1KQVA

Family of nmr solution structures of ca ln calbindin d9k
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN
publication title Paramagnetism-based versus classical constraints: an analysis of the solution structure of Ca Ln calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqvA00
4GFTA 1PSBA 4AQJA 1F71A 1RTP1 1DVIA 2M9GA 3AKAA 5D7FA 4DS7A 1K8UA 5KU1A 1IKUA 2JPTA 1U5IA 1MWNA 1UURA 2AMIA 1XK4A 1SMGA 5CSFA 2JXCA 1MR8A 2D8NA 2OS8B 4PE4A 2L50A 1JF2A 2F3YA 2KI6C 1IG5A 3TUYB 2TN4A 4L9MA 4YRUA 1SR6B 1B9AA 1QV1A 4USLA 1DF0A 2EHBA 1QX7A 3DF0A 1KK8C 3HCMA 2KFHA 4C0JA 1C7WA 2K7DA 5G08A 5TNCA 2LC5A 1QX2A 2KI4C 1YVLA 2EGDA 2M49B 3BUOB 1JWDA 1NX3A 1QIWA 1D1OA 1SW8A 4ZCVA 1AUIB 1NYAA 1SBJA 1SK6D 2B1UA 4ORAB 5KSZA 3NXAA 4MLWA 4MRXA 1VRKA 1L7ZA 2ZRSA 4WQ3A 4FQOA 2Y1MA 3WHUB 4BY4A 1TNXA 2PVBA 4NQGA 3SG6A 3WNXB 5B8IB 4GGNA 3NSIA 3K21A 2LAPA 1XO5A 1SCVA 1WDCC 3PM8A 4PHMA 4E68A 1CDMA 1QJTA 1CFPA 3I5IC 1FBVA 2CT9A 2BECA 3EKJA 2NCOA 2PALA 2I18A 3JTDC 2CBLA 1UWOA 3C1VA 2Q4UA 1SL7A 1TOPA 1XVJA 1QVIZ 2JU0A 2R2IA 3OB2B 4N5XA 2ZNEA 1WRZA 2K7CA 5CSJA 4YGEB 3CLNA 1CM1A 1K90D 1QATA 2WCFA 1BMOA 1PVAA 1K94A 1MUXA 2NLNA 1FI5A 1RK9A 1S26D 2K7BA 4I5KA 5HKWA 4PHJA 3VROA 1S6CA 2KFFA 4A4BA 4GNKB 3D10A 2FCDA 2JULA 1WLMA 1XFWO 1Y1AA 2FCEA 3H4SE 1FF1A 1M39A 1DJHA 3IQQA 1SYMA 2MA2A 4A4CA 1QLSA 1K9UA 2ZRTA 1X02A 3BUWB 1CLMA 4YGAA 1SKTA 3AAKA 4GBAA 1G4YR 2BKHB 4MZKA 1NCZA 1XYDA 4C0LA 5HYDA 2LLSA 2MHHA 4YGBB 1JUOA 2M8UA 1MQ1A 2LCPA 3JVTC 5JOLA 2EC6C 3LL8B 2JTTA 1OOJA 2M0RA 1SRAA 2PSRA 3IF7A 3BYAA 3KF9A 4PHKA 1CFCA 1IJ5A 2F2OA 3TS5C 1N2DA 5GQQC 3I5GB 3I5FB 2KHNA 5AERA 1F4QA 4GUKA 3PALA 3O6BA 2LLTA 3LK1A 4DIRA 3ZNIA 3OP0A 4PCWA 2NCPA 4ICBA 1SPYA 4R1EA 1CDNA 1BLQA 3PN7C 1IQ3A 1TTXA 1UHJA 1YUTA 1B7TY 5ER4X 4AQIA 1UHNA 5AXIA 1K9PA 1UP5A 2JC2A 5HLVA 1K95A 1KFXS 4OVNF 1BF5A 1JSAA 2COLB 4MVFA 1UHHA 1UHIA 2ZFDA 1R6PA 1Y6WA 2LUXA 2Q91A 3EK8A 1M46A 2H61A 1KWOC 2Y4QA 1R2UA 1A75B 3D0YB 1NX0A 4YGDB 3KPXA 1FI6A 3CR4X 1H4BA 1A4PA 2BKIB 1B1GA 3SG2A 1EJ3A 1A29A 1GQMA 2FOTA 1OMRA 4GAOA 4C0KA 2JNFA 3SIAA 3OX5A 4MN0A 1RJVA 2JT8A 3AKBA 5F6TA 2K8MB 1YX8A 2LE9B 1N0YA 4TNCA 4NDDA 1Y1UA 2HQ8A 1NX2A 2KBIA 2HQWA 1W7IB 1QV0A 3I5HC 3WXAA 4DRWA 4PE1A 1CLBA 2L2EA 5PALA 1GJYA 2KAXA 1KK7Y 1QX5B 3QRXA 2JT3A 3DVMA 1C07A 1XA5A 1B8LA 3WHTB 1MXLC 1QASA 4YI8A 2KOTA 2KAYA 2KI4B 1BT6A 5DKQA 3SG7A 2KNEA 1NUBA 3OHMB 1YRUB 3TDUA 3SIBA 2H61C 1LVCD 4ZCUA 2LMTA 2O60A 5K89A 2KAVA 1ZACA 3FWCA 1SY9A 2BL0B 1CDPA 2H2KA 4BY5A 3M0WA 2LMUA 3TUYC 1SL9A 1K96A 1SR6C 1S5GZ 1ZOTB 1M63B 2NZ0A 2LM5A 2NXQA 4AOMA 1WDCB 2M29A 2DOQA 1J1DA 3TZ1A 1U5IB 4GGFA 3I5IB 1F55A 2F8PA 1LA3A 1QXPA 1S1EA 1B4CA 4OR9B 3BXKA 1NWDA 5HKYA 1J7OA 1AVSA 1DTLA 4XJKA 4UPGA 2LNKA 1PALA 3EK4A 1YUUA 1JBAA 3BOWA 2BE4A 1RECA 1DF0B 2A4JA 4MEWA 5ER5A 3CWGA 1OZOA 3DF0B 1B8RA 1SCMB 2O5GA 1ZMZA 4HRGA 2GV5A 1K93D 3PLFB 1MXEA 2CTNA 2M97A 5FYXA 5I2OA 4ORCB 1RFJA 4YI9A 1XFYO 4MRYA 2M7NA 2KSPA 2LVKA 1KFUL 2BBMA 3KEVA 1GGWA 1BJFA 1B7TZ 1LA0A 1OMDA 2IS9A 1PSRA 5KTYA 3TDIA 4PE7A 1LXFC 2L98A 2PRUA 3GK1A 2JQ6A 1RROA 3LK0A 2ISDA 1YX7A 5CSNA 2G9BA 2JZIA 1BR1B 1HQVA 1EG4A 1F70A 2BE6A 1DGUA 1V1GA 2GGMA 4GGFC 4M2PA 1EG3A 2ZKMX 2KQYA 1LKJA 1S36A 1NPQA 1JC2A 2WCEA 1QIVA 4MSPA 3VRRA 3BQ3A 4PE0A 1JF0A 2LVIA 2MBXA 2HETA 1EL4A 1S6IA 1IRJA 4MZLA 1WY9A 1CNPA 1OE9B 2KQ6A 4NDBA 2AAOA 2MLEC 1TNQA 4YGCB 5BPJA 3A4UB 3SJSA 4WRIA 2LVVA 3HX4A 2LP2A 3DVJA 5I2LA 1TNPA 3EK7A 2V53A 2MAZA 3CR5X 3EVUA 4I5JA 3OB1B 1KQMC 5J3XA 1KK7Z 1L2OB 1AHRA 1QLKA 2OTGB 4FTGA 3BUXB 1NX1A 3EVVA 3LLEA 5CSIA 4WQ2A 2PMYA 1J55A 4QJ5B 1DJZA 3F45A 4MZJA 1MF8B 4HREE 2I2RE 2AUCA 2QACA 2KGBC 3E3RA 1QVIY 2E6WA 2MRDA 5CPVA 3I5GC 1H8BA 1KWOB 1IGVA 1CFFA 4P2YB 1E8AA 3ZWHA 1NCXA 5AEQA 1S6JA 3OX6A 3CS1A 5D69A 2F2PA 2RGIA 3SG5A 1AJ5A 1N65A 1DMOA 1F8HA 2LP3A 5DKNA 2LHLA 4CLNA 2JXLA 2Y1NA 1F4OA 4ORBB 2WC8A 4CIDA 1CKKA 3SG3A 2BCXA 1AP4A 1DJYA 4GPLB 1IQ5A 2KYFA 2GGZA 1TCOB 1CMGA 2CNPA 1UHKA 2K2FA 4U8DA 1ODBA 1KK8B 1KSMA 4N1GA 1TNWA 3O4YA 1ZUZA 1YURA 1DJXA 1XFXO 1XFVO 1MHOA 2KI6D 1FPWA 2MLFC 2I7AA 3SG4A 1EXRA 3LCPC 1IJ6A 2WORA 4F0ZB 5HKZA 4PALA 2K61A 3KHEA 2L5XB 2M3WA 2K7OA 1CMFA 1BR4B 1OZSA 1ALWA 3VRQA 1A2XA 2OPOA 3NSLA 4CFRA 1QS7A 2MJWB 2OS8C 1BOCA 1CM4A 1UUSA 1IH0A 1WLZA 1CLLA 2VRGA 2K2AA 2LV7A 1SNLA 1IWQA 3A8RA 1PULA 1G33A 1J7RA 4M2QA 4CPVA 1Q80A 3JTDB 3MSEB 1HT9A 1AJ4A 2L0PA 1CTRA 2M1UA 3CZTX 3NSOA 2JOJA 4OV2A 2JTZA 2LHIA 2PASA 3PFVA 2HPSA 2WCBA 3DVEA 2BL0C 1S3PA 1QTXA 2L4IA 1EH2A 3RM1A 2HF5A 1TIZA 4HRHA 4OCIA 4HSZA 1RWYA 3BUNB 1YVHA 4JPZB 4JWQA 4PDZA 1BG1A 2ZN8A 1DJWA 1DJIA 3BUMB 5I8NA 1J7PA 1J1EA 1K2HA 3VRPA 1OMVA 3O78A 1NCYA 5DKRA 4P5OE 3AAJA 1XK4C 3FS7A 1OSAA 2G2BA 2I94A 2L51A 1BODA 1YR5A 1A03A 3RLZA 3GOFA 1SCMC 2LANA 1YUSA 2ZNDA 2BCBA 2L4HA 1C7VA 2WOSA 1WRKA 4QJ3B 5I2QA 1FW4A 3JVTB 1GGZA 1K9KA 2LLUA 3FIAA 4XJKB 2EC6B 5JJGA 1TRFA 1NP8A 3BOWB 1G8IA 2CCMA 1PRWA 2QPTA 3GK2A 4QJ4B 2BBNA 3EKHA 2E30A 3TS5B 3CGAA 1PVBA 2BCAA 3VGOA 1KSOA 3NSKA 1KFUS 2Y5IA 3DVKA 4I5NB 1TCFA 3PSRA 1ZFSA 1JFJA 1YTZC 4M2OA 1CB1A 1PK0D 2LUCA 4CFQA 5IBWA 1DJGA 1KFXL 4DCKA 1S5GY 2JRFA 2ZN9A 1KQMB 2JT0A 1B8CA 1SL8A 1DT7B 1KCYA 1A75A 3PN7B 4NDCA 3D0YA 1WRLA 3FWBA 1OQPA 2FJUB 1KQVA 2WNDA 1CDLA 1V1FA 3CTNA 5AANA 1NSHA 1DGVA 1AK8A 3CR2A 1LINA 3IQOA 2JWWA 3O2PA 2KDHA 2SCPA 4IL1A 2M7LA 3I5FC 4N1FA 3VRNA 3KO0A 4ETOA 2SASA 4JQ0D 1B47A 5AFPA 5HLOA 1M45A 1CFDA 2CXJA 2KFGA 4DUQA 2OTGC 1L2OC 1W7JB 1TN4A 2LMVA 1JFKA 2M1KB 4Q04A 2F3ZA 1J7QA 2JNXA 1M31A 3ICBA 4OKHA 1XFUO 1Y1XA 2KBMA 3DD4A 1NIWA 1ALVA 3TDZA 1XFZO 2KGRA 1Y0VH 4I5LB 4MBEA 2KYCA 3I5HB 1YRTB 3GK4X 2K0JA 4XYNA 4YBHB 4D1EA 3PATA 4PHNA 1BU3A 2F33A 2P6BB 3EVRA 2LVJA 1F54A
chains in the Genus database with same CATH superfamily
3O4XA 4GFTA 1PSBA 4AQJA 1F71A 1RTP1 1DVIA 2M9GA 3AKAA 5FI6A 5D7FA 4DS7A 1K8UA 5KU1A 1IKUA 2JPTA 1U5IA 1MWNA 4INXA 4IJ7A 1UURA 2AMIA 1XK4A 1SMGA 5CSFA 2JXCA 1MR8A 2D8NA 2OS8B 4PE4A 2L50A 1JF2A 2F3YA 2KI6C 1IG5A 3TUYB 2TN4A 4L9MA 4YRUA 1SR6B 1B9AA 1QV1A 4USLA 1DF0A 2EHBA 1QX7A 3DF0A 1KK8C 2KPHA 1W9ZA 3HCMA 2KFHA 4C0JA 1C7WA 3N7HA 1DC1A 2K7DA 5G08A 5TNCA 2H8VA 2LC5A 3DYEA 1QX2A 2KI4C 1YVLA 2EGDA 2M49B 3BUOB 1JWDA 1NX3A 3Q8IA 1QIWA 1D1OA 1SW8A 4ZCVA 1AUIB 1NYAA 1SBJA 1SK6D 2B1UA 4ORAB 5KSZA 3NXAA 4MLWA 4MRXA 1VRKA 1L7ZA 2ZRSA 3L4LA 4FQOA 2Y1MA 4WQ3A 3WHUB 1TNXA 4BY4A 2PVBA 4NQGA 3SG6A 3WNXB 5B8IB 4GGNA 3NSIA 3QMEA 1TWOA 3BFHA 3K21A 3R1VA 2LAPA 1XO5A 1SCVA 1WDCC 3PM8A 4PHMA 4E68A 1CDMA 1QJTA 1CFPA 3I5IC 1FBVA 2CT9A 4FQTA 2BECA 3EKJA 2NCOA 2PALA 2I18A 3JTDC 2CBLA 1UWOA 3C1VA 2Q4UA 1SL7A 1TOPA 1XVJA 1QVIZ 2JU0A 2R2IA 3OB2B 4N5XA 4OZDA 2ZNEA 1WRZA 2K7CA 5CSJA 4YGEB 3CLNA 1CM1A 2WC6A 1K90D 1QATA 2WCFA 1BMOA 1PVAA 1K94A 1MUXA 2NLNA 1FI5A 1RK9A 1S26D 2K7BA 4I5KA 2YGUA 5HKWA 4PHJA 3B7AA 3VROA 3D75A 1S6CA 2KFFA 4A4BA 1C3YA 4GNKB 3D10A 2FCDA 2JULA 3FE9A 1WLMA 1XFWO 1Y1AA 2FCEA 3H4SE 4JKTA 1M39A 1FF1A 1DJHA 3IQQA 1SYMA 2MA2A 4A4CA 1QLSA 3B6XA 1K9UA 2ZRTA 1X02A 3BUWB 1CLMA 4YGAA 3D76A 1SKTA 3AAKA 4GBAA 1G4YR 2BKHB 4MZKA 1NCZA 1XYDA 4C0LA 3VB1A 5HYDA 2LLSA 2MHHA 4YGBB 1JUOA 2M8UA 1MQ1A 2LCPA 3JVTC 5JOLA 2EC6C 3B87A 2L5YA 3LL8B 2JTTA 1OOJA 2M0RA 1SRAA 2PSRA 3IF7A 3BYAA 3KF9A 1XFRA 4PHKA 3RZSA 1CFCA 1IIOA 1IJ5A 2F2OA 3TS5C 1N2DA 2PQLA 5GQQC 3I5GB 1OW4A 3I5FB 3CABA 3BFAA 3S0FA 2KHNA 5AERA 1F4QA 4GUKA 3PALA 3O6BA 3D78A 2LLTA 3LK1A 4DIRA 3ZNIA 3OP0A 4PCWA 2NCPA 1OOHA 4ICBA 1SPYA 4R1EA 1CDNA 1BLQA 3PN7C 1IQ3A 1TTXA 3K1EA 1UHJA 1YUTA 1B7TY 3DY9A 5ER4X 1UHNA 5FI7A 5AXIA 1K9PA 1UP5A 4AQIA 2JC2A 5HLVA 1K95A 1KFXS 4OVNF 3EG5B 1BF5A 2COLB 4MVFA 1UHHA 1JSAA 1UHIA 3R1PA 2ZFDA 1R6PA 1Y6WA 2LUXA 2Q91A 3EK8A 1M46A 2H61A 2WCKA 1KWOC 2L2CA 2Y4QA 1R2UA 3SS5A 1A75B 3D0YB 1NX0A 4YGDB 3KPXA 1FI6A 3CR4X 1H4BA 1A4PA 2BKIB 1B1GA 3SG2A 1EJ3A 1A29A 1GQMA 2FOTA 1OMRA 4GAOA 4C0KA 2JNFA 3SIAA 3OX5A 4MN0A 1RJVA 2JT8A 3AKBA 5D3OA 5F6TA 2K8MB 1YX8A 2GTEA 2LE9B 2ERBA 1N0YA 4TNCA 4NDDA 1Y1UA 2HQ8A 1NX2A 2KBIA 3DXLA 2HQWA 1W7IB 1QV0A 3I5HC 3WXAA 4DRWA 4PE1A 1TUJA 3S0GA 1CLBA 2L2EA 5PALA 1GJYA 2KAXA 1KK7Y 1QX5B 3QRXA 2JT3A 3DVMA 1C07A 1XA5A 1B8LA 3WHTB 1MXLC 1QASA 4YI8A 3S0AA 2KOTA 2KAYA 2WCMA 2KI4B 1BT6A 5DKQA 3SG7A 2KNEA 1NUBA 3OHMB 1YRUB 3TDUA 3SIBA 2H61C 1LVCD 4ZCUA 2LMTA 2O60A 5K89A 2KAVA 1ZACA 3FWCA 1SY9A 2BL0B 1CDPA 2H2KA 3PJIA 4BY5A 3M0WA 2LMUA 3IVTA 3TUYC 1SL9A 1K96A 1SR6C 1S5GZ 1ZOTB 1M63B 2NZ0A 3L47A 2BAPA 2LM5A 2NXQA 4AOMA 1WDCB 2M29A 2DOQA 1J1DA 3TZ1A 1U5IB 4GGFA 3I5IB 1F55A 2F8PA 1LA3A 1QXPA 1S1EA 1B4CA 4OR9B 3BXKA 1NWDA 5HKYA 3UO9A 1OOGA 1AVSA 1DTLA 1J7OA 4XJKA 4UPGA 5HL1A 1GM0A 2LNKA 1PALA 3CZ1A 1YUUA 3EK4A 1JBAA 3BOWA 2BE4A 1RECA 4KYNA 1DF0B 2A4JA 4MEWA 5ER5A 1TUZA 1OZOA 2QEOA 3CWGA 3DF0B 1B8RA 1SCMB 2O5GA 1ZMZA 4HRGA 2GV5A 1K93D 3PLFB 1MXEA 2CTNA 2M97A 5FYXA 5I2OA 4ORCB 1RFJA 4YI9A 1Z2CB 1XFYO 4MRYA 2M7NA 2KSPA 3CDNA 2LVKA 1KFUL 2BBMA 3KEVA 1GGWA 1BJFA 1B7TZ 1LA0A 1OMDA 2IS9A 1PSRA 3SS4A 5KTYA 3TDIA 4PE7A 1LXFC 2L98A 2PRUA 3GK1A 2JQ6A 1RROA 3LK0A 2ISDA 1YX7A 5CSNA 2G9BA 2JZIA 5DICA 1BR1B 1HQVA 1EG4A 1F70A 3S0DA 2BE6A 1DGUA 1V1GA 2GGMA 4GGFC 4JD9A 4M2PA 1EG3A 1LS8A 2ZKMX 2KQYA 1LKJA 1DQEA 1NPQA 1S36A 2WCEA 1QIVA 1JC2A 4MSPA 3VRRA 3BQ3A 4PE0A 1JF0A 2LVIA 2MBXA 2HETA 1EL4A 1S6IA 1IRJA 4MZLA 1WY9A 1CNPA 1OE9B 2KQ6A 3CZ2A 2WCLA 4NDBA 2AAOA 2MLEC 1TNQA 4YGCB 5BPJA 3A4UB 3SJSA 4WRIA 2LVVA 3HX4A 1DEKA 2LP2A 1C3ZA 3DVJA 3NGVA 5I2LA 1TNPA 3EK7A 2V53A 2MAZA 3CR5X 3EVUA 4I5JA 4F7FA 3OB1B 1KQMC 5J3XA 1KK7Z 1L2OB 1AHRA 1QLKA 2OTGB 4FTGA 3BUXB 1NX1A 1P28A 3EVVA 3LLEA 5CSIA 4WQ2A 2PMYA 1J55A 2PYQA 4QJ5B 1DJZA 3F45A 4MZJA 1MF8B 1SSEB 4HREE 2I2RE 2AUCA 2QACA 2KGBC 3FE8A 3E3RA 1QVIY 2E6WA 2MRDA 3FE6A 5CPVA 3I5GC 1H8BA 1KWOB 1IGVA 1CFFA 3L4AA 1E8AA 4P2YB 3ZWHA 2WCJA 1NCXA 5AEQA 1S6JA 3OX6A 3CS1A 5D69A 1T14A 2F2PA 2RGIA 3D77A 3SG5A 1AJ5A 1N65A 1DMOA 1F8HA 2LP3A 5DKNA 2LHLA 4CLNA 2JXLA 2Y1NA 1F4OA 4ORBB 2WC8A 4CIDA 1CKKA 2P71A 3SG3A 1ORGA 2BCXA 1AP4A 1DJYA 4GPLB 1IQ5A 2KYFA 1OOIX 2GGZA 1TCOB 1CMGA 2CNPA 1QWVA 1UHKA 2K2FA 4U8DA 1ODBA 3SS3A 1KK8B 1KSMA 4N1GA 1TNWA 3O4YA 1ZUZA 1YURA 1DJXA 1XFXO 1XFVO 1MHOA 2KI6D 1FPWA 2MLFC 2I7AA 3SG4A 1EXRA 3LCPC 1IJ6A 2WORA 4F0ZB 5HKZA 4PALA 2K61A 3KHEA 2L5XB 3DZTA 3CYZA 2M3WA 2K7OA 1CMFA 1BR4B 1OZSA 1ALWA 3VRQA 1A2XA 2OPOA 3NSLA 4CFRA 1QS7A 2MJWB 2OS8C 1BOCA 1CM4A 1UUSA 1IH0A 1WLZA 1CLLA 2VRGA 2K2AA 2LV7A 1SNLA 1IWQA 3A8RA 1PULA 1G33A 1J7RA 4M2QA 2BNXA 4CPVA 1Q80A 3JTDB 3MSEB 1HT9A 3BJHA 1AJ4A 2L0PA 1CTRA 2M1UA 3CZTX 3NSOA 2JOJA 4OV2A 2JTZA 2LHIA 2PASA 2JPOA 2QEHA 3PFVA 3R72A 2HPSA 2WCBA 2FJYA 3DVEA 2BL0C 1S3PA 1QTXA 2L4IA 1EH2A 3RM1A 2HF5A 1TIZA 4HRHA 4OCIA 4HSZA 3S0EA 1RWYA 3BUNB 1YVHA 4JPZB 4JWQA 1DELA 4PDZA 1BG1A 2ZN8A 1DJWA 1DJIA 3BUMB 3NHTA 5I8NA 1J7PA 1J1EA 2QEBA 1K2HA 3VRPA 1OMVA 3O78A 3CZ0A 1NCYA 5DKRA 4P5OE 3AAJA 1XK4C 3FS7A 1OSAA 2G2BA 2QDIA 2I94A 2L51A 3S0BA 1BODA 1YR5A 1A03A 3RLZA 3D73A 3GOFA 1SCMC 2LANA 1YUSA 4INWA 3PM2A 2ZNDA 2BCBA 2L4HA 1C7VA 2WOSA 1WRKA 3OGNA 4QJ3B 5I2QA 1FW4A 3JVTB 1GGZA 1K9KA 2LLUA 3FIAA 4XJKB 5FI2A 2EC6B 5JJGA 1TRFA 1NP8A 3BOWB 1G8IA 2CCMA 1PRWA 2QPTA 3BFBA 3GK2A 4QJ4B 3NHIA 2BBNA 3EKHA 2E30A 3TS5B 3CGAA 1PVBA 2BCAA 3VGOA 1KSOA 4PT1A 3NSKA 1KFUS 2Y5IA 3DVKA 1Z4HA 1TCFA 3PSRA 4I5NB 1ZFSA 2QEVA 1JFJA 1YTZC 4M2OA 5I94A 1PK0D 2LUCA 4CFQA 1CB1A 5IBWA 1DJGA 1KFXL 4DCKA 1S5GY 2JRFA 2ZN9A 1KQMB 2JT0A 1B8CA 1SL8A 3B86A 1DT7B 1KCYA 1A75A 3PN7B 4NDCA 3D0YA 2P70A 3V2LA 1WRLA 1OOFA 3FWBA 1OQPA 2FJUB 1KQVA 2WNDA 1CDLA 1V1FA 3CTNA 5AANA 1NSHA 1DGVA 3UNWA 1AK8A 3CR2A 3B88A 1LINA 3IQOA 2JWWA 3O2PA 2KDHA 2SCPA 4IL1A 2M7LA 3I5FC 4N1FA 3VRNA 2KLEA 3KO0A 4ETOA 2SASA 4JQ0D 1B47A 5AFPA 5HLOA 2K60A 1M45A 1CFDA 2CXJA 2KFGA 4DUQA 2WCHA 2OTGC 1L2OC 3D74A 1W7JB 1TN4A 2LMVA 1JFKA 2M1KB 4Q04A 2F3ZA 3OBVA 1J7QA 2JNXA 1M31A 3ICBA 4OKHA 1XFUO 1Y1XA 2KBMA 3DD4A 1NIWA 1ALVA 3TDZA 1XFZO 2KGRA 5EL2A 1Y0VH 4I5LB 4MBEA 2KYCA 3I5HB 1YRTB 2KLDA 3GK4X 2K0JA 2WC5A 4XYNA 4YBHB 4D1EA 3PATA 4PHNA 1BU3A 2F33A 2P6BB 3EVRA 2LVJA 3R1OA 1F54A
chains in the Genus database with same CATH topology
4GFTA 1PSBA 4AQJA 1F71A 1RTP1 1DVIA 2M9GA 3AKAA 5D7FA 4DS7A 1K8UA 5KU1A 1IKUA 2JPTA 1U5IA 1MWNA 1UURA 2AMIA 1XK4A 1SMGA 5CSFA 2JXCA 1MR8A 2D8NA 2OS8B 4PE4A 2L50A 1JF2A 2F3YA 2KI6C 1IG5A 3TUYB 2TN4A 4L9MA 4YRUA 1SR6B 1B9AA 1QV1A 4USLA 1DF0A 2EHBA 1QX7A 3DF0A 1KK8C 3HCMA 2KFHA 4C0JA 1C7WA 2K7DA 5G08A 5TNCA 2LC5A 1QX2A 2KI4C 1YVLA 2EGDA 2M49B 3BUOB 1JWDA 1NX3A 1QIWA 1D1OA 1SW8A 4ZCVA 1AUIB 1NYAA 1SBJA 1SK6D 2B1UA 4ORAB 5KSZA 3NXAA 4MLWA 4MRXA 1VRKA 1L7ZA 2ZRSA 4WQ3A 4FQOA 2Y1MA 3WHUB 4BY4A 1TNXA 2PVBA 4NQGA 3SG6A 3WNXB 5B8IB 4GGNA 3NSIA 3K21A 2LAPA 1XO5A 1SCVA 1WDCC 3PM8A 4PHMA 4E68A 1CDMA 1QJTA 1CFPA 3I5IC 1FBVA 2CT9A 2BECA 3EKJA 2NCOA 2PALA 2I18A 3JTDC 2CBLA 1UWOA 3C1VA 2Q4UA 1SL7A 1TOPA 1XVJA 1QVIZ 2JU0A 2R2IA 3OB2B 4N5XA 2ZNEA 1WRZA 2K7CA 5CSJA 4YGEB 3CLNA 1CM1A 1K90D 1QATA 2WCFA 1BMOA 1PVAA 1K94A 1MUXA 2NLNA 1FI5A 1RK9A 1S26D 2K7BA 4I5KA 5HKWA 4PHJA 3VROA 1S6CA 2KFFA 4A4BA 4GNKB 3D10A 2FCDA 2JULA 1WLMA 1XFWO 1Y1AA 2FCEA 3H4SE 1FF1A 1M39A 1DJHA 3IQQA 1SYMA 2MA2A 4A4CA 1QLSA 1K9UA 2ZRTA 1X02A 3BUWB 1CLMA 4YGAA 1SKTA 3AAKA 4GBAA 1G4YR 2BKHB 4MZKA 1NCZA 1XYDA 4C0LA 5HYDA 2LLSA 2MHHA 4YGBB 1JUOA 2M8UA 1MQ1A 2LCPA 3JVTC 5JOLA 2EC6C 3LL8B 2JTTA 1OOJA 2M0RA 1SRAA 2PSRA 3IF7A 3BYAA 3KF9A 4PHKA 1CFCA 1IJ5A 2F2OA 3TS5C 1N2DA 5GQQC 3I5GB 3I5FB 2KHNA 5AERA 1F4QA 4GUKA 3PALA 3O6BA 2LLTA 3LK1A 4DIRA 3ZNIA 3OP0A 4PCWA 2NCPA 4ICBA 1SPYA 4R1EA 1CDNA 1BLQA 3PN7C 1IQ3A 1TTXA 1UHJA 1YUTA 1B7TY 5ER4X 4AQIA 1UHNA 5AXIA 1K9PA 1UP5A 2JC2A 5HLVA 1K95A 1KFXS 4OVNF 1BF5A 1JSAA 2COLB 4MVFA 1UHHA 1UHIA 2ZFDA 1R6PA 1Y6WA 2LUXA 2Q91A 3EK8A 1M46A 2H61A 1KWOC 2Y4QA 1R2UA 1A75B 3D0YB 1NX0A 4YGDB 3KPXA 1FI6A 3CR4X 1H4BA 1A4PA 2BKIB 1B1GA 3SG2A 1EJ3A 1A29A 1GQMA 2FOTA 1OMRA 4GAOA 4C0KA 2JNFA 3SIAA 3OX5A 4MN0A 1RJVA 2JT8A 3AKBA 5F6TA 2K8MB 1YX8A 2LE9B 1N0YA 4TNCA 4NDDA 1Y1UA 2HQ8A 1NX2A 2KBIA 2HQWA 1W7IB 1QV0A 3I5HC 3WXAA 4DRWA 4PE1A 1CLBA 2L2EA 5PALA 1GJYA 2KAXA 1KK7Y 1QX5B 3QRXA 2JT3A 3DVMA 1C07A 1XA5A 1B8LA 3WHTB 1MXLC 1QASA 4YI8A 2KOTA 2KAYA 2KI4B 1BT6A 5DKQA 3SG7A 2KNEA 1NUBA 3OHMB 1YRUB 3TDUA 3SIBA 2H61C 1LVCD 4ZCUA 2LMTA 2O60A 5K89A 2KAVA 1ZACA 3FWCA 1SY9A 2BL0B 1CDPA 2H2KA 4BY5A 3M0WA 2LMUA 3TUYC 1SL9A 1K96A 1SR6C 1S5GZ 1ZOTB 1M63B 2NZ0A 2LM5A 2NXQA 4AOMA 1WDCB 2M29A 2DOQA 1J1DA 3TZ1A 1U5IB 4GGFA 3I5IB 1F55A 2F8PA 1LA3A 1QXPA 1S1EA 1B4CA 4OR9B 3BXKA 1NWDA 5HKYA 1J7OA 1AVSA 1DTLA 4XJKA 4UPGA 2LNKA 1PALA 3EK4A 1YUUA 1JBAA 3BOWA 2BE4A 1RECA 1DF0B 2A4JA 4MEWA 5ER5A 3CWGA 1OZOA 3DF0B 1B8RA 1SCMB 2O5GA 1ZMZA 4HRGA 2GV5A 1K93D 3PLFB 1MXEA 2CTNA 2M97A 5FYXA 5I2OA 4ORCB 1RFJA 4YI9A 1XFYO 4MRYA 2M7NA 2KSPA 2LVKA 1KFUL 2BBMA 3KEVA 1GGWA 1BJFA 1B7TZ 1LA0A 1OMDA 2IS9A 1PSRA 5KTYA 3TDIA 4PE7A 1LXFC 2L98A 2PRUA 3GK1A 2JQ6A 1RROA 3LK0A 2ISDA 1YX7A 5CSNA 2G9BA 2JZIA 1BR1B 1HQVA 1EG4A 1F70A 2BE6A 1DGUA 1V1GA 2GGMA 4GGFC 4M2PA 1EG3A 2ZKMX 2KQYA 1LKJA 1S36A 1NPQA 1JC2A 2WCEA 1QIVA 4MSPA 3VRRA 3BQ3A 4PE0A 1JF0A 2LVIA 2MBXA 2HETA 1EL4A 1S6IA 1IRJA 4MZLA 1WY9A 1CNPA 1OE9B 2KQ6A 4NDBA 2AAOA 2MLEC 1TNQA 4YGCB 5BPJA 3A4UB 3SJSA 4WRIA 2LVVA 3HX4A 2LP2A 3DVJA 5I2LA 1TNPA 3EK7A 2V53A 2MAZA 3CR5X 3EVUA 4I5JA 3OB1B 1KQMC 5J3XA 1KK7Z 1L2OB 1AHRA 1QLKA 2OTGB 4FTGA 3BUXB 1NX1A 3EVVA 3LLEA 5CSIA 4WQ2A 2PMYA 1J55A 4QJ5B 1DJZA 3F45A 4MZJA 1MF8B 4HREE 2I2RE 2AUCA 2QACA 2KGBC 3E3RA 1QVIY 2E6WA 2MRDA 5CPVA 3I5GC 1H8BA 1KWOB 1IGVA 1CFFA 4P2YB 1E8AA 3ZWHA 1NCXA 5AEQA 1S6JA 3OX6A 3CS1A 5D69A 2F2PA 2RGIA 3SG5A 1AJ5A 1N65A 1DMOA 1F8HA 2LP3A 5DKNA 2LHLA 4CLNA 2JXLA 2Y1NA 1F4OA 4ORBB 2WC8A 4CIDA 1CKKA 3SG3A 2BCXA 1AP4A 1DJYA 4GPLB 1IQ5A 2KYFA 2GGZA 1TCOB 1CMGA 2CNPA 1UHKA 2K2FA 4U8DA 1ODBA 1KK8B 1KSMA 4N1GA 1TNWA 3O4YA 1ZUZA 1YURA 1DJXA 1XFXO 1XFVO 1MHOA 2KI6D 1FPWA 2MLFC 2I7AA 3SG4A 1EXRA 3LCPC 1IJ6A 2WORA 4F0ZB 5HKZA 4PALA 2K61A 3KHEA 2L5XB 2M3WA 2K7OA 1CMFA 1BR4B 1OZSA 1ALWA 3VRQA 1A2XA 2OPOA 3NSLA 4CFRA 1QS7A 2MJWB 2OS8C 1BOCA 1CM4A 1UUSA 1IH0A 1WLZA 1CLLA 2VRGA 2K2AA 2LV7A 1SNLA 1IWQA 3A8RA 1PULA 1G33A 1J7RA 4M2QA 4CPVA 1Q80A 3JTDB 3MSEB 1HT9A 1AJ4A 2L0PA 1CTRA 2M1UA 3CZTX 3NSOA 2JOJA 4OV2A 2JTZA 2LHIA 2PASA 3PFVA 2HPSA 2WCBA 3DVEA 2BL0C 1S3PA 1QTXA 2L4IA 1EH2A 3RM1A 2HF5A 1TIZA 4HRHA 4OCIA 4HSZA 1RWYA 3BUNB 1YVHA 4JPZB 4JWQA 4PDZA 1BG1A 2ZN8A 1DJWA 1DJIA 3BUMB 5I8NA 1J7PA 1J1EA 1K2HA 3VRPA 1OMVA 3O78A 1NCYA 5DKRA 4P5OE 3AAJA 1XK4C 3FS7A 1OSAA 2G2BA 2I94A 2L51A 1BODA 1YR5A 1A03A 3RLZA 3GOFA 1SCMC 2LANA 1YUSA 2ZNDA 2BCBA 2L4HA 1C7VA 2WOSA 1WRKA 4QJ3B 5I2QA 1FW4A 3JVTB 1GGZA 1K9KA 2LLUA 3FIAA 4XJKB 2EC6B 5JJGA 1TRFA 1NP8A 3BOWB 1G8IA 2CCMA 1PRWA 2QPTA 3GK2A 4QJ4B 2BBNA 3EKHA 2E30A 3TS5B 3CGAA 1PVBA 2BCAA 3VGOA 1KSOA 3NSKA 1KFUS 2Y5IA 3DVKA 4I5NB 1TCFA 3PSRA 1ZFSA 1JFJA 1YTZC 4M2OA 1CB1A 1PK0D 2LUCA 4CFQA 5IBWA 1DJGA 1KFXL 4DCKA 1S5GY 2JRFA 2ZN9A 1KQMB 2JT0A 1B8CA 1SL8A 1DT7B 1KCYA 1A75A 3PN7B 4NDCA 3D0YA 1WRLA 3FWBA 1OQPA 2FJUB 1KQVA 2WNDA 1CDLA 1V1FA 3CTNA 5AANA 1NSHA 1DGVA 1AK8A 3CR2A 1LINA 3IQOA 2JWWA 3O2PA 2KDHA 2SCPA 4IL1A 2M7LA 3I5FC 4N1FA 3VRNA 3KO0A 4ETOA 2SASA 4JQ0D 1B47A 5AFPA 5HLOA 1M45A 1CFDA 2CXJA 2KFGA 4DUQA 2OTGC 1L2OC 1W7JB 1TN4A 2LMVA 1JFKA 2M1KB 4Q04A 2F3ZA 1J7QA 2JNXA 1M31A 3ICBA 4OKHA 1XFUO 1Y1XA 2KBMA 3DD4A 1NIWA 1ALVA 3TDZA 1XFZO 2KGRA 1Y0VH 4I5LB 4MBEA 2KYCA 3I5HB 1YRTB 3GK4X 2K0JA 4XYNA 4YBHB 4D1EA 3PATA 4PHNA 1BU3A 2F33A 2P6BB 3EVRA 2LVJA 1F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFT A;  1PSB A;  4AQJ A;  1F71 A;  1RTP 1;  1DVI A;  2M9G A;  3AKA A;  5D7F A;  4DS7 A;  1K8U A;  5KU1 A;  1IKU A;  2JPT A;  1U5I A;  1MWN A;  1UUR A;  2AMI A;  1XK4 A;  1SMG A;  5CSF A;  2JXC A;  1MR8 A;  2D8N A;  2OS8 B;  4PE4 A;  2L50 A;  1JF2 A;  2F3Y A;  2KI6 C;  1IG5 A;  3TUY B;  2TN4 A;  4L9M A;  4YRU A;  1SR6 B;  1B9A A;  1QV1 A;  4USL A;  1DF0 A;  2EHB A;  1QX7 A;  3DF0 A;  1KK8 C;  3HCM A;  2KFH A;  4C0J A;  1C7W A;  2K7D A;  5G08 A;  5TNC A;  2LC5 A;  1QX2 A;  2KI4 C;  1YVL A;  2EGD A;  2M49 B;  3BUO B;  1JWD A;  1NX3 A;  1QIW A;  1D1O A;  1SW8 A;  4ZCV A;  1AUI B;  1NYA A;  1SBJ A;  1SK6 D;  2B1U A;  4ORA B;  5KSZ A;  3NXA A;  4MLW A;  4MRX A;  1VRK A;  1L7Z A;  2ZRS A;  4WQ3 A;  4FQO A;  2Y1M A;  3WHU B;  4BY4 A;  1TNX A;  2PVB A;  4NQG A;  3SG6 A;  3WNX B;  5B8I B;  4GGN A;  3NSI A;  3K21 A;  2LAP A;  1XO5 A;  1SCV A;  1WDC C;  3PM8 A;  4PHM A;  4E68 A;  1CDM A;  1QJT A;  1CFP A;  3I5I C;  1FBV A;  2CT9 A;  2BEC A;  3EKJ A;  2NCO A;  2PAL A;  2I18 A;  3JTD C;  2CBL A;  1UWO A;  3C1V A;  2Q4U A;  1SL7 A;  1TOP A;  1XVJ A;  1QVI Z;  2JU0 A;  2R2I A;  3OB2 B;  4N5X A;  2ZNE A;  1WRZ A;  2K7C A;  5CSJ A;  4YGE B;  3CLN A;  1CM1 A;  1K90 D;  1QAT A;  2WCF A;  1BMO A;  1PVA A;  1K94 A;  1MUX A;  2NLN A;  1FI5 A;  1RK9 A;  1S26 D;  2K7B A;  4I5K A;  5HKW A;  4PHJ A;  3VRO A;  1S6C A;  2KFF A;  4A4B A;  4GNK B;  3D10 A;  2FCD A;  2JUL A;  1WLM A;  1XFW O;  1Y1A A;  2FCE A;  3H4S E;  1FF1 A;  1M39 A;  1DJH A;  3IQQ A;  1SYM A;  2MA2 A;  4A4C A;  1QLS A;  1K9U A;  2ZRT A;  1X02 A;  3BUW B;  1CLM A;  4YGA A;  1SKT A;  3AAK A;  4GBA A;  1G4Y R;  2BKH B;  4MZK A;  1NCZ A;  1XYD A;  4C0L A;  5HYD A;  2LLS A;  2MHH A;  4YGB B;  1JUO A;  2M8U A;  1MQ1 A;  2LCP A;  3JVT C;  5JOL A;  2EC6 C;  3LL8 B;  2JTT A;  1OOJ A;  2M0R A;  1SRA A;  2PSR A;  3IF7 A;  3BYA A;  3KF9 A;  4PHK A;  1CFC A;  1IJ5 A;  2F2O A;  3TS5 C;  1N2D A;  5GQQ C;  3I5G B;  3I5F B;  2KHN A;  5AER A;  1F4Q A;  4GUK A;  3PAL A;  3O6B A;  2LLT A;  3LK1 A;  4DIR A;  3ZNI A;  3OP0 A;  4PCW A;  2NCP A;  4ICB A;  1SPY A;  4R1E A;  1CDN A;  1BLQ A;  3PN7 C;  1IQ3 A;  1TTX A;  1UHJ A;  1YUT A;  1B7T Y;  5ER4 X;  4AQI A;  1UHN A;  5AXI A;  1K9P A;  1UP5 A;  2JC2 A;  5HLV A;  1K95 A;  1KFX S;  4OVN F;  1BF5 A;  1JSA A;  2COL B;  4MVF A;  1UHH A;  1UHI A;  2ZFD A;  1R6P A;  1Y6W A;  2LUX A;  2Q91 A;  3EK8 A;  1M46 A;  2H61 A;  1KWO C;  2Y4Q A;  1R2U A;  1A75 B;  3D0Y B;  1NX0 A;  4YGD B;  3KPX A;  1FI6 A;  3CR4 X;  1H4B A;  1A4P A;  2BKI B;  1B1G A;  3SG2 A;  1EJ3 A;  1A29 A;  1GQM A;  2FOT A;  1OMR A;  4GAO A;  4C0K A;  2JNF A;  3SIA A;  3OX5 A;  4MN0 A;  1RJV A;  2JT8 A;  3AKB A;  5F6T A;  2K8M B;  1YX8 A;  2LE9 B;  1N0Y A;  4TNC A;  4NDD A;  1Y1U A;  2HQ8 A;  1NX2 A;  2KBI A;  2HQW A;  1W7I B;  1QV0 A;  3I5H C;  3WXA A;  4DRW A;  4PE1 A;  1CLB A;  2L2E A;  5PAL A;  1GJY A;  2KAX A;  1KK7 Y;  1QX5 B;  3QRX A;  2JT3 A;  3DVM A;  1C07 A;  1XA5 A;  1B8L A;  3WHT B;  1MXL C;  1QAS A;  4YI8 A;  2KOT A;  2KAY A;  2KI4 B;  1BT6 A;  5DKQ A;  3SG7 A;  2KNE A;  1NUB A;  3OHM B;  1YRU B;  3TDU A;  3SIB A;  2H61 C;  1LVC D;  4ZCU A;  2LMT A;  2O60 A;  5K89 A;  2KAV A;  1ZAC A;  3FWC A;  1SY9 A;  2BL0 B;  1CDP A;  2H2K A;  4BY5 A;  3M0W A;  2LMU A;  3TUY C;  1SL9 A;  1K96 A;  1SR6 C;  1S5G Z;  1ZOT B;  1M63 B;  2NZ0 A;  2LM5 A;  2NXQ A;  4AOM A;  1WDC B;  2M29 A;  2DOQ A;  1J1D A;  3TZ1 A;  1U5I B;  4GGF A;  3I5I B;  1F55 A;  2F8P A;  1LA3 A;  1QXP A;  1S1E A;  1B4C A;  4OR9 B;  3BXK A;  1NWD A;  5HKY A;  1J7O A;  1AVS A;  1DTL A;  4XJK A;  4UPG A;  2LNK A;  1PAL A;  3EK4 A;  1YUU A;  1JBA A;  3BOW A;  2BE4 A;  1REC A;  1DF0 B;  2A4J A;  4MEW A;  5ER5 A;  3CWG A;  1OZO A;  3DF0 B;  1B8R A;  1SCM B;  2O5G A;  1ZMZ A;  4HRG A;  2GV5 A;  1K93 D;  3PLF B;  1MXE A;  2CTN A;  2M97 A;  5FYX A;  5I2O A;  4ORC B;  1RFJ A;  4YI9 A;  1XFY O;  4MRY A;  2M7N A;  2KSP A;  2LVK A;  1KFU L;  2BBM A;  3KEV A;  1GGW A;  1BJF A;  1B7T Z;  1LA0 A;  1OMD A;  2IS9 A;  1PSR A;  5KTY A;  3TDI A;  4PE7 A;  1LXF C;  2L98 A;  2PRU A;  3GK1 A;  2JQ6 A;  1RRO A;  3LK0 A;  2ISD A;  1YX7 A;  5CSN A;  2G9B A;  2JZI A;  1BR1 B;  1HQV A;  1EG4 A;  1F70 A;  2BE6 A;  1DGU A;  1V1G A;  2GGM A;  4GGF C;  4M2P A;  1EG3 A;  2ZKM X;  2KQY A;  1LKJ A;  1S36 A;  1NPQ A;  1JC2 A;  2WCE A;  1QIV A;  4MSP A;  3VRR A;  3BQ3 A;  4PE0 A;  1JF0 A;  2LVI A;  2MBX A;  2HET A;  1EL4 A;  1S6I A;  1IRJ A;  4MZL A;  1WY9 A;  1CNP A;  1OE9 B;  2KQ6 A;  4NDB A;  2AAO A;  2MLE C;  1TNQ A;  4YGC B;  5BPJ A;  3A4U B;  3SJS A;  4WRI A;  2LVV A;  3HX4 A;  2LP2 A;  3DVJ A;  5I2L A;  1TNP A;  3EK7 A;  2V53 A;  2MAZ A;  3CR5 X;  3EVU A;  4I5J A;  3OB1 B;  1KQM C;  5J3X A;  1KK7 Z;  1L2O B;  1AHR A;  1QLK A;  2OTG B;  4FTG A;  3BUX B;  1NX1 A;  3EVV A;  3LLE A;  5CSI A;  4WQ2 A;  2PMY A;  1J55 A;  4QJ5 B;  1DJZ A;  3F45 A;  4MZJ A;  1MF8 B;  4HRE E;  2I2R E;  2AUC A;  2QAC A;  2KGB C;  3E3R A;  1QVI Y;  2E6W A;  2MRD A;  5CPV A;  3I5G C;  1H8B A;  1KWO B;  1IGV A;  1CFF A;  4P2Y B;  1E8A A;  3ZWH A;  1NCX A;  5AEQ A;  1S6J A;  3OX6 A;  3CS1 A;  5D69 A;  2F2P A;  2RGI A;  3SG5 A;  1AJ5 A;  1N65 A;  1DMO A;  1F8H A;  2LP3 A;  5DKN A;  2LHL A;  4CLN A;  2JXL A;  2Y1N A;  1F4O A;  4ORB B;  2WC8 A;  4CID A;  1CKK A;  3SG3 A;  2BCX A;  1AP4 A;  1DJY A;  4GPL B;  1IQ5 A;  2KYF A;  2GGZ A;  1TCO B;  1CMG A;  2CNP A;  1UHK A;  2K2F A;  4U8D A;  1ODB A;  1KK8 B;  1KSM A;  4N1G A;  1TNW A;  3O4Y A;  1ZUZ A;  1YUR A;  1DJX A;  1XFX O;  1XFV O;  1MHO A;  2KI6 D;  1FPW A;  2MLF C;  2I7A A;  3SG4 A;  1EXR A;  3LCP C;  1IJ6 A;  2WOR A;  4F0Z B;  5HKZ A;  4PAL A;  2K61 A;  3KHE A;  2L5X B;  2M3W A;  2K7O A;  1CMF A;  1BR4 B;  1OZS A;  1ALW A;  3VRQ A;  1A2X A;  2OPO A;  3NSL A;  4CFR A;  1QS7 A;  2MJW B;  2OS8 C;  1BOC A;  1CM4 A;  1UUS A;  1IH0 A;  1WLZ A;  1CLL A;  2VRG A;  2K2A A;  2LV7 A;  1SNL A;  1IWQ A;  3A8R A;  1PUL A;  1G33 A;  1J7R A;  4M2Q A;  4CPV A;  1Q80 A;  3JTD B;  3MSE B;  1HT9 A;  1AJ4 A;  2L0P A;  1CTR A;  2M1U A;  3CZT X;  3NSO A;  2JOJ A;  4OV2 A;  2JTZ A;  2LHI A;  2PAS A;  3PFV A;  2HPS A;  2WCB A;  3DVE A;  2BL0 C;  1S3P A;  1QTX A;  2L4I A;  1EH2 A;  3RM1 A;  2HF5 A;  1TIZ A;  4HRH A;  4OCI A;  4HSZ A;  1RWY A;  3BUN B;  1YVH A;  4JPZ B;  4JWQ A;  4PDZ A;  1BG1 A;  2ZN8 A;  1DJW A;  1DJI A;  3BUM B;  5I8N A;  1J7P A;  1J1E A;  1K2H A;  3VRP A;  1OMV A;  3O78 A;  1NCY A;  5DKR A;  4P5O E;  3AAJ A;  1XK4 C;  3FS7 A;  1OSA A;  2G2B A;  2I94 A;  2L51 A;  1BOD A;  1YR5 A;  1A03 A;  3RLZ A;  3GOF A;  1SCM C;  2LAN A;  1YUS A;  2ZND A;  2BCB A;  2L4H A;  1C7V A;  2WOS A;  1WRK A;  4QJ3 B;  5I2Q A;  1FW4 A;  3JVT B;  1GGZ A;  1K9K A;  2LLU A;  3FIA A;  4XJK B;  2EC6 B;  5JJG A;  1TRF A;  1NP8 A;  3BOW B;  1G8I A;  2CCM A;  1PRW A;  2QPT A;  3GK2 A;  4QJ4 B;  2BBN A;  3EKH A;  2E30 A;  3TS5 B;  3CGA A;  1PVB A;  2BCA A;  3VGO A;  1KSO A;  3NSK A;  1KFU S;  2Y5I A;  3DVK A;  4I5N B;  1TCF A;  3PSR A;  1ZFS A;  1JFJ A;  1YTZ C;  4M2O A;  1CB1 A;  1PK0 D;  2LUC A;  4CFQ A;  5IBW A;  1DJG A;  1KFX L;  4DCK A;  1S5G Y;  2JRF A;  2ZN9 A;  1KQM B;  2JT0 A;  1B8C A;  1SL8 A;  1DT7 B;  1KCY A;  1A75 A;  3PN7 B;  4NDC A;  3D0Y A;  1WRL A;  3FWB A;  1OQP A;  2FJU B;  1KQV A;  2WND A;  1CDL A;  1V1F A;  3CTN A;  5AAN A;  1NSH A;  1DGV A;  1AK8 A;  3CR2 A;  1LIN A;  3IQO A;  2JWW A;  3O2P A;  2KDH A;  2SCP A;  4IL1 A;  2M7L A;  3I5F C;  4N1F A;  3VRN A;  3KO0 A;  4ETO A;  2SAS A;  4JQ0 D;  1B47 A;  5AFP A;  5HLO A;  1M45 A;  1CFD A;  2CXJ A;  2KFG A;  4DUQ A;  2OTG C;  1L2O C;  1W7J B;  1TN4 A;  2LMV A;  1JFK A;  2M1K B;  4Q04 A;  2F3Z A;  1J7Q A;  2JNX A;  1M31 A;  3ICB A;  4OKH A;  1XFU O;  1Y1X A;  2KBM A;  3DD4 A;  1NIW A;  1ALV A;  3TDZ A;  1XFZ O;  2KGR A;  1Y0V H;  4I5L B;  4MBE A;  2KYC A;  3I5H B;  1YRT B;  3GK4 X;  2K0J A;  4XYN A;  4YBH B;  4D1E A;  3PAT A;  4PHN A;  1BU3 A;  2F33 A;  2P6B B;  3EVR A;  2LVJ A;  1F54 A; 
#chains in the Genus database with same CATH topology
 3O4X A;  4GFT A;  1PSB A;  4AQJ A;  1F71 A;  1RTP 1;  1DVI A;  2M9G A;  3AKA A;  5FI6 A;  5D7F A;  4DS7 A;  1K8U A;  5KU1 A;  1IKU A;  2JPT A;  1U5I A;  1MWN A;  4INX A;  4IJ7 A;  1UUR A;  2AMI A;  1XK4 A;  1SMG A;  5CSF A;  2JXC A;  1MR8 A;  2D8N A;  2OS8 B;  4PE4 A;  2L50 A;  1JF2 A;  2F3Y A;  2KI6 C;  1IG5 A;  3TUY B;  2TN4 A;  4L9M A;  4YRU A;  1SR6 B;  1B9A A;  1QV1 A;  4USL A;  1DF0 A;  2EHB A;  1QX7 A;  3DF0 A;  1KK8 C;  2KPH A;  1W9Z A;  3HCM A;  2KFH A;  4C0J A;  1C7W A;  3N7H A;  1DC1 A;  2K7D A;  5G08 A;  5TNC A;  2H8V A;  2LC5 A;  3DYE A;  1QX2 A;  2KI4 C;  1YVL A;  2EGD A;  2M49 B;  3BUO B;  1JWD A;  1NX3 A;  3Q8I A;  1QIW A;  1D1O A;  1SW8 A;  4ZCV A;  1AUI B;  1NYA A;  1SBJ A;  1SK6 D;  2B1U A;  4ORA B;  5KSZ A;  3NXA A;  4MLW A;  4MRX A;  1VRK A;  1L7Z A;  2ZRS A;  3L4L A;  4FQO A;  2Y1M A;  4WQ3 A;  3WHU B;  1TNX A;  4BY4 A;  2PVB A;  4NQG A;  3SG6 A;  3WNX B;  5B8I B;  4GGN A;  3NSI A;  3QME A;  1TWO A;  3BFH A;  3K21 A;  3R1V A;  2LAP A;  1XO5 A;  1SCV A;  1WDC C;  3PM8 A;  4PHM A;  4E68 A;  1CDM A;  1QJT A;  1CFP A;  3I5I C;  1FBV A;  2CT9 A;  4FQT A;  2BEC A;  3EKJ A;  2NCO A;  2PAL A;  2I18 A;  3JTD C;  2CBL A;  1UWO A;  3C1V A;  2Q4U A;  1SL7 A;  1TOP A;  1XVJ A;  1QVI Z;  2JU0 A;  2R2I A;  3OB2 B;  4N5X A;  4OZD A;  2ZNE A;  1WRZ A;  2K7C A;  5CSJ A;  4YGE B;  3CLN A;  1CM1 A;  2WC6 A;  1K90 D;  1QAT A;  2WCF A;  1BMO A;  1PVA A;  1K94 A;  1MUX A;  2NLN A;  1FI5 A;  1RK9 A;  1S26 D;  2K7B A;  4I5K A;  2YGU A;  5HKW A;  4PHJ A;  3B7A A;  3VRO A;  3D75 A;  1S6C A;  2KFF A;  4A4B A;  1C3Y A;  4GNK B;  3D10 A;  2FCD A;  2JUL A;  3FE9 A;  1WLM A;  1XFW O;  1Y1A A;  2FCE A;  3H4S E;  4JKT A;  1M39 A;  1FF1 A;  1DJH A;  3IQQ A;  1SYM A;  2MA2 A;  4A4C A;  1QLS A;  3B6X A;  1K9U A;  2ZRT A;  1X02 A;  3BUW B;  1CLM A;  4YGA A;  3D76 A;  1SKT A;  3AAK A;  4GBA A;  1G4Y R;  2BKH B;  4MZK A;  1NCZ A;  1XYD A;  4C0L A;  3VB1 A;  5HYD A;  2LLS A;  2MHH A;  4YGB B;  1JUO A;  2M8U A;  1MQ1 A;  2LCP A;  3JVT C;  5JOL A;  2EC6 C;  3B87 A;  2L5Y A;  3LL8 B;  2JTT A;  1OOJ A;  2M0R A;  1SRA A;  2PSR A;  3IF7 A;  3BYA A;  3KF9 A;  1XFR A;  4PHK A;  3RZS A;  1CFC A;  1IIO A;  1IJ5 A;  2F2O A;  3TS5 C;  1N2D A;  2PQL A;  5GQQ C;  3I5G B;  1OW4 A;  3I5F B;  3CAB A;  3BFA A;  3S0F A;  2KHN A;  5AER A;  1F4Q A;  4GUK A;  3PAL A;  3O6B A;  3D78 A;  2LLT A;  3LK1 A;  4DIR A;  3ZNI A;  3OP0 A;  4PCW A;  2NCP A;  1OOH A;  4ICB A;  1SPY A;  4R1E A;  1CDN A;  1BLQ A;  3PN7 C;  1IQ3 A;  1TTX A;  3K1E A;  1UHJ A;  1YUT A;  1B7T Y;  3DY9 A;  5ER4 X;  1UHN A;  5FI7 A;  5AXI A;  1K9P A;  1UP5 A;  4AQI A;  2JC2 A;  5HLV A;  1K95 A;  1KFX S;  4OVN F;  3EG5 B;  1BF5 A;  2COL B;  4MVF A;  1UHH A;  1JSA A;  1UHI A;  3R1P A;  2ZFD A;  1R6P A;  1Y6W A;  2LUX A;  2Q91 A;  3EK8 A;  1M46 A;  2H61 A;  2WCK A;  1KWO C;  2L2C A;  2Y4Q A;  1R2U A;  3SS5 A;  1A75 B;  3D0Y B;  1NX0 A;  4YGD B;  3KPX A;  1FI6 A;  3CR4 X;  1H4B A;  1A4P A;  2BKI B;  1B1G A;  3SG2 A;  1EJ3 A;  1A29 A;  1GQM A;  2FOT A;  1OMR A;  4GAO A;  4C0K A;  2JNF A;  3SIA A;  3OX5 A;  4MN0 A;  1RJV A;  2JT8 A;  3AKB A;  5D3O A;  5F6T A;  2K8M B;  1YX8 A;  2GTE A;  2LE9 B;  2ERB A;  1N0Y A;  4TNC A;  4NDD A;  1Y1U A;  2HQ8 A;  1NX2 A;  2KBI A;  3DXL A;  2HQW A;  1W7I B;  1QV0 A;  3I5H C;  3WXA A;  4DRW A;  4PE1 A;  1TUJ A;  3S0G A;  1CLB A;  2L2E A;  5PAL A;  1GJY A;  2KAX A;  1KK7 Y;  1QX5 B;  3QRX A;  2JT3 A;  3DVM A;  1C07 A;  1XA5 A;  1B8L A;  3WHT B;  1MXL C;  1QAS A;  4YI8 A;  3S0A A;  2KOT A;  2KAY A;  2WCM A;  2KI4 B;  1BT6 A;  5DKQ A;  3SG7 A;  2KNE A;  1NUB A;  3OHM B;  1YRU B;  3TDU A;  3SIB A;  2H61 C;  1LVC D;  4ZCU A;  2LMT A;  2O60 A;  5K89 A;  2KAV A;  1ZAC A;  3FWC A;  1SY9 A;  2BL0 B;  1CDP A;  2H2K A;  3PJI A;  4BY5 A;  3M0W A;  2LMU A;  3IVT A;  3TUY C;  1SL9 A;  1K96 A;  1SR6 C;  1S5G Z;  1ZOT B;  1M63 B;  2NZ0 A;  3L47 A;  2BAP A;  2LM5 A;  2NXQ A;  4AOM A;  1WDC B;  2M29 A;  2DOQ A;  1J1D A;  3TZ1 A;  1U5I B;  4GGF A;  3I5I B;  1F55 A;  2F8P A;  1LA3 A;  1QXP A;  1S1E A;  1B4C A;  4OR9 B;  3BXK A;  1NWD A;  5HKY A;  3UO9 A;  1OOG A;  1AVS A;  1DTL A;  1J7O A;  4XJK A;  4UPG A;  5HL1 A;  1GM0 A;  2LNK A;  1PAL A;  3CZ1 A;  1YUU A;  3EK4 A;  1JBA A;  3BOW A;  2BE4 A;  1REC A;  4KYN A;  1DF0 B;  2A4J A;  4MEW A;  5ER5 A;  1TUZ A;  1OZO A;  2QEO A;  3CWG A;  3DF0 B;  1B8R A;  1SCM B;  2O5G A;  1ZMZ A;  4HRG A;  2GV5 A;  1K93 D;  3PLF B;  1MXE A;  2CTN A;  2M97 A;  5FYX A;  5I2O A;  4ORC B;  1RFJ A;  4YI9 A;  1Z2C B;  1XFY O;  4MRY A;  2M7N A;  2KSP A;  3CDN A;  2LVK A;  1KFU L;  2BBM A;  3KEV A;  1GGW A;  1BJF A;  1B7T Z;  1LA0 A;  1OMD A;  2IS9 A;  1PSR A;  3SS4 A;  5KTY A;  3TDI A;  4PE7 A;  1LXF C;  2L98 A;  2PRU A;  3GK1 A;  2JQ6 A;  1RRO A;  3LK0 A;  2ISD A;  1YX7 A;  5CSN A;  2G9B A;  2JZI A;  5DIC A;  1BR1 B;  1HQV A;  1EG4 A;  1F70 A;  3S0D A;  2BE6 A;  1DGU A;  1V1G A;  2GGM A;  4GGF C;  4JD9 A;  4M2P A;  1EG3 A;  1LS8 A;  2ZKM X;  2KQY A;  1LKJ A;  1DQE A;  1NPQ A;  1S36 A;  2WCE A;  1QIV A;  1JC2 A;  4MSP A;  3VRR A;  3BQ3 A;  4PE0 A;  1JF0 A;  2LVI A;  2MBX A;  2HET A;  1EL4 A;  1S6I A;  1IRJ A;  4MZL A;  1WY9 A;  1CNP A;  1OE9 B;  2KQ6 A;  3CZ2 A;  2WCL A;  4NDB A;  2AAO A;  2MLE C;  1TNQ A;  4YGC B;  5BPJ A;  3A4U B;  3SJS A;  4WRI A;  2LVV A;  3HX4 A;  1DEK A;  2LP2 A;  1C3Z A;  3DVJ A;  3NGV A;  5I2L A;  1TNP A;  3EK7 A;  2V53 A;  2MAZ A;  3CR5 X;  3EVU A;  4I5J A;  4F7F A;  3OB1 B;  1KQM C;  5J3X A;  1KK7 Z;  1L2O B;  1AHR A;  1QLK A;  2OTG B;  4FTG A;  3BUX B;  1NX1 A;  1P28 A;  3EVV A;  3LLE A;  5CSI A;  4WQ2 A;  2PMY A;  1J55 A;  2PYQ A;  4QJ5 B;  1DJZ A;  3F45 A;  4MZJ A;  1MF8 B;  1SSE B;  4HRE E;  2I2R E;  2AUC A;  2QAC A;  2KGB C;  3FE8 A;  3E3R A;  1QVI Y;  2E6W A;  2MRD A;  3FE6 A;  5CPV A;  3I5G C;  1H8B A;  1KWO B;  1IGV A;  1CFF A;  3L4A A;  1E8A A;  4P2Y B;  3ZWH A;  2WCJ A;  1NCX A;  5AEQ A;  1S6J A;  3OX6 A;  3CS1 A;  5D69 A;  1T14 A;  2F2P A;  2RGI A;  3D77 A;  3SG5 A;  1AJ5 A;  1N65 A;  1DMO A;  1F8H A;  2LP3 A;  5DKN A;  2LHL A;  4CLN A;  2JXL A;  2Y1N A;  1F4O A;  4ORB B;  2WC8 A;  4CID A;  1CKK A;  2P71 A;  3SG3 A;  1ORG A;  2BCX A;  1AP4 A;  1DJY A;  4GPL B;  1IQ5 A;  2KYF A;  1OOI X;  2GGZ A;  1TCO B;  1CMG A;  2CNP A;  1QWV A;  1UHK A;  2K2F A;  4U8D A;  1ODB A;  3SS3 A;  1KK8 B;  1KSM A;  4N1G A;  1TNW A;  3O4Y A;  1ZUZ A;  1YUR A;  1DJX A;  1XFX O;  1XFV O;  1MHO A;  2KI6 D;  1FPW A;  2MLF C;  2I7A A;  3SG4 A;  1EXR A;  3LCP C;  1IJ6 A;  2WOR A;  4F0Z B;  5HKZ A;  4PAL A;  2K61 A;  3KHE A;  2L5X B;  3DZT A;  3CYZ A;  2M3W A;  2K7O A;  1CMF A;  1BR4 B;  1OZS A;  1ALW A;  3VRQ A;  1A2X A;  2OPO A;  3NSL A;  4CFR A;  1QS7 A;  2MJW B;  2OS8 C;  1BOC A;  1CM4 A;  1UUS A;  1IH0 A;  1WLZ A;  1CLL A;  2VRG A;  2K2A A;  2LV7 A;  1SNL A;  1IWQ A;  3A8R A;  1PUL A;  1G33 A;  1J7R A;  4M2Q A;  2BNX A;  4CPV A;  1Q80 A;  3JTD B;  3MSE B;  1HT9 A;  3BJH A;  1AJ4 A;  2L0P A;  1CTR A;  2M1U A;  3CZT X;  3NSO A;  2JOJ A;  4OV2 A;  2JTZ A;  2LHI A;  2PAS A;  2JPO A;  2QEH A;  3PFV A;  3R72 A;  2HPS A;  2WCB A;  2FJY A;  3DVE A;  2BL0 C;  1S3P A;  1QTX A;  2L4I A;  1EH2 A;  3RM1 A;  2HF5 A;  1TIZ A;  4HRH A;  4OCI A;  4HSZ A;  3S0E A;  1RWY A;  3BUN B;  1YVH A;  4JPZ B;  4JWQ A;  1DEL A;  4PDZ A;  1BG1 A;  2ZN8 A;  1DJW A;  1DJI A;  3BUM B;  3NHT A;  5I8N A;  1J7P A;  1J1E A;  2QEB A;  1K2H A;  3VRP A;  1OMV A;  3O78 A;  3CZ0 A;  1NCY A;  5DKR A;  4P5O E;  3AAJ A;  1XK4 C;  3FS7 A;  1OSA A;  2G2B A;  2QDI A;  2I94 A;  2L51 A;  3S0B A;  1BOD A;  1YR5 A;  1A03 A;  3RLZ A;  3D73 A;  3GOF A;  1SCM C;  2LAN A;  1YUS A;  4INW A;  3PM2 A;  2ZND A;  2BCB A;  2L4H A;  1C7V A;  2WOS A;  1WRK A;  3OGN A;  4QJ3 B;  5I2Q A;  1FW4 A;  3JVT B;  1GGZ A;  1K9K A;  2LLU A;  3FIA A;  4XJK B;  5FI2 A;  2EC6 B;  5JJG A;  1TRF A;  1NP8 A;  3BOW B;  1G8I A;  2CCM A;  1PRW A;  2QPT A;  3BFB A;  3GK2 A;  4QJ4 B;  3NHI A;  2BBN A;  3EKH A;  2E30 A;  3TS5 B;  3CGA A;  1PVB A;  2BCA A;  3VGO A;  1KSO A;  4PT1 A;  3NSK A;  1KFU S;  2Y5I A;  3DVK A;  1Z4H A;  1TCF A;  3PSR A;  4I5N B;  1ZFS A;  2QEV A;  1JFJ A;  1YTZ C;  4M2O A;  5I94 A;  1PK0 D;  2LUC A;  4CFQ A;  1CB1 A;  5IBW A;  1DJG A;  1KFX L;  4DCK A;  1S5G Y;  2JRF A;  2ZN9 A;  1KQM B;  2JT0 A;  1B8C A;  1SL8 A;  3B86 A;  1DT7 B;  1KCY A;  1A75 A;  3PN7 B;  4NDC A;  3D0Y A;  2P70 A;  3V2L A;  1WRL A;  1OOF A;  3FWB A;  1OQP A;  2FJU B;  1KQV A;  2WND A;  1CDL A;  1V1F A;  3CTN A;  5AAN A;  1NSH A;  1DGV A;  3UNW A;  1AK8 A;  3CR2 A;  3B88 A;  1LIN A;  3IQO A;  2JWW A;  3O2P A;  2KDH A;  2SCP A;  4IL1 A;  2M7L A;  3I5F C;  4N1F A;  3VRN A;  2KLE A;  3KO0 A;  4ETO A;  2SAS A;  4JQ0 D;  1B47 A;  5AFP A;  5HLO A;  2K60 A;  1M45 A;  1CFD A;  2CXJ A;  2KFG A;  4DUQ A;  2WCH A;  2OTG C;  1L2O C;  3D74 A;  1W7J B;  1TN4 A;  2LMV A;  1JFK A;  2M1K B;  4Q04 A;  2F3Z A;  3OBV A;  1J7Q A;  2JNX A;  1M31 A;  3ICB A;  4OKH A;  1XFU O;  1Y1X A;  2KBM A;  3DD4 A;  1NIW A;  1ALV A;  3TDZ A;  1XFZ O;  2KGR A;  5EL2 A;  1Y0V H;  4I5L B;  4MBE A;  2KYC A;  3I5H B;  1YRT B;  2KLD A;  3GK4 X;  2K0J A;  2WC5 A;  4XYN A;  4YBH B;  4D1E A;  3PAT A;  4PHN A;  1BU3 A;  2F33 A;  2P6B B;  3EVR A;  2LVJ A;  3R1O A;  1F54 A; 
#chains in the Genus database with same CATH homology
 4GFT A;  1PSB A;  4AQJ A;  1F71 A;  1RTP 1;  1DVI A;  2M9G A;  3AKA A;  5D7F A;  4DS7 A;  1K8U A;  5KU1 A;  1IKU A;  2JPT A;  1U5I A;  1MWN A;  1UUR A;  2AMI A;  1XK4 A;  1SMG A;  5CSF A;  2JXC A;  1MR8 A;  2D8N A;  2OS8 B;  4PE4 A;  2L50 A;  1JF2 A;  2F3Y A;  2KI6 C;  1IG5 A;  3TUY B;  2TN4 A;  4L9M A;  4YRU A;  1SR6 B;  1B9A A;  1QV1 A;  4USL A;  1DF0 A;  2EHB A;  1QX7 A;  3DF0 A;  1KK8 C;  3HCM A;  2KFH A;  4C0J A;  1C7W A;  2K7D A;  5G08 A;  5TNC A;  2LC5 A;  1QX2 A;  2KI4 C;  1YVL A;  2EGD A;  2M49 B;  3BUO B;  1JWD A;  1NX3 A;  1QIW A;  1D1O A;  1SW8 A;  4ZCV A;  1AUI B;  1NYA A;  1SBJ A;  1SK6 D;  2B1U A;  4ORA B;  5KSZ A;  3NXA A;  4MLW A;  4MRX A;  1VRK A;  1L7Z A;  2ZRS A;  4WQ3 A;  4FQO A;  2Y1M A;  3WHU B;  4BY4 A;  1TNX A;  2PVB A;  4NQG A;  3SG6 A;  3WNX B;  5B8I B;  4GGN A;  3NSI A;  3K21 A;  2LAP A;  1XO5 A;  1SCV A;  1WDC C;  3PM8 A;  4PHM A;  4E68 A;  1CDM A;  1QJT A;  1CFP A;  3I5I C;  1FBV A;  2CT9 A;  2BEC A;  3EKJ A;  2NCO A;  2PAL A;  2I18 A;  3JTD C;  2CBL A;  1UWO A;  3C1V A;  2Q4U A;  1SL7 A;  1TOP A;  1XVJ A;  1QVI Z;  2JU0 A;  2R2I A;  3OB2 B;  4N5X A;  2ZNE A;  1WRZ A;  2K7C A;  5CSJ A;  4YGE B;  3CLN A;  1CM1 A;  1K90 D;  1QAT A;  2WCF A;  1BMO A;  1PVA A;  1K94 A;  1MUX A;  2NLN A;  1FI5 A;  1RK9 A;  1S26 D;  2K7B A;  4I5K A;  5HKW A;  4PHJ A;  3VRO A;  1S6C A;  2KFF A;  4A4B A;  4GNK B;  3D10 A;  2FCD A;  2JUL A;  1WLM A;  1XFW O;  1Y1A A;  2FCE A;  3H4S E;  1FF1 A;  1M39 A;  1DJH A;  3IQQ A;  1SYM A;  2MA2 A;  4A4C A;  1QLS A;  1K9U A;  2ZRT A;  1X02 A;  3BUW B;  1CLM A;  4YGA A;  1SKT A;  3AAK A;  4GBA A;  1G4Y R;  2BKH B;  4MZK A;  1NCZ A;  1XYD A;  4C0L A;  5HYD A;  2LLS A;  2MHH A;  4YGB B;  1JUO A;  2M8U A;  1MQ1 A;  2LCP A;  3JVT C;  5JOL A;  2EC6 C;  3LL8 B;  2JTT A;  1OOJ A;  2M0R A;  1SRA A;  2PSR A;  3IF7 A;  3BYA A;  3KF9 A;  4PHK A;  1CFC A;  1IJ5 A;  2F2O A;  3TS5 C;  1N2D A;  5GQQ C;  3I5G B;  3I5F B;  2KHN A;  5AER A;  1F4Q A;  4GUK A;  3PAL A;  3O6B A;  2LLT A;  3LK1 A;  4DIR A;  3ZNI A;  3OP0 A;  4PCW A;  2NCP A;  4ICB A;  1SPY A;  4R1E A;  1CDN A;  1BLQ A;  3PN7 C;  1IQ3 A;  1TTX A;  1UHJ A;  1YUT A;  1B7T Y;  5ER4 X;  4AQI A;  1UHN A;  5AXI A;  1K9P A;  1UP5 A;  2JC2 A;  5HLV A;  1K95 A;  1KFX S;  4OVN F;  1BF5 A;  1JSA A;  2COL B;  4MVF A;  1UHH A;  1UHI A;  2ZFD A;  1R6P A;  1Y6W A;  2LUX A;  2Q91 A;  3EK8 A;  1M46 A;  2H61 A;  1KWO C;  2Y4Q A;  1R2U A;  1A75 B;  3D0Y B;  1NX0 A;  4YGD B;  3KPX A;  1FI6 A;  3CR4 X;  1H4B A;  1A4P A;  2BKI B;  1B1G A;  3SG2 A;  1EJ3 A;  1A29 A;  1GQM A;  2FOT A;  1OMR A;  4GAO A;  4C0K A;  2JNF A;  3SIA A;  3OX5 A;  4MN0 A;  1RJV A;  2JT8 A;  3AKB A;  5F6T A;  2K8M B;  1YX8 A;  2LE9 B;  1N0Y A;  4TNC A;  4NDD A;  1Y1U A;  2HQ8 A;  1NX2 A;  2KBI A;  2HQW A;  1W7I B;  1QV0 A;  3I5H C;  3WXA A;  4DRW A;  4PE1 A;  1CLB A;  2L2E A;  5PAL A;  1GJY A;  2KAX A;  1KK7 Y;  1QX5 B;  3QRX A;  2JT3 A;  3DVM A;  1C07 A;  1XA5 A;  1B8L A;  3WHT B;  1MXL C;  1QAS A;  4YI8 A;  2KOT A;  2KAY A;  2KI4 B;  1BT6 A;  5DKQ A;  3SG7 A;  2KNE A;  1NUB A;  3OHM B;  1YRU B;  3TDU A;  3SIB A;  2H61 C;  1LVC D;  4ZCU A;  2LMT A;  2O60 A;  5K89 A;  2KAV A;  1ZAC A;  3FWC A;  1SY9 A;  2BL0 B;  1CDP A;  2H2K A;  4BY5 A;  3M0W A;  2LMU A;  3TUY C;  1SL9 A;  1K96 A;  1SR6 C;  1S5G Z;  1ZOT B;  1M63 B;  2NZ0 A;  2LM5 A;  2NXQ A;  4AOM A;  1WDC B;  2M29 A;  2DOQ A;  1J1D A;  3TZ1 A;  1U5I B;  4GGF A;  3I5I B;  1F55 A;  2F8P A;  1LA3 A;  1QXP A;  1S1E A;  1B4C A;  4OR9 B;  3BXK A;  1NWD A;  5HKY A;  1J7O A;  1AVS A;  1DTL A;  4XJK A;  4UPG A;  2LNK A;  1PAL A;  3EK4 A;  1YUU A;  1JBA A;  3BOW A;  2BE4 A;  1REC A;  1DF0 B;  2A4J A;  4MEW A;  5ER5 A;  3CWG A;  1OZO A;  3DF0 B;  1B8R A;  1SCM B;  2O5G A;  1ZMZ A;  4HRG A;  2GV5 A;  1K93 D;  3PLF B;  1MXE A;  2CTN A;  2M97 A;  5FYX A;  5I2O A;  4ORC B;  1RFJ A;  4YI9 A;  1XFY O;  4MRY A;  2M7N A;  2KSP A;  2LVK A;  1KFU L;  2BBM A;  3KEV A;  1GGW A;  1BJF A;  1B7T Z;  1LA0 A;  1OMD A;  2IS9 A;  1PSR A;  5KTY A;  3TDI A;  4PE7 A;  1LXF C;  2L98 A;  2PRU A;  3GK1 A;  2JQ6 A;  1RRO A;  3LK0 A;  2ISD A;  1YX7 A;  5CSN A;  2G9B A;  2JZI A;  1BR1 B;  1HQV A;  1EG4 A;  1F70 A;  2BE6 A;  1DGU A;  1V1G A;  2GGM A;  4GGF C;  4M2P A;  1EG3 A;  2ZKM X;  2KQY A;  1LKJ A;  1S36 A;  1NPQ A;  1JC2 A;  2WCE A;  1QIV A;  4MSP A;  3VRR A;  3BQ3 A;  4PE0 A;  1JF0 A;  2LVI A;  2MBX A;  2HET A;  1EL4 A;  1S6I A;  1IRJ A;  4MZL A;  1WY9 A;  1CNP A;  1OE9 B;  2KQ6 A;  4NDB A;  2AAO A;  2MLE C;  1TNQ A;  4YGC B;  5BPJ A;  3A4U B;  3SJS A;  4WRI A;  2LVV A;  3HX4 A;  2LP2 A;  3DVJ A;  5I2L A;  1TNP A;  3EK7 A;  2V53 A;  2MAZ A;  3CR5 X;  3EVU A;  4I5J A;  3OB1 B;  1KQM C;  5J3X A;  1KK7 Z;  1L2O B;  1AHR A;  1QLK A;  2OTG B;  4FTG A;  3BUX B;  1NX1 A;  3EVV A;  3LLE A;  5CSI A;  4WQ2 A;  2PMY A;  1J55 A;  4QJ5 B;  1DJZ A;  3F45 A;  4MZJ A;  1MF8 B;  4HRE E;  2I2R E;  2AUC A;  2QAC A;  2KGB C;  3E3R A;  1QVI Y;  2E6W A;  2MRD A;  5CPV A;  3I5G C;  1H8B A;  1KWO B;  1IGV A;  1CFF A;  4P2Y B;  1E8A A;  3ZWH A;  1NCX A;  5AEQ A;  1S6J A;  3OX6 A;  3CS1 A;  5D69 A;  2F2P A;  2RGI A;  3SG5 A;  1AJ5 A;  1N65 A;  1DMO A;  1F8H A;  2LP3 A;  5DKN A;  2LHL A;  4CLN A;  2JXL A;  2Y1N A;  1F4O A;  4ORB B;  2WC8 A;  4CID A;  1CKK A;  3SG3 A;  2BCX A;  1AP4 A;  1DJY A;  4GPL B;  1IQ5 A;  2KYF A;  2GGZ A;  1TCO B;  1CMG A;  2CNP A;  1UHK A;  2K2F A;  4U8D A;  1ODB A;  1KK8 B;  1KSM A;  4N1G A;  1TNW A;  3O4Y A;  1ZUZ A;  1YUR A;  1DJX A;  1XFX O;  1XFV O;  1MHO A;  2KI6 D;  1FPW A;  2MLF C;  2I7A A;  3SG4 A;  1EXR A;  3LCP C;  1IJ6 A;  2WOR A;  4F0Z B;  5HKZ A;  4PAL A;  2K61 A;  3KHE A;  2L5X B;  2M3W A;  2K7O A;  1CMF A;  1BR4 B;  1OZS A;  1ALW A;  3VRQ A;  1A2X A;  2OPO A;  3NSL A;  4CFR A;  1QS7 A;  2MJW B;  2OS8 C;  1BOC A;  1CM4 A;  1UUS A;  1IH0 A;  1WLZ A;  1CLL A;  2VRG A;  2K2A A;  2LV7 A;  1SNL A;  1IWQ A;  3A8R A;  1PUL A;  1G33 A;  1J7R A;  4M2Q A;  4CPV A;  1Q80 A;  3JTD B;  3MSE B;  1HT9 A;  1AJ4 A;  2L0P A;  1CTR A;  2M1U A;  3CZT X;  3NSO A;  2JOJ A;  4OV2 A;  2JTZ A;  2LHI A;  2PAS A;  3PFV A;  2HPS A;  2WCB A;  3DVE A;  2BL0 C;  1S3P A;  1QTX A;  2L4I A;  1EH2 A;  3RM1 A;  2HF5 A;  1TIZ A;  4HRH A;  4OCI A;  4HSZ A;  1RWY A;  3BUN B;  1YVH A;  4JPZ B;  4JWQ A;  4PDZ A;  1BG1 A;  2ZN8 A;  1DJW A;  1DJI A;  3BUM B;  5I8N A;  1J7P A;  1J1E A;  1K2H A;  3VRP A;  1OMV A;  3O78 A;  1NCY A;  5DKR A;  4P5O E;  3AAJ A;  1XK4 C;  3FS7 A;  1OSA A;  2G2B A;  2I94 A;  2L51 A;  1BOD A;  1YR5 A;  1A03 A;  3RLZ A;  3GOF A;  1SCM C;  2LAN A;  1YUS A;  2ZND A;  2BCB A;  2L4H A;  1C7V A;  2WOS A;  1WRK A;  4QJ3 B;  5I2Q A;  1FW4 A;  3JVT B;  1GGZ A;  1K9K A;  2LLU A;  3FIA A;  4XJK B;  2EC6 B;  5JJG A;  1TRF A;  1NP8 A;  3BOW B;  1G8I A;  2CCM A;  1PRW A;  2QPT A;  3GK2 A;  4QJ4 B;  2BBN A;  3EKH A;  2E30 A;  3TS5 B;  3CGA A;  1PVB A;  2BCA A;  3VGO A;  1KSO A;  3NSK A;  1KFU S;  2Y5I A;  3DVK A;  4I5N B;  1TCF A;  3PSR A;  1ZFS A;  1JFJ A;  1YTZ C;  4M2O A;  1CB1 A;  1PK0 D;  2LUC A;  4CFQ A;  5IBW A;  1DJG A;  1KFX L;  4DCK A;  1S5G Y;  2JRF A;  2ZN9 A;  1KQM B;  2JT0 A;  1B8C A;  1SL8 A;  1DT7 B;  1KCY A;  1A75 A;  3PN7 B;  4NDC A;  3D0Y A;  1WRL A;  3FWB A;  1OQP A;  2FJU B;  1KQV A;  2WND A;  1CDL A;  1V1F A;  3CTN A;  5AAN A;  1NSH A;  1DGV A;  1AK8 A;  3CR2 A;  1LIN A;  3IQO A;  2JWW A;  3O2P A;  2KDH A;  2SCP A;  4IL1 A;  2M7L A;  3I5F C;  4N1F A;  3VRN A;  3KO0 A;  4ETO A;  2SAS A;  4JQ0 D;  1B47 A;  5AFP A;  5HLO A;  1M45 A;  1CFD A;  2CXJ A;  2KFG A;  4DUQ A;  2OTG C;  1L2O C;  1W7J B;  1TN4 A;  2LMV A;  1JFK A;  2M1K B;  4Q04 A;  2F3Z A;  1J7Q A;  2JNX A;  1M31 A;  3ICB A;  4OKH A;  1XFU O;  1Y1X A;  2KBM A;  3DD4 A;  1NIW A;  1ALV A;  3TDZ A;  1XFZ O;  2KGR A;  1Y0V H;  4I5L B;  4MBE A;  2KYC A;  3I5H B;  1YRT B;  3GK4 X;  2K0J A;  4XYN A;  4YBH B;  4D1E A;  3PAT A;  4PHN A;  1BU3 A;  2F33 A;  2P6B B;  3EVR A;  2LVJ A;  1F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...