1KWOC

Scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords MYOSIN HEAVY CHAIN
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoC02
3SG2A 3NSLA 4BY5A 1KQMB 1CLLA 3GOFA 3EVVA 2EC6C 1QX2A 4Q04A 2MBXA 1DJYA 1JF0A 1PULA 3NSOA 1LA0A 1Y1XA 1ODBA 3NSKA 1XK4C 1ZOTB 1ALVA 2LANA 5G08A 2JPTA 1M45A 4QJ3B 1E8AA 1TNWA 1CFDA 1SL7A 4OVNF 4C0KA 4DS7A 2E6WA 2HQ8A 1L2OC 3JTDC 1LKJA 2BL0B 1SKTA 1S6IA 2WCEA 2KFHA 2LVVA 1WDCB 1NX1A 1A29A 2LV7A 4GGFC 1H8BA 1K2HA 2FCDA 1TNPA 2ZN8A 3DVKA 1SBJA 3I5FB 2PSRA 3RM1A 1UHNA 1TNQA 1DT7B 4CFRA 1C7VA 1WRLA 2FCEA 1M46A 2QPTA 3WNXB 3LLEA 1UURA 4WQ3A 2GV5A 1IG5A 1KFUL 1KK8C 4IL1A 1F4OA 5CSNA 1KQVA 3GK2A 4MSPA 3GK1A 1NPQA 2JNFA 1UWOA 2KI6D 3CR5X 3D0YB 1LINA 1SCVA 3CLNA 2LLUA 2BE6A 4PHNA 3IQOA 4AOMA 2Y5IA 1NP8A 5ER4X 2JQ6A 1EXRA 1CDPA 2OPOA 3TDUA 2F2PA 2LMVA 4GNKB 4D1EA 1MUXA 2PVBA 1CFPA 2ISDA 1B8RA 3SG7A 1ZUZA 1XFXO 2LVIA 2KBMA 5AEQA 1A75B 1EG3A 3LK1A 3VRNA 1GGWA 3JVTB 1BR1B 2PASA 1YTZC 3HX4A 2RGIA 3SG5A 3PN7C 1H4BA 1QIVA 1B4CA 2WNDA 2LHLA 3VRRA 5HYDA 4PALA 1BMOA 1AP4A 1CNPA 4YGDB 3CS1A 3OP0A 3TUYB 1CB1A 1QS7A 1NUBA 3FIAA 5HKYA 1F55A 1K95A 2LM5A 2CNPA 2QACA 5I2QA 1QVIY 5I8NA 3BYAA 2M1UA 3NXAA 4WQ2A 1RFJA 4YBHB 5ER5A 4ETOA 1TRFA 1SR6B 1TNXA 3A4UB 1RWYA 2BCXA 4I5NB 3KPXA 3AKAA 1FI6A 1JUOA 1OOJA 3A8RA 1DJXA 1RROA 1XFVO 4ORCB 3KHEA 5FYXA 4QJ4B 1F71A 4NDDA 3BXKA 2KYCA 2LMUA 4U8DA 4GBAA 1XA5A 1S3PA 4N1FA 1B1GA 2CXJA 2KQ6A 1AVSA 2KGRA 3IF7A 1DTLA 1DJHA 1F4QA 4JWQA 5I2OA 3BQ3A 1YURA 1BG1A 1WLZA 2JNXA 1KSMA 2BKIB 2KSPA 5AERA 2KYFA 1NYAA 3DF0A 3DVMA 1XK4A 3OHMB 2MHHA 1BR4B 2NCPA 1CFCA 3CZTX 1J1DA 3O4YA 1C7WA 2M0RA 1CTRA 2L5XB 2MLEC 4E68A 1A03A 4XJKA 3EK7A 1V1GA 2JRFA 1UP5A 1S26D 2LCPA 2EHBA 1AUIB 4MN0A 1SNLA 1IQ3A 1Y1AA 2BECA 3OX6A 1UHIA 2AUCA 3EVRA 3SIAA 2HQWA 4GGFA 4DUQA 1QV1A 5B8IB 2DOQA 2EC6B 1HT9A 3BOWB 1BLQA 1LA3A 4CFQA 5KSZA 2LP2A 1J7RA 4GUKA 4MBEA 4MZLA 4C0JA 1RJVA 4HSZA 4JPZB 1J55A 1NCXA 1MHOA 1NX3A 1YVHA 1JC2A 1QATA 1PK0D 1YVLA 1B8CA 2M97A 1K90D 1IGVA 1FF1A 1BT6A 2KGBC 2CTNA 1F8HA 1SPYA 2LVKA 1R2UA 1GJYA 3MSEB 1TN4A 4PE7A 2K2AA 4MZKA 4M2PA 4XYNA 4HRGA 1JWDA 1MQ1A 2OTGC 2K7DA 1BJFA 1OMRA 1RK9A 1CFFA 1MR8A 2MJWB 1S5GY 2G9BA 2A4JA 2JU0A 4QJ5B 1TCFA 2B1UA 2LC5A 1KK8B 1D1OA 4I5LB 2LP3A 5AANA 2GGZA 1DJZA 2D8NA 1NX2A 1IWQA 3E3RA 2Y4QA 3CR2A 1J7OA 2KI4C 2OS8C 3FWCA 1WRKA 2JT0A 4MEWA 3WHUB 1DGVA 3SG6A 1SK6D 1XO5A 1M31A 1AHRA 2KFGA 1JF2A 1TTXA 3EKHA 3I5IB 1Y0VH 2BBNA 2ZNDA 1PVAA 2H61C 3HCMA 2GGMA 3WHTB 2MLFC 1PRWA 3PM8A 3I5GB 1MF8B 1YUTA 5CSJA 1S5GZ 4M2QA 1BODA 3TS5C 2WOSA 1WY9A 2PMYA 5K89A 1SYMA 2JULA 1Q80A 4HRHA 2KAYA 3AAJA 1XFYO 1DJWA 1OE9B 1VRKA 1WDCC 1KSOA 1Y6WA 4PE1A 3EK8A 3RLZA 4NDCA 4YGAA 3WXAA 2KHNA 2EGDA 1K96A 1CMGA 1QLSA 3M0WA 2ZNEA 2JOJA 1K9UA 1C07A 2M9GA 2MAZA 2AAOA 2M3WA 3I5HB 5IBWA 1KCYA 1ALWA 1U5IA 1A4PA 5AFPA 1XFWO 2CCMA 4AQIA 2NZ0A 1EH2A 3BUMB 2F33A 3OX5A 1IJ5A 4M2OA 5CPVA 1K9PA 4R1EA 2KDHA 3SG3A 2PRUA 1QX5B 2K7OA 2KBIA 3PLFB 1SMGA 4YGCB 2JTZA 4GGNA 1KFXL 2PALA 1EG4A 5HKWA 1UHHA 2LLTA 1DF0A 4YGEB 1S6JA 1SRAA 2M7NA 3PFVA 2BBMA 4GPLB 2ZRTA 4ICBA 4YGBB 1K8UA 3F45A 1SCMC 2K7CA 3JVTC 1KFXS 1RTP1 1AJ4A 1YUSA 1S36A 1DMOA 1L7ZA 4N5XA 1JSAA 3OB2B 1IQ5A 4JQ0D 1FI5A 1ZMZA 1Y1UA 1OZOA 4OV2A 1IH0A 1QVIZ 2MRDA 3BUOB 2CBLA 2HETA 1OMDA 1CDLA 1XVJA 4YI9A 1SL9A 2COLB 3BUWB 4ZCUA 4YRUA 2JWWA 1LXFC 1UUSA 1KWOC 1CLBA 3NSIA 2JTTA 1SR6C 2O5GA 2Y1NA 1AK8A 1DGUA 4PE0A 1DVIA 1K9KA 2KNEA 3SG4A 3O6BA 2L2EA 1QV0A 2H2KA 2M49B 3KO0A 1N2DA 1GGZA 1DJGA 2L98A 1J7PA 2KQYA 4PHJA 2LLSA 5D7FA 4DRWA 2SASA 3BUNB 4MZJA 4OR9B 1LVCD 3DF0B 1BOCA 1FPWA 1WRZA 1YRTB 2JXLA 4CIDA 1N65A 1PSBA 2LMTA 4OKHA 1QX7A 2HPSA 3AKBA 1OMVA 1BU3A 4XJKB 4A4CA 1QLKA 4GFTA 3VROA 1X02A 4DCKA 1JFJA 2H61A 1L2OB 3JTDB 1NCYA 1PVBA 2LUXA 2K0JA 1UHKA 4N1GA 1NCZA 3PATA 3DVEA 2KI4B 1MWNA 3QRXA 3BUXB 3TDIA 4PCWA 1IRJA 3AAKA 4NDBA 5AXIA 3FS7A 4PHKA 2F3YA 1JFKA 1J1EA 2JT8A 2WORA 2BE4A 3ZNIA 2L0PA 5PALA 2M7LA 1PSRA 1ZACA 2IS9A 1CDNA 2ZFDA 4TNCA 5KTYA 2M8UA 1JBAA 1YX8A 1NWDA 2Y1MA 1CMFA 3DVJA 4P2YB 5I2LA 1XFUO 2NLNA 1XFZO 1KQMC 2F8PA 3TS5B 5DKRA 1QTXA 2WC8A 3D0YA 1N0YA 1K94A 1G33A 5HLVA 3LCPC 1OZSA 2LUCA 2NCOA 4A4BA 1DJIA 1UHJA 1K93D 1NX0A 2I2RE 3CR4X 4AQJA 4ZCVA 3PN7B 1S1EA 1CDMA 2JZIA 2FOTA 1J7QA 2K2FA 1IKUA 2ZN9A 1A75A 5CSFA 3TDZA 1TCOB 2LHIA 4PE4A 2BL0C 3SIBA 2LE9B 1M63B 2AMIA 1R6PA 2VRGA 4I5JA 2V53A 3CGAA 2Q4UA 5CSIA 3EVUA 3I5FC 4L9MA 4F0ZB 4C0LA 1QIWA 4YI8A 2O60A 1TIZA 3VGOA 4ORAB 3D10A 1F70A 1KFUS 4NQGA 4CPVA 1QXPA 2R2IA 3DD4A 2JC2A 1EL4A 2JT3A 2ZKMX 3FWBA 3K21A 5F6TA 4MLWA 2M1KB 4CLNA 3I5IC 2BKHB 3H4SE 3IQQA 3O2PA 2KAVA 2WCFA 1XYDA 1B9AA 3EKJA 2P6BB 3CTNA 2BCBA 2FJUB 1SCMB 2LNKA 3O78A 1CM1A 2I7AA 5KU1A 1YUUA 3I5GC 2L4IA 3TZ1A 1W7JB 3PSRA 1SW8A 3SJSA 1PALA 1FBVA 2KFFA 4PDZA 1TOPA 1G4YR 1HQVA 4FQOA 4UPGA 4DIRA 1U5IB 1EJ3A 5JJGA 3VRPA 1OQPA 3LK0A 3CWGA 1KWOB 4MRXA 1QJTA 3EK4A 5J3XA 1B47A 1QASA 3I5HC 1NSHA 1B7TY 4USLA 3TUYC 2ZRSA 5D69A 2K8MB 2KI6C 1AJ5A 5TNCA 3KF9A 2K7BA 3ZWHA 5JOLA 1CM4A 2L51A 2K61A 1S6CA 1CLMA 1A2XA 2NXQA 1ZFSA 1W7IB 3ICBA 4OCIA 2G2BA 3C1VA 4MVFA 1OSAA 5DKNA 4MRYA 1KK7Y 1SY9A 1DF0B 2TN4A 2WCBA 3GK4X 4HREE 3BOWA 2M29A 5HLOA 3KEVA 2I18A 2L4HA 5DKQA 1YR5A 2HF5A 2LVJA 4ORBB 4WRIA 1YRUB 1IJ6A 3VRQA 1WLMA 1M39A 1SL8A 1YX7A 5GQQC 4P5OE 1MXEA 2OTGB 2F2OA 2F3ZA 3OB1B 1B7TZ 1B8LA 2KAXA 2SCPA 1BF5A 4GAOA 1NIWA 2E30A 3LL8B 2BCAA 1RECA 1F54A 4I5KA 1GQMA 1V1FA 4FTGA 2Q91A 2JXCA 5HKZA 4BY4A 2LAPA 5BPJA 1KK7Z 4PHMA 2CT9A 2MA2A 1FW4A 2L50A 1CKKA 2OS8B 1G8IA 1MXLC 3PALA 2I94A 2KOTA
chains in the Genus database with same CATH superfamily
3SG2A 3NSLA 4BY5A 1KQMB 1CLLA 3GOFA 3EVVA 2EC6C 1QX2A 4Q04A 2MBXA 1DJYA 1JF0A 1PULA 2ERBA 3NSOA 2QDIA 1LA0A 3DXLA 1Y1XA 1ODBA 3NSKA 1XK4C 1ZOTB 1ALVA 2LANA 3DYEA 3V2LA 5G08A 2JPTA 1M45A 3OGNA 4QJ3B 1E8AA 1TNWA 3NHIA 1DEKA 1CFDA 3L4AA 1P28A 1SL7A 4OVNF 4C0KA 4DS7A 2E6WA 2HQ8A 1L2OC 3JTDC 1LKJA 2BL0B 1SKTA 1S6IA 2WCEA 2KFHA 2LVVA 1WDCB 1NX1A 1A29A 2LV7A 4GGFC 1H8BA 1K2HA 2FCDA 1TNPA 2ZN8A 3DVKA 1SBJA 3I5FB 2PSRA 3RM1A 1UHNA 1TNQA 1DT7B 4CFRA 1C7VA 1WRLA 3R1PA 2FCEA 1M46A 2QPTA 3WNXB 3LLEA 1UURA 4WQ3A 2GV5A 4FQTA 1IG5A 1KFUL 5I94A 3UNWA 1KK8C 4IL1A 1F4OA 5CSNA 1KQVA 3GK2A 4MSPA 3GK1A 1NPQA 2JNFA 1UWOA 2KI6D 3CR5X 3D0YB 3PM2A 1LINA 1SCVA 1OOHA 3CLNA 2LLUA 2BE6A 4JD9A 4PHNA 3IQOA 4AOMA 2Y5IA 1NP8A 5ER4X 3SS4A 2JQ6A 1EXRA 1CDPA 2OPOA 3TDUA 2F2PA 2LMVA 4GNKB 4D1EA 1MUXA 1QWVA 2PVBA 1CFPA 2ISDA 1B8RA 3SG7A 4F7FA 1ZUZA 1XFXO 2LVIA 2KBMA 5AEQA 1A75B 1EG3A 3LK1A 3VRNA 1GGWA 3JVTB 1BR1B 2PASA 1YTZC 3HX4A 2RGIA 3SG5A 3PN7C 1H4BA 1QIVA 1B4CA 2WNDA 2LHLA 3VRRA 5HYDA 3IVTA 3B6XA 4PALA 1BMOA 2BAPA 1AP4A 1CNPA 4YGDB 3CS1A 3NGVA 3OP0A 3TUYB 1CB1A 1QS7A 1NUBA 3FIAA 5HKYA 1F55A 1K95A 2LM5A 5DICA 2CNPA 2QACA 5I2QA 1QVIY 5I8NA 3BYAA 2M1UA 3D74A 3NXAA 1RFJA 4WQ2A 4YBHB 5ER5A 4ETOA 1TRFA 1SR6B 3UO9A 1TNXA 2K60A 3A4UB 1RWYA 2BCXA 4I5NB 3KPXA 3AKAA 1FI6A 1JUOA 1OOJA 3A8RA 1DJXA 1RROA 1XFVO 4ORCB 3KHEA 5FYXA 4QJ4B 1F71A 4NDDA 3BXKA 2KYCA 2LMUA 3DY9A 4U8DA 4GBAA 1XA5A 1S3PA 1DELA 4N1FA 1B1GA 2CXJA 2KQ6A 1AVSA 2KGRA 3IF7A 1XFRA 1DTLA 1DJHA 1F4QA 4JWQA 5I2OA 3BQ3A 1YURA 1BG1A 1WLZA 2JNXA 1KSMA 2BKIB 2KSPA 5AERA 2KYFA 1NYAA 1T14A 3DF0A 1XK4A 3DVMA 3OHMB 2MHHA 1BR4B 2NCPA 1CFCA 3CZTX 1J1DA 3O4YA 1C7WA 2M0RA 1CTRA 2L5XB 2MLEC 5EL2A 1OOFA 4E68A 3OBVA 1A03A 2FJYA 4XJKA 3EK7A 1V1GA 2JRFA 1UP5A 1S26D 2LCPA 2EHBA 1AUIB 4MN0A 1SNLA 1IQ3A 1Y1AA 2BECA 3QMEA 3OX6A 1UHIA 2AUCA 3EVRA 3SIAA 2HQWA 3CZ1A 4GGFA 4DUQA 1QV1A 5FI7A 5B8IB 2DOQA 2EC6B 1C3YA 1HT9A 3BOWB 1BLQA 1LA3A 4CFQA 5KSZA 2LP2A 1J7RA 4GUKA 4MBEA 4MZLA 4C0JA 1RJVA 4HSZA 4JPZB 1J55A 2BNXA 1NCXA 1MHOA 1NX3A 1YVHA 1JC2A 1QATA 1PK0D 1YVLA 1B8CA 2M97A 1K90D 1IGVA 1FF1A 1BT6A 2KGBC 2CTNA 1F8HA 1SPYA 2LVKA 1R2UA 1GJYA 3MSEB 1Z2CB 1TN4A 4IJ7A 4PE7A 2K2AA 4MZKA 3S0BA 4M2PA 4XYNA 4HRGA 1JWDA 1MQ1A 2OTGC 3BFAA 2K7DA 1BJFA 1OMRA 1RK9A 1CFFA 1MR8A 2MJWB 1S5GY 2G9BA 2A4JA 2JU0A 3FE9A 4QJ5B 1TCFA 2B1UA 1OW4A 2KLDA 2LC5A 1KK8B 1D1OA 4I5LB 2LP3A 5AANA 2GGZA 1DJZA 2D8NA 1NX2A 1IWQA 3E3RA 3O4XA 2Y4QA 3CR2A 1J7OA 2KI4C 2OS8C 3FWCA 1WRKA 1GM0A 2JT0A 3R72A 4MEWA 3WHUB 1DGVA 3SG6A 1SK6D 1XO5A 1M31A 1AHRA 1TUJA 1JF2A 1TTXA 1W9ZA 2KFGA 3CZ2A 3EKHA 1Y0VH 2BBNA 2ZNDA 1PVAA 2H61C 3HCMA 2KPHA 2GGMA 3WHTB 2MLFC 3SS3A 1PRWA 3PM8A 4OZDA 3I5GB 1MF8B 1YUTA 5CSJA 1S5GZ 4M2QA 1BODA 3I5IB 3TS5C 2WOSA 1WY9A 2PMYA 5K89A 1SYMA 2JULA 1Q80A 3L47A 4HRHA 2KAYA 3AAJA 2KLEA 1XFYO 1DJWA 1OE9B 1VRKA 3S0FA 1WDCC 1KSOA 1Y6WA 2H8VA 4PE1A 3EK8A 3RLZA 4NDCA 4YGAA 3WXAA 2KHNA 2EGDA 1K96A 1CMGA 1QLSA 3M0WA 2ZNEA 2JOJA 1K9UA 1C07A 2M9GA 2MAZA 2AAOA 2M3WA 3I5HB 5IBWA 1KCYA 1ALWA 1U5IA 1A4PA 5AFPA 1XFWO 2CCMA 4AQIA 3DZTA 2NZ0A 1EH2A 3BUMB 3BJHA 2F33A 3OX5A 1IJ5A 3S0DA 1TUZA 4M2OA 3B87A 4INXA 5CPVA 1K9PA 4R1EA 2KDHA 3SG3A 2PRUA 1QX5B 2K7OA 2KBIA 2WCHA 3PLFB 1SMGA 4YGCB 1IIOA 2JTZA 3EG5B 4GGNA 1KFXL 2PALA 1EG4A 5HKWA 1UHHA 2LLTA 1DF0A 4YGEB 1S6JA 1SRAA 2M7NA 3PFVA 2BBMA 4GPLB 2ZRTA 4ICBA 4INWA 2WCJA 4YGBB 1K8UA 3F45A 1SCMC 2K7CA 3JVTC 1KFXS 1RTP1 1AJ4A 1YUSA 1OOGA 1SSEB 1S36A 1DMOA 1L7ZA 4N5XA 1JSAA 3OB2B 1IQ5A 4JQ0D 1FI5A 1ZMZA 3RZSA 1Y1UA 1OZOA 4OV2A 1IH0A 1QVIZ 2MRDA 3BUOB 1Z4HA 2CBLA 2HETA 1OMDA 1CDLA 1XVJA 4YI9A 1SL9A 2COLB 3BUWB 4ZCUA 4YRUA 4PT1A 2JWWA 1LXFC 1UUSA 1KWOC 2QEVA 3BFHA 1CLBA 3NSIA 3CDNA 2JTTA 1SR6C 2O5GA 2Y1NA 3Q8IA 1AK8A 1DGUA 4PE0A 3BFBA 1DVIA 1K9KA 2KNEA 3SG4A 3O6BA 1DC1A 2L2EA 1QV0A 2H2KA 2M49B 3KO0A 5HL1A 1N2DA 1GGZA 1DJGA 2L98A 1J7PA 2KQYA 4PHJA 2LLSA 5D7FA 2GTEA 2SASA 3BUNB 4MZJA 4OR9B 5FI2A 1LVCD 3DF0B 2L5YA 1BOCA 1FPWA 1WRZA 1YRTB 2JXLA 4CIDA 1N65A 1PSBA 2LMTA 4OKHA 1QX7A 2HPSA 3K1EA 3AKBA 1OMVA 3VB1A 1BU3A 4XJKB 4A4CA 1QLKA 4GFTA 3VROA 1X02A 2QEBA 4DCKA 1JFJA 2H61A 1L2OB 3B86A 1NCYA 3JTDB 1PVBA 2LUXA 2K0JA 3D73A 1UHKA 3FE8A 4N1GA 1LS8A 1NCZA 3PATA 3DVEA 2KI4B 1MWNA 3QRXA 3BUXB 3TDIA 4PCWA 1IRJA 3AAKA 4NDBA 5AXIA 3FS7A 4PHKA 2F3YA 1JFKA 1J1EA 2JT8A 2WORA 2BE4A 3ZNIA 2L0PA 5PALA 3CYZA 2M7LA 1PSRA 1ZACA 2IS9A 2YGUA 1CDNA 2ZFDA 4TNCA 2P71A 2M8UA 5KTYA 1JBAA 1YX8A 1NWDA 2Y1MA 1CMFA 3DVJA 4P2YB 5I2LA 1XFUO 1ORGA 2NLNA 1XFZO 1KQMC 2F8PA 3CABA 1OOIX 3S0EA 5DKRA 1QTXA 2WC8A 3D0YA 2QEHA 1N0YA 3TS5B 1K94A 1G33A 5HLVA 3LCPC 1OZSA 2LUCA 2NCOA 4A4BA 1DJIA 1UHJA 1K93D 1NX0A 2I2RE 3CR4X 4AQJA 4ZCVA 3PN7B 1S1EA 1CDMA 2JZIA 2FOTA 1J7QA 2K2FA 5FI6A 2ZN9A 1IKUA 1A75A 5CSFA 3CZ0A 1TCOB 2LHIA 4PE4A 2BL0C 3SIBA 2LE9B 3TDZA 1M63B 3S0GA 2AMIA 1R6PA 2VRGA 4I5JA 2V53A 3CGAA 2Q4UA 5CSIA 3EVUA 3I5FC 4L9MA 4F0ZB 4C0LA 1C3ZA 1QIWA 4YI8A 2O60A 1TIZA 3VGOA 4ORAB 3D10A 1F70A 1KFUS 4NQGA 4CPVA 1QXPA 2R2IA 3DD4A 3NHTA 2JC2A 2L2CA 1EL4A 2JT3A 2ZKMX 3FWBA 3K21A 5F6TA 4MLWA 2M1KB 3PJIA 2JPOA 4CLNA 3I5IC 2BKHB 3H4SE 3IQQA 3O2PA 2KAVA 2WCFA 1XYDA 2WC5A 2QEOA 3SS5A 1B9AA 3EKJA 2P6BB 3CTNA 2BCBA 2FJUB 1SCMB 2LNKA 3O78A 1CM1A 2I7AA 5KU1A 1YUUA 1DQEA 3I5GC 2L4IA 3TZ1A 1W7JB 4KYNA 3PSRA 1SW8A 3SJSA 1PALA 3D75A 2WCKA 1FBVA 2KFFA 4PDZA 3B7AA 1TOPA 1G4YR 1HQVA 4FQOA 3B88A 4DIRA 4UPGA 1U5IB 1EJ3A 2PYQA 5JJGA 3VRPA 1OQPA 3LK0A 3CWGA 1KWOB 2WC6A 4MRXA 1QJTA 3EK4A 5J3XA 1B47A 1QASA 3I5HC 1NSHA 1B7TY 4DRWA 4USLA 3TUYC 2ZRSA 5D69A 2K8MB 2KI6C 1AJ5A 3R1OA 5TNCA 3KF9A 2K7BA 3ZWHA 5JOLA 1CM4A 2L51A 2K61A 3D77A 1S6CA 1CLMA 1A2XA 2NXQA 1ZFSA 1W7IB 3ICBA 4OCIA 2G2BA 3C1VA 4MVFA 1OSAA 5DKNA 4MRYA 1KK7Y 1SY9A 1DF0B 2TN4A 2WCBA 3GK4X 4HREE 3BOWA 3R1VA 2M29A 5HLOA 3KEVA 2I18A 2L4HA 5DKQA 1YR5A 2HF5A 2PQLA 2LVJA 3N7HA 4ORBB 4WRIA 1YRUB 3S0AA 1IJ6A 3VRQA 1WLMA 1M39A 1SL8A 3FE6A 1TWOA 1YX7A 5GQQC 4P5OE 1MXEA 2OTGB 5D3OA 3L4LA 2F2OA 2F3ZA 3OB1B 1B7TZ 1B8LA 2KAXA 3D78A 2SCPA 1BF5A 4GAOA 1NIWA 2E30A 3LL8B 2BCAA 1RECA 2WCMA 1F54A 4I5KA 1GQMA 1V1FA 4FTGA 2Q91A 2JXCA 5HKZA 4BY4A 3D76A 2LAPA 2P70A 5BPJA 1KK7Z 2WCLA 4PHMA 2CT9A 2MA2A 1FW4A 2L50A 4JKTA 1CKKA 2OS8B 1G8IA 1MXLC 3PALA 2I94A 2KOTA
chains in the Genus database with same CATH topology
3SG2A 3NSLA 4BY5A 1KQMB 1CLLA 3GOFA 3EVVA 2EC6C 1QX2A 4Q04A 2MBXA 1DJYA 1JF0A 1PULA 3NSOA 1LA0A 1Y1XA 1ODBA 3NSKA 1XK4C 1ZOTB 1ALVA 2LANA 5G08A 2JPTA 1M45A 4QJ3B 1E8AA 1TNWA 1CFDA 1SL7A 4OVNF 4C0KA 4DS7A 2E6WA 2HQ8A 1L2OC 3JTDC 1LKJA 2BL0B 1SKTA 1S6IA 2WCEA 2KFHA 2LVVA 1WDCB 1NX1A 1A29A 2LV7A 4GGFC 1H8BA 1K2HA 2FCDA 1TNPA 2ZN8A 3DVKA 1SBJA 3I5FB 2PSRA 3RM1A 1UHNA 1TNQA 1DT7B 4CFRA 1C7VA 1WRLA 2FCEA 1M46A 2QPTA 3WNXB 3LLEA 1UURA 4WQ3A 2GV5A 1IG5A 1KFUL 1KK8C 4IL1A 1F4OA 5CSNA 1KQVA 3GK2A 4MSPA 3GK1A 1NPQA 2JNFA 1UWOA 2KI6D 3CR5X 3D0YB 1LINA 1SCVA 3CLNA 2LLUA 2BE6A 4PHNA 3IQOA 4AOMA 2Y5IA 1NP8A 5ER4X 2JQ6A 1EXRA 1CDPA 2OPOA 3TDUA 2F2PA 2LMVA 4GNKB 4D1EA 1MUXA 2PVBA 1CFPA 2ISDA 1B8RA 3SG7A 1ZUZA 1XFXO 2LVIA 2KBMA 5AEQA 1A75B 1EG3A 3LK1A 3VRNA 1GGWA 3JVTB 1BR1B 2PASA 1YTZC 3HX4A 2RGIA 3SG5A 3PN7C 1H4BA 1QIVA 1B4CA 2WNDA 2LHLA 3VRRA 5HYDA 4PALA 1BMOA 1AP4A 1CNPA 4YGDB 3CS1A 3OP0A 3TUYB 1CB1A 1QS7A 1NUBA 3FIAA 5HKYA 1F55A 1K95A 2LM5A 2CNPA 2QACA 5I2QA 1QVIY 5I8NA 3BYAA 2M1UA 3NXAA 4WQ2A 1RFJA 4YBHB 5ER5A 4ETOA 1TRFA 1SR6B 1TNXA 3A4UB 1RWYA 2BCXA 4I5NB 3KPXA 3AKAA 1FI6A 1JUOA 1OOJA 3A8RA 1DJXA 1RROA 1XFVO 4ORCB 3KHEA 5FYXA 4QJ4B 1F71A 4NDDA 3BXKA 2KYCA 2LMUA 4U8DA 4GBAA 1XA5A 1S3PA 4N1FA 1B1GA 2CXJA 2KQ6A 1AVSA 2KGRA 3IF7A 1DTLA 1DJHA 1F4QA 4JWQA 5I2OA 3BQ3A 1YURA 1BG1A 1WLZA 2JNXA 1KSMA 2BKIB 2KSPA 5AERA 2KYFA 1NYAA 3DF0A 3DVMA 1XK4A 3OHMB 2MHHA 1BR4B 2NCPA 1CFCA 3CZTX 1J1DA 3O4YA 1C7WA 2M0RA 1CTRA 2L5XB 2MLEC 4E68A 1A03A 4XJKA 3EK7A 1V1GA 2JRFA 1UP5A 1S26D 2LCPA 2EHBA 1AUIB 4MN0A 1SNLA 1IQ3A 1Y1AA 2BECA 3OX6A 1UHIA 2AUCA 3EVRA 3SIAA 2HQWA 4GGFA 4DUQA 1QV1A 5B8IB 2DOQA 2EC6B 1HT9A 3BOWB 1BLQA 1LA3A 4CFQA 5KSZA 2LP2A 1J7RA 4GUKA 4MBEA 4MZLA 4C0JA 1RJVA 4HSZA 4JPZB 1J55A 1NCXA 1MHOA 1NX3A 1YVHA 1JC2A 1QATA 1PK0D 1YVLA 1B8CA 2M97A 1K90D 1IGVA 1FF1A 1BT6A 2KGBC 2CTNA 1F8HA 1SPYA 2LVKA 1R2UA 1GJYA 3MSEB 1TN4A 4PE7A 2K2AA 4MZKA 4M2PA 4XYNA 4HRGA 1JWDA 1MQ1A 2OTGC 2K7DA 1BJFA 1OMRA 1RK9A 1CFFA 1MR8A 2MJWB 1S5GY 2G9BA 2A4JA 2JU0A 4QJ5B 1TCFA 2B1UA 2LC5A 1KK8B 1D1OA 4I5LB 2LP3A 5AANA 2GGZA 1DJZA 2D8NA 1NX2A 1IWQA 3E3RA 2Y4QA 3CR2A 1J7OA 2KI4C 2OS8C 3FWCA 1WRKA 2JT0A 4MEWA 3WHUB 1DGVA 3SG6A 1SK6D 1XO5A 1M31A 1AHRA 2KFGA 1JF2A 1TTXA 3EKHA 3I5IB 1Y0VH 2BBNA 2ZNDA 1PVAA 2H61C 3HCMA 2GGMA 3WHTB 2MLFC 1PRWA 3PM8A 3I5GB 1MF8B 1YUTA 5CSJA 1S5GZ 4M2QA 1BODA 3TS5C 2WOSA 1WY9A 2PMYA 5K89A 1SYMA 2JULA 1Q80A 4HRHA 2KAYA 3AAJA 1XFYO 1DJWA 1OE9B 1VRKA 1WDCC 1KSOA 1Y6WA 4PE1A 3EK8A 3RLZA 4NDCA 4YGAA 3WXAA 2KHNA 2EGDA 1K96A 1CMGA 1QLSA 3M0WA 2ZNEA 2JOJA 1K9UA 1C07A 2M9GA 2MAZA 2AAOA 2M3WA 3I5HB 5IBWA 1KCYA 1ALWA 1U5IA 1A4PA 5AFPA 1XFWO 2CCMA 4AQIA 2NZ0A 1EH2A 3BUMB 2F33A 3OX5A 1IJ5A 4M2OA 5CPVA 1K9PA 4R1EA 2KDHA 3SG3A 2PRUA 1QX5B 2K7OA 2KBIA 3PLFB 1SMGA 4YGCB 2JTZA 4GGNA 1KFXL 2PALA 1EG4A 5HKWA 1UHHA 2LLTA 1DF0A 4YGEB 1S6JA 1SRAA 2M7NA 3PFVA 2BBMA 4GPLB 2ZRTA 4ICBA 4YGBB 1K8UA 3F45A 1SCMC 2K7CA 3JVTC 1KFXS 1RTP1 1AJ4A 1YUSA 1S36A 1DMOA 1L7ZA 4N5XA 1JSAA 3OB2B 1IQ5A 4JQ0D 1FI5A 1ZMZA 1Y1UA 1OZOA 4OV2A 1IH0A 1QVIZ 2MRDA 3BUOB 2CBLA 2HETA 1OMDA 1CDLA 1XVJA 4YI9A 1SL9A 2COLB 3BUWB 4ZCUA 4YRUA 2JWWA 1LXFC 1UUSA 1KWOC 1CLBA 3NSIA 2JTTA 1SR6C 2O5GA 2Y1NA 1AK8A 1DGUA 4PE0A 1DVIA 1K9KA 2KNEA 3SG4A 3O6BA 2L2EA 1QV0A 2H2KA 2M49B 3KO0A 1N2DA 1GGZA 1DJGA 2L98A 1J7PA 2KQYA 4PHJA 2LLSA 5D7FA 4DRWA 2SASA 3BUNB 4MZJA 4OR9B 1LVCD 3DF0B 1BOCA 1FPWA 1WRZA 1YRTB 2JXLA 4CIDA 1N65A 1PSBA 2LMTA 4OKHA 1QX7A 2HPSA 3AKBA 1OMVA 1BU3A 4XJKB 4A4CA 1QLKA 4GFTA 3VROA 1X02A 4DCKA 1JFJA 2H61A 1L2OB 3JTDB 1NCYA 1PVBA 2LUXA 2K0JA 1UHKA 4N1GA 1NCZA 3PATA 3DVEA 2KI4B 1MWNA 3QRXA 3BUXB 3TDIA 4PCWA 1IRJA 3AAKA 4NDBA 5AXIA 3FS7A 4PHKA 2F3YA 1JFKA 1J1EA 2JT8A 2WORA 2BE4A 3ZNIA 2L0PA 5PALA 2M7LA 1PSRA 1ZACA 2IS9A 1CDNA 2ZFDA 4TNCA 5KTYA 2M8UA 1JBAA 1YX8A 1NWDA 2Y1MA 1CMFA 3DVJA 4P2YB 5I2LA 1XFUO 2NLNA 1XFZO 1KQMC 2F8PA 3TS5B 5DKRA 1QTXA 2WC8A 3D0YA 1N0YA 1K94A 1G33A 5HLVA 3LCPC 1OZSA 2LUCA 2NCOA 4A4BA 1DJIA 1UHJA 1K93D 1NX0A 2I2RE 3CR4X 4AQJA 4ZCVA 3PN7B 1S1EA 1CDMA 2JZIA 2FOTA 1J7QA 2K2FA 1IKUA 2ZN9A 1A75A 5CSFA 3TDZA 1TCOB 2LHIA 4PE4A 2BL0C 3SIBA 2LE9B 1M63B 2AMIA 1R6PA 2VRGA 4I5JA 2V53A 3CGAA 2Q4UA 5CSIA 3EVUA 3I5FC 4L9MA 4F0ZB 4C0LA 1QIWA 4YI8A 2O60A 1TIZA 3VGOA 4ORAB 3D10A 1F70A 1KFUS 4NQGA 4CPVA 1QXPA 2R2IA 3DD4A 2JC2A 1EL4A 2JT3A 2ZKMX 3FWBA 3K21A 5F6TA 4MLWA 2M1KB 4CLNA 3I5IC 2BKHB 3H4SE 3IQQA 3O2PA 2KAVA 2WCFA 1XYDA 1B9AA 3EKJA 2P6BB 3CTNA 2BCBA 2FJUB 1SCMB 2LNKA 3O78A 1CM1A 2I7AA 5KU1A 1YUUA 3I5GC 2L4IA 3TZ1A 1W7JB 3PSRA 1SW8A 3SJSA 1PALA 1FBVA 2KFFA 4PDZA 1TOPA 1G4YR 1HQVA 4FQOA 4UPGA 4DIRA 1U5IB 1EJ3A 5JJGA 3VRPA 1OQPA 3LK0A 3CWGA 1KWOB 4MRXA 1QJTA 3EK4A 5J3XA 1B47A 1QASA 3I5HC 1NSHA 1B7TY 4USLA 3TUYC 2ZRSA 5D69A 2K8MB 2KI6C 1AJ5A 5TNCA 3KF9A 2K7BA 3ZWHA 5JOLA 1CM4A 2L51A 2K61A 1S6CA 1CLMA 1A2XA 2NXQA 1ZFSA 1W7IB 3ICBA 4OCIA 2G2BA 3C1VA 4MVFA 1OSAA 5DKNA 4MRYA 1KK7Y 1SY9A 1DF0B 2TN4A 2WCBA 3GK4X 4HREE 3BOWA 2M29A 5HLOA 3KEVA 2I18A 2L4HA 5DKQA 1YR5A 2HF5A 2LVJA 4ORBB 4WRIA 1YRUB 1IJ6A 3VRQA 1WLMA 1M39A 1SL8A 1YX7A 5GQQC 4P5OE 1MXEA 2OTGB 2F2OA 2F3ZA 3OB1B 1B7TZ 1B8LA 2KAXA 2SCPA 1BF5A 4GAOA 1NIWA 2E30A 3LL8B 2BCAA 1RECA 1F54A 4I5KA 1GQMA 1V1FA 4FTGA 2Q91A 2JXCA 5HKZA 4BY4A 2LAPA 5BPJA 1KK7Z 4PHMA 2CT9A 2MA2A 1FW4A 2L50A 1CKKA 2OS8B 1G8IA 1MXLC 3PALA 2I94A 2KOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG2 A;  3NSL A;  4BY5 A;  1KQM B;  1CLL A;  3GOF A;  3EVV A;  2EC6 C;  1QX2 A;  4Q04 A;  2MBX A;  1DJY A;  1JF0 A;  1PUL A;  3NSO A;  1LA0 A;  1Y1X A;  1ODB A;  3NSK A;  1XK4 C;  1ZOT B;  1ALV A;  2LAN A;  5G08 A;  2JPT A;  1M45 A;  4QJ3 B;  1E8A A;  1TNW A;  1CFD A;  1SL7 A;  4OVN F;  4C0K A;  4DS7 A;  2E6W A;  2HQ8 A;  1L2O C;  3JTD C;  1LKJ A;  2BL0 B;  1SKT A;  1S6I A;  2WCE A;  2KFH A;  2LVV A;  1WDC B;  1NX1 A;  1A29 A;  2LV7 A;  4GGF C;  1H8B A;  1K2H A;  2FCD A;  1TNP A;  2ZN8 A;  3DVK A;  1SBJ A;  3I5F B;  2PSR A;  3RM1 A;  1UHN A;  1TNQ A;  1DT7 B;  4CFR A;  1C7V A;  1WRL A;  2FCE A;  1M46 A;  2QPT A;  3WNX B;  3LLE A;  1UUR A;  4WQ3 A;  2GV5 A;  1IG5 A;  1KFU L;  1KK8 C;  4IL1 A;  1F4O A;  5CSN A;  1KQV A;  3GK2 A;  4MSP A;  3GK1 A;  1NPQ A;  2JNF A;  1UWO A;  2KI6 D;  3CR5 X;  3D0Y B;  1LIN A;  1SCV A;  3CLN A;  2LLU A;  2BE6 A;  4PHN A;  3IQO A;  4AOM A;  2Y5I A;  1NP8 A;  5ER4 X;  2JQ6 A;  1EXR A;  1CDP A;  2OPO A;  3TDU A;  2F2P A;  2LMV A;  4GNK B;  4D1E A;  1MUX A;  2PVB A;  1CFP A;  2ISD A;  1B8R A;  3SG7 A;  1ZUZ A;  1XFX O;  2LVI A;  2KBM A;  5AEQ A;  1A75 B;  1EG3 A;  3LK1 A;  3VRN A;  1GGW A;  3JVT B;  1BR1 B;  2PAS A;  1YTZ C;  3HX4 A;  2RGI A;  3SG5 A;  3PN7 C;  1H4B A;  1QIV A;  1B4C A;  2WND A;  2LHL A;  3VRR A;  5HYD A;  4PAL A;  1BMO A;  1AP4 A;  1CNP A;  4YGD B;  3CS1 A;  3OP0 A;  3TUY B;  1CB1 A;  1QS7 A;  1NUB A;  3FIA A;  5HKY A;  1F55 A;  1K95 A;  2LM5 A;  2CNP A;  2QAC A;  5I2Q A;  1QVI Y;  5I8N A;  3BYA A;  2M1U A;  3NXA A;  4WQ2 A;  1RFJ A;  4YBH B;  5ER5 A;  4ETO A;  1TRF A;  1SR6 B;  1TNX A;  3A4U B;  1RWY A;  2BCX A;  4I5N B;  3KPX A;  3AKA A;  1FI6 A;  1JUO A;  1OOJ A;  3A8R A;  1DJX A;  1RRO A;  1XFV O;  4ORC B;  3KHE A;  5FYX A;  4QJ4 B;  1F71 A;  4NDD A;  3BXK A;  2KYC A;  2LMU A;  4U8D A;  4GBA A;  1XA5 A;  1S3P A;  4N1F A;  1B1G A;  2CXJ A;  2KQ6 A;  1AVS A;  2KGR A;  3IF7 A;  1DTL A;  1DJH A;  1F4Q A;  4JWQ A;  5I2O A;  3BQ3 A;  1YUR A;  1BG1 A;  1WLZ A;  2JNX A;  1KSM A;  2BKI B;  2KSP A;  5AER A;  2KYF A;  1NYA A;  3DF0 A;  3DVM A;  1XK4 A;  3OHM B;  2MHH A;  1BR4 B;  2NCP A;  1CFC A;  3CZT X;  1J1D A;  3O4Y A;  1C7W A;  2M0R A;  1CTR A;  2L5X B;  2MLE C;  4E68 A;  1A03 A;  4XJK A;  3EK7 A;  1V1G A;  2JRF A;  1UP5 A;  1S26 D;  2LCP A;  2EHB A;  1AUI B;  4MN0 A;  1SNL A;  1IQ3 A;  1Y1A A;  2BEC A;  3OX6 A;  1UHI A;  2AUC A;  3EVR A;  3SIA A;  2HQW A;  4GGF A;  4DUQ A;  1QV1 A;  5B8I B;  2DOQ A;  2EC6 B;  1HT9 A;  3BOW B;  1BLQ A;  1LA3 A;  4CFQ A;  5KSZ A;  2LP2 A;  1J7R A;  4GUK A;  4MBE A;  4MZL A;  4C0J A;  1RJV A;  4HSZ A;  4JPZ B;  1J55 A;  1NCX A;  1MHO A;  1NX3 A;  1YVH A;  1JC2 A;  1QAT A;  1PK0 D;  1YVL A;  1B8C A;  2M97 A;  1K90 D;  1IGV A;  1FF1 A;  1BT6 A;  2KGB C;  2CTN A;  1F8H A;  1SPY A;  2LVK A;  1R2U A;  1GJY A;  3MSE B;  1TN4 A;  4PE7 A;  2K2A A;  4MZK A;  4M2P A;  4XYN A;  4HRG A;  1JWD A;  1MQ1 A;  2OTG C;  2K7D A;  1BJF A;  1OMR A;  1RK9 A;  1CFF A;  1MR8 A;  2MJW B;  1S5G Y;  2G9B A;  2A4J A;  2JU0 A;  4QJ5 B;  1TCF A;  2B1U A;  2LC5 A;  1KK8 B;  1D1O A;  4I5L B;  2LP3 A;  5AAN A;  2GGZ A;  1DJZ A;  2D8N A;  1NX2 A;  1IWQ A;  3E3R A;  2Y4Q A;  3CR2 A;  1J7O A;  2KI4 C;  2OS8 C;  3FWC A;  1WRK A;  2JT0 A;  4MEW A;  3WHU B;  1DGV A;  3SG6 A;  1SK6 D;  1XO5 A;  1M31 A;  1AHR A;  2KFG A;  1JF2 A;  1TTX A;  3EKH A;  3I5I B;  1Y0V H;  2BBN A;  2ZND A;  1PVA A;  2H61 C;  3HCM A;  2GGM A;  3WHT B;  2MLF C;  1PRW A;  3PM8 A;  3I5G B;  1MF8 B;  1YUT A;  5CSJ A;  1S5G Z;  4M2Q A;  1BOD A;  3TS5 C;  2WOS A;  1WY9 A;  2PMY A;  5K89 A;  1SYM A;  2JUL A;  1Q80 A;  4HRH A;  2KAY A;  3AAJ A;  1XFY O;  1DJW A;  1OE9 B;  1VRK A;  1WDC C;  1KSO A;  1Y6W A;  4PE1 A;  3EK8 A;  3RLZ A;  4NDC A;  4YGA A;  3WXA A;  2KHN A;  2EGD A;  1K96 A;  1CMG A;  1QLS A;  3M0W A;  2ZNE A;  2JOJ A;  1K9U A;  1C07 A;  2M9G A;  2MAZ A;  2AAO A;  2M3W A;  3I5H B;  5IBW A;  1KCY A;  1ALW A;  1U5I A;  1A4P A;  5AFP A;  1XFW O;  2CCM A;  4AQI A;  2NZ0 A;  1EH2 A;  3BUM B;  2F33 A;  3OX5 A;  1IJ5 A;  4M2O A;  5CPV A;  1K9P A;  4R1E A;  2KDH A;  3SG3 A;  2PRU A;  1QX5 B;  2K7O A;  2KBI A;  3PLF B;  1SMG A;  4YGC B;  2JTZ A;  4GGN A;  1KFX L;  2PAL A;  1EG4 A;  5HKW A;  1UHH A;  2LLT A;  1DF0 A;  4YGE B;  1S6J A;  1SRA A;  2M7N A;  3PFV A;  2BBM A;  4GPL B;  2ZRT A;  4ICB A;  4YGB B;  1K8U A;  3F45 A;  1SCM C;  2K7C A;  3JVT C;  1KFX S;  1RTP 1;  1AJ4 A;  1YUS A;  1S36 A;  1DMO A;  1L7Z A;  4N5X A;  1JSA A;  3OB2 B;  1IQ5 A;  4JQ0 D;  1FI5 A;  1ZMZ A;  1Y1U A;  1OZO A;  4OV2 A;  1IH0 A;  1QVI Z;  2MRD A;  3BUO B;  2CBL A;  2HET A;  1OMD A;  1CDL A;  1XVJ A;  4YI9 A;  1SL9 A;  2COL B;  3BUW B;  4ZCU A;  4YRU A;  2JWW A;  1LXF C;  1UUS A;  1KWO C;  1CLB A;  3NSI A;  2JTT A;  1SR6 C;  2O5G A;  2Y1N A;  1AK8 A;  1DGU A;  4PE0 A;  1DVI A;  1K9K A;  2KNE A;  3SG4 A;  3O6B A;  2L2E A;  1QV0 A;  2H2K A;  2M49 B;  3KO0 A;  1N2D A;  1GGZ A;  1DJG A;  2L98 A;  1J7P A;  2KQY A;  4PHJ A;  2LLS A;  5D7F A;  4DRW A;  2SAS A;  3BUN B;  4MZJ A;  4OR9 B;  1LVC D;  3DF0 B;  1BOC A;  1FPW A;  1WRZ A;  1YRT B;  2JXL A;  4CID A;  1N65 A;  1PSB A;  2LMT A;  4OKH A;  1QX7 A;  2HPS A;  3AKB A;  1OMV A;  1BU3 A;  4XJK B;  4A4C A;  1QLK A;  4GFT A;  3VRO A;  1X02 A;  4DCK A;  1JFJ A;  2H61 A;  1L2O B;  3JTD B;  1NCY A;  1PVB A;  2LUX A;  2K0J A;  1UHK A;  4N1G A;  1NCZ A;  3PAT A;  3DVE A;  2KI4 B;  1MWN A;  3QRX A;  3BUX B;  3TDI A;  4PCW A;  1IRJ A;  3AAK A;  4NDB A;  5AXI A;  3FS7 A;  4PHK A;  2F3Y A;  1JFK A;  1J1E A;  2JT8 A;  2WOR A;  2BE4 A;  3ZNI A;  2L0P A;  5PAL A;  2M7L A;  1PSR A;  1ZAC A;  2IS9 A;  1CDN A;  2ZFD A;  4TNC A;  5KTY A;  2M8U A;  1JBA A;  1YX8 A;  1NWD A;  2Y1M A;  1CMF A;  3DVJ A;  4P2Y B;  5I2L A;  1XFU O;  2NLN A;  1XFZ O;  1KQM C;  2F8P A;  3TS5 B;  5DKR A;  1QTX A;  2WC8 A;  3D0Y A;  1N0Y A;  1K94 A;  1G33 A;  5HLV A;  3LCP C;  1OZS A;  2LUC A;  2NCO A;  4A4B A;  1DJI A;  1UHJ A;  1K93 D;  1NX0 A;  2I2R E;  3CR4 X;  4AQJ A;  4ZCV A;  3PN7 B;  1S1E A;  1CDM A;  2JZI A;  2FOT A;  1J7Q A;  2K2F A;  1IKU A;  2ZN9 A;  1A75 A;  5CSF A;  3TDZ A;  1TCO B;  2LHI A;  4PE4 A;  2BL0 C;  3SIB A;  2LE9 B;  1M63 B;  2AMI A;  1R6P A;  2VRG A;  4I5J A;  2V53 A;  3CGA A;  2Q4U A;  5CSI A;  3EVU A;  3I5F C;  4L9M A;  4F0Z B;  4C0L A;  1QIW A;  4YI8 A;  2O60 A;  1TIZ A;  3VGO A;  4ORA B;  3D10 A;  1F70 A;  1KFU S;  4NQG A;  4CPV A;  1QXP A;  2R2I A;  3DD4 A;  2JC2 A;  1EL4 A;  2JT3 A;  2ZKM X;  3FWB A;  3K21 A;  5F6T A;  4MLW A;  2M1K B;  4CLN A;  3I5I C;  2BKH B;  3H4S E;  3IQQ A;  3O2P A;  2KAV A;  2WCF A;  1XYD A;  1B9A A;  3EKJ A;  2P6B B;  3CTN A;  2BCB A;  2FJU B;  1SCM B;  2LNK A;  3O78 A;  1CM1 A;  2I7A A;  5KU1 A;  1YUU A;  3I5G C;  2L4I A;  3TZ1 A;  1W7J B;  3PSR A;  1SW8 A;  3SJS A;  1PAL A;  1FBV A;  2KFF A;  4PDZ A;  1TOP A;  1G4Y R;  1HQV A;  4FQO A;  4UPG A;  4DIR A;  1U5I B;  1EJ3 A;  5JJG A;  3VRP A;  1OQP A;  3LK0 A;  3CWG A;  1KWO B;  4MRX A;  1QJT A;  3EK4 A;  5J3X A;  1B47 A;  1QAS A;  3I5H C;  1NSH A;  1B7T Y;  4USL A;  3TUY C;  2ZRS A;  5D69 A;  2K8M B;  2KI6 C;  1AJ5 A;  5TNC A;  3KF9 A;  2K7B A;  3ZWH A;  5JOL A;  1CM4 A;  2L51 A;  2K61 A;  1S6C A;  1CLM A;  1A2X A;  2NXQ A;  1ZFS A;  1W7I B;  3ICB A;  4OCI A;  2G2B A;  3C1V A;  4MVF A;  1OSA A;  5DKN A;  4MRY A;  1KK7 Y;  1SY9 A;  1DF0 B;  2TN4 A;  2WCB A;  3GK4 X;  4HRE E;  3BOW A;  2M29 A;  5HLO A;  3KEV A;  2I18 A;  2L4H A;  5DKQ A;  1YR5 A;  2HF5 A;  2LVJ A;  4ORB B;  4WRI A;  1YRU B;  1IJ6 A;  3VRQ A;  1WLM A;  1M39 A;  1SL8 A;  1YX7 A;  5GQQ C;  4P5O E;  1MXE A;  2OTG B;  2F2O A;  2F3Z A;  3OB1 B;  1B7T Z;  1B8L A;  2KAX A;  2SCP A;  1BF5 A;  4GAO A;  1NIW A;  2E30 A;  3LL8 B;  2BCA A;  1REC A;  1F54 A;  4I5K A;  1GQM A;  1V1F A;  4FTG A;  2Q91 A;  2JXC A;  5HKZ A;  4BY4 A;  2LAP A;  5BPJ A;  1KK7 Z;  4PHM A;  2CT9 A;  2MA2 A;  1FW4 A;  2L50 A;  1CKK A;  2OS8 B;  1G8I A;  1MXL C;  3PAL A;  2I94 A;  2KOT A; 
#chains in the Genus database with same CATH topology
 3SG2 A;  3NSL A;  4BY5 A;  1KQM B;  1CLL A;  3GOF A;  3EVV A;  2EC6 C;  1QX2 A;  4Q04 A;  2MBX A;  1DJY A;  1JF0 A;  1PUL A;  2ERB A;  3NSO A;  2QDI A;  1LA0 A;  3DXL A;  1Y1X A;  1ODB A;  3NSK A;  1XK4 C;  1ZOT B;  1ALV A;  2LAN A;  3DYE A;  3V2L A;  5G08 A;  2JPT A;  1M45 A;  3OGN A;  4QJ3 B;  1E8A A;  1TNW A;  3NHI A;  1DEK A;  1CFD A;  3L4A A;  1P28 A;  1SL7 A;  4OVN F;  4C0K A;  4DS7 A;  2E6W A;  2HQ8 A;  1L2O C;  3JTD C;  1LKJ A;  2BL0 B;  1SKT A;  1S6I A;  2WCE A;  2KFH A;  2LVV A;  1WDC B;  1NX1 A;  1A29 A;  2LV7 A;  4GGF C;  1H8B A;  1K2H A;  2FCD A;  1TNP A;  2ZN8 A;  3DVK A;  1SBJ A;  3I5F B;  2PSR A;  3RM1 A;  1UHN A;  1TNQ A;  1DT7 B;  4CFR A;  1C7V A;  1WRL A;  3R1P A;  2FCE A;  1M46 A;  2QPT A;  3WNX B;  3LLE A;  1UUR A;  4WQ3 A;  2GV5 A;  4FQT A;  1IG5 A;  1KFU L;  5I94 A;  3UNW A;  1KK8 C;  4IL1 A;  1F4O A;  5CSN A;  1KQV A;  3GK2 A;  4MSP A;  3GK1 A;  1NPQ A;  2JNF A;  1UWO A;  2KI6 D;  3CR5 X;  3D0Y B;  3PM2 A;  1LIN A;  1SCV A;  1OOH A;  3CLN A;  2LLU A;  2BE6 A;  4JD9 A;  4PHN A;  3IQO A;  4AOM A;  2Y5I A;  1NP8 A;  5ER4 X;  3SS4 A;  2JQ6 A;  1EXR A;  1CDP A;  2OPO A;  3TDU A;  2F2P A;  2LMV A;  4GNK B;  4D1E A;  1MUX A;  1QWV A;  2PVB A;  1CFP A;  2ISD A;  1B8R A;  3SG7 A;  4F7F A;  1ZUZ A;  1XFX O;  2LVI A;  2KBM A;  5AEQ A;  1A75 B;  1EG3 A;  3LK1 A;  3VRN A;  1GGW A;  3JVT B;  1BR1 B;  2PAS A;  1YTZ C;  3HX4 A;  2RGI A;  3SG5 A;  3PN7 C;  1H4B A;  1QIV A;  1B4C A;  2WND A;  2LHL A;  3VRR A;  5HYD A;  3IVT A;  3B6X A;  4PAL A;  1BMO A;  2BAP A;  1AP4 A;  1CNP A;  4YGD B;  3CS1 A;  3NGV A;  3OP0 A;  3TUY B;  1CB1 A;  1QS7 A;  1NUB A;  3FIA A;  5HKY A;  1F55 A;  1K95 A;  2LM5 A;  5DIC A;  2CNP A;  2QAC A;  5I2Q A;  1QVI Y;  5I8N A;  3BYA A;  2M1U A;  3D74 A;  3NXA A;  1RFJ A;  4WQ2 A;  4YBH B;  5ER5 A;  4ETO A;  1TRF A;  1SR6 B;  3UO9 A;  1TNX A;  2K60 A;  3A4U B;  1RWY A;  2BCX A;  4I5N B;  3KPX A;  3AKA A;  1FI6 A;  1JUO A;  1OOJ A;  3A8R A;  1DJX A;  1RRO A;  1XFV O;  4ORC B;  3KHE A;  5FYX A;  4QJ4 B;  1F71 A;  4NDD A;  3BXK A;  2KYC A;  2LMU A;  3DY9 A;  4U8D A;  4GBA A;  1XA5 A;  1S3P A;  1DEL A;  4N1F A;  1B1G A;  2CXJ A;  2KQ6 A;  1AVS A;  2KGR A;  3IF7 A;  1XFR A;  1DTL A;  1DJH A;  1F4Q A;  4JWQ A;  5I2O A;  3BQ3 A;  1YUR A;  1BG1 A;  1WLZ A;  2JNX A;  1KSM A;  2BKI B;  2KSP A;  5AER A;  2KYF A;  1NYA A;  1T14 A;  3DF0 A;  1XK4 A;  3DVM A;  3OHM B;  2MHH A;  1BR4 B;  2NCP A;  1CFC A;  3CZT X;  1J1D A;  3O4Y A;  1C7W A;  2M0R A;  1CTR A;  2L5X B;  2MLE C;  5EL2 A;  1OOF A;  4E68 A;  3OBV A;  1A03 A;  2FJY A;  4XJK A;  3EK7 A;  1V1G A;  2JRF A;  1UP5 A;  1S26 D;  2LCP A;  2EHB A;  1AUI B;  4MN0 A;  1SNL A;  1IQ3 A;  1Y1A A;  2BEC A;  3QME A;  3OX6 A;  1UHI A;  2AUC A;  3EVR A;  3SIA A;  2HQW A;  3CZ1 A;  4GGF A;  4DUQ A;  1QV1 A;  5FI7 A;  5B8I B;  2DOQ A;  2EC6 B;  1C3Y A;  1HT9 A;  3BOW B;  1BLQ A;  1LA3 A;  4CFQ A;  5KSZ A;  2LP2 A;  1J7R A;  4GUK A;  4MBE A;  4MZL A;  4C0J A;  1RJV A;  4HSZ A;  4JPZ B;  1J55 A;  2BNX A;  1NCX A;  1MHO A;  1NX3 A;  1YVH A;  1JC2 A;  1QAT A;  1PK0 D;  1YVL A;  1B8C A;  2M97 A;  1K90 D;  1IGV A;  1FF1 A;  1BT6 A;  2KGB C;  2CTN A;  1F8H A;  1SPY A;  2LVK A;  1R2U A;  1GJY A;  3MSE B;  1Z2C B;  1TN4 A;  4IJ7 A;  4PE7 A;  2K2A A;  4MZK A;  3S0B A;  4M2P A;  4XYN A;  4HRG A;  1JWD A;  1MQ1 A;  2OTG C;  3BFA A;  2K7D A;  1BJF A;  1OMR A;  1RK9 A;  1CFF A;  1MR8 A;  2MJW B;  1S5G Y;  2G9B A;  2A4J A;  2JU0 A;  3FE9 A;  4QJ5 B;  1TCF A;  2B1U A;  1OW4 A;  2KLD A;  2LC5 A;  1KK8 B;  1D1O A;  4I5L B;  2LP3 A;  5AAN A;  2GGZ A;  1DJZ A;  2D8N A;  1NX2 A;  1IWQ A;  3E3R A;  3O4X A;  2Y4Q A;  3CR2 A;  1J7O A;  2KI4 C;  2OS8 C;  3FWC A;  1WRK A;  1GM0 A;  2JT0 A;  3R72 A;  4MEW A;  3WHU B;  1DGV A;  3SG6 A;  1SK6 D;  1XO5 A;  1M31 A;  1AHR A;  1TUJ A;  1JF2 A;  1TTX A;  1W9Z A;  2KFG A;  3CZ2 A;  3EKH A;  1Y0V H;  2BBN A;  2ZND A;  1PVA A;  2H61 C;  3HCM A;  2KPH A;  2GGM A;  3WHT B;  2MLF C;  3SS3 A;  1PRW A;  3PM8 A;  4OZD A;  3I5G B;  1MF8 B;  1YUT A;  5CSJ A;  1S5G Z;  4M2Q A;  1BOD A;  3I5I B;  3TS5 C;  2WOS A;  1WY9 A;  2PMY A;  5K89 A;  1SYM A;  2JUL A;  1Q80 A;  3L47 A;  4HRH A;  2KAY A;  3AAJ A;  2KLE A;  1XFY O;  1DJW A;  1OE9 B;  1VRK A;  3S0F A;  1WDC C;  1KSO A;  1Y6W A;  2H8V A;  4PE1 A;  3EK8 A;  3RLZ A;  4NDC A;  4YGA A;  3WXA A;  2KHN A;  2EGD A;  1K96 A;  1CMG A;  1QLS A;  3M0W A;  2ZNE A;  2JOJ A;  1K9U A;  1C07 A;  2M9G A;  2MAZ A;  2AAO A;  2M3W A;  3I5H B;  5IBW A;  1KCY A;  1ALW A;  1U5I A;  1A4P A;  5AFP A;  1XFW O;  2CCM A;  4AQI A;  3DZT A;  2NZ0 A;  1EH2 A;  3BUM B;  3BJH A;  2F33 A;  3OX5 A;  1IJ5 A;  3S0D A;  1TUZ A;  4M2O A;  3B87 A;  4INX A;  5CPV A;  1K9P A;  4R1E A;  2KDH A;  3SG3 A;  2PRU A;  1QX5 B;  2K7O A;  2KBI A;  2WCH A;  3PLF B;  1SMG A;  4YGC B;  1IIO A;  2JTZ A;  3EG5 B;  4GGN A;  1KFX L;  2PAL A;  1EG4 A;  5HKW A;  1UHH A;  2LLT A;  1DF0 A;  4YGE B;  1S6J A;  1SRA A;  2M7N A;  3PFV A;  2BBM A;  4GPL B;  2ZRT A;  4ICB A;  4INW A;  2WCJ A;  4YGB B;  1K8U A;  3F45 A;  1SCM C;  2K7C A;  3JVT C;  1KFX S;  1RTP 1;  1AJ4 A;  1YUS A;  1OOG A;  1SSE B;  1S36 A;  1DMO A;  1L7Z A;  4N5X A;  1JSA A;  3OB2 B;  1IQ5 A;  4JQ0 D;  1FI5 A;  1ZMZ A;  3RZS A;  1Y1U A;  1OZO A;  4OV2 A;  1IH0 A;  1QVI Z;  2MRD A;  3BUO B;  1Z4H A;  2CBL A;  2HET A;  1OMD A;  1CDL A;  1XVJ A;  4YI9 A;  1SL9 A;  2COL B;  3BUW B;  4ZCU A;  4YRU A;  4PT1 A;  2JWW A;  1LXF C;  1UUS A;  1KWO C;  2QEV A;  3BFH A;  1CLB A;  3NSI A;  3CDN A;  2JTT A;  1SR6 C;  2O5G A;  2Y1N A;  3Q8I A;  1AK8 A;  1DGU A;  4PE0 A;  3BFB A;  1DVI A;  1K9K A;  2KNE A;  3SG4 A;  3O6B A;  1DC1 A;  2L2E A;  1QV0 A;  2H2K A;  2M49 B;  3KO0 A;  5HL1 A;  1N2D A;  1GGZ A;  1DJG A;  2L98 A;  1J7P A;  2KQY A;  4PHJ A;  2LLS A;  5D7F A;  2GTE A;  2SAS A;  3BUN B;  4MZJ A;  4OR9 B;  5FI2 A;  1LVC D;  3DF0 B;  2L5Y A;  1BOC A;  1FPW A;  1WRZ A;  1YRT B;  2JXL A;  4CID A;  1N65 A;  1PSB A;  2LMT A;  4OKH A;  1QX7 A;  2HPS A;  3K1E A;  3AKB A;  1OMV A;  3VB1 A;  1BU3 A;  4XJK B;  4A4C A;  1QLK A;  4GFT A;  3VRO A;  1X02 A;  2QEB A;  4DCK A;  1JFJ A;  2H61 A;  1L2O B;  3B86 A;  1NCY A;  3JTD B;  1PVB A;  2LUX A;  2K0J A;  3D73 A;  1UHK A;  3FE8 A;  4N1G A;  1LS8 A;  1NCZ A;  3PAT A;  3DVE A;  2KI4 B;  1MWN A;  3QRX A;  3BUX B;  3TDI A;  4PCW A;  1IRJ A;  3AAK A;  4NDB A;  5AXI A;  3FS7 A;  4PHK A;  2F3Y A;  1JFK A;  1J1E A;  2JT8 A;  2WOR A;  2BE4 A;  3ZNI A;  2L0P A;  5PAL A;  3CYZ A;  2M7L A;  1PSR A;  1ZAC A;  2IS9 A;  2YGU A;  1CDN A;  2ZFD A;  4TNC A;  2P71 A;  2M8U A;  5KTY A;  1JBA A;  1YX8 A;  1NWD A;  2Y1M A;  1CMF A;  3DVJ A;  4P2Y B;  5I2L A;  1XFU O;  1ORG A;  2NLN A;  1XFZ O;  1KQM C;  2F8P A;  3CAB A;  1OOI X;  3S0E A;  5DKR A;  1QTX A;  2WC8 A;  3D0Y A;  2QEH A;  1N0Y A;  3TS5 B;  1K94 A;  1G33 A;  5HLV A;  3LCP C;  1OZS A;  2LUC A;  2NCO A;  4A4B A;  1DJI A;  1UHJ A;  1K93 D;  1NX0 A;  2I2R E;  3CR4 X;  4AQJ A;  4ZCV A;  3PN7 B;  1S1E A;  1CDM A;  2JZI A;  2FOT A;  1J7Q A;  2K2F A;  5FI6 A;  2ZN9 A;  1IKU A;  1A75 A;  5CSF A;  3CZ0 A;  1TCO B;  2LHI A;  4PE4 A;  2BL0 C;  3SIB A;  2LE9 B;  3TDZ A;  1M63 B;  3S0G A;  2AMI A;  1R6P A;  2VRG A;  4I5J A;  2V53 A;  3CGA A;  2Q4U A;  5CSI A;  3EVU A;  3I5F C;  4L9M A;  4F0Z B;  4C0L A;  1C3Z A;  1QIW A;  4YI8 A;  2O60 A;  1TIZ A;  3VGO A;  4ORA B;  3D10 A;  1F70 A;  1KFU S;  4NQG A;  4CPV A;  1QXP A;  2R2I A;  3DD4 A;  3NHT A;  2JC2 A;  2L2C A;  1EL4 A;  2JT3 A;  2ZKM X;  3FWB A;  3K21 A;  5F6T A;  4MLW A;  2M1K B;  3PJI A;  2JPO A;  4CLN A;  3I5I C;  2BKH B;  3H4S E;  3IQQ A;  3O2P A;  2KAV A;  2WCF A;  1XYD A;  2WC5 A;  2QEO A;  3SS5 A;  1B9A A;  3EKJ A;  2P6B B;  3CTN A;  2BCB A;  2FJU B;  1SCM B;  2LNK A;  3O78 A;  1CM1 A;  2I7A A;  5KU1 A;  1YUU A;  1DQE A;  3I5G C;  2L4I A;  3TZ1 A;  1W7J B;  4KYN A;  3PSR A;  1SW8 A;  3SJS A;  1PAL A;  3D75 A;  2WCK A;  1FBV A;  2KFF A;  4PDZ A;  3B7A A;  1TOP A;  1G4Y R;  1HQV A;  4FQO A;  3B88 A;  4DIR A;  4UPG A;  1U5I B;  1EJ3 A;  2PYQ A;  5JJG A;  3VRP A;  1OQP A;  3LK0 A;  3CWG A;  1KWO B;  2WC6 A;  4MRX A;  1QJT A;  3EK4 A;  5J3X A;  1B47 A;  1QAS A;  3I5H C;  1NSH A;  1B7T Y;  4DRW A;  4USL A;  3TUY C;  2ZRS A;  5D69 A;  2K8M B;  2KI6 C;  1AJ5 A;  3R1O A;  5TNC A;  3KF9 A;  2K7B A;  3ZWH A;  5JOL A;  1CM4 A;  2L51 A;  2K61 A;  3D77 A;  1S6C A;  1CLM A;  1A2X A;  2NXQ A;  1ZFS A;  1W7I B;  3ICB A;  4OCI A;  2G2B A;  3C1V A;  4MVF A;  1OSA A;  5DKN A;  4MRY A;  1KK7 Y;  1SY9 A;  1DF0 B;  2TN4 A;  2WCB A;  3GK4 X;  4HRE E;  3BOW A;  3R1V A;  2M29 A;  5HLO A;  3KEV A;  2I18 A;  2L4H A;  5DKQ A;  1YR5 A;  2HF5 A;  2PQL A;  2LVJ A;  3N7H A;  4ORB B;  4WRI A;  1YRU B;  3S0A A;  1IJ6 A;  3VRQ A;  1WLM A;  1M39 A;  1SL8 A;  3FE6 A;  1TWO A;  1YX7 A;  5GQQ C;  4P5O E;  1MXE A;  2OTG B;  5D3O A;  3L4L A;  2F2O A;  2F3Z A;  3OB1 B;  1B7T Z;  1B8L A;  2KAX A;  3D78 A;  2SCP A;  1BF5 A;  4GAO A;  1NIW A;  2E30 A;  3LL8 B;  2BCA A;  1REC A;  2WCM A;  1F54 A;  4I5K A;  1GQM A;  1V1F A;  4FTG A;  2Q91 A;  2JXC A;  5HKZ A;  4BY4 A;  3D76 A;  2LAP A;  2P70 A;  5BPJ A;  1KK7 Z;  2WCL A;  4PHM A;  2CT9 A;  2MA2 A;  1FW4 A;  2L50 A;  4JKT A;  1CKK A;  2OS8 B;  1G8I A;  1MXL C;  3PAL A;  2I94 A;  2KOT A; 
#chains in the Genus database with same CATH homology
 3SG2 A;  3NSL A;  4BY5 A;  1KQM B;  1CLL A;  3GOF A;  3EVV A;  2EC6 C;  1QX2 A;  4Q04 A;  2MBX A;  1DJY A;  1JF0 A;  1PUL A;  3NSO A;  1LA0 A;  1Y1X A;  1ODB A;  3NSK A;  1XK4 C;  1ZOT B;  1ALV A;  2LAN A;  5G08 A;  2JPT A;  1M45 A;  4QJ3 B;  1E8A A;  1TNW A;  1CFD A;  1SL7 A;  4OVN F;  4C0K A;  4DS7 A;  2E6W A;  2HQ8 A;  1L2O C;  3JTD C;  1LKJ A;  2BL0 B;  1SKT A;  1S6I A;  2WCE A;  2KFH A;  2LVV A;  1WDC B;  1NX1 A;  1A29 A;  2LV7 A;  4GGF C;  1H8B A;  1K2H A;  2FCD A;  1TNP A;  2ZN8 A;  3DVK A;  1SBJ A;  3I5F B;  2PSR A;  3RM1 A;  1UHN A;  1TNQ A;  1DT7 B;  4CFR A;  1C7V A;  1WRL A;  2FCE A;  1M46 A;  2QPT A;  3WNX B;  3LLE A;  1UUR A;  4WQ3 A;  2GV5 A;  1IG5 A;  1KFU L;  1KK8 C;  4IL1 A;  1F4O A;  5CSN A;  1KQV A;  3GK2 A;  4MSP A;  3GK1 A;  1NPQ A;  2JNF A;  1UWO A;  2KI6 D;  3CR5 X;  3D0Y B;  1LIN A;  1SCV A;  3CLN A;  2LLU A;  2BE6 A;  4PHN A;  3IQO A;  4AOM A;  2Y5I A;  1NP8 A;  5ER4 X;  2JQ6 A;  1EXR A;  1CDP A;  2OPO A;  3TDU A;  2F2P A;  2LMV A;  4GNK B;  4D1E A;  1MUX A;  2PVB A;  1CFP A;  2ISD A;  1B8R A;  3SG7 A;  1ZUZ A;  1XFX O;  2LVI A;  2KBM A;  5AEQ A;  1A75 B;  1EG3 A;  3LK1 A;  3VRN A;  1GGW A;  3JVT B;  1BR1 B;  2PAS A;  1YTZ C;  3HX4 A;  2RGI A;  3SG5 A;  3PN7 C;  1H4B A;  1QIV A;  1B4C A;  2WND A;  2LHL A;  3VRR A;  5HYD A;  4PAL A;  1BMO A;  1AP4 A;  1CNP A;  4YGD B;  3CS1 A;  3OP0 A;  3TUY B;  1CB1 A;  1QS7 A;  1NUB A;  3FIA A;  5HKY A;  1F55 A;  1K95 A;  2LM5 A;  2CNP A;  2QAC A;  5I2Q A;  1QVI Y;  5I8N A;  3BYA A;  2M1U A;  3NXA A;  4WQ2 A;  1RFJ A;  4YBH B;  5ER5 A;  4ETO A;  1TRF A;  1SR6 B;  1TNX A;  3A4U B;  1RWY A;  2BCX A;  4I5N B;  3KPX A;  3AKA A;  1FI6 A;  1JUO A;  1OOJ A;  3A8R A;  1DJX A;  1RRO A;  1XFV O;  4ORC B;  3KHE A;  5FYX A;  4QJ4 B;  1F71 A;  4NDD A;  3BXK A;  2KYC A;  2LMU A;  4U8D A;  4GBA A;  1XA5 A;  1S3P A;  4N1F A;  1B1G A;  2CXJ A;  2KQ6 A;  1AVS A;  2KGR A;  3IF7 A;  1DTL A;  1DJH A;  1F4Q A;  4JWQ A;  5I2O A;  3BQ3 A;  1YUR A;  1BG1 A;  1WLZ A;  2JNX A;  1KSM A;  2BKI B;  2KSP A;  5AER A;  2KYF A;  1NYA A;  3DF0 A;  3DVM A;  1XK4 A;  3OHM B;  2MHH A;  1BR4 B;  2NCP A;  1CFC A;  3CZT X;  1J1D A;  3O4Y A;  1C7W A;  2M0R A;  1CTR A;  2L5X B;  2MLE C;  4E68 A;  1A03 A;  4XJK A;  3EK7 A;  1V1G A;  2JRF A;  1UP5 A;  1S26 D;  2LCP A;  2EHB A;  1AUI B;  4MN0 A;  1SNL A;  1IQ3 A;  1Y1A A;  2BEC A;  3OX6 A;  1UHI A;  2AUC A;  3EVR A;  3SIA A;  2HQW A;  4GGF A;  4DUQ A;  1QV1 A;  5B8I B;  2DOQ A;  2EC6 B;  1HT9 A;  3BOW B;  1BLQ A;  1LA3 A;  4CFQ A;  5KSZ A;  2LP2 A;  1J7R A;  4GUK A;  4MBE A;  4MZL A;  4C0J A;  1RJV A;  4HSZ A;  4JPZ B;  1J55 A;  1NCX A;  1MHO A;  1NX3 A;  1YVH A;  1JC2 A;  1QAT A;  1PK0 D;  1YVL A;  1B8C A;  2M97 A;  1K90 D;  1IGV A;  1FF1 A;  1BT6 A;  2KGB C;  2CTN A;  1F8H A;  1SPY A;  2LVK A;  1R2U A;  1GJY A;  3MSE B;  1TN4 A;  4PE7 A;  2K2A A;  4MZK A;  4M2P A;  4XYN A;  4HRG A;  1JWD A;  1MQ1 A;  2OTG C;  2K7D A;  1BJF A;  1OMR A;  1RK9 A;  1CFF A;  1MR8 A;  2MJW B;  1S5G Y;  2G9B A;  2A4J A;  2JU0 A;  4QJ5 B;  1TCF A;  2B1U A;  2LC5 A;  1KK8 B;  1D1O A;  4I5L B;  2LP3 A;  5AAN A;  2GGZ A;  1DJZ A;  2D8N A;  1NX2 A;  1IWQ A;  3E3R A;  2Y4Q A;  3CR2 A;  1J7O A;  2KI4 C;  2OS8 C;  3FWC A;  1WRK A;  2JT0 A;  4MEW A;  3WHU B;  1DGV A;  3SG6 A;  1SK6 D;  1XO5 A;  1M31 A;  1AHR A;  2KFG A;  1JF2 A;  1TTX A;  3EKH A;  3I5I B;  1Y0V H;  2BBN A;  2ZND A;  1PVA A;  2H61 C;  3HCM A;  2GGM A;  3WHT B;  2MLF C;  1PRW A;  3PM8 A;  3I5G B;  1MF8 B;  1YUT A;  5CSJ A;  1S5G Z;  4M2Q A;  1BOD A;  3TS5 C;  2WOS A;  1WY9 A;  2PMY A;  5K89 A;  1SYM A;  2JUL A;  1Q80 A;  4HRH A;  2KAY A;  3AAJ A;  1XFY O;  1DJW A;  1OE9 B;  1VRK A;  1WDC C;  1KSO A;  1Y6W A;  4PE1 A;  3EK8 A;  3RLZ A;  4NDC A;  4YGA A;  3WXA A;  2KHN A;  2EGD A;  1K96 A;  1CMG A;  1QLS A;  3M0W A;  2ZNE A;  2JOJ A;  1K9U A;  1C07 A;  2M9G A;  2MAZ A;  2AAO A;  2M3W A;  3I5H B;  5IBW A;  1KCY A;  1ALW A;  1U5I A;  1A4P A;  5AFP A;  1XFW O;  2CCM A;  4AQI A;  2NZ0 A;  1EH2 A;  3BUM B;  2F33 A;  3OX5 A;  1IJ5 A;  4M2O A;  5CPV A;  1K9P A;  4R1E A;  2KDH A;  3SG3 A;  2PRU A;  1QX5 B;  2K7O A;  2KBI A;  3PLF B;  1SMG A;  4YGC B;  2JTZ A;  4GGN A;  1KFX L;  2PAL A;  1EG4 A;  5HKW A;  1UHH A;  2LLT A;  1DF0 A;  4YGE B;  1S6J A;  1SRA A;  2M7N A;  3PFV A;  2BBM A;  4GPL B;  2ZRT A;  4ICB A;  4YGB B;  1K8U A;  3F45 A;  1SCM C;  2K7C A;  3JVT C;  1KFX S;  1RTP 1;  1AJ4 A;  1YUS A;  1S36 A;  1DMO A;  1L7Z A;  4N5X A;  1JSA A;  3OB2 B;  1IQ5 A;  4JQ0 D;  1FI5 A;  1ZMZ A;  1Y1U A;  1OZO A;  4OV2 A;  1IH0 A;  1QVI Z;  2MRD A;  3BUO B;  2CBL A;  2HET A;  1OMD A;  1CDL A;  1XVJ A;  4YI9 A;  1SL9 A;  2COL B;  3BUW B;  4ZCU A;  4YRU A;  2JWW A;  1LXF C;  1UUS A;  1KWO C;  1CLB A;  3NSI A;  2JTT A;  1SR6 C;  2O5G A;  2Y1N A;  1AK8 A;  1DGU A;  4PE0 A;  1DVI A;  1K9K A;  2KNE A;  3SG4 A;  3O6B A;  2L2E A;  1QV0 A;  2H2K A;  2M49 B;  3KO0 A;  1N2D A;  1GGZ A;  1DJG A;  2L98 A;  1J7P A;  2KQY A;  4PHJ A;  2LLS A;  5D7F A;  4DRW A;  2SAS A;  3BUN B;  4MZJ A;  4OR9 B;  1LVC D;  3DF0 B;  1BOC A;  1FPW A;  1WRZ A;  1YRT B;  2JXL A;  4CID A;  1N65 A;  1PSB A;  2LMT A;  4OKH A;  1QX7 A;  2HPS A;  3AKB A;  1OMV A;  1BU3 A;  4XJK B;  4A4C A;  1QLK A;  4GFT A;  3VRO A;  1X02 A;  4DCK A;  1JFJ A;  2H61 A;  1L2O B;  3JTD B;  1NCY A;  1PVB A;  2LUX A;  2K0J A;  1UHK A;  4N1G A;  1NCZ A;  3PAT A;  3DVE A;  2KI4 B;  1MWN A;  3QRX A;  3BUX B;  3TDI A;  4PCW A;  1IRJ A;  3AAK A;  4NDB A;  5AXI A;  3FS7 A;  4PHK A;  2F3Y A;  1JFK A;  1J1E A;  2JT8 A;  2WOR A;  2BE4 A;  3ZNI A;  2L0P A;  5PAL A;  2M7L A;  1PSR A;  1ZAC A;  2IS9 A;  1CDN A;  2ZFD A;  4TNC A;  5KTY A;  2M8U A;  1JBA A;  1YX8 A;  1NWD A;  2Y1M A;  1CMF A;  3DVJ A;  4P2Y B;  5I2L A;  1XFU O;  2NLN A;  1XFZ O;  1KQM C;  2F8P A;  3TS5 B;  5DKR A;  1QTX A;  2WC8 A;  3D0Y A;  1N0Y A;  1K94 A;  1G33 A;  5HLV A;  3LCP C;  1OZS A;  2LUC A;  2NCO A;  4A4B A;  1DJI A;  1UHJ A;  1K93 D;  1NX0 A;  2I2R E;  3CR4 X;  4AQJ A;  4ZCV A;  3PN7 B;  1S1E A;  1CDM A;  2JZI A;  2FOT A;  1J7Q A;  2K2F A;  1IKU A;  2ZN9 A;  1A75 A;  5CSF A;  3TDZ A;  1TCO B;  2LHI A;  4PE4 A;  2BL0 C;  3SIB A;  2LE9 B;  1M63 B;  2AMI A;  1R6P A;  2VRG A;  4I5J A;  2V53 A;  3CGA A;  2Q4U A;  5CSI A;  3EVU A;  3I5F C;  4L9M A;  4F0Z B;  4C0L A;  1QIW A;  4YI8 A;  2O60 A;  1TIZ A;  3VGO A;  4ORA B;  3D10 A;  1F70 A;  1KFU S;  4NQG A;  4CPV A;  1QXP A;  2R2I A;  3DD4 A;  2JC2 A;  1EL4 A;  2JT3 A;  2ZKM X;  3FWB A;  3K21 A;  5F6T A;  4MLW A;  2M1K B;  4CLN A;  3I5I C;  2BKH B;  3H4S E;  3IQQ A;  3O2P A;  2KAV A;  2WCF A;  1XYD A;  1B9A A;  3EKJ A;  2P6B B;  3CTN A;  2BCB A;  2FJU B;  1SCM B;  2LNK A;  3O78 A;  1CM1 A;  2I7A A;  5KU1 A;  1YUU A;  3I5G C;  2L4I A;  3TZ1 A;  1W7J B;  3PSR A;  1SW8 A;  3SJS A;  1PAL A;  1FBV A;  2KFF A;  4PDZ A;  1TOP A;  1G4Y R;  1HQV A;  4FQO A;  4UPG A;  4DIR A;  1U5I B;  1EJ3 A;  5JJG A;  3VRP A;  1OQP A;  3LK0 A;  3CWG A;  1KWO B;  4MRX A;  1QJT A;  3EK4 A;  5J3X A;  1B47 A;  1QAS A;  3I5H C;  1NSH A;  1B7T Y;  4USL A;  3TUY C;  2ZRS A;  5D69 A;  2K8M B;  2KI6 C;  1AJ5 A;  5TNC A;  3KF9 A;  2K7B A;  3ZWH A;  5JOL A;  1CM4 A;  2L51 A;  2K61 A;  1S6C A;  1CLM A;  1A2X A;  2NXQ A;  1ZFS A;  1W7I B;  3ICB A;  4OCI A;  2G2B A;  3C1V A;  4MVF A;  1OSA A;  5DKN A;  4MRY A;  1KK7 Y;  1SY9 A;  1DF0 B;  2TN4 A;  2WCB A;  3GK4 X;  4HRE E;  3BOW A;  2M29 A;  5HLO A;  3KEV A;  2I18 A;  2L4H A;  5DKQ A;  1YR5 A;  2HF5 A;  2LVJ A;  4ORB B;  4WRI A;  1YRU B;  1IJ6 A;  3VRQ A;  1WLM A;  1M39 A;  1SL8 A;  1YX7 A;  5GQQ C;  4P5O E;  1MXE A;  2OTG B;  2F2O A;  2F3Z A;  3OB1 B;  1B7T Z;  1B8L A;  2KAX A;  2SCP A;  1BF5 A;  4GAO A;  1NIW A;  2E30 A;  3LL8 B;  2BCA A;  1REC A;  1F54 A;  4I5K A;  1GQM A;  1V1F A;  4FTG A;  2Q91 A;  2JXC A;  5HKZ A;  4BY4 A;  2LAP A;  5BPJ A;  1KK7 Z;  4PHM A;  2CT9 A;  2MA2 A;  1FW4 A;  2L50 A;  1CKK A;  2OS8 B;  1G8I A;  1MXL C;  3PAL A;  2I94 A;  2KOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...