1KWOC

Scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoC02
1IQ3A 3I5FB 4MEWA 4AQJA 4DUQA 1UUSA 1J1EA 2COLB 3ZWHA 1NCYA 4GAOA 1PVBA 1IGVA 2GGZA 1NSHA 1QLKA 1FF1A 1G8IA 2LVVA 1KQMB 1DJHA 1KK7Z 1TNWA 2OTGC 2VRGA 1KSOA 2R2IA 1FW4A 1CLBA 2L50A 3AAKA 1A75B 1DJZA 3SG7A 4HSZA 1DMOA 4ZCVA 5CSJA 3VRNA 4C0JA 1NX3A 1SYMA 1NUBA 2JC2A 2K61A 4MZJA 3RM1A 3TDUA 1QIVA 1KWOB 1J7RA 1WRZA 4FTGA 1UHJA 4MZLA 1G33A 3EK7A 3I5GC 3GK2A 5AXIA 2Y1MA 4YGEB 2BL0B 2FOTA 4ETOA 3WHTB 1E8AA 1ALWA 1NYAA 2BCAA 3NSIA 5HLOA 1F4OA 1TIZA 1YX8A 3BUWB 1AUIB 1WDCC 1CFCA 2LLSA 1K9PA 2EGDA 3CR2A 1OMDA 4ORBB 2WCFA 1DJYA 3H4SE 3DF0B 1TRFA 2P6BB 3SG4A 3JVTC 4CFRA 5B8IB 1IKUA 2PRUA 2B1UA 2I18A 1DGVA 3OX5A 3KO0A 2MBXA 2O60A 2L0PA 2MLEC 5KTYA 4PE0A 1EH2A 4Q04A 5GQQC 1M63B 2HQ8A 2JTTA 4PHMA 3TUYB 1CDNA 1SK6D 1F71A 2L4HA 1MXEA 4OV2A 1NX0A 5JJGA 1QATA 2KBMA 3IQOA 1TCFA 3SG3A 2KNEA 1CFDA 1CMFA 1K94A 2WOSA 2JT0A 1ZOTB 1XVJA 5HLVA 1N0YA 1K90D 1SCMC 2JULA 1BMOA 3O78A 3HCMA 1VRKA 1QXPA 2ZRSA 3VRQA 2KFFA 1CDPA 2ZRTA 2KFGA 1DT7B 2L51A 2M0RA 3E3RA 3PSRA 5AERA 2M1KB 3EVUA 1XK4A 1WDCB 4M2PA 1S5GZ 1K8UA 2LM5A 2LP3A 4OCIA 3KF9A 2HPSA 1ZFSA 1QX5B 1SPYA 1SL9A 5PALA 1L2OB 3KHEA 4OR9B 4ORAB 4NDDA 1MF8B 1SNLA 2MRDA 1J7PA 4YGCB 3PN7C 1K9UA 2ZFDA 3PM8A 4PDZA 3PALA 1EG4A 1NWDA 2KAVA 1QX2A 2MA2A 3C1VA 2JT3A 4DS7A 1MWNA 1A03A 3O4YA 4XYNA 4JQ0D 3DVEA 1CDMA 2CTNA 2CCMA 1BG1A 4GUKA 1B47A 4YI9A 5DKNA 1NIWA 2JWWA 4OKHA 1S1EA 1WLZA 1KQVA 1KSMA 1F4QA 3DD4A 2LCPA 3PLFB 2F33A 2A4JA 4TNCA 4YRUA 1MXLC 1IJ5A 4GFTA 1AHRA 5DKRA 5I8NA 1PRWA 1GGZA 2K7CA 3O2PA 5KU1A 3A4UB 2JXCA 3SIAA 2KQ6A 2K7OA 4N1GA 3BUOB 3EKHA 2JZIA 1W7JB 5J3XA 1B8LA 1PVAA 2D8NA 1TTXA 2LMTA 3TDZA 1PK0D 1IJ6A 1CKKA 1NCZA 1TCOB 3CLNA 1B4CA 2L4IA 1MUXA 2KYFA 3CR4X 1CLMA 4C0KA 1DJIA 2HQWA 4QJ5B 3BUXB 2KSPA 3DVMA 2GGMA 1XK4C 1SMGA 1S36A 2LV7A 4R1EA 2JOJA 5D7FA 3FS7A 1K96A 2KAYA 2LAPA 2BCBA 4OVNF 1OQPA 1LA3A 2KGBC 2KI4C 1PULA 2HETA 2KQYA 4PE1A 4XJKA 2M8UA 4I5NB 1GJYA 1HQVA 1GGWA 1NX1A 1SL8A 2EC6C 2I2RE 2M49B 2LC5A 1FBVA 1NP8A 2BKHB 4YI8A 4JWQA 1EL4A 2MLFC 1J7OA 1GQMA 1UP5A 3RLZA 1Y1UA 1ZUZA 2LMUA 4NDBA 2Q4UA 4GBAA 3FIAA 2ZN9A 1RK9A 1JSAA 1QLSA 1H8BA 1CMGA 1BT6A 3ICBA 1LXFC 2M7NA 3GK1A 1Y1XA 1TNQA 1XFVO 5G08A 4CFQA 4A4BA 1RTP1 5AANA 5KSZA 1CDLA 2F2PA 2JT8A 1OZSA 3SG5A 1RFJA 2AAOA 3OB2B 1BR1B 3A8RA 1U5IA 2I7AA 4AQIA 2OS8C 2OTGB 1UHIA 2EC6B 2KFHA 4DIRA 2F3YA 5AEQA 3WXAA 3CS1A 1XFZO 2QPTA 4YGDB 5I2OA 4GPLB 1BLQA 4BY5A 1OZOA 1QVIY 1S6JA 3GOFA 5HKYA 2H2KA 3OB1B 4MRYA 3BQ3A 1V1FA 1DF0A 2JXLA 3KEVA 1JF2A 2JNFA 3I5HC 1HT9A 5DKQA 2KOTA 1AJ4A 1A29A 3I5GB 1KFUS 3F45A 4MSPA 1KFXS 1LA0A 1SW8A 1OOJA 2PMYA 1YVHA 5CPVA 2E6WA 4M2OA 1J1DA 2LUCA 5F6TA 1QV0A 2IS9A 1YRUB 1Y0VH 2LLUA 1QV1A 1IH0A 1XFYO 4E68A 1K2HA 2O5GA 1S6IA 2DOQA 4U8DA 1WRKA 1C07A 3JVTB 2K8MB 2KGRA 4C0LA 2AMIA 1K95A 4PHJA 1EG3A 5HKWA 2K7BA 2K0JA 3I5HB 1KCYA 3VROA 2PALA 3CGAA 2LNKA 1UHKA 1JF0A 1XFXO 1YUSA 2JNXA 4GNKB 1DJGA 2Y5IA 1S6CA 1YVLA 2LUXA 4A4CA 1S26D 3O6BA 2I94A 2LMVA 3BUNB 1SCMB 1SY9A 2ZN8A 4QJ3B 2F3ZA 2M1UA 1BJFA 1V1GA 2ZKMX 1DJWA 5D69A 4D1EA 1OE9B 4MZKA 3VRRA 1SBJA 2MJWB 1YR5A 1B7TY 1QS7A 5HKZA 1FI5A 4XJKB 1NX2A 2WC8A 1BF5A 3BYAA 3FWCA 4CIDA 4WQ3A 1BOCA 3IQQA 2WCBA 2NCPA 3EK8A 3NSKA 3SG2A 1IG5A 4PHNA 1LINA 2KBIA 4PALA 3JTDC 1M45A 2WCEA 1XO5A 1YX7A 3GK4X 3M0WA 1RJVA 1UURA 3EVVA 3TDIA 3NXAA 1YUUA 1CM1A 1MR8A 2WORA 1JC2A 3IF7A 1NPQA 2M97A 1KK8C 3PN7B 1AVSA 2ZNDA 3I5IC 3VRPA 2SCPA 2CXJA 2QACA 2NCOA 2JU0A 2K2FA 2BCXA 2M7LA 4CPVA 3I5FC 2V53A 5TNCA 1K93D 2FJUB 1QX7A 1SKTA 1UHNA 3CWGA 1F55A 1C7VA 1QJTA 2JRFA 2CNPA 2KI6C 2HF5A 4FQOA 1IQ5A 1QIWA 4YGAA 1IRJA 2PSRA 2OPOA 1OMVA 1B9AA 5CSNA 1DVIA 1RROA 2BECA 1PSRA 3QRXA 4BY4A 1F8HA 1M46A 3NSLA 1EXRA 1DF0B 3PFVA 4WRIA 3CTNA 3NSOA 1BR4B 1K9KA 1OMRA 2TN4A 3I5IB 1YTZC 4P5OE 1YRTB 1FI6A 1ZACA 4N5XA 3LL8B 1KWOC 2NLNA 1W7IB 3BOWA 3OX6A 1LKJA 1SL7A 4HREE 1ZMZA 2SASA 2RGIA 1JUOA 3MSEB 1KK7Y 2KDHA 2NZ0A 5JOLA 2BL0C 3WNXB 4I5LB 5K89A 3SJSA 4M2QA 2PVBA 2E30A 4ZCUA 1Q80A 1R6PA 5IBWA 3BUMB 2BKIB 2LP2A 4HRGA 4IL1A 1JFKA 1X02A 4HRHA 2KI4B 1TNXA 2ISDA 1DTLA 1MQ1A 1XFUO 3SIBA 2MHHA 3FWBA 3BXKA 4I5KA 1JBAA 1CFPA 3D10A 5HYDA 5ER4X 2F8PA 5CSIA 1AK8A 3D0YA 2MAZA 1M39A 2FCDA 1WRLA 2LVJA 2H61A 3TUYC 1FPWA 3K21A 4YBHB 4CLNA 2KHNA 4USLA 5AFPA 5ER5A 4UPGA 1J7QA 1RWYA 1RECA 1SR6C 1DGUA 1WLMA 2M9GA 1QVIZ 3OHMB 4MBEA 4NQGA 1B1GA 2G2BA 1XA5A 1R2UA 2KI6D 2K7DA 3HX4A 4DCKA 5I2QA 2EHBA 1N65A 2G9BA 1WY9A 3WHUB 1B8CA 2Y1NA 3EK4A 1AJ5A 4GGFA 1L7ZA 1UWOA 2OS8B 1L2OC 1SRAA 1PALA 1BODA 2NXQA 4DRWA 1BU3A 2LHIA 5FYXA 1TNPA 3TS5C 3LLEA 1YURA 2BBNA 1SR6B 4MRXA 1A75A 1LVCD 1XYDA 3SG6A 1F54A 2Q91A 1S5GY 4PE4A 1CB1A 3AKAA 1CTRA 2KYCA 2LLTA 2BBMA 3EVRA 3KPXA 1CM4A 4JPZB 1J55A 5I2LA 2LE9B 2Y4QA 1UHHA 3CZTX 1QASA 5CSFA 2JTZA 4PHKA 2L98A 1Y6WA 3AAJA 4I5JA 4GGNA 1KFUL 4ICBA 1KFXL 2BE6A 2LHLA 2CT9A 4P2YB 2M29A 2LVKA 1ALVA 3AKBA 4WQ2A 2GV5A 2KAXA 3LCPC 1CFFA 1CLLA 2K2AA 1H4BA 1A4PA 1XFWO 1JWDA 3TS5B 3EKJA 2H61C 1NCXA 1TOPA 2JQ6A 1B7TZ 1JFJA 4MVFA 2PASA 1S3PA 4MN0A 1B8RA 3DF0A 3TZ1A 2FCEA 3BOWB 2LANA 1CNPA 1IWQA 2LVIA 1A2XA 2BE4A 4NDCA 4L9MA 4PCWA 4F0ZB 2AUCA 4MLWA 1C7WA 2F2OA 1EJ3A 4AOMA 1TN4A 1ODBA 1PSBA 3DVJA 1QTXA 3CR5X 2WNDA 1MHOA 4GGFC 1D1OA 1U5IB 3VGOA 3D0YB 1KQMC 1OSAA 1Y1AA 4N1FA 4YGBB 5BPJA 1M31A 1N2DA 1DJXA 3JTDB 1AP4A 4QJ4B 2M3WA 3PATA 3LK1A 2CBLA 1SCVA 2L2EA 1KK8B 3LK0A 4ORCB 3ZNIA 1F70A 2ZNEA 1G4YR 1YUTA 3DVKA 4PE7A 2L5XB 3OP0A 2JPTA
chains in the Genus database with same CATH superfamily
1IQ3A 3I5FB 4MEWA 4AQJA 4DUQA 2WCJA 1UUSA 1J1EA 3CZ2A 2COLB 3ZWHA 1OOIX 1NCYA 2FJYA 5DICA 4GAOA 1PVBA 1IGVA 2GGZA 1NSHA 1QLKA 1FF1A 1G8IA 2LVVA 1KQMB 1DJHA 2PQLA 1KK7Z 1TNWA 2OTGC 2VRGA 3N7HA 3S0FA 1KSOA 2R2IA 1FW4A 3NHIA 1CLBA 4F7FA 1T14A 2L50A 1A75B 1DJZA 3AAKA 3DZTA 3R1OA 4HSZA 3SG7A 1DMOA 4ZCVA 5CSJA 3VRNA 3S0GA 4C0JA 1NX3A 1SYMA 1NUBA 2JC2A 2K61A 1TWOA 2KPHA 4MZJA 1QIVA 1KWOB 1J7RA 1WRZA 4FTGA 1UHJA 4MZLA 1G33A 3EK7A 3I5GC 3GK2A 5AXIA 2Y1MA 4YGEB 2BL0B 2FOTA 4ETOA 2BAPA 3QMEA 3WHTB 1E8AA 1ALWA 1NYAA 2BCAA 3NSIA 5HLOA 1F4OA 1TIZA 1YX8A 3BUWB 1AUIB 1WDCC 1CFCA 2LLSA 1K9PA 1OOFA 2EGDA 3CR2A 1OMDA 4ORBB 2WCFA 1DJYA 3H4SE 3DF0B 1TRFA 2P6BB 3SG4A 3JVTC 3UO9A 4CFRA 5B8IB 1IKUA 2PRUA 2B1UA 2I18A 1DGVA 3OX5A 3KO0A 2MBXA 2O60A 2L0PA 2MLEC 3IVTA 5KTYA 4PE0A 1EH2A 4Q04A 3O4XA 5GQQC 1M63B 2HQ8A 2JTTA 4PHMA 3TUYB 1DC1A 1C3YA 1SK6D 3S0DA 1CDNA 1F71A 2L4HA 1MXEA 3K1EA 1NX0A 4OV2A 1QATA 2KBMA 3IQOA 1TCFA 3SG3A 2KNEA 3BFHA 1CFDA 3L4AA 1CMFA 1K94A 2WOSA 1DELA 2JT0A 1ZOTB 1XVJA 3PM2A 5HLVA 1N0YA 1K90D 1SCMC 2JULA 1BMOA 3O78A 3HCMA 1VRKA 1QXPA 2ZRSA 3VRQA 2KFFA 1CDPA 2ZRTA 2KFGA 1DT7B 2L51A 2M0RA 3E3RA 3PSRA 5AERA 2M1KB 3EVUA 1XK4A 1WDCB 4M2PA 1S5GZ 1K8UA 2LM5A 2LP3A 4OCIA 3KF9A 2HPSA 1ZFSA 1QX5B 1SPYA 1SL9A 3FE9A 5PALA 1L2OB 3KHEA 4OR9B 4ORAB 4NDDA 3B86A 1MF8B 1SSEB 1SNLA 2MRDA 1J7PA 4YGCB 3PN7C 1K9UA 2PYQA 2ZFDA 3PM8A 4PDZA 1DEKA 3PALA 1EG4A 1NWDA 2KAVA 1QX2A 2MA2A 3C1VA 2JT3A 4DS7A 1MWNA 1A03A 3O4YA 4XYNA 4INXA 4JQ0D 3DVEA 1CDMA 2CTNA 3SS3A 2CCMA 1BG1A 4GUKA 1B47A 4YI9A 1TUZA 5DKNA 1NIWA 2JWWA 4OKHA 1S1EA 1WLZA 1KQVA 1KSMA 3EG5B 1F4QA 2QEBA 3DD4A 2LCPA 3PLFB 2F33A 2A4JA 4TNCA 4YRUA 1MXLC 1IJ5A 4GFTA 1AHRA 5DKRA 5I8NA 1PRWA 1GGZA 2K7CA 3O2PA 5KU1A 3A4UB 2JXCA 3SIAA 2KQ6A 2K7OA 4N1GA 3BUOB 4IJ7A 5I94A 4JD9A 3V2LA 3EKHA 2JZIA 1W7JB 5J3XA 2ERBA 1B8LA 1PVAA 2D8NA 3BJHA 1TTXA 2LMTA 3TDZA 3S0BA 1PK0D 1IJ6A 1CKKA 1NCZA 1TCOB 3CLNA 5FI2A 1B4CA 2L4IA 1MUXA 2KYFA 3CR4X 1CLMA 4C0KA 1DJIA 2HQWA 3BFAA 3BUXB 2KSPA 3DVMA 4QJ5B 3S0AA 2GGMA 1XK4C 1SMGA 1S36A 2LV7A 2WCKA 4R1EA 2JOJA 2H8VA 3FS7A 5D7FA 1K96A 2KAYA 2LAPA 2BCBA 4OVNF 1OQPA 1LA3A 2KGBC 2KI4C 1PULA 2HETA 2KQYA 4PE1A 4XJKA 2M8UA 4I5NB 1GJYA 1HQVA 3L47A 1GGWA 1NX1A 1SL8A 2EC6C 2I2RE 2M49B 2LC5A 1FBVA 1NP8A 2BKHB 2L2CA 3OGNA 4YI8A 4JWQA 3CDNA 1EL4A 2MLFC 1J7OA 1GQMA 1UP5A 3RLZA 1Y1UA 1ZUZA 2LMUA 4NDBA 2Q4UA 4GBAA 3FIAA 2ZN9A 1RK9A 3B7AA 1JSAA 1QLSA 1H8BA 1CMGA 1BT6A 3ICBA 1LXFC 4KYNA 1IIOA 2M7NA 3GK1A 1Y1XA 1TNQA 1XFVO 5G08A 4CFQA 4A4BA 1RTP1 5AANA 5KSZA 1CDLA 2F2PA 2JT8A 1OZSA 2YGUA 3SG5A 3D73A 1RFJA 2AAOA 3OB2B 1BR1B 3A8RA 1U5IA 2I7AA 4AQIA 2OS8C 2OTGB 1UHIA 2EC6B 2KFHA 4DIRA 2F3YA 5AEQA 3WXAA 3CS1A 1XFZO 2QPTA 4YGDB 5I2OA 4GPLB 1BLQA 4BY5A 1OZOA 1QVIY 1S6JA 1W9ZA 2WCMA 3GOFA 5HKYA 2H2KA 3OB1B 1OOHA 4MRYA 3BQ3A 1V1FA 1DF0A 2WCLA 2JXLA 3KEVA 1JF2A 2JNFA 3DY9A 3I5HC 1HT9A 3PJIA 5DKQA 2KOTA 1AJ4A 3B6XA 1A29A 3I5GB 1KFUS 3F45A 4MSPA 1KFXS 1LA0A 1SW8A 1OOJA 2PMYA 3CZ0A 1YVHA 5CPVA 2E6WA 4M2OA 1J1DA 3D77A 3SS4A 2LUCA 5F6TA 1QV0A 2IS9A 1YRUB 1Y0VH 2LLUA 1QV1A 1IH0A 1XFYO 4E68A 1K2HA 2O5GA 1S6IA 1QWVA 2DOQA 4U8DA 1WRKA 1C07A 3JVTB 2K8MB 2KGRA 4OZDA 4C0LA 2AMIA 3CZ1A 1K95A 4PHJA 1EG3A 5HKWA 2K7BA 3RM1A 2K0JA 3I5HB 1KCYA 3NHTA 3VROA 2JPOA 2PALA 3CGAA 2LNKA 2WCHA 1UHKA 1JF0A 1XFXO 1YUSA 5HL1A 2JNXA 4GNKB 1DJGA 2Y5IA 1S6CA 1YVLA 2LUXA 3Q8IA 4A4CA 1S26D 3O6BA 2I94A 2LMVA 3BUNB 1ORGA 1SCMB 1SY9A 2KLDA 2ZN8A 4QJ3B 5D3OA 2F3ZA 2M1UA 1BJFA 1V1GA 2P70A 1DJWA 2ZKMX 1OOGA 5D69A 1OE9B 4MZKA 3VRRA 4D1EA 1SBJA 2MJWB 1YR5A 1B7TY 1QS7A 5HKZA 1FI5A 4XJKB 1NX2A 2WC8A 1BF5A 3BYAA 3FWCA 4CIDA 4WQ3A 1BOCA 3IQQA 2WCBA 2NCPA 3EK8A 3NSKA 4INWA 1Z2CB 1IG5A 2QEVA 4PHNA 3SG2A 1LINA 2KBIA 4PALA 3JTDC 1M45A 2WCEA 1XO5A 1YX7A 3GK4X 3M0WA 1RJVA 1UURA 3EVVA 3TDIA 3NXAA 1YUUA 1CM1A 1MR8A 2WORA 1JC2A 3IF7A 1NPQA 2M97A 1KK8C 3PN7B 1AVSA 3D74A 2ZNDA 3I5IC 3VRPA 2SCPA 2CXJA 2QACA 2NCOA 2JU0A 2K2FA 2BCXA 2M7LA 3CYZA 4CPVA 3I5FC 2V53A 5TNCA 1K93D 2FJUB 1QX7A 1SKTA 1UHNA 3CWGA 1F55A 1C7VA 1QJTA 2JRFA 2CNPA 2KI6C 2HF5A 4FQOA 1IQ5A 1QIWA 2P71A 4YGAA 1IRJA 2PSRA 2OPOA 1OMVA 1B9AA 5CSNA 1DVIA 1RROA 2BECA 1PSRA 3QRXA 4BY4A 1F8HA 1M46A 3NSLA 1EXRA 1DF0B 3PFVA 4WRIA 3CTNA 3NSOA 1BR4B 1K9KA 1OMRA 2TN4A 3I5IB 1YTZC 4P5OE 2WC6A 2L5YA 1YRTB 1FI6A 1ZACA 3RZSA 4N5XA 3LL8B 5FI7A 1KWOC 2NLNA 1W7IB 1TUJA 3BOWA 1LKJA 1SL7A 3OX6A 1ZMZA 4HREE 2SASA 2RGIA 1JUOA 3MSEB 1KK7Y 2KDHA 2NZ0A 5JOLA 2BL0C 3WNXB 4I5LB 5K89A 3SJSA 4M2QA 2PVBA 2E30A 1C3ZA 3FE6A 4ZCUA 1Q80A 1R6PA 5IBWA 4FQTA 3BUMB 3VB1A 2BKIB 2LP2A 4HRGA 4IL1A 1JFKA 1X02A 4HRHA 5EL2A 2KI4B 1TNXA 3FE8A 2ISDA 1DTLA 1MQ1A 2GTEA 1XFUO 3L4LA 2MHHA 3FWBA 3SIBA 3BXKA 4I5KA 1JBAA 1CFPA 3D10A 5HYDA 5ER4X 2F8PA 5CSIA 1OW4A 3S0EA 1AK8A 3D0YA 2MAZA 1M39A 2FCDA 1WRLA 2LVJA 2H61A 3D75A 3DXLA 3TUYC 1FPWA 3K21A 4YBHB 4CLNA 2KHNA 1P28A 4USLA 5AFPA 5ER5A 4UPGA 1J7QA 1RWYA 3DYEA 1RECA 1SR6C 1DGUA 1WLMA 2M9GA 1Z4HA 1QVIZ 3OHMB 4MBEA 4NQGA 1B1GA 2G2BA 1XA5A 1R2UA 2WC5A 2KI6D 2K7DA 3HX4A 4DCKA 5I2QA 2EHBA 1N65A 2G9BA 1WY9A 3WHUB 1B8CA 2Y1NA 3EK4A 1AJ5A 4GGFA 5JJGA 1L7ZA 3R72A 1UWOA 2OS8B 1L2OC 1SRAA 2QEHA 1PALA 1BODA 2NXQA 4DRWA 1BU3A 2QEOA 2LHIA 5FYXA 1TNPA 3TS5C 4JKTA 3LLEA 1YURA 3TDUA 3D78A 2BBNA 1SR6B 4MRXA 1A75A 1LVCD 1XYDA 3OBVA 3SG6A 2Q91A 1F54A 1S5GY 3BFBA 1GM0A 4PE4A 1CB1A 3AKAA 1CTRA 2KLEA 2KYCA 2BBMA 2LLTA 3EVRA 1CM4A 3KPXA 1J55A 2K60A 4JPZB 5I2LA 2LE9B 2Y4QA 1UHHA 3CZTX 1QASA 5CSFA 2BNXA 2JTZA 4PHKA 1DQEA 1Y6WA 2L98A 3AAJA 1LS8A 4GGNA 4I5JA 1KFUL 4ICBA 1KFXL 2BE6A 2LHLA 3CABA 2CT9A 4P2YB 2M29A 2LVKA 1ALVA 3UNWA 3AKBA 4WQ2A 2GV5A 2KAXA 3LCPC 2QDIA 1CFFA 1CLLA 2K2AA 1H4BA 1A4PA 1XFWO 1JWDA 3TS5B 3EKJA 2H61C 1NCXA 1TOPA 2JQ6A 1B7TZ 1JFJA 4MVFA 2PASA 1S3PA 4MN0A 1B8RA 3DF0A 3TZ1A 2FCEA 3BOWB 2LANA 1CNPA 1IWQA 2LVIA 4PT1A 1A2XA 2BE4A 4NDCA 1XFRA 4L9MA 4PCWA 3B88A 2AUCA 4F0ZB 4MLWA 1C7WA 2F2OA 1EJ3A 4AOMA 1TN4A 1ODBA 1PSBA 3DVJA 1QTXA 5FI6A 3CR5X 3SS5A 2WNDA 1MHOA 3R1VA 4GGFC 1D1OA 1U5IB 3VGOA 3B87A 3D0YB 1KQMC 1OSAA 1Y1AA 4N1FA 4YGBB 5BPJA 1M31A 1N2DA 1DJXA 3JTDB 1AP4A 4QJ4B 2M3WA 3PATA 3LK1A 2CBLA 1SCVA 2L2EA 1KK8B 3LK0A 3NGVA 4ORCB 3ZNIA 3R1PA 1F70A 3D76A 2ZNEA 1G4YR 1YUTA 3DVKA 4PE7A 2L5XB 3OP0A 2JPTA
chains in the Genus database with same CATH topology
1IQ3A 3I5FB 4MEWA 4AQJA 4DUQA 1UUSA 1J1EA 2COLB 3ZWHA 1NCYA 4GAOA 1PVBA 1IGVA 2GGZA 1NSHA 1QLKA 1FF1A 1G8IA 2LVVA 1KQMB 1DJHA 1KK7Z 1TNWA 2OTGC 2VRGA 1KSOA 2R2IA 1FW4A 1CLBA 2L50A 3AAKA 1A75B 1DJZA 3SG7A 4HSZA 1DMOA 4ZCVA 5CSJA 3VRNA 4C0JA 1NX3A 1SYMA 1NUBA 2JC2A 2K61A 4MZJA 3RM1A 3TDUA 1QIVA 1KWOB 1J7RA 1WRZA 4FTGA 1UHJA 4MZLA 1G33A 3EK7A 3I5GC 3GK2A 5AXIA 2Y1MA 4YGEB 2BL0B 2FOTA 4ETOA 3WHTB 1E8AA 1ALWA 1NYAA 2BCAA 3NSIA 5HLOA 1F4OA 1TIZA 1YX8A 3BUWB 1AUIB 1WDCC 1CFCA 2LLSA 1K9PA 2EGDA 3CR2A 1OMDA 4ORBB 2WCFA 1DJYA 3H4SE 3DF0B 1TRFA 2P6BB 3SG4A 3JVTC 4CFRA 5B8IB 1IKUA 2PRUA 2B1UA 2I18A 1DGVA 3OX5A 3KO0A 2MBXA 2O60A 2L0PA 2MLEC 5KTYA 4PE0A 1EH2A 4Q04A 5GQQC 1M63B 2HQ8A 2JTTA 4PHMA 3TUYB 1CDNA 1SK6D 1F71A 2L4HA 1MXEA 4OV2A 1NX0A 5JJGA 1QATA 2KBMA 3IQOA 1TCFA 3SG3A 2KNEA 1CFDA 1CMFA 1K94A 2WOSA 2JT0A 1ZOTB 1XVJA 5HLVA 1N0YA 1K90D 1SCMC 2JULA 1BMOA 3O78A 3HCMA 1VRKA 1QXPA 2ZRSA 3VRQA 2KFFA 1CDPA 2ZRTA 2KFGA 1DT7B 2L51A 2M0RA 3E3RA 3PSRA 5AERA 2M1KB 3EVUA 1XK4A 1WDCB 4M2PA 1S5GZ 1K8UA 2LM5A 2LP3A 4OCIA 3KF9A 2HPSA 1ZFSA 1QX5B 1SPYA 1SL9A 5PALA 1L2OB 3KHEA 4OR9B 4ORAB 4NDDA 1MF8B 1SNLA 2MRDA 1J7PA 4YGCB 3PN7C 1K9UA 2ZFDA 3PM8A 4PDZA 3PALA 1EG4A 1NWDA 2KAVA 1QX2A 2MA2A 3C1VA 2JT3A 4DS7A 1MWNA 1A03A 3O4YA 4XYNA 4JQ0D 3DVEA 1CDMA 2CTNA 2CCMA 1BG1A 4GUKA 1B47A 4YI9A 5DKNA 1NIWA 2JWWA 4OKHA 1S1EA 1WLZA 1KQVA 1KSMA 1F4QA 3DD4A 2LCPA 3PLFB 2F33A 2A4JA 4TNCA 4YRUA 1MXLC 1IJ5A 4GFTA 1AHRA 5DKRA 5I8NA 1PRWA 1GGZA 2K7CA 3O2PA 5KU1A 3A4UB 2JXCA 3SIAA 2KQ6A 2K7OA 4N1GA 3BUOB 3EKHA 2JZIA 1W7JB 5J3XA 1B8LA 1PVAA 2D8NA 1TTXA 2LMTA 3TDZA 1PK0D 1IJ6A 1CKKA 1NCZA 1TCOB 3CLNA 1B4CA 2L4IA 1MUXA 2KYFA 3CR4X 1CLMA 4C0KA 1DJIA 2HQWA 4QJ5B 3BUXB 2KSPA 3DVMA 2GGMA 1XK4C 1SMGA 1S36A 2LV7A 4R1EA 2JOJA 5D7FA 3FS7A 1K96A 2KAYA 2LAPA 2BCBA 4OVNF 1OQPA 1LA3A 2KGBC 2KI4C 1PULA 2HETA 2KQYA 4PE1A 4XJKA 2M8UA 4I5NB 1GJYA 1HQVA 1GGWA 1NX1A 1SL8A 2EC6C 2I2RE 2M49B 2LC5A 1FBVA 1NP8A 2BKHB 4YI8A 4JWQA 1EL4A 2MLFC 1J7OA 1GQMA 1UP5A 3RLZA 1Y1UA 1ZUZA 2LMUA 4NDBA 2Q4UA 4GBAA 3FIAA 2ZN9A 1RK9A 1JSAA 1QLSA 1H8BA 1CMGA 1BT6A 3ICBA 1LXFC 2M7NA 3GK1A 1Y1XA 1TNQA 1XFVO 5G08A 4CFQA 4A4BA 1RTP1 5AANA 5KSZA 1CDLA 2F2PA 2JT8A 1OZSA 3SG5A 1RFJA 2AAOA 3OB2B 1BR1B 3A8RA 1U5IA 2I7AA 4AQIA 2OS8C 2OTGB 1UHIA 2EC6B 2KFHA 4DIRA 2F3YA 5AEQA 3WXAA 3CS1A 1XFZO 2QPTA 4YGDB 5I2OA 4GPLB 1BLQA 4BY5A 1OZOA 1QVIY 1S6JA 3GOFA 5HKYA 2H2KA 3OB1B 4MRYA 3BQ3A 1V1FA 1DF0A 2JXLA 3KEVA 1JF2A 2JNFA 3I5HC 1HT9A 5DKQA 2KOTA 1AJ4A 1A29A 3I5GB 1KFUS 3F45A 4MSPA 1KFXS 1LA0A 1SW8A 1OOJA 2PMYA 1YVHA 5CPVA 2E6WA 4M2OA 1J1DA 2LUCA 5F6TA 1QV0A 2IS9A 1YRUB 1Y0VH 2LLUA 1QV1A 1IH0A 1XFYO 4E68A 1K2HA 2O5GA 1S6IA 2DOQA 4U8DA 1WRKA 1C07A 3JVTB 2K8MB 2KGRA 4C0LA 2AMIA 1K95A 4PHJA 1EG3A 5HKWA 2K7BA 2K0JA 3I5HB 1KCYA 3VROA 2PALA 3CGAA 2LNKA 1UHKA 1JF0A 1XFXO 1YUSA 2JNXA 4GNKB 1DJGA 2Y5IA 1S6CA 1YVLA 2LUXA 4A4CA 1S26D 3O6BA 2I94A 2LMVA 3BUNB 1SCMB 1SY9A 2ZN8A 4QJ3B 2F3ZA 2M1UA 1BJFA 1V1GA 2ZKMX 1DJWA 5D69A 4D1EA 1OE9B 4MZKA 3VRRA 1SBJA 2MJWB 1YR5A 1B7TY 1QS7A 5HKZA 1FI5A 4XJKB 1NX2A 2WC8A 1BF5A 3BYAA 3FWCA 4CIDA 4WQ3A 1BOCA 3IQQA 2WCBA 2NCPA 3EK8A 3NSKA 3SG2A 1IG5A 4PHNA 1LINA 2KBIA 4PALA 3JTDC 1M45A 2WCEA 1XO5A 1YX7A 3GK4X 3M0WA 1RJVA 1UURA 3EVVA 3TDIA 3NXAA 1YUUA 1CM1A 1MR8A 2WORA 1JC2A 3IF7A 1NPQA 2M97A 1KK8C 3PN7B 1AVSA 2ZNDA 3I5IC 3VRPA 2SCPA 2CXJA 2QACA 2NCOA 2JU0A 2K2FA 2BCXA 2M7LA 4CPVA 3I5FC 2V53A 5TNCA 1K93D 2FJUB 1QX7A 1SKTA 1UHNA 3CWGA 1F55A 1C7VA 1QJTA 2JRFA 2CNPA 2KI6C 2HF5A 4FQOA 1IQ5A 1QIWA 4YGAA 1IRJA 2PSRA 2OPOA 1OMVA 1B9AA 5CSNA 1DVIA 1RROA 2BECA 1PSRA 3QRXA 4BY4A 1F8HA 1M46A 3NSLA 1EXRA 1DF0B 3PFVA 4WRIA 3CTNA 3NSOA 1BR4B 1K9KA 1OMRA 2TN4A 3I5IB 1YTZC 4P5OE 1YRTB 1FI6A 1ZACA 4N5XA 3LL8B 1KWOC 2NLNA 1W7IB 3BOWA 3OX6A 1LKJA 1SL7A 4HREE 1ZMZA 2SASA 2RGIA 1JUOA 3MSEB 1KK7Y 2KDHA 2NZ0A 5JOLA 2BL0C 3WNXB 4I5LB 5K89A 3SJSA 4M2QA 2PVBA 2E30A 4ZCUA 1Q80A 1R6PA 5IBWA 3BUMB 2BKIB 2LP2A 4HRGA 4IL1A 1JFKA 1X02A 4HRHA 2KI4B 1TNXA 2ISDA 1DTLA 1MQ1A 1XFUO 3SIBA 2MHHA 3FWBA 3BXKA 4I5KA 1JBAA 1CFPA 3D10A 5HYDA 5ER4X 2F8PA 5CSIA 1AK8A 3D0YA 2MAZA 1M39A 2FCDA 1WRLA 2LVJA 2H61A 3TUYC 1FPWA 3K21A 4YBHB 4CLNA 2KHNA 4USLA 5AFPA 5ER5A 4UPGA 1J7QA 1RWYA 1RECA 1SR6C 1DGUA 1WLMA 2M9GA 1QVIZ 3OHMB 4MBEA 4NQGA 1B1GA 2G2BA 1XA5A 1R2UA 2KI6D 2K7DA 3HX4A 4DCKA 5I2QA 2EHBA 1N65A 2G9BA 1WY9A 3WHUB 1B8CA 2Y1NA 3EK4A 1AJ5A 4GGFA 1L7ZA 1UWOA 2OS8B 1L2OC 1SRAA 1PALA 1BODA 2NXQA 4DRWA 1BU3A 2LHIA 5FYXA 1TNPA 3TS5C 3LLEA 1YURA 2BBNA 1SR6B 4MRXA 1A75A 1LVCD 1XYDA 3SG6A 1F54A 2Q91A 1S5GY 4PE4A 1CB1A 3AKAA 1CTRA 2KYCA 2LLTA 2BBMA 3EVRA 3KPXA 1CM4A 4JPZB 1J55A 5I2LA 2LE9B 2Y4QA 1UHHA 3CZTX 1QASA 5CSFA 2JTZA 4PHKA 2L98A 1Y6WA 3AAJA 4I5JA 4GGNA 1KFUL 4ICBA 1KFXL 2BE6A 2LHLA 2CT9A 4P2YB 2M29A 2LVKA 1ALVA 3AKBA 4WQ2A 2GV5A 2KAXA 3LCPC 1CFFA 1CLLA 2K2AA 1H4BA 1A4PA 1XFWO 1JWDA 3TS5B 3EKJA 2H61C 1NCXA 1TOPA 2JQ6A 1B7TZ 1JFJA 4MVFA 2PASA 1S3PA 4MN0A 1B8RA 3DF0A 3TZ1A 2FCEA 3BOWB 2LANA 1CNPA 1IWQA 2LVIA 1A2XA 2BE4A 4NDCA 4L9MA 4PCWA 4F0ZB 2AUCA 4MLWA 1C7WA 2F2OA 1EJ3A 4AOMA 1TN4A 1ODBA 1PSBA 3DVJA 1QTXA 3CR5X 2WNDA 1MHOA 4GGFC 1D1OA 1U5IB 3VGOA 3D0YB 1KQMC 1OSAA 1Y1AA 4N1FA 4YGBB 5BPJA 1M31A 1N2DA 1DJXA 3JTDB 1AP4A 4QJ4B 2M3WA 3PATA 3LK1A 2CBLA 1SCVA 2L2EA 1KK8B 3LK0A 4ORCB 3ZNIA 1F70A 2ZNEA 1G4YR 1YUTA 3DVKA 4PE7A 2L5XB 3OP0A 2JPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ3 A;  3I5F B;  4MEW A;  4AQJ A;  4DUQ A;  1UUS A;  1J1E A;  2COL B;  3ZWH A;  1NCY A;  4GAO A;  1PVB A;  1IGV A;  2GGZ A;  1NSH A;  1QLK A;  1FF1 A;  1G8I A;  2LVV A;  1KQM B;  1DJH A;  1KK7 Z;  1TNW A;  2OTG C;  2VRG A;  1KSO A;  2R2I A;  1FW4 A;  1CLB A;  2L50 A;  3AAK A;  1A75 B;  1DJZ A;  3SG7 A;  4HSZ A;  1DMO A;  4ZCV A;  5CSJ A;  3VRN A;  4C0J A;  1NX3 A;  1SYM A;  1NUB A;  2JC2 A;  2K61 A;  4MZJ A;  3RM1 A;  3TDU A;  1QIV A;  1KWO B;  1J7R A;  1WRZ A;  4FTG A;  1UHJ A;  4MZL A;  1G33 A;  3EK7 A;  3I5G C;  3GK2 A;  5AXI A;  2Y1M A;  4YGE B;  2BL0 B;  2FOT A;  4ETO A;  3WHT B;  1E8A A;  1ALW A;  1NYA A;  2BCA A;  3NSI A;  5HLO A;  1F4O A;  1TIZ A;  1YX8 A;  3BUW B;  1AUI B;  1WDC C;  1CFC A;  2LLS A;  1K9P A;  2EGD A;  3CR2 A;  1OMD A;  4ORB B;  2WCF A;  1DJY A;  3H4S E;  3DF0 B;  1TRF A;  2P6B B;  3SG4 A;  3JVT C;  4CFR A;  5B8I B;  1IKU A;  2PRU A;  2B1U A;  2I18 A;  1DGV A;  3OX5 A;  3KO0 A;  2MBX A;  2O60 A;  2L0P A;  2MLE C;  5KTY A;  4PE0 A;  1EH2 A;  4Q04 A;  5GQQ C;  1M63 B;  2HQ8 A;  2JTT A;  4PHM A;  3TUY B;  1CDN A;  1SK6 D;  1F71 A;  2L4H A;  1MXE A;  4OV2 A;  1NX0 A;  5JJG A;  1QAT A;  2KBM A;  3IQO A;  1TCF A;  3SG3 A;  2KNE A;  1CFD A;  1CMF A;  1K94 A;  2WOS A;  2JT0 A;  1ZOT B;  1XVJ A;  5HLV A;  1N0Y A;  1K90 D;  1SCM C;  2JUL A;  1BMO A;  3O78 A;  3HCM A;  1VRK A;  1QXP A;  2ZRS A;  3VRQ A;  2KFF A;  1CDP A;  2ZRT A;  2KFG A;  1DT7 B;  2L51 A;  2M0R A;  3E3R A;  3PSR A;  5AER A;  2M1K B;  3EVU A;  1XK4 A;  1WDC B;  4M2P A;  1S5G Z;  1K8U A;  2LM5 A;  2LP3 A;  4OCI A;  3KF9 A;  2HPS A;  1ZFS A;  1QX5 B;  1SPY A;  1SL9 A;  5PAL A;  1L2O B;  3KHE A;  4OR9 B;  4ORA B;  4NDD A;  1MF8 B;  1SNL A;  2MRD A;  1J7P A;  4YGC B;  3PN7 C;  1K9U A;  2ZFD A;  3PM8 A;  4PDZ A;  3PAL A;  1EG4 A;  1NWD A;  2KAV A;  1QX2 A;  2MA2 A;  3C1V A;  2JT3 A;  4DS7 A;  1MWN A;  1A03 A;  3O4Y A;  4XYN A;  4JQ0 D;  3DVE A;  1CDM A;  2CTN A;  2CCM A;  1BG1 A;  4GUK A;  1B47 A;  4YI9 A;  5DKN A;  1NIW A;  2JWW A;  4OKH A;  1S1E A;  1WLZ A;  1KQV A;  1KSM A;  1F4Q A;  3DD4 A;  2LCP A;  3PLF B;  2F33 A;  2A4J A;  4TNC A;  4YRU A;  1MXL C;  1IJ5 A;  4GFT A;  1AHR A;  5DKR A;  5I8N A;  1PRW A;  1GGZ A;  2K7C A;  3O2P A;  5KU1 A;  3A4U B;  2JXC A;  3SIA A;  2KQ6 A;  2K7O A;  4N1G A;  3BUO B;  3EKH A;  2JZI A;  1W7J B;  5J3X A;  1B8L A;  1PVA A;  2D8N A;  1TTX A;  2LMT A;  3TDZ A;  1PK0 D;  1IJ6 A;  1CKK A;  1NCZ A;  1TCO B;  3CLN A;  1B4C A;  2L4I A;  1MUX A;  2KYF A;  3CR4 X;  1CLM A;  4C0K A;  1DJI A;  2HQW A;  4QJ5 B;  3BUX B;  2KSP A;  3DVM A;  2GGM A;  1XK4 C;  1SMG A;  1S36 A;  2LV7 A;  4R1E A;  2JOJ A;  5D7F A;  3FS7 A;  1K96 A;  2KAY A;  2LAP A;  2BCB A;  4OVN F;  1OQP A;  1LA3 A;  2KGB C;  2KI4 C;  1PUL A;  2HET A;  2KQY A;  4PE1 A;  4XJK A;  2M8U A;  4I5N B;  1GJY A;  1HQV A;  1GGW A;  1NX1 A;  1SL8 A;  2EC6 C;  2I2R E;  2M49 B;  2LC5 A;  1FBV A;  1NP8 A;  2BKH B;  4YI8 A;  4JWQ A;  1EL4 A;  2MLF C;  1J7O A;  1GQM A;  1UP5 A;  3RLZ A;  1Y1U A;  1ZUZ A;  2LMU A;  4NDB A;  2Q4U A;  4GBA A;  3FIA A;  2ZN9 A;  1RK9 A;  1JSA A;  1QLS A;  1H8B A;  1CMG A;  1BT6 A;  3ICB A;  1LXF C;  2M7N A;  3GK1 A;  1Y1X A;  1TNQ A;  1XFV O;  5G08 A;  4CFQ A;  4A4B A;  1RTP 1;  5AAN A;  5KSZ A;  1CDL A;  2F2P A;  2JT8 A;  1OZS A;  3SG5 A;  1RFJ A;  2AAO A;  3OB2 B;  1BR1 B;  3A8R A;  1U5I A;  2I7A A;  4AQI A;  2OS8 C;  2OTG B;  1UHI A;  2EC6 B;  2KFH A;  4DIR A;  2F3Y A;  5AEQ A;  3WXA A;  3CS1 A;  1XFZ O;  2QPT A;  4YGD B;  5I2O A;  4GPL B;  1BLQ A;  4BY5 A;  1OZO A;  1QVI Y;  1S6J A;  3GOF A;  5HKY A;  2H2K A;  3OB1 B;  4MRY A;  3BQ3 A;  1V1F A;  1DF0 A;  2JXL A;  3KEV A;  1JF2 A;  2JNF A;  3I5H C;  1HT9 A;  5DKQ A;  2KOT A;  1AJ4 A;  1A29 A;  3I5G B;  1KFU S;  3F45 A;  4MSP A;  1KFX S;  1LA0 A;  1SW8 A;  1OOJ A;  2PMY A;  1YVH A;  5CPV A;  2E6W A;  4M2O A;  1J1D A;  2LUC A;  5F6T A;  1QV0 A;  2IS9 A;  1YRU B;  1Y0V H;  2LLU A;  1QV1 A;  1IH0 A;  1XFY O;  4E68 A;  1K2H A;  2O5G A;  1S6I A;  2DOQ A;  4U8D A;  1WRK A;  1C07 A;  3JVT B;  2K8M B;  2KGR A;  4C0L A;  2AMI A;  1K95 A;  4PHJ A;  1EG3 A;  5HKW A;  2K7B A;  2K0J A;  3I5H B;  1KCY A;  3VRO A;  2PAL A;  3CGA A;  2LNK A;  1UHK A;  1JF0 A;  1XFX O;  1YUS A;  2JNX A;  4GNK B;  1DJG A;  2Y5I A;  1S6C A;  1YVL A;  2LUX A;  4A4C A;  1S26 D;  3O6B A;  2I94 A;  2LMV A;  3BUN B;  1SCM B;  1SY9 A;  2ZN8 A;  4QJ3 B;  2F3Z A;  2M1U A;  1BJF A;  1V1G A;  2ZKM X;  1DJW A;  5D69 A;  4D1E A;  1OE9 B;  4MZK A;  3VRR A;  1SBJ A;  2MJW B;  1YR5 A;  1B7T Y;  1QS7 A;  5HKZ A;  1FI5 A;  4XJK B;  1NX2 A;  2WC8 A;  1BF5 A;  3BYA A;  3FWC A;  4CID A;  4WQ3 A;  1BOC A;  3IQQ A;  2WCB A;  2NCP A;  3EK8 A;  3NSK A;  3SG2 A;  1IG5 A;  4PHN A;  1LIN A;  2KBI A;  4PAL A;  3JTD C;  1M45 A;  2WCE A;  1XO5 A;  1YX7 A;  3GK4 X;  3M0W A;  1RJV A;  1UUR A;  3EVV A;  3TDI A;  3NXA A;  1YUU A;  1CM1 A;  1MR8 A;  2WOR A;  1JC2 A;  3IF7 A;  1NPQ A;  2M97 A;  1KK8 C;  3PN7 B;  1AVS A;  2ZND A;  3I5I C;  3VRP A;  2SCP A;  2CXJ A;  2QAC A;  2NCO A;  2JU0 A;  2K2F A;  2BCX A;  2M7L A;  4CPV A;  3I5F C;  2V53 A;  5TNC A;  1K93 D;  2FJU B;  1QX7 A;  1SKT A;  1UHN A;  3CWG A;  1F55 A;  1C7V A;  1QJT A;  2JRF A;  2CNP A;  2KI6 C;  2HF5 A;  4FQO A;  1IQ5 A;  1QIW A;  4YGA A;  1IRJ A;  2PSR A;  2OPO A;  1OMV A;  1B9A A;  5CSN A;  1DVI A;  1RRO A;  2BEC A;  1PSR A;  3QRX A;  4BY4 A;  1F8H A;  1M46 A;  3NSL A;  1EXR A;  1DF0 B;  3PFV A;  4WRI A;  3CTN A;  3NSO A;  1BR4 B;  1K9K A;  1OMR A;  2TN4 A;  3I5I B;  1YTZ C;  4P5O E;  1YRT B;  1FI6 A;  1ZAC A;  4N5X A;  3LL8 B;  1KWO C;  2NLN A;  1W7I B;  3BOW A;  3OX6 A;  1LKJ A;  1SL7 A;  4HRE E;  1ZMZ A;  2SAS A;  2RGI A;  1JUO A;  3MSE B;  1KK7 Y;  2KDH A;  2NZ0 A;  5JOL A;  2BL0 C;  3WNX B;  4I5L B;  5K89 A;  3SJS A;  4M2Q A;  2PVB A;  2E30 A;  4ZCU A;  1Q80 A;  1R6P A;  5IBW A;  3BUM B;  2BKI B;  2LP2 A;  4HRG A;  4IL1 A;  1JFK A;  1X02 A;  4HRH A;  2KI4 B;  1TNX A;  2ISD A;  1DTL A;  1MQ1 A;  1XFU O;  3SIB A;  2MHH A;  3FWB A;  3BXK A;  4I5K A;  1JBA A;  1CFP A;  3D10 A;  5HYD A;  5ER4 X;  2F8P A;  5CSI A;  1AK8 A;  3D0Y A;  2MAZ A;  1M39 A;  2FCD A;  1WRL A;  2LVJ A;  2H61 A;  3TUY C;  1FPW A;  3K21 A;  4YBH B;  4CLN A;  2KHN A;  4USL A;  5AFP A;  5ER5 A;  4UPG A;  1J7Q A;  1RWY A;  1REC A;  1SR6 C;  1DGU A;  1WLM A;  2M9G A;  1QVI Z;  3OHM B;  4MBE A;  4NQG A;  1B1G A;  2G2B A;  1XA5 A;  1R2U A;  2KI6 D;  2K7D A;  3HX4 A;  4DCK A;  5I2Q A;  2EHB A;  1N65 A;  2G9B A;  1WY9 A;  3WHU B;  1B8C A;  2Y1N A;  3EK4 A;  1AJ5 A;  4GGF A;  1L7Z A;  1UWO A;  2OS8 B;  1L2O C;  1SRA A;  1PAL A;  1BOD A;  2NXQ A;  4DRW A;  1BU3 A;  2LHI A;  5FYX A;  1TNP A;  3TS5 C;  3LLE A;  1YUR A;  2BBN A;  1SR6 B;  4MRX A;  1A75 A;  1LVC D;  1XYD A;  3SG6 A;  1F54 A;  2Q91 A;  1S5G Y;  4PE4 A;  1CB1 A;  3AKA A;  1CTR A;  2KYC A;  2LLT A;  2BBM A;  3EVR A;  3KPX A;  1CM4 A;  4JPZ B;  1J55 A;  5I2L A;  2LE9 B;  2Y4Q A;  1UHH A;  3CZT X;  1QAS A;  5CSF A;  2JTZ A;  4PHK A;  2L98 A;  1Y6W A;  3AAJ A;  4I5J A;  4GGN A;  1KFU L;  4ICB A;  1KFX L;  2BE6 A;  2LHL A;  2CT9 A;  4P2Y B;  2M29 A;  2LVK A;  1ALV A;  3AKB A;  4WQ2 A;  2GV5 A;  2KAX A;  3LCP C;  1CFF A;  1CLL A;  2K2A A;  1H4B A;  1A4P A;  1XFW O;  1JWD A;  3TS5 B;  3EKJ A;  2H61 C;  1NCX A;  1TOP A;  2JQ6 A;  1B7T Z;  1JFJ A;  4MVF A;  2PAS A;  1S3P A;  4MN0 A;  1B8R A;  3DF0 A;  3TZ1 A;  2FCE A;  3BOW B;  2LAN A;  1CNP A;  1IWQ A;  2LVI A;  1A2X A;  2BE4 A;  4NDC A;  4L9M A;  4PCW A;  4F0Z B;  2AUC A;  4MLW A;  1C7W A;  2F2O A;  1EJ3 A;  4AOM A;  1TN4 A;  1ODB A;  1PSB A;  3DVJ A;  1QTX A;  3CR5 X;  2WND A;  1MHO A;  4GGF C;  1D1O A;  1U5I B;  3VGO A;  3D0Y B;  1KQM C;  1OSA A;  1Y1A A;  4N1F A;  4YGB B;  5BPJ A;  1M31 A;  1N2D A;  1DJX A;  3JTD B;  1AP4 A;  4QJ4 B;  2M3W A;  3PAT A;  3LK1 A;  2CBL A;  1SCV A;  2L2E A;  1KK8 B;  3LK0 A;  4ORC B;  3ZNI A;  1F70 A;  2ZNE A;  1G4Y R;  1YUT A;  3DVK A;  4PE7 A;  2L5X B;  3OP0 A;  2JPT A; 
#chains in the Genus database with same CATH topology
 1IQ3 A;  3I5F B;  4MEW A;  4AQJ A;  4DUQ A;  2WCJ A;  1UUS A;  1J1E A;  3CZ2 A;  2COL B;  3ZWH A;  1OOI X;  1NCY A;  2FJY A;  5DIC A;  4GAO A;  1PVB A;  1IGV A;  2GGZ A;  1NSH A;  1QLK A;  1FF1 A;  1G8I A;  2LVV A;  1KQM B;  1DJH A;  2PQL A;  1KK7 Z;  1TNW A;  2OTG C;  2VRG A;  3N7H A;  3S0F A;  1KSO A;  2R2I A;  1FW4 A;  3NHI A;  1CLB A;  4F7F A;  1T14 A;  2L50 A;  1A75 B;  1DJZ A;  3AAK A;  3DZT A;  3R1O A;  4HSZ A;  3SG7 A;  1DMO A;  4ZCV A;  5CSJ A;  3VRN A;  3S0G A;  4C0J A;  1NX3 A;  1SYM A;  1NUB A;  2JC2 A;  2K61 A;  1TWO A;  2KPH A;  4MZJ A;  1QIV A;  1KWO B;  1J7R A;  1WRZ A;  4FTG A;  1UHJ A;  4MZL A;  1G33 A;  3EK7 A;  3I5G C;  3GK2 A;  5AXI A;  2Y1M A;  4YGE B;  2BL0 B;  2FOT A;  4ETO A;  2BAP A;  3QME A;  3WHT B;  1E8A A;  1ALW A;  1NYA A;  2BCA A;  3NSI A;  5HLO A;  1F4O A;  1TIZ A;  1YX8 A;  3BUW B;  1AUI B;  1WDC C;  1CFC A;  2LLS A;  1K9P A;  1OOF A;  2EGD A;  3CR2 A;  1OMD A;  4ORB B;  2WCF A;  1DJY A;  3H4S E;  3DF0 B;  1TRF A;  2P6B B;  3SG4 A;  3JVT C;  3UO9 A;  4CFR A;  5B8I B;  1IKU A;  2PRU A;  2B1U A;  2I18 A;  1DGV A;  3OX5 A;  3KO0 A;  2MBX A;  2O60 A;  2L0P A;  2MLE C;  3IVT A;  5KTY A;  4PE0 A;  1EH2 A;  4Q04 A;  3O4X A;  5GQQ C;  1M63 B;  2HQ8 A;  2JTT A;  4PHM A;  3TUY B;  1DC1 A;  1C3Y A;  1SK6 D;  3S0D A;  1CDN A;  1F71 A;  2L4H A;  1MXE A;  3K1E A;  1NX0 A;  4OV2 A;  1QAT A;  2KBM A;  3IQO A;  1TCF A;  3SG3 A;  2KNE A;  3BFH A;  1CFD A;  3L4A A;  1CMF A;  1K94 A;  2WOS A;  1DEL A;  2JT0 A;  1ZOT B;  1XVJ A;  3PM2 A;  5HLV A;  1N0Y A;  1K90 D;  1SCM C;  2JUL A;  1BMO A;  3O78 A;  3HCM A;  1VRK A;  1QXP A;  2ZRS A;  3VRQ A;  2KFF A;  1CDP A;  2ZRT A;  2KFG A;  1DT7 B;  2L51 A;  2M0R A;  3E3R A;  3PSR A;  5AER A;  2M1K B;  3EVU A;  1XK4 A;  1WDC B;  4M2P A;  1S5G Z;  1K8U A;  2LM5 A;  2LP3 A;  4OCI A;  3KF9 A;  2HPS A;  1ZFS A;  1QX5 B;  1SPY A;  1SL9 A;  3FE9 A;  5PAL A;  1L2O B;  3KHE A;  4OR9 B;  4ORA B;  4NDD A;  3B86 A;  1MF8 B;  1SSE B;  1SNL A;  2MRD A;  1J7P A;  4YGC B;  3PN7 C;  1K9U A;  2PYQ A;  2ZFD A;  3PM8 A;  4PDZ A;  1DEK A;  3PAL A;  1EG4 A;  1NWD A;  2KAV A;  1QX2 A;  2MA2 A;  3C1V A;  2JT3 A;  4DS7 A;  1MWN A;  1A03 A;  3O4Y A;  4XYN A;  4INX A;  4JQ0 D;  3DVE A;  1CDM A;  2CTN A;  3SS3 A;  2CCM A;  1BG1 A;  4GUK A;  1B47 A;  4YI9 A;  1TUZ A;  5DKN A;  1NIW A;  2JWW A;  4OKH A;  1S1E A;  1WLZ A;  1KQV A;  1KSM A;  3EG5 B;  1F4Q A;  2QEB A;  3DD4 A;  2LCP A;  3PLF B;  2F33 A;  2A4J A;  4TNC A;  4YRU A;  1MXL C;  1IJ5 A;  4GFT A;  1AHR A;  5DKR A;  5I8N A;  1PRW A;  1GGZ A;  2K7C A;  3O2P A;  5KU1 A;  3A4U B;  2JXC A;  3SIA A;  2KQ6 A;  2K7O A;  4N1G A;  3BUO B;  4IJ7 A;  5I94 A;  4JD9 A;  3V2L A;  3EKH A;  2JZI A;  1W7J B;  5J3X A;  2ERB A;  1B8L A;  1PVA A;  2D8N A;  3BJH A;  1TTX A;  2LMT A;  3TDZ A;  3S0B A;  1PK0 D;  1IJ6 A;  1CKK A;  1NCZ A;  1TCO B;  3CLN A;  5FI2 A;  1B4C A;  2L4I A;  1MUX A;  2KYF A;  3CR4 X;  1CLM A;  4C0K A;  1DJI A;  2HQW A;  3BFA A;  3BUX B;  2KSP A;  3DVM A;  4QJ5 B;  3S0A A;  2GGM A;  1XK4 C;  1SMG A;  1S36 A;  2LV7 A;  2WCK A;  4R1E A;  2JOJ A;  2H8V A;  3FS7 A;  5D7F A;  1K96 A;  2KAY A;  2LAP A;  2BCB A;  4OVN F;  1OQP A;  1LA3 A;  2KGB C;  2KI4 C;  1PUL A;  2HET A;  2KQY A;  4PE1 A;  4XJK A;  2M8U A;  4I5N B;  1GJY A;  1HQV A;  3L47 A;  1GGW A;  1NX1 A;  1SL8 A;  2EC6 C;  2I2R E;  2M49 B;  2LC5 A;  1FBV A;  1NP8 A;  2BKH B;  2L2C A;  3OGN A;  4YI8 A;  4JWQ A;  3CDN A;  1EL4 A;  2MLF C;  1J7O A;  1GQM A;  1UP5 A;  3RLZ A;  1Y1U A;  1ZUZ A;  2LMU A;  4NDB A;  2Q4U A;  4GBA A;  3FIA A;  2ZN9 A;  1RK9 A;  3B7A A;  1JSA A;  1QLS A;  1H8B A;  1CMG A;  1BT6 A;  3ICB A;  1LXF C;  4KYN A;  1IIO A;  2M7N A;  3GK1 A;  1Y1X A;  1TNQ A;  1XFV O;  5G08 A;  4CFQ A;  4A4B A;  1RTP 1;  5AAN A;  5KSZ A;  1CDL A;  2F2P A;  2JT8 A;  1OZS A;  2YGU A;  3SG5 A;  3D73 A;  1RFJ A;  2AAO A;  3OB2 B;  1BR1 B;  3A8R A;  1U5I A;  2I7A A;  4AQI A;  2OS8 C;  2OTG B;  1UHI A;  2EC6 B;  2KFH A;  4DIR A;  2F3Y A;  5AEQ A;  3WXA A;  3CS1 A;  1XFZ O;  2QPT A;  4YGD B;  5I2O A;  4GPL B;  1BLQ A;  4BY5 A;  1OZO A;  1QVI Y;  1S6J A;  1W9Z A;  2WCM A;  3GOF A;  5HKY A;  2H2K A;  3OB1 B;  1OOH A;  4MRY A;  3BQ3 A;  1V1F A;  1DF0 A;  2WCL A;  2JXL A;  3KEV A;  1JF2 A;  2JNF A;  3DY9 A;  3I5H C;  1HT9 A;  3PJI A;  5DKQ A;  2KOT A;  1AJ4 A;  3B6X A;  1A29 A;  3I5G B;  1KFU S;  3F45 A;  4MSP A;  1KFX S;  1LA0 A;  1SW8 A;  1OOJ A;  2PMY A;  3CZ0 A;  1YVH A;  5CPV A;  2E6W A;  4M2O A;  1J1D A;  3D77 A;  3SS4 A;  2LUC A;  5F6T A;  1QV0 A;  2IS9 A;  1YRU B;  1Y0V H;  2LLU A;  1QV1 A;  1IH0 A;  1XFY O;  4E68 A;  1K2H A;  2O5G A;  1S6I A;  1QWV A;  2DOQ A;  4U8D A;  1WRK A;  1C07 A;  3JVT B;  2K8M B;  2KGR A;  4OZD A;  4C0L A;  2AMI A;  3CZ1 A;  1K95 A;  4PHJ A;  1EG3 A;  5HKW A;  2K7B A;  3RM1 A;  2K0J A;  3I5H B;  1KCY A;  3NHT A;  3VRO A;  2JPO A;  2PAL A;  3CGA A;  2LNK A;  2WCH A;  1UHK A;  1JF0 A;  1XFX O;  1YUS A;  5HL1 A;  2JNX A;  4GNK B;  1DJG A;  2Y5I A;  1S6C A;  1YVL A;  2LUX A;  3Q8I A;  4A4C A;  1S26 D;  3O6B A;  2I94 A;  2LMV A;  3BUN B;  1ORG A;  1SCM B;  1SY9 A;  2KLD A;  2ZN8 A;  4QJ3 B;  5D3O A;  2F3Z A;  2M1U A;  1BJF A;  1V1G A;  2P70 A;  1DJW A;  2ZKM X;  1OOG A;  5D69 A;  1OE9 B;  4MZK A;  3VRR A;  4D1E A;  1SBJ A;  2MJW B;  1YR5 A;  1B7T Y;  1QS7 A;  5HKZ A;  1FI5 A;  4XJK B;  1NX2 A;  2WC8 A;  1BF5 A;  3BYA A;  3FWC A;  4CID A;  4WQ3 A;  1BOC A;  3IQQ A;  2WCB A;  2NCP A;  3EK8 A;  3NSK A;  4INW A;  1Z2C B;  1IG5 A;  2QEV A;  4PHN A;  3SG2 A;  1LIN A;  2KBI A;  4PAL A;  3JTD C;  1M45 A;  2WCE A;  1XO5 A;  1YX7 A;  3GK4 X;  3M0W A;  1RJV A;  1UUR A;  3EVV A;  3TDI A;  3NXA A;  1YUU A;  1CM1 A;  1MR8 A;  2WOR A;  1JC2 A;  3IF7 A;  1NPQ A;  2M97 A;  1KK8 C;  3PN7 B;  1AVS A;  3D74 A;  2ZND A;  3I5I C;  3VRP A;  2SCP A;  2CXJ A;  2QAC A;  2NCO A;  2JU0 A;  2K2F A;  2BCX A;  2M7L A;  3CYZ A;  4CPV A;  3I5F C;  2V53 A;  5TNC A;  1K93 D;  2FJU B;  1QX7 A;  1SKT A;  1UHN A;  3CWG A;  1F55 A;  1C7V A;  1QJT A;  2JRF A;  2CNP A;  2KI6 C;  2HF5 A;  4FQO A;  1IQ5 A;  1QIW A;  2P71 A;  4YGA A;  1IRJ A;  2PSR A;  2OPO A;  1OMV A;  1B9A A;  5CSN A;  1DVI A;  1RRO A;  2BEC A;  1PSR A;  3QRX A;  4BY4 A;  1F8H A;  1M46 A;  3NSL A;  1EXR A;  1DF0 B;  3PFV A;  4WRI A;  3CTN A;  3NSO A;  1BR4 B;  1K9K A;  1OMR A;  2TN4 A;  3I5I B;  1YTZ C;  4P5O E;  2WC6 A;  2L5Y A;  1YRT B;  1FI6 A;  1ZAC A;  3RZS A;  4N5X A;  3LL8 B;  5FI7 A;  1KWO C;  2NLN A;  1W7I B;  1TUJ A;  3BOW A;  1LKJ A;  1SL7 A;  3OX6 A;  1ZMZ A;  4HRE E;  2SAS A;  2RGI A;  1JUO A;  3MSE B;  1KK7 Y;  2KDH A;  2NZ0 A;  5JOL A;  2BL0 C;  3WNX B;  4I5L B;  5K89 A;  3SJS A;  4M2Q A;  2PVB A;  2E30 A;  1C3Z A;  3FE6 A;  4ZCU A;  1Q80 A;  1R6P A;  5IBW A;  4FQT A;  3BUM B;  3VB1 A;  2BKI B;  2LP2 A;  4HRG A;  4IL1 A;  1JFK A;  1X02 A;  4HRH A;  5EL2 A;  2KI4 B;  1TNX A;  3FE8 A;  2ISD A;  1DTL A;  1MQ1 A;  2GTE A;  1XFU O;  3L4L A;  2MHH A;  3FWB A;  3SIB A;  3BXK A;  4I5K A;  1JBA A;  1CFP A;  3D10 A;  5HYD A;  5ER4 X;  2F8P A;  5CSI A;  1OW4 A;  3S0E A;  1AK8 A;  3D0Y A;  2MAZ A;  1M39 A;  2FCD A;  1WRL A;  2LVJ A;  2H61 A;  3D75 A;  3DXL A;  3TUY C;  1FPW A;  3K21 A;  4YBH B;  4CLN A;  2KHN A;  1P28 A;  4USL A;  5AFP A;  5ER5 A;  4UPG A;  1J7Q A;  1RWY A;  3DYE A;  1REC A;  1SR6 C;  1DGU A;  1WLM A;  2M9G A;  1Z4H A;  1QVI Z;  3OHM B;  4MBE A;  4NQG A;  1B1G A;  2G2B A;  1XA5 A;  1R2U A;  2WC5 A;  2KI6 D;  2K7D A;  3HX4 A;  4DCK A;  5I2Q A;  2EHB A;  1N65 A;  2G9B A;  1WY9 A;  3WHU B;  1B8C A;  2Y1N A;  3EK4 A;  1AJ5 A;  4GGF A;  5JJG A;  1L7Z A;  3R72 A;  1UWO A;  2OS8 B;  1L2O C;  1SRA A;  2QEH A;  1PAL A;  1BOD A;  2NXQ A;  4DRW A;  1BU3 A;  2QEO A;  2LHI A;  5FYX A;  1TNP A;  3TS5 C;  4JKT A;  3LLE A;  1YUR A;  3TDU A;  3D78 A;  2BBN A;  1SR6 B;  4MRX A;  1A75 A;  1LVC D;  1XYD A;  3OBV A;  3SG6 A;  2Q91 A;  1F54 A;  1S5G Y;  3BFB A;  1GM0 A;  4PE4 A;  1CB1 A;  3AKA A;  1CTR A;  2KLE A;  2KYC A;  2BBM A;  2LLT A;  3EVR A;  1CM4 A;  3KPX A;  1J55 A;  2K60 A;  4JPZ B;  5I2L A;  2LE9 B;  2Y4Q A;  1UHH A;  3CZT X;  1QAS A;  5CSF A;  2BNX A;  2JTZ A;  4PHK A;  1DQE A;  1Y6W A;  2L98 A;  3AAJ A;  1LS8 A;  4GGN A;  4I5J A;  1KFU L;  4ICB A;  1KFX L;  2BE6 A;  2LHL A;  3CAB A;  2CT9 A;  4P2Y B;  2M29 A;  2LVK A;  1ALV A;  3UNW A;  3AKB A;  4WQ2 A;  2GV5 A;  2KAX A;  3LCP C;  2QDI A;  1CFF A;  1CLL A;  2K2A A;  1H4B A;  1A4P A;  1XFW O;  1JWD A;  3TS5 B;  3EKJ A;  2H61 C;  1NCX A;  1TOP A;  2JQ6 A;  1B7T Z;  1JFJ A;  4MVF A;  2PAS A;  1S3P A;  4MN0 A;  1B8R A;  3DF0 A;  3TZ1 A;  2FCE A;  3BOW B;  2LAN A;  1CNP A;  1IWQ A;  2LVI A;  4PT1 A;  1A2X A;  2BE4 A;  4NDC A;  1XFR A;  4L9M A;  4PCW A;  3B88 A;  2AUC A;  4F0Z B;  4MLW A;  1C7W A;  2F2O A;  1EJ3 A;  4AOM A;  1TN4 A;  1ODB A;  1PSB A;  3DVJ A;  1QTX A;  5FI6 A;  3CR5 X;  3SS5 A;  2WND A;  1MHO A;  3R1V A;  4GGF C;  1D1O A;  1U5I B;  3VGO A;  3B87 A;  3D0Y B;  1KQM C;  1OSA A;  1Y1A A;  4N1F A;  4YGB B;  5BPJ A;  1M31 A;  1N2D A;  1DJX A;  3JTD B;  1AP4 A;  4QJ4 B;  2M3W A;  3PAT A;  3LK1 A;  2CBL A;  1SCV A;  2L2E A;  1KK8 B;  3LK0 A;  3NGV A;  4ORC B;  3ZNI A;  3R1P A;  1F70 A;  3D76 A;  2ZNE A;  1G4Y R;  1YUT A;  3DVK A;  4PE7 A;  2L5X B;  3OP0 A;  2JPT A; 
#chains in the Genus database with same CATH homology
 1IQ3 A;  3I5F B;  4MEW A;  4AQJ A;  4DUQ A;  1UUS A;  1J1E A;  2COL B;  3ZWH A;  1NCY A;  4GAO A;  1PVB A;  1IGV A;  2GGZ A;  1NSH A;  1QLK A;  1FF1 A;  1G8I A;  2LVV A;  1KQM B;  1DJH A;  1KK7 Z;  1TNW A;  2OTG C;  2VRG A;  1KSO A;  2R2I A;  1FW4 A;  1CLB A;  2L50 A;  3AAK A;  1A75 B;  1DJZ A;  3SG7 A;  4HSZ A;  1DMO A;  4ZCV A;  5CSJ A;  3VRN A;  4C0J A;  1NX3 A;  1SYM A;  1NUB A;  2JC2 A;  2K61 A;  4MZJ A;  3RM1 A;  3TDU A;  1QIV A;  1KWO B;  1J7R A;  1WRZ A;  4FTG A;  1UHJ A;  4MZL A;  1G33 A;  3EK7 A;  3I5G C;  3GK2 A;  5AXI A;  2Y1M A;  4YGE B;  2BL0 B;  2FOT A;  4ETO A;  3WHT B;  1E8A A;  1ALW A;  1NYA A;  2BCA A;  3NSI A;  5HLO A;  1F4O A;  1TIZ A;  1YX8 A;  3BUW B;  1AUI B;  1WDC C;  1CFC A;  2LLS A;  1K9P A;  2EGD A;  3CR2 A;  1OMD A;  4ORB B;  2WCF A;  1DJY A;  3H4S E;  3DF0 B;  1TRF A;  2P6B B;  3SG4 A;  3JVT C;  4CFR A;  5B8I B;  1IKU A;  2PRU A;  2B1U A;  2I18 A;  1DGV A;  3OX5 A;  3KO0 A;  2MBX A;  2O60 A;  2L0P A;  2MLE C;  5KTY A;  4PE0 A;  1EH2 A;  4Q04 A;  5GQQ C;  1M63 B;  2HQ8 A;  2JTT A;  4PHM A;  3TUY B;  1CDN A;  1SK6 D;  1F71 A;  2L4H A;  1MXE A;  4OV2 A;  1NX0 A;  5JJG A;  1QAT A;  2KBM A;  3IQO A;  1TCF A;  3SG3 A;  2KNE A;  1CFD A;  1CMF A;  1K94 A;  2WOS A;  2JT0 A;  1ZOT B;  1XVJ A;  5HLV A;  1N0Y A;  1K90 D;  1SCM C;  2JUL A;  1BMO A;  3O78 A;  3HCM A;  1VRK A;  1QXP A;  2ZRS A;  3VRQ A;  2KFF A;  1CDP A;  2ZRT A;  2KFG A;  1DT7 B;  2L51 A;  2M0R A;  3E3R A;  3PSR A;  5AER A;  2M1K B;  3EVU A;  1XK4 A;  1WDC B;  4M2P A;  1S5G Z;  1K8U A;  2LM5 A;  2LP3 A;  4OCI A;  3KF9 A;  2HPS A;  1ZFS A;  1QX5 B;  1SPY A;  1SL9 A;  5PAL A;  1L2O B;  3KHE A;  4OR9 B;  4ORA B;  4NDD A;  1MF8 B;  1SNL A;  2MRD A;  1J7P A;  4YGC B;  3PN7 C;  1K9U A;  2ZFD A;  3PM8 A;  4PDZ A;  3PAL A;  1EG4 A;  1NWD A;  2KAV A;  1QX2 A;  2MA2 A;  3C1V A;  2JT3 A;  4DS7 A;  1MWN A;  1A03 A;  3O4Y A;  4XYN A;  4JQ0 D;  3DVE A;  1CDM A;  2CTN A;  2CCM A;  1BG1 A;  4GUK A;  1B47 A;  4YI9 A;  5DKN A;  1NIW A;  2JWW A;  4OKH A;  1S1E A;  1WLZ A;  1KQV A;  1KSM A;  1F4Q A;  3DD4 A;  2LCP A;  3PLF B;  2F33 A;  2A4J A;  4TNC A;  4YRU A;  1MXL C;  1IJ5 A;  4GFT A;  1AHR A;  5DKR A;  5I8N A;  1PRW A;  1GGZ A;  2K7C A;  3O2P A;  5KU1 A;  3A4U B;  2JXC A;  3SIA A;  2KQ6 A;  2K7O A;  4N1G A;  3BUO B;  3EKH A;  2JZI A;  1W7J B;  5J3X A;  1B8L A;  1PVA A;  2D8N A;  1TTX A;  2LMT A;  3TDZ A;  1PK0 D;  1IJ6 A;  1CKK A;  1NCZ A;  1TCO B;  3CLN A;  1B4C A;  2L4I A;  1MUX A;  2KYF A;  3CR4 X;  1CLM A;  4C0K A;  1DJI A;  2HQW A;  4QJ5 B;  3BUX B;  2KSP A;  3DVM A;  2GGM A;  1XK4 C;  1SMG A;  1S36 A;  2LV7 A;  4R1E A;  2JOJ A;  5D7F A;  3FS7 A;  1K96 A;  2KAY A;  2LAP A;  2BCB A;  4OVN F;  1OQP A;  1LA3 A;  2KGB C;  2KI4 C;  1PUL A;  2HET A;  2KQY A;  4PE1 A;  4XJK A;  2M8U A;  4I5N B;  1GJY A;  1HQV A;  1GGW A;  1NX1 A;  1SL8 A;  2EC6 C;  2I2R E;  2M49 B;  2LC5 A;  1FBV A;  1NP8 A;  2BKH B;  4YI8 A;  4JWQ A;  1EL4 A;  2MLF C;  1J7O A;  1GQM A;  1UP5 A;  3RLZ A;  1Y1U A;  1ZUZ A;  2LMU A;  4NDB A;  2Q4U A;  4GBA A;  3FIA A;  2ZN9 A;  1RK9 A;  1JSA A;  1QLS A;  1H8B A;  1CMG A;  1BT6 A;  3ICB A;  1LXF C;  2M7N A;  3GK1 A;  1Y1X A;  1TNQ A;  1XFV O;  5G08 A;  4CFQ A;  4A4B A;  1RTP 1;  5AAN A;  5KSZ A;  1CDL A;  2F2P A;  2JT8 A;  1OZS A;  3SG5 A;  1RFJ A;  2AAO A;  3OB2 B;  1BR1 B;  3A8R A;  1U5I A;  2I7A A;  4AQI A;  2OS8 C;  2OTG B;  1UHI A;  2EC6 B;  2KFH A;  4DIR A;  2F3Y A;  5AEQ A;  3WXA A;  3CS1 A;  1XFZ O;  2QPT A;  4YGD B;  5I2O A;  4GPL B;  1BLQ A;  4BY5 A;  1OZO A;  1QVI Y;  1S6J A;  3GOF A;  5HKY A;  2H2K A;  3OB1 B;  4MRY A;  3BQ3 A;  1V1F A;  1DF0 A;  2JXL A;  3KEV A;  1JF2 A;  2JNF A;  3I5H C;  1HT9 A;  5DKQ A;  2KOT A;  1AJ4 A;  1A29 A;  3I5G B;  1KFU S;  3F45 A;  4MSP A;  1KFX S;  1LA0 A;  1SW8 A;  1OOJ A;  2PMY A;  1YVH A;  5CPV A;  2E6W A;  4M2O A;  1J1D A;  2LUC A;  5F6T A;  1QV0 A;  2IS9 A;  1YRU B;  1Y0V H;  2LLU A;  1QV1 A;  1IH0 A;  1XFY O;  4E68 A;  1K2H A;  2O5G A;  1S6I A;  2DOQ A;  4U8D A;  1WRK A;  1C07 A;  3JVT B;  2K8M B;  2KGR A;  4C0L A;  2AMI A;  1K95 A;  4PHJ A;  1EG3 A;  5HKW A;  2K7B A;  2K0J A;  3I5H B;  1KCY A;  3VRO A;  2PAL A;  3CGA A;  2LNK A;  1UHK A;  1JF0 A;  1XFX O;  1YUS A;  2JNX A;  4GNK B;  1DJG A;  2Y5I A;  1S6C A;  1YVL A;  2LUX A;  4A4C A;  1S26 D;  3O6B A;  2I94 A;  2LMV A;  3BUN B;  1SCM B;  1SY9 A;  2ZN8 A;  4QJ3 B;  2F3Z A;  2M1U A;  1BJF A;  1V1G A;  2ZKM X;  1DJW A;  5D69 A;  4D1E A;  1OE9 B;  4MZK A;  3VRR A;  1SBJ A;  2MJW B;  1YR5 A;  1B7T Y;  1QS7 A;  5HKZ A;  1FI5 A;  4XJK B;  1NX2 A;  2WC8 A;  1BF5 A;  3BYA A;  3FWC A;  4CID A;  4WQ3 A;  1BOC A;  3IQQ A;  2WCB A;  2NCP A;  3EK8 A;  3NSK A;  3SG2 A;  1IG5 A;  4PHN A;  1LIN A;  2KBI A;  4PAL A;  3JTD C;  1M45 A;  2WCE A;  1XO5 A;  1YX7 A;  3GK4 X;  3M0W A;  1RJV A;  1UUR A;  3EVV A;  3TDI A;  3NXA A;  1YUU A;  1CM1 A;  1MR8 A;  2WOR A;  1JC2 A;  3IF7 A;  1NPQ A;  2M97 A;  1KK8 C;  3PN7 B;  1AVS A;  2ZND A;  3I5I C;  3VRP A;  2SCP A;  2CXJ A;  2QAC A;  2NCO A;  2JU0 A;  2K2F A;  2BCX A;  2M7L A;  4CPV A;  3I5F C;  2V53 A;  5TNC A;  1K93 D;  2FJU B;  1QX7 A;  1SKT A;  1UHN A;  3CWG A;  1F55 A;  1C7V A;  1QJT A;  2JRF A;  2CNP A;  2KI6 C;  2HF5 A;  4FQO A;  1IQ5 A;  1QIW A;  4YGA A;  1IRJ A;  2PSR A;  2OPO A;  1OMV A;  1B9A A;  5CSN A;  1DVI A;  1RRO A;  2BEC A;  1PSR A;  3QRX A;  4BY4 A;  1F8H A;  1M46 A;  3NSL A;  1EXR A;  1DF0 B;  3PFV A;  4WRI A;  3CTN A;  3NSO A;  1BR4 B;  1K9K A;  1OMR A;  2TN4 A;  3I5I B;  1YTZ C;  4P5O E;  1YRT B;  1FI6 A;  1ZAC A;  4N5X A;  3LL8 B;  1KWO C;  2NLN A;  1W7I B;  3BOW A;  3OX6 A;  1LKJ A;  1SL7 A;  4HRE E;  1ZMZ A;  2SAS A;  2RGI A;  1JUO A;  3MSE B;  1KK7 Y;  2KDH A;  2NZ0 A;  5JOL A;  2BL0 C;  3WNX B;  4I5L B;  5K89 A;  3SJS A;  4M2Q A;  2PVB A;  2E30 A;  4ZCU A;  1Q80 A;  1R6P A;  5IBW A;  3BUM B;  2BKI B;  2LP2 A;  4HRG A;  4IL1 A;  1JFK A;  1X02 A;  4HRH A;  2KI4 B;  1TNX A;  2ISD A;  1DTL A;  1MQ1 A;  1XFU O;  3SIB A;  2MHH A;  3FWB A;  3BXK A;  4I5K A;  1JBA A;  1CFP A;  3D10 A;  5HYD A;  5ER4 X;  2F8P A;  5CSI A;  1AK8 A;  3D0Y A;  2MAZ A;  1M39 A;  2FCD A;  1WRL A;  2LVJ A;  2H61 A;  3TUY C;  1FPW A;  3K21 A;  4YBH B;  4CLN A;  2KHN A;  4USL A;  5AFP A;  5ER5 A;  4UPG A;  1J7Q A;  1RWY A;  1REC A;  1SR6 C;  1DGU A;  1WLM A;  2M9G A;  1QVI Z;  3OHM B;  4MBE A;  4NQG A;  1B1G A;  2G2B A;  1XA5 A;  1R2U A;  2KI6 D;  2K7D A;  3HX4 A;  4DCK A;  5I2Q A;  2EHB A;  1N65 A;  2G9B A;  1WY9 A;  3WHU B;  1B8C A;  2Y1N A;  3EK4 A;  1AJ5 A;  4GGF A;  1L7Z A;  1UWO A;  2OS8 B;  1L2O C;  1SRA A;  1PAL A;  1BOD A;  2NXQ A;  4DRW A;  1BU3 A;  2LHI A;  5FYX A;  1TNP A;  3TS5 C;  3LLE A;  1YUR A;  2BBN A;  1SR6 B;  4MRX A;  1A75 A;  1LVC D;  1XYD A;  3SG6 A;  1F54 A;  2Q91 A;  1S5G Y;  4PE4 A;  1CB1 A;  3AKA A;  1CTR A;  2KYC A;  2LLT A;  2BBM A;  3EVR A;  3KPX A;  1CM4 A;  4JPZ B;  1J55 A;  5I2L A;  2LE9 B;  2Y4Q A;  1UHH A;  3CZT X;  1QAS A;  5CSF A;  2JTZ A;  4PHK A;  2L98 A;  1Y6W A;  3AAJ A;  4I5J A;  4GGN A;  1KFU L;  4ICB A;  1KFX L;  2BE6 A;  2LHL A;  2CT9 A;  4P2Y B;  2M29 A;  2LVK A;  1ALV A;  3AKB A;  4WQ2 A;  2GV5 A;  2KAX A;  3LCP C;  1CFF A;  1CLL A;  2K2A A;  1H4B A;  1A4P A;  1XFW O;  1JWD A;  3TS5 B;  3EKJ A;  2H61 C;  1NCX A;  1TOP A;  2JQ6 A;  1B7T Z;  1JFJ A;  4MVF A;  2PAS A;  1S3P A;  4MN0 A;  1B8R A;  3DF0 A;  3TZ1 A;  2FCE A;  3BOW B;  2LAN A;  1CNP A;  1IWQ A;  2LVI A;  1A2X A;  2BE4 A;  4NDC A;  4L9M A;  4PCW A;  4F0Z B;  2AUC A;  4MLW A;  1C7W A;  2F2O A;  1EJ3 A;  4AOM A;  1TN4 A;  1ODB A;  1PSB A;  3DVJ A;  1QTX A;  3CR5 X;  2WND A;  1MHO A;  4GGF C;  1D1O A;  1U5I B;  3VGO A;  3D0Y B;  1KQM C;  1OSA A;  1Y1A A;  4N1F A;  4YGB B;  5BPJ A;  1M31 A;  1N2D A;  1DJX A;  3JTD B;  1AP4 A;  4QJ4 B;  2M3W A;  3PAT A;  3LK1 A;  2CBL A;  1SCV A;  2L2E A;  1KK8 B;  3LK0 A;  4ORC B;  3ZNI A;  1F70 A;  2ZNE A;  1G4Y R;  1YUT A;  3DVK A;  4PE7 A;  2L5X B;  3OP0 A;  2JPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...