1JFKA

Minimum energy representative structure of a calcium bound ef-hand protein from entamoeba histolytica
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
b'MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
pubmed doi rcsb
molecule keywords CALCIUM-BINDING PROTEIN
source organism Entamoeba histolytica
molecule tags Metal binding protein
total genus 35
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfkA02
2SASA 1YUTA 4PHNA 5HKWA 1SCMC 1M45A 4YGBB 2Y1MA 5FYXA 4XJKA 2LM5A 1F4OA 1CTRA 3CTNA 1PRWA 2WC8A 5AANA 2KDHA 2JPTA 3FIAA 3O2PA 4U8DA 4NDDA 4MBEA 1SK6D 3KHEA 2LNKA 3TS5C 4AOMA 1DGVA 2CTNA 4YI9A 1DMOA 1IQ5A 1WLMA 2LANA 2M7NA 2WOSA 4N1FA 1WY9A 1BODA 2M49B 1N65A 3FS7A 3DVEA 2KSPA 2KNEA 2PASA 2D8NA 3DVMA 2M9GA 1K8UA 1HT9A 1XFUO 2K61A 2BCBA 2KBIA 3IQQA 4ZCUA 2V53A 2L2EA 2BCAA 4MRYA 1UHIA 3K21A 1DJGA 1ODBA 1LINA 5CSNA 4PDZA 1EG3A 1MWNA 4I5JA 4BY4A 1WRLA 3JTDB 5I2QA 1BG1A 4YGAA 2KGBC 1B7TZ 3VRNA 1IJ5A 1ZMZA 2CNPA 5K89A 2L50A 4I5NB 2JNFA 4Q04A 2KOTA 1XO5A 3SG4A 1YTZC 3EVRA 4GBAA 2BECA 1DJWA 1KWOC 1K9KA 2BL0C 1PULA 1XFVO 3KF9A 1SNLA 4NDBA 1V1FA 5KU1A 2Y1NA 1IQ3A 3O6BA 1Q80A 3TS5B 1OMDA 3DF0A 3MSEB 4HREE 4R1EA 1PSBA 1QTXA 3NSIA 3VRQA 1JBAA 2M3WA 4WRIA 4OKHA 1XFYO 4USLA 1J7RA 1OZSA 1KCYA 3WNXB 1BT6A 1E8AA 1F54A 1YX8A 1PVAA 3SJSA 3HCMA 2OS8C 4QJ5B 2G9BA 2O5GA 1QX7A 2BBNA 2M0RA 1LA0A 3DD4A 1UWOA 2VRGA 2FCDA 4PE4A 3H4SE 1RTP1 3ZWHA 1NX1A 1ZOTB 1R2UA 1K95A 3AKBA 1SMGA 2O60A 1J7QA 1CLLA 3OB2B 2KAVA 1QIWA 1SYMA 1UUSA 2M29A 1CFPA 1QATA 1OMVA 3LLEA 1Y1XA 3OB1B 1JF0A 2WCFA 2WORA 2GV5A 1KWOB 1NP8A 2R2IA 1OZOA 1BJFA 3TZ1A 4DS7A 1QS7A 4A4CA 2HQWA 2E6WA 2OTGC 2CT9A 4N1GA 2JZIA 1PSRA 1TN4A 3SG7A 1QLSA 1RJVA 4M2OA 1NIWA 4MEWA 2FJUB 2F2OA 2ZNEA 2ISDA 1CDMA 1IKUA 1X02A 1SKTA 5AEQA 2TN4A 2P6BB 4D1EA 4F0ZB 2LLTA 2GGZA 1CDLA 1TOPA 2LCPA 3O4YA 1WRZA 2PALA 2KHNA 3GOFA 1EJ3A 4YBHB 2I94A 2JQ6A 2EHBA 2JOJA 3CGAA 1JFJA 2OS8B 5I8NA 1CM4A 1IG5A 2PSRA 3IF7A 1YX7A 1DT7B 1CB1A 2LHIA 1S36A 1KQMB 4DIRA 4GFTA 2LMTA 1S3PA 1TNXA 2F33A 4MSPA 3TDZA 3BUWB 3TDUA 4QJ4B 2KI6C 2NXQA 3KEVA 1MF8B 4YRUA 1GGWA 1B8CA 1BMOA 5HLVA 2Q91A 4PE0A 4P5OE 5HKZA 1A29A 2DOQA 1K90D 2JT8A 4TNCA 3VRRA 3NSOA 1QV0A 1TRFA 2KAXA 1YRUB 1NSHA 1UP5A 2LVVA 5CSJA 1LXFC 3CWGA 2LHLA 5D7FA 1KK8C 2K0JA 2KI6D 1M39A 4GGFC 3BQ3A 1SW8A 1AP4A 4YI8A 3SG6A 3BUMB 2OTGB 1L7ZA 1CM1A 2BCXA 2JWWA 2ZN8A 3AKAA 5HLOA 1SY9A 1BR4B 2L4HA 2MHHA 2F2PA 3LK0A 1HQVA 2LV7A 3I5IC 5CPVA 5AXIA 5D69A 3I5HC 3BOWB 1NCYA 2LP3A 2MLFC 2Q4UA 2HPSA 1NX0A 1GQMA 1KFUS 1CFCA 1MUXA 1A4PA 1J1EA 1XVJA 1AJ5A 3BUNB 5KTYA 1FI5A 1M46A 3EK7A 1B7TY 2PVBA 2WCBA 1QX5B 3D0YB 4NQGA 1UHJA 1AJ4A 1G33A 1XK4C 4YGCB 3VROA 4WQ2A 5DKQA 1B9AA 1SCMB 5KSZA 3SG5A 2ZRSA 1OMRA 1JUOA 1F4QA 2F8PA 2JNXA 1M31A 3FWBA 4I5LB 1BLQA 4AQJA 2KQYA 1XFXO 1FBVA 2L51A 3PN7C 1PVBA 1KFUL 1NUBA 3EVUA 1FI6A 2NLNA 3OX5A 1NCXA 1ZUZA 2FCEA 5TNCA 1F8HA 2MAZA 2KFFA 2WCEA 5HKYA 3EKJA 4HRGA 1G8IA 2KYCA 1ALVA 1J55A 1DF0B 1JFKA 1A75B 1SBJA 1UHHA 1WDCC 3CLNA 3PALA 5IBWA 1CKKA 1KFXL 1AHRA 1ZFSA 1JF2A 1SPYA 2JC2A 3LCPC 3LK1A 3EKHA 3AAKA 4YGDB 4BY5A 1OSAA 3I5HB 1GJYA 2JT0A 1XA5A 1C7VA 4GUKA 3EK8A 4C0KA 3GK1A 1NWDA 1JC2A 2LVKA 2ZRTA 1NCZA 4JPZB 1W7JB 2BE4A 1LVCD 2L0PA 1F70A 3HX4A 1K94A 4OCIA 5JJGA 2NZ0A 2IS9A 2KFGA 2A4JA 2HF5A 3A4UB 4HSZA 4DUQA 1EH2A 1IH0A 1NX2A 1K2HA 3WHUB 4IL1A 2EC6C 4ZCVA 1AVSA 1H4BA 2BL0B 2LAPA 4JWQA 2KI4C 1KSMA 1FPWA 3I5FC 1G4YR 3GK4X 3PN7B 3E3RA 2EGDA 1CMGA 1J1DA 1QXPA 2CXJA 1CLBA 2KBMA 1F71A 1SRAA 5AFPA 2L4IA 1FW4A 1A2XA 3A8RA 1SCVA 1QIVA 4L9MA 1C7WA 3OHMB 2JXLA 2Y5IA 1CFFA 2ZFDA 4GAOA 4MVFA 1K9UA 1WDCB 4GPLB 2LE9B 2M1UA 1KQVA 2MA2A 2CCMA 4N5XA 1B47A 4M2PA 2CBLA 2G2BA 4FQOA 1J7OA 2LMUA 3D0YA 2JU0A 1R6PA 1KK7Z 5I2OA 2JT3A 4A4BA 1DVIA 1RECA 2NCPA 2OPOA 4MRXA 1UURA 3D10A 1TTXA 1DGUA 1V1GA 4PCWA 1UHKA 1A03A 2LVJA 3F45A 1MR8A 2I2RE 1CMFA 4PHKA 4E68A 2K2FA 1B4CA 4CFQA 1MQ1A 2H61C 2BKHB 1RWYA 2KGRA 1SL8A 4GGFA 4PE7A 2EC6B 3BXKA 3WXAA 2L5XB 2F3YA 2K8MB 1N0YA 5B8IB 1SR6C 2KI4B 1YUSA 3OP0A 1DJHA 1W7IB 3I5FB 2M7LA 3SIAA 1FF1A 1S26D 1QX2A 1K96A 2QPTA 5ER4X 2KQ6A 3LL8B 1M63B 1QVIY 2F3ZA 2I18A 3PSRA 2HQ8A 1TNWA 2ZNDA 4MZLA 4AQIA 4CFRA 2QACA 1D1OA 4ICBA 1QVIZ 4MZKA 1RROA 1CLMA 3NXAA 1EG4A 4PALA 5DKNA 2BBMA 4WQ3A 3PFVA 2PRUA 2AAOA 1Y6WA 3IQOA 2KFHA 1AK8A 1DJZA 3M0WA 1LKJA 1IRJA 1XK4A 1ZACA 2JXCA 4OVNF 4PE1A 1PALA 3BUXB 1EXRA 5AERA 4C0LA 2K7BA 1CDNA 1S5GY 1NPQA 1KFXS 5F6TA 1QLKA 3KPXA 1OE9B 1S5GZ 2LUCA 1TCFA 1UHNA 1MHOA 2MRDA 3CS1A 5ER5A 2K2AA 4M2QA 2JTZA 4XYNA 1SL7A 1Y1UA 2LLUA 2MLEC 4ORCB 2RGIA 1U5IB 4OR9B 4DCKA 1BF5A 3PATA 2BKIB 4NDCA 3RLZA 1SR6B 1PK0D 3FWCA 3KO0A 1B1GA 3BUOB 3DVJA 1S1EA 3TDIA 1KK8B 4I5KA 3SIBA 4PHMA 2AMIA 4FTGA 2H2KA 1MXEA 2K7OA 1VRKA 2AUCA 2K7DA 3JVTC 3CR2A 4MZJA 1DJIA 3VRPA 1IJ6A 3VGOA 1DJYA 3CZTX 3I5IB 3I5GC 1WRKA 3CR5X 5JOLA 4UPGA 5CSFA 1S6CA 2Y4QA 1BR1B 2JRFA 3NSLA 2ZN9A 1TIZA 1XYDA 3AAJA 4GNKB 2LC5A 1YR5A 4XJKB 1AUIB 1H8BA 1YVLA 5GQQC 2M1KB 2LP2A 2K7CA 3OX6A 3SG3A 1CFDA 1QV1A 1K93D 1XFZO 1TCOB 2BE6A 2LVIA 4C0JA 2GGMA 3C1VA 3QRXA 4ORAB 1LA3A 5J3XA 5HYDA 1XFWO 5I2LA 1J7PA 2M8UA 2M97A 1DTLA 4QJ3B 1NX3A 1QASA 3O78A 3RM1A 3TUYC 5G08A 3WHTB 2LMVA 1L2OC 2L98A 1B8RA 2HETA 1BOCA 1C07A 2E30A 1KQMC 1WLZA 4MN0A 3EK4A 4ORBB 1TNQA 1DJXA 1F55A 4GGNA 4HRHA 3BOWA 1S6JA 1B8LA 2JULA 3NSKA 1NYAA 5CSIA 3EVVA 3JVTB 1YURA 1Y1AA 2PMYA 2LLSA 1JSAA 1RK9A 1JWDA 3GK2A 1S6IA 2ZKMX 4CPVA 1Y0VH 1IGVA 1KK7Y 2COLB 1EL4A 1ALWA 2KYFA 3I5GB 2KAYA 4PHJA 1KSOA 1RFJA 5BPJA 1OQPA 1TNPA 1YRTB 4P2YB 1OOJA 3SG2A 2JTTA 5PALA 4MLWA 3DVKA 1SL9A 4CIDA 2H61A 4JQ0D 3PLFB 1IWQA 1U5IA 1QJTA 1YUUA 1N2DA 1CDPA 2FOTA 2B1UA 4CLNA 4ETOA 3ZNIA 1BU3A 1MXLC 3DF0B 1K9PA 3BYAA 2NCOA 1GGZA 1CNPA 2MJWB 4YGEB 3TUYB 2MBXA 1DF0A 2LUXA 4OV2A 4DRWA 1A75A 1L2OB 3JTDC 1YVHA 2SCPA 5DKRA 2I7AA 2WNDA 3ICBA 3PM8A 3CR4X
chains in the Genus database with same CATH superfamily
2SASA 3B87A 1YUTA 4PHNA 5HKWA 1SCMC 1M45A 4YGBB 2Y1MA 5FYXA 4XJKA 2LM5A 1F4OA 1CTRA 3CTNA 1PRWA 2WC8A 5AANA 2KDHA 2JPTA 3FIAA 3O2PA 4U8DA 4NDDA 4MBEA 1SK6D 4IJ7A 3KHEA 2LNKA 3TS5C 4AOMA 1DGVA 2CTNA 4YI9A 1DMOA 1IQ5A 1WLMA 2LANA 2M7NA 2WOSA 4N1FA 1WY9A 1BODA 2M49B 1N65A 3FS7A 3DVEA 2KSPA 2KNEA 2PASA 2D8NA 1C3ZA 3DVMA 2M9GA 1K8UA 1HT9A 1XFUO 2K61A 2BCBA 2KBIA 3IQQA 4ZCUA 3NHIA 2V53A 2L2EA 3RZSA 2BCAA 4MRYA 1UHIA 3K21A 1DJGA 1ODBA 1LINA 5CSNA 4PDZA 1EG3A 1MWNA 4I5JA 4INWA 1WRLA 3JTDB 4BY4A 5I2QA 4YGAA 1BG1A 2KGBC 1B7TZ 3VRNA 1IJ5A 1ZMZA 2CNPA 5K89A 2L50A 3S0AA 4I5NB 2JNFA 4Q04A 2KOTA 1XO5A 3SG4A 1YTZC 3EVRA 4GBAA 2BECA 1DJWA 1KWOC 1K9KA 2BL0C 1PULA 1XFVO 3KF9A 1SNLA 4NDBA 1V1FA 5KU1A 1DEKA 2Y1NA 1IQ3A 3O6BA 1Q80A 2JPOA 3TS5B 1OMDA 3BFHA 3DF0A 3MSEB 4HREE 2WC5A 1PSBA 1QTXA 4R1EA 3NSIA 3VRQA 3D76A 1JBAA 2M3WA 4WRIA 3BFAA 1XFYO 4OKHA 4USLA 1J7RA 3R1VA 1OZSA 1KCYA 3WNXB 1BT6A 1E8AA 1F54A 1YX8A 1PVAA 3SJSA 3HCMA 2OS8C 4QJ5B 3FE6A 2G9BA 2O5GA 1QX7A 3VB1A 2BBNA 2M0RA 1LA0A 3DD4A 1UWOA 2VRGA 2FCDA 4PE4A 3H4SE 1RTP1 3ZWHA 1NX1A 1ZOTB 1R2UA 2L2CA 1K95A 3AKBA 1SMGA 2O60A 3R1PA 1J7QA 2WCMA 1CLLA 3OB2B 2KAVA 3BJHA 3DY9A 1QIWA 1SYMA 1UUSA 2M29A 1CFPA 1QATA 1OMVA 3LLEA 1Y1XA 3OB1B 1JF0A 2WCFA 2WORA 2QEHA 2GV5A 1KWOB 1NP8A 2R2IA 3NHTA 1OZOA 1OOGA 1BJFA 1ORGA 3OBVA 3TZ1A 4DS7A 1QS7A 4A4CA 2HQWA 3PJIA 2E6WA 2OTGC 2CT9A 4N1GA 2P70A 2JZIA 1PSRA 1TN4A 3SG7A 1QLSA 2PYQA 1RJVA 4M2OA 1NIWA 4MEWA 2FJUB 2F2OA 2ZNEA 2ISDA 1CDMA 1IKUA 1T14A 1X02A 1SKTA 5AEQA 2TN4A 2P6BB 5FI6A 4D1EA 2LLTA 4F0ZB 2GGZA 1CDLA 1TOPA 2LCPA 3O4XA 1OW4A 3O4YA 1WRZA 2PALA 2KHNA 3GOFA 1EJ3A 3BFBA 4YBHB 2I94A 2JQ6A 2EHBA 2JOJA 3CGAA 1JFJA 2OS8B 2QEBA 5I8NA 1CM4A 1IG5A 3PM2A 2PSRA 3IF7A 1YX7A 1DT7B 1CB1A 2LHIA 1S36A 1KQMB 4DIRA 4GFTA 2LMTA 1S3PA 1DQEA 1TNXA 2F33A 4MSPA 3TDZA 3BUWB 3TDUA 4QJ4B 2KI6C 2NXQA 3KEVA 1MF8B 4YRUA 1GGWA 1B8CA 1BMOA 5HLVA 2Q91A 4PE0A 4P5OE 5HKZA 1A29A 3SS3A 2DOQA 1K90D 2JT8A 4TNCA 3CZ0A 3NSOA 1QV0A 1TRFA 2KAXA 1YRUB 1NSHA 3VRRA 1DC1A 1UP5A 2LVVA 5CSJA 1LXFC 3CWGA 3S0DA 2LHLA 5D7FA 1KK8C 2K0JA 2KI6D 1M39A 4GGFC 3BQ3A 1SW8A 1AP4A 4YI8A 3SG6A 3BUMB 2OTGB 2QEVA 1L7ZA 1CM1A 2BCXA 2JWWA 2ZN8A 3AKAA 3OGNA 5HLOA 1SY9A 2WCLA 1BR4B 2L4HA 2MHHA 3R1OA 2F2PA 4INXA 3LK0A 1HQVA 2LV7A 3B7AA 3I5IC 5CPVA 5FI2A 5D69A 5AXIA 3I5HC 3BOWB 1NCYA 2LP3A 2MLFC 2Q4UA 2HPSA 1NX0A 4PT1A 1GQMA 1KFUS 1CFCA 1MUXA 1A4PA 1J1EA 1XVJA 1AJ5A 3BUNB 5KTYA 1FI5A 5DICA 2FJYA 1M46A 3EK7A 1B7TY 2PVBA 2WCBA 1QX5B 3D0YB 1TUZA 4NQGA 1UHJA 1AJ4A 1G33A 3SS4A 1XK4C 4YGCB 3VROA 2KLDA 4WQ2A 5D3OA 1B9AA 5DKQA 1SCMB 3N7HA 3DZTA 5KSZA 3SG5A 2ZRSA 1OMRA 1JUOA 1F4QA 2F8PA 2JNXA 1M31A 3FWBA 4I5LB 1BLQA 4AQJA 2KQYA 1XFXO 1FBVA 2L51A 3PN7C 2BAPA 1PVBA 1KFUL 1NUBA 3EVUA 1FI6A 2NLNA 3OX5A 1NCXA 1ZUZA 2ERBA 2FCEA 5TNCA 1F8HA 2MAZA 2KFFA 2KLEA 2WCEA 3EKJA 5HKYA 4HRGA 1G8IA 2KYCA 1QWVA 3SS5A 1ALVA 1J55A 1DF0B 1JFKA 1A75B 1SBJA 1UHHA 1WDCC 3CLNA 3PALA 4F7FA 5IBWA 1KFXL 1CKKA 1AHRA 1ZFSA 1JF2A 3B6XA 1SPYA 2JC2A 3LCPC 3LK1A 3EKHA 3AAKA 4YGDB 2H8VA 3B86A 3DXLA 4BY5A 1OSAA 3I5HB 1GJYA 2JT0A 1LS8A 1XA5A 4GUKA 3EK8A 1C7VA 4C0KA 3GK1A 1NWDA 1JC2A 2LVKA 2ZRTA 1NCZA 4JPZB 1W7JB 1Z4HA 2BE4A 1LVCD 2L0PA 1F70A 3HX4A 3S0BA 1K94A 3B88A 4OCIA 5JJGA 2NZ0A 2BNXA 4FQTA 3S0EA 2L5YA 2IS9A 2KFGA 2A4JA 2HF5A 3A4UB 4HSZA 4DUQA 1EH2A 1IH0A 1NX2A 1K2HA 3WHUB 4IL1A 2EC6C 4ZCVA 1AVSA 1H4BA 2BL0B 2LAPA 4JWQA 2KI4C 1KSMA 1FPWA 3I5FC 1G4YR 3GK4X 3PN7B 3UO9A 3E3RA 2EGDA 1CMGA 1J1DA 1QXPA 2CXJA 3K1EA 2KBMA 1CLBA 1F71A 1SRAA 5AFPA 2L4IA 1FW4A 1A2XA 3A8RA 1SCVA 1QIVA 4L9MA 1C7WA 3OHMB 2JXLA 2Y5IA 1CFFA 2ZFDA 4GAOA 3CYZA 1K9UA 1WDCB 4MVFA 4GPLB 2LE9B 2M1UA 1KQVA 2MA2A 2CCMA 4N5XA 1B47A 4M2PA 1GM0A 2CBLA 2G2BA 4FQOA 1J7OA 2LMUA 3D0YA 1C3YA 2QEOA 2JU0A 1R6PA 1KK7Z 5I2OA 2JT3A 4A4BA 1DVIA 1RECA 2NCPA 2OPOA 4MRXA 3L47A 1UURA 3D10A 1TTXA 1DELA 1DGUA 1V1GA 1UHKA 3QMEA 4PCWA 1A03A 2LVJA 3F45A 1MR8A 2I2RE 1CMFA 4PHKA 4E68A 2K2FA 1B4CA 4CFQA 1MQ1A 2H61C 2BKHB 1RWYA 2KGRA 1SL8A 4GGFA 4PE7A 2EC6B 3BXKA 3WXAA 2L5XB 2F3YA 2K8MB 1N0YA 1P28A 5B8IB 1SR6C 2KI4B 1YUSA 3OP0A 1DJHA 1W7IB 3I5FB 2M7LA 3SIAA 1FF1A 1S26D 1QX2A 3S0FA 1K96A 2QPTA 3D75A 5ER4X 2KQ6A 3LL8B 1M63B 1QVIY 2F3ZA 2I18A 3PSRA 2HQ8A 1TNWA 2ZNDA 4MZLA 4AQIA 4CFRA 2QACA 1D1OA 1OOHA 3Q8IA 4ICBA 1QVIZ 5EL2A 4MZKA 1RROA 1CLMA 1IIOA 3NXAA 1EG4A 4PALA 1TWOA 5DKNA 2BBMA 4WQ3A 1TUJA 3PFVA 2PRUA 2AAOA 1Y6WA 3D78A 3IQOA 2KFHA 1AK8A 1DJZA 3M0WA 1LKJA 1IRJA 1XK4A 3UNWA 1ZACA 2JXCA 4OVNF 4PE1A 1PALA 3BUXB 1EXRA 5AERA 4C0LA 2K7BA 1CDNA 1S5GY 1NPQA 1KFXS 5F6TA 1QLKA 3KPXA 1OE9B 1S5GZ 2LUCA 1TCFA 1UHNA 1MHOA 2MRDA 3CS1A 5ER5A 2K2AA 4M2QA 2JTZA 4XYNA 1SL7A 1Y1UA 2LLUA 2MLEC 4ORCB 2RGIA 1U5IB 4OR9B 4DCKA 1BF5A 2KPHA 3PATA 2BKIB 4NDCA 3RLZA 1SR6B 1PK0D 3FWCA 3KO0A 1B1GA 3BUOB 3DVJA 1S1EA 3TDIA 1KK8B 4I5KA 3SIBA 1Z2CB 4PHMA 2AMIA 4FTGA 2H2KA 1MXEA 2K7OA 1OOIX 1VRKA 2AUCA 2K7DA 2P71A 3CR2A 3JVTC 4MZJA 1DJIA 3VRPA 3D74A 1IJ6A 3VGOA 1DJYA 3D73A 3CZTX 3I5IB 3I5GC 1WRKA 2WCJA 3CR5X 5JOLA 4UPGA 5CSFA 3FE8A 1S6CA 2Y4QA 1BR1B 2JRFA 3NSLA 2ZN9A 1TIZA 1XYDA 3AAJA 2K60A 4GNKB 2LC5A 3IVTA 1YR5A 4XJKB 1AUIB 1H8BA 3FE9A 1YVLA 5GQQC 2M1KB 2LP2A 2K7CA 3OX6A 3SG3A 1CFDA 1QV1A 3CDNA 1K93D 1XFZO 1TCOB 2BE6A 2LVIA 4C0JA 2GGMA 3C1VA 3QRXA 4ORAB 1LA3A 5J3XA 5HYDA 1XFWO 3EG5B 5I2LA 1J7PA 2M8UA 2M97A 4OZDA 1DTLA 4QJ3B 1NX3A 1QASA 2YGUA 3O78A 5I94A 3CZ2A 2WC6A 3S0GA 3RM1A 3TUYC 5G08A 3WHTB 2LMVA 1L2OC 4KYNA 5FI7A 2L98A 1B8RA 2HETA 1BOCA 1C07A 2E30A 1KQMC 1WLZA 4MN0A 3EK4A 4ORBB 1TNQA 1DJXA 3V2LA 1F55A 4GGNA 4HRHA 5HL1A 3BOWA 1S6JA 1B8LA 2JULA 3NSKA 1NYAA 5CSIA 3EVVA 3JVTB 1YURA 1Y1AA 2PMYA 2LLSA 1JSAA 1SSEB 3CZ1A 1RK9A 1JWDA 3GK2A 1S6IA 2ZKMX 4CPVA 1Y0VH 1IGVA 1KK7Y 1XFRA 1EL4A 1ALWA 2COLB 2KYFA 2KAYA 3I5GB 4JD9A 4JKTA 1KSOA 1RFJA 4PHJA 5BPJA 1OQPA 1TNPA 2PQLA 2QDIA 1YRTB 4P2YB 1OOJA 3SG2A 2JTTA 1W9ZA 5PALA 4MLWA 3L4AA 3DVKA 1SL9A 4CIDA 2H61A 4JQ0D 3PLFB 1IWQA 1U5IA 1QJTA 1YUUA 2WCKA 2GTEA 3L4LA 1N2DA 1CDPA 2FOTA 2B1UA 4CLNA 4ETOA 3ZNIA 1BU3A 1MXLC 3DF0B 3CABA 1K9PA 3BYAA 2NCOA 1GGZA 2WCHA 1CNPA 3NGVA 2MJWB 3D77A 4YGEB 3TUYB 2MBXA 1DF0A 2LUXA 4OV2A 4DRWA 1A75A 1L2OB 3JTDC 3R72A 1YVHA 2SCPA 3DYEA 5DKRA 1OOFA 2I7AA 2WNDA 3ICBA 3PM8A 3CR4X
chains in the Genus database with same CATH topology
2SASA 1YUTA 4PHNA 5HKWA 1SCMC 1M45A 4YGBB 2Y1MA 5FYXA 4XJKA 2LM5A 1F4OA 1CTRA 3CTNA 1PRWA 2WC8A 5AANA 2KDHA 2JPTA 3FIAA 3O2PA 4U8DA 4NDDA 4MBEA 1SK6D 3KHEA 2LNKA 3TS5C 4AOMA 1DGVA 2CTNA 4YI9A 1DMOA 1IQ5A 1WLMA 2LANA 2M7NA 2WOSA 4N1FA 1WY9A 1BODA 2M49B 1N65A 3FS7A 3DVEA 2KSPA 2KNEA 2PASA 2D8NA 3DVMA 2M9GA 1K8UA 1HT9A 1XFUO 2K61A 2BCBA 2KBIA 3IQQA 4ZCUA 2V53A 2L2EA 2BCAA 4MRYA 1UHIA 3K21A 1DJGA 1ODBA 1LINA 5CSNA 4PDZA 1EG3A 1MWNA 4I5JA 4BY4A 1WRLA 3JTDB 5I2QA 1BG1A 4YGAA 2KGBC 1B7TZ 3VRNA 1IJ5A 1ZMZA 2CNPA 5K89A 2L50A 4I5NB 2JNFA 4Q04A 2KOTA 1XO5A 3SG4A 1YTZC 3EVRA 4GBAA 2BECA 1DJWA 1KWOC 1K9KA 2BL0C 1PULA 1XFVO 3KF9A 1SNLA 4NDBA 1V1FA 5KU1A 2Y1NA 1IQ3A 3O6BA 1Q80A 3TS5B 1OMDA 3DF0A 3MSEB 4HREE 4R1EA 1PSBA 1QTXA 3NSIA 3VRQA 1JBAA 2M3WA 4WRIA 4OKHA 1XFYO 4USLA 1J7RA 1OZSA 1KCYA 3WNXB 1BT6A 1E8AA 1F54A 1YX8A 1PVAA 3SJSA 3HCMA 2OS8C 4QJ5B 2G9BA 2O5GA 1QX7A 2BBNA 2M0RA 1LA0A 3DD4A 1UWOA 2VRGA 2FCDA 4PE4A 3H4SE 1RTP1 3ZWHA 1NX1A 1ZOTB 1R2UA 1K95A 3AKBA 1SMGA 2O60A 1J7QA 1CLLA 3OB2B 2KAVA 1QIWA 1SYMA 1UUSA 2M29A 1CFPA 1QATA 1OMVA 3LLEA 1Y1XA 3OB1B 1JF0A 2WCFA 2WORA 2GV5A 1KWOB 1NP8A 2R2IA 1OZOA 1BJFA 3TZ1A 4DS7A 1QS7A 4A4CA 2HQWA 2E6WA 2OTGC 2CT9A 4N1GA 2JZIA 1PSRA 1TN4A 3SG7A 1QLSA 1RJVA 4M2OA 1NIWA 4MEWA 2FJUB 2F2OA 2ZNEA 2ISDA 1CDMA 1IKUA 1X02A 1SKTA 5AEQA 2TN4A 2P6BB 4D1EA 4F0ZB 2LLTA 2GGZA 1CDLA 1TOPA 2LCPA 3O4YA 1WRZA 2PALA 2KHNA 3GOFA 1EJ3A 4YBHB 2I94A 2JQ6A 2EHBA 2JOJA 3CGAA 1JFJA 2OS8B 5I8NA 1CM4A 1IG5A 2PSRA 3IF7A 1YX7A 1DT7B 1CB1A 2LHIA 1S36A 1KQMB 4DIRA 4GFTA 2LMTA 1S3PA 1TNXA 2F33A 4MSPA 3TDZA 3BUWB 3TDUA 4QJ4B 2KI6C 2NXQA 3KEVA 1MF8B 4YRUA 1GGWA 1B8CA 1BMOA 5HLVA 2Q91A 4PE0A 4P5OE 5HKZA 1A29A 2DOQA 1K90D 2JT8A 4TNCA 3VRRA 3NSOA 1QV0A 1TRFA 2KAXA 1YRUB 1NSHA 1UP5A 2LVVA 5CSJA 1LXFC 3CWGA 2LHLA 5D7FA 1KK8C 2K0JA 2KI6D 1M39A 4GGFC 3BQ3A 1SW8A 1AP4A 4YI8A 3SG6A 3BUMB 2OTGB 1L7ZA 1CM1A 2BCXA 2JWWA 2ZN8A 3AKAA 5HLOA 1SY9A 1BR4B 2L4HA 2MHHA 2F2PA 3LK0A 1HQVA 2LV7A 3I5IC 5CPVA 5AXIA 5D69A 3I5HC 3BOWB 1NCYA 2LP3A 2MLFC 2Q4UA 2HPSA 1NX0A 1GQMA 1KFUS 1CFCA 1MUXA 1A4PA 1J1EA 1XVJA 1AJ5A 3BUNB 5KTYA 1FI5A 1M46A 3EK7A 1B7TY 2PVBA 2WCBA 1QX5B 3D0YB 4NQGA 1UHJA 1AJ4A 1G33A 1XK4C 4YGCB 3VROA 4WQ2A 5DKQA 1B9AA 1SCMB 5KSZA 3SG5A 2ZRSA 1OMRA 1JUOA 1F4QA 2F8PA 2JNXA 1M31A 3FWBA 4I5LB 1BLQA 4AQJA 2KQYA 1XFXO 1FBVA 2L51A 3PN7C 1PVBA 1KFUL 1NUBA 3EVUA 1FI6A 2NLNA 3OX5A 1NCXA 1ZUZA 2FCEA 5TNCA 1F8HA 2MAZA 2KFFA 2WCEA 5HKYA 3EKJA 4HRGA 1G8IA 2KYCA 1ALVA 1J55A 1DF0B 1JFKA 1A75B 1SBJA 1UHHA 1WDCC 3CLNA 3PALA 5IBWA 1CKKA 1KFXL 1AHRA 1ZFSA 1JF2A 1SPYA 2JC2A 3LCPC 3LK1A 3EKHA 3AAKA 4YGDB 4BY5A 1OSAA 3I5HB 1GJYA 2JT0A 1XA5A 1C7VA 4GUKA 3EK8A 4C0KA 3GK1A 1NWDA 1JC2A 2LVKA 2ZRTA 1NCZA 4JPZB 1W7JB 2BE4A 1LVCD 2L0PA 1F70A 3HX4A 1K94A 4OCIA 5JJGA 2NZ0A 2IS9A 2KFGA 2A4JA 2HF5A 3A4UB 4HSZA 4DUQA 1EH2A 1IH0A 1NX2A 1K2HA 3WHUB 4IL1A 2EC6C 4ZCVA 1AVSA 1H4BA 2BL0B 2LAPA 4JWQA 2KI4C 1KSMA 1FPWA 3I5FC 1G4YR 3GK4X 3PN7B 3E3RA 2EGDA 1CMGA 1J1DA 1QXPA 2CXJA 1CLBA 2KBMA 1F71A 1SRAA 5AFPA 2L4IA 1FW4A 1A2XA 3A8RA 1SCVA 1QIVA 4L9MA 1C7WA 3OHMB 2JXLA 2Y5IA 1CFFA 2ZFDA 4GAOA 4MVFA 1K9UA 1WDCB 4GPLB 2LE9B 2M1UA 1KQVA 2MA2A 2CCMA 4N5XA 1B47A 4M2PA 2CBLA 2G2BA 4FQOA 1J7OA 2LMUA 3D0YA 2JU0A 1R6PA 1KK7Z 5I2OA 2JT3A 4A4BA 1DVIA 1RECA 2NCPA 2OPOA 4MRXA 1UURA 3D10A 1TTXA 1DGUA 1V1GA 4PCWA 1UHKA 1A03A 2LVJA 3F45A 1MR8A 2I2RE 1CMFA 4PHKA 4E68A 2K2FA 1B4CA 4CFQA 1MQ1A 2H61C 2BKHB 1RWYA 2KGRA 1SL8A 4GGFA 4PE7A 2EC6B 3BXKA 3WXAA 2L5XB 2F3YA 2K8MB 1N0YA 5B8IB 1SR6C 2KI4B 1YUSA 3OP0A 1DJHA 1W7IB 3I5FB 2M7LA 3SIAA 1FF1A 1S26D 1QX2A 1K96A 2QPTA 5ER4X 2KQ6A 3LL8B 1M63B 1QVIY 2F3ZA 2I18A 3PSRA 2HQ8A 1TNWA 2ZNDA 4MZLA 4AQIA 4CFRA 2QACA 1D1OA 4ICBA 1QVIZ 4MZKA 1RROA 1CLMA 3NXAA 1EG4A 4PALA 5DKNA 2BBMA 4WQ3A 3PFVA 2PRUA 2AAOA 1Y6WA 3IQOA 2KFHA 1AK8A 1DJZA 3M0WA 1LKJA 1IRJA 1XK4A 1ZACA 2JXCA 4OVNF 4PE1A 1PALA 3BUXB 1EXRA 5AERA 4C0LA 2K7BA 1CDNA 1S5GY 1NPQA 1KFXS 5F6TA 1QLKA 3KPXA 1OE9B 1S5GZ 2LUCA 1TCFA 1UHNA 1MHOA 2MRDA 3CS1A 5ER5A 2K2AA 4M2QA 2JTZA 4XYNA 1SL7A 1Y1UA 2LLUA 2MLEC 4ORCB 2RGIA 1U5IB 4OR9B 4DCKA 1BF5A 3PATA 2BKIB 4NDCA 3RLZA 1SR6B 1PK0D 3FWCA 3KO0A 1B1GA 3BUOB 3DVJA 1S1EA 3TDIA 1KK8B 4I5KA 3SIBA 4PHMA 2AMIA 4FTGA 2H2KA 1MXEA 2K7OA 1VRKA 2AUCA 2K7DA 3JVTC 3CR2A 4MZJA 1DJIA 3VRPA 1IJ6A 3VGOA 1DJYA 3CZTX 3I5IB 3I5GC 1WRKA 3CR5X 5JOLA 4UPGA 5CSFA 1S6CA 2Y4QA 1BR1B 2JRFA 3NSLA 2ZN9A 1TIZA 1XYDA 3AAJA 4GNKB 2LC5A 1YR5A 4XJKB 1AUIB 1H8BA 1YVLA 5GQQC 2M1KB 2LP2A 2K7CA 3OX6A 3SG3A 1CFDA 1QV1A 1K93D 1XFZO 1TCOB 2BE6A 2LVIA 4C0JA 2GGMA 3C1VA 3QRXA 4ORAB 1LA3A 5J3XA 5HYDA 1XFWO 5I2LA 1J7PA 2M8UA 2M97A 1DTLA 4QJ3B 1NX3A 1QASA 3O78A 3RM1A 3TUYC 5G08A 3WHTB 2LMVA 1L2OC 2L98A 1B8RA 2HETA 1BOCA 1C07A 2E30A 1KQMC 1WLZA 4MN0A 3EK4A 4ORBB 1TNQA 1DJXA 1F55A 4GGNA 4HRHA 3BOWA 1S6JA 1B8LA 2JULA 3NSKA 1NYAA 5CSIA 3EVVA 3JVTB 1YURA 1Y1AA 2PMYA 2LLSA 1JSAA 1RK9A 1JWDA 3GK2A 1S6IA 2ZKMX 4CPVA 1Y0VH 1IGVA 1KK7Y 2COLB 1EL4A 1ALWA 2KYFA 3I5GB 2KAYA 4PHJA 1KSOA 1RFJA 5BPJA 1OQPA 1TNPA 1YRTB 4P2YB 1OOJA 3SG2A 2JTTA 5PALA 4MLWA 3DVKA 1SL9A 4CIDA 2H61A 4JQ0D 3PLFB 1IWQA 1U5IA 1QJTA 1YUUA 1N2DA 1CDPA 2FOTA 2B1UA 4CLNA 4ETOA 3ZNIA 1BU3A 1MXLC 3DF0B 1K9PA 3BYAA 2NCOA 1GGZA 1CNPA 2MJWB 4YGEB 3TUYB 2MBXA 1DF0A 2LUXA 4OV2A 4DRWA 1A75A 1L2OB 3JTDC 1YVHA 2SCPA 5DKRA 2I7AA 2WNDA 3ICBA 3PM8A 3CR4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAS A;  1YUT A;  4PHN A;  5HKW A;  1SCM C;  1M45 A;  4YGB B;  2Y1M A;  5FYX A;  4XJK A;  2LM5 A;  1F4O A;  1CTR A;  3CTN A;  1PRW A;  2WC8 A;  5AAN A;  2KDH A;  2JPT A;  3FIA A;  3O2P A;  4U8D A;  4NDD A;  4MBE A;  1SK6 D;  3KHE A;  2LNK A;  3TS5 C;  4AOM A;  1DGV A;  2CTN A;  4YI9 A;  1DMO A;  1IQ5 A;  1WLM A;  2LAN A;  2M7N A;  2WOS A;  4N1F A;  1WY9 A;  1BOD A;  2M49 B;  1N65 A;  3FS7 A;  3DVE A;  2KSP A;  2KNE A;  2PAS A;  2D8N A;  3DVM A;  2M9G A;  1K8U A;  1HT9 A;  1XFU O;  2K61 A;  2BCB A;  2KBI A;  3IQQ A;  4ZCU A;  2V53 A;  2L2E A;  2BCA A;  4MRY A;  1UHI A;  3K21 A;  1DJG A;  1ODB A;  1LIN A;  5CSN A;  4PDZ A;  1EG3 A;  1MWN A;  4I5J A;  4BY4 A;  1WRL A;  3JTD B;  5I2Q A;  1BG1 A;  4YGA A;  2KGB C;  1B7T Z;  3VRN A;  1IJ5 A;  1ZMZ A;  2CNP A;  5K89 A;  2L50 A;  4I5N B;  2JNF A;  4Q04 A;  2KOT A;  1XO5 A;  3SG4 A;  1YTZ C;  3EVR A;  4GBA A;  2BEC A;  1DJW A;  1KWO C;  1K9K A;  2BL0 C;  1PUL A;  1XFV O;  3KF9 A;  1SNL A;  4NDB A;  1V1F A;  5KU1 A;  2Y1N A;  1IQ3 A;  3O6B A;  1Q80 A;  3TS5 B;  1OMD A;  3DF0 A;  3MSE B;  4HRE E;  4R1E A;  1PSB A;  1QTX A;  3NSI A;  3VRQ A;  1JBA A;  2M3W A;  4WRI A;  4OKH A;  1XFY O;  4USL A;  1J7R A;  1OZS A;  1KCY A;  3WNX B;  1BT6 A;  1E8A A;  1F54 A;  1YX8 A;  1PVA A;  3SJS A;  3HCM A;  2OS8 C;  4QJ5 B;  2G9B A;  2O5G A;  1QX7 A;  2BBN A;  2M0R A;  1LA0 A;  3DD4 A;  1UWO A;  2VRG A;  2FCD A;  4PE4 A;  3H4S E;  1RTP 1;  3ZWH A;  1NX1 A;  1ZOT B;  1R2U A;  1K95 A;  3AKB A;  1SMG A;  2O60 A;  1J7Q A;  1CLL A;  3OB2 B;  2KAV A;  1QIW A;  1SYM A;  1UUS A;  2M29 A;  1CFP A;  1QAT A;  1OMV A;  3LLE A;  1Y1X A;  3OB1 B;  1JF0 A;  2WCF A;  2WOR A;  2GV5 A;  1KWO B;  1NP8 A;  2R2I A;  1OZO A;  1BJF A;  3TZ1 A;  4DS7 A;  1QS7 A;  4A4C A;  2HQW A;  2E6W A;  2OTG C;  2CT9 A;  4N1G A;  2JZI A;  1PSR A;  1TN4 A;  3SG7 A;  1QLS A;  1RJV A;  4M2O A;  1NIW A;  4MEW A;  2FJU B;  2F2O A;  2ZNE A;  2ISD A;  1CDM A;  1IKU A;  1X02 A;  1SKT A;  5AEQ A;  2TN4 A;  2P6B B;  4D1E A;  4F0Z B;  2LLT A;  2GGZ A;  1CDL A;  1TOP A;  2LCP A;  3O4Y A;  1WRZ A;  2PAL A;  2KHN A;  3GOF A;  1EJ3 A;  4YBH B;  2I94 A;  2JQ6 A;  2EHB A;  2JOJ A;  3CGA A;  1JFJ A;  2OS8 B;  5I8N A;  1CM4 A;  1IG5 A;  2PSR A;  3IF7 A;  1YX7 A;  1DT7 B;  1CB1 A;  2LHI A;  1S36 A;  1KQM B;  4DIR A;  4GFT A;  2LMT A;  1S3P A;  1TNX A;  2F33 A;  4MSP A;  3TDZ A;  3BUW B;  3TDU A;  4QJ4 B;  2KI6 C;  2NXQ A;  3KEV A;  1MF8 B;  4YRU A;  1GGW A;  1B8C A;  1BMO A;  5HLV A;  2Q91 A;  4PE0 A;  4P5O E;  5HKZ A;  1A29 A;  2DOQ A;  1K90 D;  2JT8 A;  4TNC A;  3VRR A;  3NSO A;  1QV0 A;  1TRF A;  2KAX A;  1YRU B;  1NSH A;  1UP5 A;  2LVV A;  5CSJ A;  1LXF C;  3CWG A;  2LHL A;  5D7F A;  1KK8 C;  2K0J A;  2KI6 D;  1M39 A;  4GGF C;  3BQ3 A;  1SW8 A;  1AP4 A;  4YI8 A;  3SG6 A;  3BUM B;  2OTG B;  1L7Z A;  1CM1 A;  2BCX A;  2JWW A;  2ZN8 A;  3AKA A;  5HLO A;  1SY9 A;  1BR4 B;  2L4H A;  2MHH A;  2F2P A;  3LK0 A;  1HQV A;  2LV7 A;  3I5I C;  5CPV A;  5AXI A;  5D69 A;  3I5H C;  3BOW B;  1NCY A;  2LP3 A;  2MLF C;  2Q4U A;  2HPS A;  1NX0 A;  1GQM A;  1KFU S;  1CFC A;  1MUX A;  1A4P A;  1J1E A;  1XVJ A;  1AJ5 A;  3BUN B;  5KTY A;  1FI5 A;  1M46 A;  3EK7 A;  1B7T Y;  2PVB A;  2WCB A;  1QX5 B;  3D0Y B;  4NQG A;  1UHJ A;  1AJ4 A;  1G33 A;  1XK4 C;  4YGC B;  3VRO A;  4WQ2 A;  5DKQ A;  1B9A A;  1SCM B;  5KSZ A;  3SG5 A;  2ZRS A;  1OMR A;  1JUO A;  1F4Q A;  2F8P A;  2JNX A;  1M31 A;  3FWB A;  4I5L B;  1BLQ A;  4AQJ A;  2KQY A;  1XFX O;  1FBV A;  2L51 A;  3PN7 C;  1PVB A;  1KFU L;  1NUB A;  3EVU A;  1FI6 A;  2NLN A;  3OX5 A;  1NCX A;  1ZUZ A;  2FCE A;  5TNC A;  1F8H A;  2MAZ A;  2KFF A;  2WCE A;  5HKY A;  3EKJ A;  4HRG A;  1G8I A;  2KYC A;  1ALV A;  1J55 A;  1DF0 B;  1JFK A;  1A75 B;  1SBJ A;  1UHH A;  1WDC C;  3CLN A;  3PAL A;  5IBW A;  1CKK A;  1KFX L;  1AHR A;  1ZFS A;  1JF2 A;  1SPY A;  2JC2 A;  3LCP C;  3LK1 A;  3EKH A;  3AAK A;  4YGD B;  4BY5 A;  1OSA A;  3I5H B;  1GJY A;  2JT0 A;  1XA5 A;  1C7V A;  4GUK A;  3EK8 A;  4C0K A;  3GK1 A;  1NWD A;  1JC2 A;  2LVK A;  2ZRT A;  1NCZ A;  4JPZ B;  1W7J B;  2BE4 A;  1LVC D;  2L0P A;  1F70 A;  3HX4 A;  1K94 A;  4OCI A;  5JJG A;  2NZ0 A;  2IS9 A;  2KFG A;  2A4J A;  2HF5 A;  3A4U B;  4HSZ A;  4DUQ A;  1EH2 A;  1IH0 A;  1NX2 A;  1K2H A;  3WHU B;  4IL1 A;  2EC6 C;  4ZCV A;  1AVS A;  1H4B A;  2BL0 B;  2LAP A;  4JWQ A;  2KI4 C;  1KSM A;  1FPW A;  3I5F C;  1G4Y R;  3GK4 X;  3PN7 B;  3E3R A;  2EGD A;  1CMG A;  1J1D A;  1QXP A;  2CXJ A;  1CLB A;  2KBM A;  1F71 A;  1SRA A;  5AFP A;  2L4I A;  1FW4 A;  1A2X A;  3A8R A;  1SCV A;  1QIV A;  4L9M A;  1C7W A;  3OHM B;  2JXL A;  2Y5I A;  1CFF A;  2ZFD A;  4GAO A;  4MVF A;  1K9U A;  1WDC B;  4GPL B;  2LE9 B;  2M1U A;  1KQV A;  2MA2 A;  2CCM A;  4N5X A;  1B47 A;  4M2P A;  2CBL A;  2G2B A;  4FQO A;  1J7O A;  2LMU A;  3D0Y A;  2JU0 A;  1R6P A;  1KK7 Z;  5I2O A;  2JT3 A;  4A4B A;  1DVI A;  1REC A;  2NCP A;  2OPO A;  4MRX A;  1UUR A;  3D10 A;  1TTX A;  1DGU A;  1V1G A;  4PCW A;  1UHK A;  1A03 A;  2LVJ A;  3F45 A;  1MR8 A;  2I2R E;  1CMF A;  4PHK A;  4E68 A;  2K2F A;  1B4C A;  4CFQ A;  1MQ1 A;  2H61 C;  2BKH B;  1RWY A;  2KGR A;  1SL8 A;  4GGF A;  4PE7 A;  2EC6 B;  3BXK A;  3WXA A;  2L5X B;  2F3Y A;  2K8M B;  1N0Y A;  5B8I B;  1SR6 C;  2KI4 B;  1YUS A;  3OP0 A;  1DJH A;  1W7I B;  3I5F B;  2M7L A;  3SIA A;  1FF1 A;  1S26 D;  1QX2 A;  1K96 A;  2QPT A;  5ER4 X;  2KQ6 A;  3LL8 B;  1M63 B;  1QVI Y;  2F3Z A;  2I18 A;  3PSR A;  2HQ8 A;  1TNW A;  2ZND A;  4MZL A;  4AQI A;  4CFR A;  2QAC A;  1D1O A;  4ICB A;  1QVI Z;  4MZK A;  1RRO A;  1CLM A;  3NXA A;  1EG4 A;  4PAL A;  5DKN A;  2BBM A;  4WQ3 A;  3PFV A;  2PRU A;  2AAO A;  1Y6W A;  3IQO A;  2KFH A;  1AK8 A;  1DJZ A;  3M0W A;  1LKJ A;  1IRJ A;  1XK4 A;  1ZAC A;  2JXC A;  4OVN F;  4PE1 A;  1PAL A;  3BUX B;  1EXR A;  5AER A;  4C0L A;  2K7B A;  1CDN A;  1S5G Y;  1NPQ A;  1KFX S;  5F6T A;  1QLK A;  3KPX A;  1OE9 B;  1S5G Z;  2LUC A;  1TCF A;  1UHN A;  1MHO A;  2MRD A;  3CS1 A;  5ER5 A;  2K2A A;  4M2Q A;  2JTZ A;  4XYN A;  1SL7 A;  1Y1U A;  2LLU A;  2MLE C;  4ORC B;  2RGI A;  1U5I B;  4OR9 B;  4DCK A;  1BF5 A;  3PAT A;  2BKI B;  4NDC A;  3RLZ A;  1SR6 B;  1PK0 D;  3FWC A;  3KO0 A;  1B1G A;  3BUO B;  3DVJ A;  1S1E A;  3TDI A;  1KK8 B;  4I5K A;  3SIB A;  4PHM A;  2AMI A;  4FTG A;  2H2K A;  1MXE A;  2K7O A;  1VRK A;  2AUC A;  2K7D A;  3JVT C;  3CR2 A;  4MZJ A;  1DJI A;  3VRP A;  1IJ6 A;  3VGO A;  1DJY A;  3CZT X;  3I5I B;  3I5G C;  1WRK A;  3CR5 X;  5JOL A;  4UPG A;  5CSF A;  1S6C A;  2Y4Q A;  1BR1 B;  2JRF A;  3NSL A;  2ZN9 A;  1TIZ A;  1XYD A;  3AAJ A;  4GNK B;  2LC5 A;  1YR5 A;  4XJK B;  1AUI B;  1H8B A;  1YVL A;  5GQQ C;  2M1K B;  2LP2 A;  2K7C A;  3OX6 A;  3SG3 A;  1CFD A;  1QV1 A;  1K93 D;  1XFZ O;  1TCO B;  2BE6 A;  2LVI A;  4C0J A;  2GGM A;  3C1V A;  3QRX A;  4ORA B;  1LA3 A;  5J3X A;  5HYD A;  1XFW O;  5I2L A;  1J7P A;  2M8U A;  2M97 A;  1DTL A;  4QJ3 B;  1NX3 A;  1QAS A;  3O78 A;  3RM1 A;  3TUY C;  5G08 A;  3WHT B;  2LMV A;  1L2O C;  2L98 A;  1B8R A;  2HET A;  1BOC A;  1C07 A;  2E30 A;  1KQM C;  1WLZ A;  4MN0 A;  3EK4 A;  4ORB B;  1TNQ A;  1DJX A;  1F55 A;  4GGN A;  4HRH A;  3BOW A;  1S6J A;  1B8L A;  2JUL A;  3NSK A;  1NYA A;  5CSI A;  3EVV A;  3JVT B;  1YUR A;  1Y1A A;  2PMY A;  2LLS A;  1JSA A;  1RK9 A;  1JWD A;  3GK2 A;  1S6I A;  2ZKM X;  4CPV A;  1Y0V H;  1IGV A;  1KK7 Y;  2COL B;  1EL4 A;  1ALW A;  2KYF A;  3I5G B;  2KAY A;  4PHJ A;  1KSO A;  1RFJ A;  5BPJ A;  1OQP A;  1TNP A;  1YRT B;  4P2Y B;  1OOJ A;  3SG2 A;  2JTT A;  5PAL A;  4MLW A;  3DVK A;  1SL9 A;  4CID A;  2H61 A;  4JQ0 D;  3PLF B;  1IWQ A;  1U5I A;  1QJT A;  1YUU A;  1N2D A;  1CDP A;  2FOT A;  2B1U A;  4CLN A;  4ETO A;  3ZNI A;  1BU3 A;  1MXL C;  3DF0 B;  1K9P A;  3BYA A;  2NCO A;  1GGZ A;  1CNP A;  2MJW B;  4YGE B;  3TUY B;  2MBX A;  1DF0 A;  2LUX A;  4OV2 A;  4DRW A;  1A75 A;  1L2O B;  3JTD C;  1YVH A;  2SCP A;  5DKR A;  2I7A A;  2WND A;  3ICB A;  3PM8 A;  3CR4 X; 
#chains in the Genus database with same CATH topology
 2SAS A;  3B87 A;  1YUT A;  4PHN A;  5HKW A;  1SCM C;  1M45 A;  4YGB B;  2Y1M A;  5FYX A;  4XJK A;  2LM5 A;  1F4O A;  1CTR A;  3CTN A;  1PRW A;  2WC8 A;  5AAN A;  2KDH A;  2JPT A;  3FIA A;  3O2P A;  4U8D A;  4NDD A;  4MBE A;  1SK6 D;  4IJ7 A;  3KHE A;  2LNK A;  3TS5 C;  4AOM A;  1DGV A;  2CTN A;  4YI9 A;  1DMO A;  1IQ5 A;  1WLM A;  2LAN A;  2M7N A;  2WOS A;  4N1F A;  1WY9 A;  1BOD A;  2M49 B;  1N65 A;  3FS7 A;  3DVE A;  2KSP A;  2KNE A;  2PAS A;  2D8N A;  1C3Z A;  3DVM A;  2M9G A;  1K8U A;  1HT9 A;  1XFU O;  2K61 A;  2BCB A;  2KBI A;  3IQQ A;  4ZCU A;  3NHI A;  2V53 A;  2L2E A;  3RZS A;  2BCA A;  4MRY A;  1UHI A;  3K21 A;  1DJG A;  1ODB A;  1LIN A;  5CSN A;  4PDZ A;  1EG3 A;  1MWN A;  4I5J A;  4INW A;  1WRL A;  3JTD B;  4BY4 A;  5I2Q A;  4YGA A;  1BG1 A;  2KGB C;  1B7T Z;  3VRN A;  1IJ5 A;  1ZMZ A;  2CNP A;  5K89 A;  2L50 A;  3S0A A;  4I5N B;  2JNF A;  4Q04 A;  2KOT A;  1XO5 A;  3SG4 A;  1YTZ C;  3EVR A;  4GBA A;  2BEC A;  1DJW A;  1KWO C;  1K9K A;  2BL0 C;  1PUL A;  1XFV O;  3KF9 A;  1SNL A;  4NDB A;  1V1F A;  5KU1 A;  1DEK A;  2Y1N A;  1IQ3 A;  3O6B A;  1Q80 A;  2JPO A;  3TS5 B;  1OMD A;  3BFH A;  3DF0 A;  3MSE B;  4HRE E;  2WC5 A;  1PSB A;  1QTX A;  4R1E A;  3NSI A;  3VRQ A;  3D76 A;  1JBA A;  2M3W A;  4WRI A;  3BFA A;  1XFY O;  4OKH A;  4USL A;  1J7R A;  3R1V A;  1OZS A;  1KCY A;  3WNX B;  1BT6 A;  1E8A A;  1F54 A;  1YX8 A;  1PVA A;  3SJS A;  3HCM A;  2OS8 C;  4QJ5 B;  3FE6 A;  2G9B A;  2O5G A;  1QX7 A;  3VB1 A;  2BBN A;  2M0R A;  1LA0 A;  3DD4 A;  1UWO A;  2VRG A;  2FCD A;  4PE4 A;  3H4S E;  1RTP 1;  3ZWH A;  1NX1 A;  1ZOT B;  1R2U A;  2L2C A;  1K95 A;  3AKB A;  1SMG A;  2O60 A;  3R1P A;  1J7Q A;  2WCM A;  1CLL A;  3OB2 B;  2KAV A;  3BJH A;  3DY9 A;  1QIW A;  1SYM A;  1UUS A;  2M29 A;  1CFP A;  1QAT A;  1OMV A;  3LLE A;  1Y1X A;  3OB1 B;  1JF0 A;  2WCF A;  2WOR A;  2QEH A;  2GV5 A;  1KWO B;  1NP8 A;  2R2I A;  3NHT A;  1OZO A;  1OOG A;  1BJF A;  1ORG A;  3OBV A;  3TZ1 A;  4DS7 A;  1QS7 A;  4A4C A;  2HQW A;  3PJI A;  2E6W A;  2OTG C;  2CT9 A;  4N1G A;  2P70 A;  2JZI A;  1PSR A;  1TN4 A;  3SG7 A;  1QLS A;  2PYQ A;  1RJV A;  4M2O A;  1NIW A;  4MEW A;  2FJU B;  2F2O A;  2ZNE A;  2ISD A;  1CDM A;  1IKU A;  1T14 A;  1X02 A;  1SKT A;  5AEQ A;  2TN4 A;  2P6B B;  5FI6 A;  4D1E A;  2LLT A;  4F0Z B;  2GGZ A;  1CDL A;  1TOP A;  2LCP A;  3O4X A;  1OW4 A;  3O4Y A;  1WRZ A;  2PAL A;  2KHN A;  3GOF A;  1EJ3 A;  3BFB A;  4YBH B;  2I94 A;  2JQ6 A;  2EHB A;  2JOJ A;  3CGA A;  1JFJ A;  2OS8 B;  2QEB A;  5I8N A;  1CM4 A;  1IG5 A;  3PM2 A;  2PSR A;  3IF7 A;  1YX7 A;  1DT7 B;  1CB1 A;  2LHI A;  1S36 A;  1KQM B;  4DIR A;  4GFT A;  2LMT A;  1S3P A;  1DQE A;  1TNX A;  2F33 A;  4MSP A;  3TDZ A;  3BUW B;  3TDU A;  4QJ4 B;  2KI6 C;  2NXQ A;  3KEV A;  1MF8 B;  4YRU A;  1GGW A;  1B8C A;  1BMO A;  5HLV A;  2Q91 A;  4PE0 A;  4P5O E;  5HKZ A;  1A29 A;  3SS3 A;  2DOQ A;  1K90 D;  2JT8 A;  4TNC A;  3CZ0 A;  3NSO A;  1QV0 A;  1TRF A;  2KAX A;  1YRU B;  1NSH A;  3VRR A;  1DC1 A;  1UP5 A;  2LVV A;  5CSJ A;  1LXF C;  3CWG A;  3S0D A;  2LHL A;  5D7F A;  1KK8 C;  2K0J A;  2KI6 D;  1M39 A;  4GGF C;  3BQ3 A;  1SW8 A;  1AP4 A;  4YI8 A;  3SG6 A;  3BUM B;  2OTG B;  2QEV A;  1L7Z A;  1CM1 A;  2BCX A;  2JWW A;  2ZN8 A;  3AKA A;  3OGN A;  5HLO A;  1SY9 A;  2WCL A;  1BR4 B;  2L4H A;  2MHH A;  3R1O A;  2F2P A;  4INX A;  3LK0 A;  1HQV A;  2LV7 A;  3B7A A;  3I5I C;  5CPV A;  5FI2 A;  5D69 A;  5AXI A;  3I5H C;  3BOW B;  1NCY A;  2LP3 A;  2MLF C;  2Q4U A;  2HPS A;  1NX0 A;  4PT1 A;  1GQM A;  1KFU S;  1CFC A;  1MUX A;  1A4P A;  1J1E A;  1XVJ A;  1AJ5 A;  3BUN B;  5KTY A;  1FI5 A;  5DIC A;  2FJY A;  1M46 A;  3EK7 A;  1B7T Y;  2PVB A;  2WCB A;  1QX5 B;  3D0Y B;  1TUZ A;  4NQG A;  1UHJ A;  1AJ4 A;  1G33 A;  3SS4 A;  1XK4 C;  4YGC B;  3VRO A;  2KLD A;  4WQ2 A;  5D3O A;  1B9A A;  5DKQ A;  1SCM B;  3N7H A;  3DZT A;  5KSZ A;  3SG5 A;  2ZRS A;  1OMR A;  1JUO A;  1F4Q A;  2F8P A;  2JNX A;  1M31 A;  3FWB A;  4I5L B;  1BLQ A;  4AQJ A;  2KQY A;  1XFX O;  1FBV A;  2L51 A;  3PN7 C;  2BAP A;  1PVB A;  1KFU L;  1NUB A;  3EVU A;  1FI6 A;  2NLN A;  3OX5 A;  1NCX A;  1ZUZ A;  2ERB A;  2FCE A;  5TNC A;  1F8H A;  2MAZ A;  2KFF A;  2KLE A;  2WCE A;  3EKJ A;  5HKY A;  4HRG A;  1G8I A;  2KYC A;  1QWV A;  3SS5 A;  1ALV A;  1J55 A;  1DF0 B;  1JFK A;  1A75 B;  1SBJ A;  1UHH A;  1WDC C;  3CLN A;  3PAL A;  4F7F A;  5IBW A;  1KFX L;  1CKK A;  1AHR A;  1ZFS A;  1JF2 A;  3B6X A;  1SPY A;  2JC2 A;  3LCP C;  3LK1 A;  3EKH A;  3AAK A;  4YGD B;  2H8V A;  3B86 A;  3DXL A;  4BY5 A;  1OSA A;  3I5H B;  1GJY A;  2JT0 A;  1LS8 A;  1XA5 A;  4GUK A;  3EK8 A;  1C7V A;  4C0K A;  3GK1 A;  1NWD A;  1JC2 A;  2LVK A;  2ZRT A;  1NCZ A;  4JPZ B;  1W7J B;  1Z4H A;  2BE4 A;  1LVC D;  2L0P A;  1F70 A;  3HX4 A;  3S0B A;  1K94 A;  3B88 A;  4OCI A;  5JJG A;  2NZ0 A;  2BNX A;  4FQT A;  3S0E A;  2L5Y A;  2IS9 A;  2KFG A;  2A4J A;  2HF5 A;  3A4U B;  4HSZ A;  4DUQ A;  1EH2 A;  1IH0 A;  1NX2 A;  1K2H A;  3WHU B;  4IL1 A;  2EC6 C;  4ZCV A;  1AVS A;  1H4B A;  2BL0 B;  2LAP A;  4JWQ A;  2KI4 C;  1KSM A;  1FPW A;  3I5F C;  1G4Y R;  3GK4 X;  3PN7 B;  3UO9 A;  3E3R A;  2EGD A;  1CMG A;  1J1D A;  1QXP A;  2CXJ A;  3K1E A;  2KBM A;  1CLB A;  1F71 A;  1SRA A;  5AFP A;  2L4I A;  1FW4 A;  1A2X A;  3A8R A;  1SCV A;  1QIV A;  4L9M A;  1C7W A;  3OHM B;  2JXL A;  2Y5I A;  1CFF A;  2ZFD A;  4GAO A;  3CYZ A;  1K9U A;  1WDC B;  4MVF A;  4GPL B;  2LE9 B;  2M1U A;  1KQV A;  2MA2 A;  2CCM A;  4N5X A;  1B47 A;  4M2P A;  1GM0 A;  2CBL A;  2G2B A;  4FQO A;  1J7O A;  2LMU A;  3D0Y A;  1C3Y A;  2QEO A;  2JU0 A;  1R6P A;  1KK7 Z;  5I2O A;  2JT3 A;  4A4B A;  1DVI A;  1REC A;  2NCP A;  2OPO A;  4MRX A;  3L47 A;  1UUR A;  3D10 A;  1TTX A;  1DEL A;  1DGU A;  1V1G A;  1UHK A;  3QME A;  4PCW A;  1A03 A;  2LVJ A;  3F45 A;  1MR8 A;  2I2R E;  1CMF A;  4PHK A;  4E68 A;  2K2F A;  1B4C A;  4CFQ A;  1MQ1 A;  2H61 C;  2BKH B;  1RWY A;  2KGR A;  1SL8 A;  4GGF A;  4PE7 A;  2EC6 B;  3BXK A;  3WXA A;  2L5X B;  2F3Y A;  2K8M B;  1N0Y A;  1P28 A;  5B8I B;  1SR6 C;  2KI4 B;  1YUS A;  3OP0 A;  1DJH A;  1W7I B;  3I5F B;  2M7L A;  3SIA A;  1FF1 A;  1S26 D;  1QX2 A;  3S0F A;  1K96 A;  2QPT A;  3D75 A;  5ER4 X;  2KQ6 A;  3LL8 B;  1M63 B;  1QVI Y;  2F3Z A;  2I18 A;  3PSR A;  2HQ8 A;  1TNW A;  2ZND A;  4MZL A;  4AQI A;  4CFR A;  2QAC A;  1D1O A;  1OOH A;  3Q8I A;  4ICB A;  1QVI Z;  5EL2 A;  4MZK A;  1RRO A;  1CLM A;  1IIO A;  3NXA A;  1EG4 A;  4PAL A;  1TWO A;  5DKN A;  2BBM A;  4WQ3 A;  1TUJ A;  3PFV A;  2PRU A;  2AAO A;  1Y6W A;  3D78 A;  3IQO A;  2KFH A;  1AK8 A;  1DJZ A;  3M0W A;  1LKJ A;  1IRJ A;  1XK4 A;  3UNW A;  1ZAC A;  2JXC A;  4OVN F;  4PE1 A;  1PAL A;  3BUX B;  1EXR A;  5AER A;  4C0L A;  2K7B A;  1CDN A;  1S5G Y;  1NPQ A;  1KFX S;  5F6T A;  1QLK A;  3KPX A;  1OE9 B;  1S5G Z;  2LUC A;  1TCF A;  1UHN A;  1MHO A;  2MRD A;  3CS1 A;  5ER5 A;  2K2A A;  4M2Q A;  2JTZ A;  4XYN A;  1SL7 A;  1Y1U A;  2LLU A;  2MLE C;  4ORC B;  2RGI A;  1U5I B;  4OR9 B;  4DCK A;  1BF5 A;  2KPH A;  3PAT A;  2BKI B;  4NDC A;  3RLZ A;  1SR6 B;  1PK0 D;  3FWC A;  3KO0 A;  1B1G A;  3BUO B;  3DVJ A;  1S1E A;  3TDI A;  1KK8 B;  4I5K A;  3SIB A;  1Z2C B;  4PHM A;  2AMI A;  4FTG A;  2H2K A;  1MXE A;  2K7O A;  1OOI X;  1VRK A;  2AUC A;  2K7D A;  2P71 A;  3CR2 A;  3JVT C;  4MZJ A;  1DJI A;  3VRP A;  3D74 A;  1IJ6 A;  3VGO A;  1DJY A;  3D73 A;  3CZT X;  3I5I B;  3I5G C;  1WRK A;  2WCJ A;  3CR5 X;  5JOL A;  4UPG A;  5CSF A;  3FE8 A;  1S6C A;  2Y4Q A;  1BR1 B;  2JRF A;  3NSL A;  2ZN9 A;  1TIZ A;  1XYD A;  3AAJ A;  2K60 A;  4GNK B;  2LC5 A;  3IVT A;  1YR5 A;  4XJK B;  1AUI B;  1H8B A;  3FE9 A;  1YVL A;  5GQQ C;  2M1K B;  2LP2 A;  2K7C A;  3OX6 A;  3SG3 A;  1CFD A;  1QV1 A;  3CDN A;  1K93 D;  1XFZ O;  1TCO B;  2BE6 A;  2LVI A;  4C0J A;  2GGM A;  3C1V A;  3QRX A;  4ORA B;  1LA3 A;  5J3X A;  5HYD A;  1XFW O;  3EG5 B;  5I2L A;  1J7P A;  2M8U A;  2M97 A;  4OZD A;  1DTL A;  4QJ3 B;  1NX3 A;  1QAS A;  2YGU A;  3O78 A;  5I94 A;  3CZ2 A;  2WC6 A;  3S0G A;  3RM1 A;  3TUY C;  5G08 A;  3WHT B;  2LMV A;  1L2O C;  4KYN A;  5FI7 A;  2L98 A;  1B8R A;  2HET A;  1BOC A;  1C07 A;  2E30 A;  1KQM C;  1WLZ A;  4MN0 A;  3EK4 A;  4ORB B;  1TNQ A;  1DJX A;  3V2L A;  1F55 A;  4GGN A;  4HRH A;  5HL1 A;  3BOW A;  1S6J A;  1B8L A;  2JUL A;  3NSK A;  1NYA A;  5CSI A;  3EVV A;  3JVT B;  1YUR A;  1Y1A A;  2PMY A;  2LLS A;  1JSA A;  1SSE B;  3CZ1 A;  1RK9 A;  1JWD A;  3GK2 A;  1S6I A;  2ZKM X;  4CPV A;  1Y0V H;  1IGV A;  1KK7 Y;  1XFR A;  1EL4 A;  1ALW A;  2COL B;  2KYF A;  2KAY A;  3I5G B;  4JD9 A;  4JKT A;  1KSO A;  1RFJ A;  4PHJ A;  5BPJ A;  1OQP A;  1TNP A;  2PQL A;  2QDI A;  1YRT B;  4P2Y B;  1OOJ A;  3SG2 A;  2JTT A;  1W9Z A;  5PAL A;  4MLW A;  3L4A A;  3DVK A;  1SL9 A;  4CID A;  2H61 A;  4JQ0 D;  3PLF B;  1IWQ A;  1U5I A;  1QJT A;  1YUU A;  2WCK A;  2GTE A;  3L4L A;  1N2D A;  1CDP A;  2FOT A;  2B1U A;  4CLN A;  4ETO A;  3ZNI A;  1BU3 A;  1MXL C;  3DF0 B;  3CAB A;  1K9P A;  3BYA A;  2NCO A;  1GGZ A;  2WCH A;  1CNP A;  3NGV A;  2MJW B;  3D77 A;  4YGE B;  3TUY B;  2MBX A;  1DF0 A;  2LUX A;  4OV2 A;  4DRW A;  1A75 A;  1L2O B;  3JTD C;  3R72 A;  1YVH A;  2SCP A;  3DYE A;  5DKR A;  1OOF A;  2I7A A;  2WND A;  3ICB A;  3PM8 A;  3CR4 X; 
#chains in the Genus database with same CATH homology
 2SAS A;  1YUT A;  4PHN A;  5HKW A;  1SCM C;  1M45 A;  4YGB B;  2Y1M A;  5FYX A;  4XJK A;  2LM5 A;  1F4O A;  1CTR A;  3CTN A;  1PRW A;  2WC8 A;  5AAN A;  2KDH A;  2JPT A;  3FIA A;  3O2P A;  4U8D A;  4NDD A;  4MBE A;  1SK6 D;  3KHE A;  2LNK A;  3TS5 C;  4AOM A;  1DGV A;  2CTN A;  4YI9 A;  1DMO A;  1IQ5 A;  1WLM A;  2LAN A;  2M7N A;  2WOS A;  4N1F A;  1WY9 A;  1BOD A;  2M49 B;  1N65 A;  3FS7 A;  3DVE A;  2KSP A;  2KNE A;  2PAS A;  2D8N A;  3DVM A;  2M9G A;  1K8U A;  1HT9 A;  1XFU O;  2K61 A;  2BCB A;  2KBI A;  3IQQ A;  4ZCU A;  2V53 A;  2L2E A;  2BCA A;  4MRY A;  1UHI A;  3K21 A;  1DJG A;  1ODB A;  1LIN A;  5CSN A;  4PDZ A;  1EG3 A;  1MWN A;  4I5J A;  4BY4 A;  1WRL A;  3JTD B;  5I2Q A;  1BG1 A;  4YGA A;  2KGB C;  1B7T Z;  3VRN A;  1IJ5 A;  1ZMZ A;  2CNP A;  5K89 A;  2L50 A;  4I5N B;  2JNF A;  4Q04 A;  2KOT A;  1XO5 A;  3SG4 A;  1YTZ C;  3EVR A;  4GBA A;  2BEC A;  1DJW A;  1KWO C;  1K9K A;  2BL0 C;  1PUL A;  1XFV O;  3KF9 A;  1SNL A;  4NDB A;  1V1F A;  5KU1 A;  2Y1N A;  1IQ3 A;  3O6B A;  1Q80 A;  3TS5 B;  1OMD A;  3DF0 A;  3MSE B;  4HRE E;  4R1E A;  1PSB A;  1QTX A;  3NSI A;  3VRQ A;  1JBA A;  2M3W A;  4WRI A;  4OKH A;  1XFY O;  4USL A;  1J7R A;  1OZS A;  1KCY A;  3WNX B;  1BT6 A;  1E8A A;  1F54 A;  1YX8 A;  1PVA A;  3SJS A;  3HCM A;  2OS8 C;  4QJ5 B;  2G9B A;  2O5G A;  1QX7 A;  2BBN A;  2M0R A;  1LA0 A;  3DD4 A;  1UWO A;  2VRG A;  2FCD A;  4PE4 A;  3H4S E;  1RTP 1;  3ZWH A;  1NX1 A;  1ZOT B;  1R2U A;  1K95 A;  3AKB A;  1SMG A;  2O60 A;  1J7Q A;  1CLL A;  3OB2 B;  2KAV A;  1QIW A;  1SYM A;  1UUS A;  2M29 A;  1CFP A;  1QAT A;  1OMV A;  3LLE A;  1Y1X A;  3OB1 B;  1JF0 A;  2WCF A;  2WOR A;  2GV5 A;  1KWO B;  1NP8 A;  2R2I A;  1OZO A;  1BJF A;  3TZ1 A;  4DS7 A;  1QS7 A;  4A4C A;  2HQW A;  2E6W A;  2OTG C;  2CT9 A;  4N1G A;  2JZI A;  1PSR A;  1TN4 A;  3SG7 A;  1QLS A;  1RJV A;  4M2O A;  1NIW A;  4MEW A;  2FJU B;  2F2O A;  2ZNE A;  2ISD A;  1CDM A;  1IKU A;  1X02 A;  1SKT A;  5AEQ A;  2TN4 A;  2P6B B;  4D1E A;  4F0Z B;  2LLT A;  2GGZ A;  1CDL A;  1TOP A;  2LCP A;  3O4Y A;  1WRZ A;  2PAL A;  2KHN A;  3GOF A;  1EJ3 A;  4YBH B;  2I94 A;  2JQ6 A;  2EHB A;  2JOJ A;  3CGA A;  1JFJ A;  2OS8 B;  5I8N A;  1CM4 A;  1IG5 A;  2PSR A;  3IF7 A;  1YX7 A;  1DT7 B;  1CB1 A;  2LHI A;  1S36 A;  1KQM B;  4DIR A;  4GFT A;  2LMT A;  1S3P A;  1TNX A;  2F33 A;  4MSP A;  3TDZ A;  3BUW B;  3TDU A;  4QJ4 B;  2KI6 C;  2NXQ A;  3KEV A;  1MF8 B;  4YRU A;  1GGW A;  1B8C A;  1BMO A;  5HLV A;  2Q91 A;  4PE0 A;  4P5O E;  5HKZ A;  1A29 A;  2DOQ A;  1K90 D;  2JT8 A;  4TNC A;  3VRR A;  3NSO A;  1QV0 A;  1TRF A;  2KAX A;  1YRU B;  1NSH A;  1UP5 A;  2LVV A;  5CSJ A;  1LXF C;  3CWG A;  2LHL A;  5D7F A;  1KK8 C;  2K0J A;  2KI6 D;  1M39 A;  4GGF C;  3BQ3 A;  1SW8 A;  1AP4 A;  4YI8 A;  3SG6 A;  3BUM B;  2OTG B;  1L7Z A;  1CM1 A;  2BCX A;  2JWW A;  2ZN8 A;  3AKA A;  5HLO A;  1SY9 A;  1BR4 B;  2L4H A;  2MHH A;  2F2P A;  3LK0 A;  1HQV A;  2LV7 A;  3I5I C;  5CPV A;  5AXI A;  5D69 A;  3I5H C;  3BOW B;  1NCY A;  2LP3 A;  2MLF C;  2Q4U A;  2HPS A;  1NX0 A;  1GQM A;  1KFU S;  1CFC A;  1MUX A;  1A4P A;  1J1E A;  1XVJ A;  1AJ5 A;  3BUN B;  5KTY A;  1FI5 A;  1M46 A;  3EK7 A;  1B7T Y;  2PVB A;  2WCB A;  1QX5 B;  3D0Y B;  4NQG A;  1UHJ A;  1AJ4 A;  1G33 A;  1XK4 C;  4YGC B;  3VRO A;  4WQ2 A;  5DKQ A;  1B9A A;  1SCM B;  5KSZ A;  3SG5 A;  2ZRS A;  1OMR A;  1JUO A;  1F4Q A;  2F8P A;  2JNX A;  1M31 A;  3FWB A;  4I5L B;  1BLQ A;  4AQJ A;  2KQY A;  1XFX O;  1FBV A;  2L51 A;  3PN7 C;  1PVB A;  1KFU L;  1NUB A;  3EVU A;  1FI6 A;  2NLN A;  3OX5 A;  1NCX A;  1ZUZ A;  2FCE A;  5TNC A;  1F8H A;  2MAZ A;  2KFF A;  2WCE A;  5HKY A;  3EKJ A;  4HRG A;  1G8I A;  2KYC A;  1ALV A;  1J55 A;  1DF0 B;  1JFK A;  1A75 B;  1SBJ A;  1UHH A;  1WDC C;  3CLN A;  3PAL A;  5IBW A;  1CKK A;  1KFX L;  1AHR A;  1ZFS A;  1JF2 A;  1SPY A;  2JC2 A;  3LCP C;  3LK1 A;  3EKH A;  3AAK A;  4YGD B;  4BY5 A;  1OSA A;  3I5H B;  1GJY A;  2JT0 A;  1XA5 A;  1C7V A;  4GUK A;  3EK8 A;  4C0K A;  3GK1 A;  1NWD A;  1JC2 A;  2LVK A;  2ZRT A;  1NCZ A;  4JPZ B;  1W7J B;  2BE4 A;  1LVC D;  2L0P A;  1F70 A;  3HX4 A;  1K94 A;  4OCI A;  5JJG A;  2NZ0 A;  2IS9 A;  2KFG A;  2A4J A;  2HF5 A;  3A4U B;  4HSZ A;  4DUQ A;  1EH2 A;  1IH0 A;  1NX2 A;  1K2H A;  3WHU B;  4IL1 A;  2EC6 C;  4ZCV A;  1AVS A;  1H4B A;  2BL0 B;  2LAP A;  4JWQ A;  2KI4 C;  1KSM A;  1FPW A;  3I5F C;  1G4Y R;  3GK4 X;  3PN7 B;  3E3R A;  2EGD A;  1CMG A;  1J1D A;  1QXP A;  2CXJ A;  1CLB A;  2KBM A;  1F71 A;  1SRA A;  5AFP A;  2L4I A;  1FW4 A;  1A2X A;  3A8R A;  1SCV A;  1QIV A;  4L9M A;  1C7W A;  3OHM B;  2JXL A;  2Y5I A;  1CFF A;  2ZFD A;  4GAO A;  4MVF A;  1K9U A;  1WDC B;  4GPL B;  2LE9 B;  2M1U A;  1KQV A;  2MA2 A;  2CCM A;  4N5X A;  1B47 A;  4M2P A;  2CBL A;  2G2B A;  4FQO A;  1J7O A;  2LMU A;  3D0Y A;  2JU0 A;  1R6P A;  1KK7 Z;  5I2O A;  2JT3 A;  4A4B A;  1DVI A;  1REC A;  2NCP A;  2OPO A;  4MRX A;  1UUR A;  3D10 A;  1TTX A;  1DGU A;  1V1G A;  4PCW A;  1UHK A;  1A03 A;  2LVJ A;  3F45 A;  1MR8 A;  2I2R E;  1CMF A;  4PHK A;  4E68 A;  2K2F A;  1B4C A;  4CFQ A;  1MQ1 A;  2H61 C;  2BKH B;  1RWY A;  2KGR A;  1SL8 A;  4GGF A;  4PE7 A;  2EC6 B;  3BXK A;  3WXA A;  2L5X B;  2F3Y A;  2K8M B;  1N0Y A;  5B8I B;  1SR6 C;  2KI4 B;  1YUS A;  3OP0 A;  1DJH A;  1W7I B;  3I5F B;  2M7L A;  3SIA A;  1FF1 A;  1S26 D;  1QX2 A;  1K96 A;  2QPT A;  5ER4 X;  2KQ6 A;  3LL8 B;  1M63 B;  1QVI Y;  2F3Z A;  2I18 A;  3PSR A;  2HQ8 A;  1TNW A;  2ZND A;  4MZL A;  4AQI A;  4CFR A;  2QAC A;  1D1O A;  4ICB A;  1QVI Z;  4MZK A;  1RRO A;  1CLM A;  3NXA A;  1EG4 A;  4PAL A;  5DKN A;  2BBM A;  4WQ3 A;  3PFV A;  2PRU A;  2AAO A;  1Y6W A;  3IQO A;  2KFH A;  1AK8 A;  1DJZ A;  3M0W A;  1LKJ A;  1IRJ A;  1XK4 A;  1ZAC A;  2JXC A;  4OVN F;  4PE1 A;  1PAL A;  3BUX B;  1EXR A;  5AER A;  4C0L A;  2K7B A;  1CDN A;  1S5G Y;  1NPQ A;  1KFX S;  5F6T A;  1QLK A;  3KPX A;  1OE9 B;  1S5G Z;  2LUC A;  1TCF A;  1UHN A;  1MHO A;  2MRD A;  3CS1 A;  5ER5 A;  2K2A A;  4M2Q A;  2JTZ A;  4XYN A;  1SL7 A;  1Y1U A;  2LLU A;  2MLE C;  4ORC B;  2RGI A;  1U5I B;  4OR9 B;  4DCK A;  1BF5 A;  3PAT A;  2BKI B;  4NDC A;  3RLZ A;  1SR6 B;  1PK0 D;  3FWC A;  3KO0 A;  1B1G A;  3BUO B;  3DVJ A;  1S1E A;  3TDI A;  1KK8 B;  4I5K A;  3SIB A;  4PHM A;  2AMI A;  4FTG A;  2H2K A;  1MXE A;  2K7O A;  1VRK A;  2AUC A;  2K7D A;  3JVT C;  3CR2 A;  4MZJ A;  1DJI A;  3VRP A;  1IJ6 A;  3VGO A;  1DJY A;  3CZT X;  3I5I B;  3I5G C;  1WRK A;  3CR5 X;  5JOL A;  4UPG A;  5CSF A;  1S6C A;  2Y4Q A;  1BR1 B;  2JRF A;  3NSL A;  2ZN9 A;  1TIZ A;  1XYD A;  3AAJ A;  4GNK B;  2LC5 A;  1YR5 A;  4XJK B;  1AUI B;  1H8B A;  1YVL A;  5GQQ C;  2M1K B;  2LP2 A;  2K7C A;  3OX6 A;  3SG3 A;  1CFD A;  1QV1 A;  1K93 D;  1XFZ O;  1TCO B;  2BE6 A;  2LVI A;  4C0J A;  2GGM A;  3C1V A;  3QRX A;  4ORA B;  1LA3 A;  5J3X A;  5HYD A;  1XFW O;  5I2L A;  1J7P A;  2M8U A;  2M97 A;  1DTL A;  4QJ3 B;  1NX3 A;  1QAS A;  3O78 A;  3RM1 A;  3TUY C;  5G08 A;  3WHT B;  2LMV A;  1L2O C;  2L98 A;  1B8R A;  2HET A;  1BOC A;  1C07 A;  2E30 A;  1KQM C;  1WLZ A;  4MN0 A;  3EK4 A;  4ORB B;  1TNQ A;  1DJX A;  1F55 A;  4GGN A;  4HRH A;  3BOW A;  1S6J A;  1B8L A;  2JUL A;  3NSK A;  1NYA A;  5CSI A;  3EVV A;  3JVT B;  1YUR A;  1Y1A A;  2PMY A;  2LLS A;  1JSA A;  1RK9 A;  1JWD A;  3GK2 A;  1S6I A;  2ZKM X;  4CPV A;  1Y0V H;  1IGV A;  1KK7 Y;  2COL B;  1EL4 A;  1ALW A;  2KYF A;  3I5G B;  2KAY A;  4PHJ A;  1KSO A;  1RFJ A;  5BPJ A;  1OQP A;  1TNP A;  1YRT B;  4P2Y B;  1OOJ A;  3SG2 A;  2JTT A;  5PAL A;  4MLW A;  3DVK A;  1SL9 A;  4CID A;  2H61 A;  4JQ0 D;  3PLF B;  1IWQ A;  1U5I A;  1QJT A;  1YUU A;  1N2D A;  1CDP A;  2FOT A;  2B1U A;  4CLN A;  4ETO A;  3ZNI A;  1BU3 A;  1MXL C;  3DF0 B;  1K9P A;  3BYA A;  2NCO A;  1GGZ A;  1CNP A;  2MJW B;  4YGE B;  3TUY B;  2MBX A;  1DF0 A;  2LUX A;  4OV2 A;  4DRW A;  1A75 A;  1L2O B;  3JTD C;  1YVH A;  2SCP A;  5DKR A;  2I7A A;  2WND A;  3ICB A;  3PM8 A;  3CR4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...