A;  1TTX A;  1OMD A;  4HSZ A;  1MQ1 A;  1F54 A;  1YUR A;  1C7W A;  3TUY B;  1CDN A;  2I7A A;  3LK0 A;  3GK2 A;  4MN0 A;  2LP2 A;  3GOF A;  1KQV A;  2MLE C;  2LMT A;  1TCO B;  3SJS A;  1CM1 A;  2KGR A;  1QXP A;  1M45 A;  1J7P A;  1MXE A;  1CDP A;  1U5I A;  2AUC A;  1KK7 Y;  2JQ6 A;  2LHL A;  2M1K B;  4ORC B;  3SG4 A;  1S6I A;  2ISD A;  2BKH B;  3CZT X;  1TNQ A;  4XJK B;  2JPT A;  1QIW A;  2JUL A;  3AAK A;  1MF8 B;  5GQQ C;  1SR6 C;  4YGD B;  1LVC D;  2Y1N A;  3BXK A;  1QS7 A;  2NLN A;  2CNP A;  1K96 A;  1G33 A;  3OB1 B;  2M7L A;  3JVT B;  3NSK A;  1GGZ A;  1BT6 A;  4MBE A;  1V1F A;  2L4I A;  4ORB B;  2JZI A;  3BUM B;  4I5K A;  2KHN A;  1DMO A;  2M3W A;  1XYD A;  3PN7 C;  1J1E A;  2LVV A;  1B8R A;  4OVN F;  2F8P A;  4GFT A;  1TNW A;  2L4H A;  3KPX A;  1PAL A;  2LUX A;  1M46 A;  4GBA A;  1PRW A;  2I18 A;  2ZNE A;  1Q80 A;  1SL9 A;  4GPL B;  1IG5 A;  3LLE A;  4WQ2 A;  3VRO A;  4P5O E;  2FJU B;  4PE0 A;  3D0Y A;  3QRX A;  1R6P A;  1TOP A;  3FIA A;  2F3Z A;  3AKB A;  2BE4 A;  1PSB A;  2L0P A;  2LAN A;  2WCB A;  1BR4 B;  4HRG A;  1OE9 B;  1FI5 A;  3TUY C;  2JNX A;  1Y1U A;  2R2I A;  1L2O B;  4CFQ A;  1FF1 A;  4PHN A;  1UHN A;  2PSR A;  3C1V A;  2MAZ A;  3SG7 A;  5B8I B;  4QJ5 B;  1PSR A;  1F55 A;  4P2Y B;  5I2O A;  3WNX B;  1DJZ A;  5AER A;  1MUX A;  5D7F A;  4XYN A;  4PDZ A;  4USL A;  1EXR A;  1LKJ A;  2ZRS A;  2LLS A;  1TRF A;  5DKR A;  3KEV A;  1MHO A;  4CLN A;  2CXJ A;  2BBM A;  1K90 D;  2HET A;  4GGF A;  2M97 A;  1YUT A;  2JT8 A;  1OZO A;  1ZMZ A;  1JFJ A;  1SCV A;  3BUN B;  2WC8 A;  1WDC B;  4PHJ A;  1SW8 A;  1EJ3 A;  3RLZ A;  1WRL A;  1SMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...