1JFKA

Minimum energy representative structure of a calcium bound ef-hand protein from entamoeba histolytica
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
publication title NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Metal binding protein
total genus 35
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfkA02
1XYDA 2ZN9A 2IS9A 4JPZB 4P5OE 1PVAA 4QJ3B 3MSEB 2JWWA 1SL8A 3I5HC 3BUMB 4N5XA 2ZRSA 3JTDB 4NQGA 1WLMA 3VROA 1RECA 1A4PA 1WRLA 2FJUB 2WCEA 1QVIY 5I2QA 1K8UA 2WOSA 1UHHA 3H4SE 3CR2A 2OS8C 3OB2B 1S36A 2KNEA 3PALA 2LUXA 1A29A 1NUBA 3RM1A 4I5NB 2WORA 1NCZA 2HQWA 1DJZA 5CSNA 5TNCA 2ISDA 4AOMA 2F2OA 4BY4A 1DGUA 5D7FA 2DOQA 1KWOC 4OR9B 2K2AA 1WY9A 1QATA 1DT7B 1XFZO 1GGZA 1AVSA 3K21A 5I8NA 1L2OC 2G2BA 1RROA 1KSOA 1W7IB 1NP8A 3GK2A 4OKHA 2KFFA 4XYNA 1SL7A 1TCFA 2M8UA 2PMYA 1U5IB 1OZSA 1PVBA 2KOTA 1ALVA 2JT8A 2JOJA 2M49B 1AUIB 3FS7A 1NPQA 1Y6WA 3LK1A 4Q04A 4PHNA 3PM8A 1WRKA 2F2PA 2K7CA 1K95A 5PALA 1JF0A 1BR1B 4JQ0D 4D1EA 1XFYO 4PE0A 2JPTA 2LM5A 4MVFA 2BBMA 3SG3A 3A8RA 1SPYA 5AFPA 1CFDA 3BUOB 2K7OA 4I5LB 3VRPA 1B7TY 1TIZA 1H8BA 3FWCA 1TNXA 4OVNF 1FBVA 2L4HA 3AAJA 5CSFA 1QJTA 3WHUB 1S1EA 1K9KA 1YUUA 4MN0A 1ZFSA 1F4OA 4YGCB 1BG1A 3VGOA 3TZ1A 1S5GZ 2Y1NA 2ZN8A 2ZNEA 2M3WA 4ETOA 1UWOA 1DF0A 1UUSA 3SG5A 1IQ3A 2K8MB 4YRUA 1AK8A 1QIVA 3SIBA 2BECA 4HSZA 4MZJA 4YBHB 1TN4A 1FF1A 4OV2A 5HKWA 2KGRA 3EK7A 2I18A 2L51A 4GFTA 1FI5A 1QASA 2F8PA 2TN4A 5AEQA 1CMGA 1S6JA 3O4YA 2L50A 2L4IA 3AKAA 1C7VA 1FI6A 1A75B 4P2YB 1YVLA 1S6CA 1EL4A 3CLNA 1NX2A 1UP5A 1PRWA 2CTNA 1DGVA 4AQJA 2MBXA 3BQ3A 1B47A 1LINA 2K2FA 2LE9B 2LHLA 1KK8C 3EVVA 1NSHA 2E30A 3I5GB 4CFRA 2JU0A 1SR6C 4DRWA 3NXAA 1S26D 2M7LA 2CXJA 3PN7B 2BKIB 2KBIA 4UPGA 4CIDA 1TCOB 1C7WA 2M1UA 2JXCA 4WRIA 3KF9A 1VRKA 1IGVA 1A03A 2M9GA 4HREE 1SKTA 4M2PA 5DKQA 3GOFA 2HETA 1S6IA 4GGFC 2BL0B 2K7BA 2G9BA 3TDIA 1IKUA 1QXPA 1KQMB 3EK4A 4GBAA 1IWQA 4MRXA 2KI4C 1UHJA 1UHNA 4DUQA 3LCPC 3O78A 1IJ6A 1G8IA 1OMDA 4YI8A 1KFXL 1A2XA 1NCXA 1X02A 1CFCA 2MHHA 2LLSA 4NDDA 1TNPA 1KSMA 1TTXA 2PSRA 2EGDA 1S3PA 1JUOA 2Y4QA 2MJWB 1J1EA 2EC6C 1KFUL 1IRJA 2PRUA 3BOWB 2NLNA 1NX3A 1DJYA 1FW4A 4PHKA 5HLOA 1K93D 5JJGA 3TUYC 1LKJA 1CDMA 1K9PA 2KAXA 3JVTB 3O6BA 1XFUO 3OB1B 2LP2A 3EK8A 3OX6A 2D8NA 3CS1A 1YX7A 1Y1XA 2K61A 1BF5A 1J55A 1R2UA 5KTYA 3CR5X 2LUCA 1CFPA 3NSKA 2O5GA 2M1KB 2KYCA 1M46A 1TOPA 1K96A 1YURA 3TS5C 2LC5A 3DVJA 1MR8A 2GGZA 1BT6A 1F8HA 1K9UA 3M0WA 2I2RE 1XO5A 1DJWA 3I5IB 2KAVA 4XJKB 2HQ8A 3CZTX 3DVMA 3D0YB 3I5FB 1GQMA 5HYDA 1AHRA 1S5GY 1JFJA 1UHIA 1PULA 1QIWA 2JXLA 2WNDA 1JSAA 3HX4A 1SRAA 2KQ6A 4YI9A 1JFKA 1WRZA 1SCMC 1K90D 3KEVA 1AJ4A 2AUCA 1ZMZA 2Y1MA 1JBAA 2LP3A 3D10A 1CLMA 2H61C 4NDBA 2PALA 1KK7Z 2LCPA 2KSPA 4JWQA 4PE1A 2BCAA 3C1VA 1SL9A 2JTZA 3CTNA 3RLZA 2LANA 5B8IB 3VRQA 4OCIA 5GQQC 5D69A 3TDUA 3BXKA 4HRHA 4GNKB 4NDCA 2LAPA 5CSIA 1DTLA 4GAOA 3PATA 4GUKA 4BY5A 3ZWHA 3I5HB 2MLFC 3GK4X 2FOTA 2I94A 1CM1A 2KBMA 1QVIZ 2Y5IA 1J7PA 2OS8B 1CNPA 1CTRA 1MUXA 3EVRA 3DVEA 4ORBB 2KI6C 2NZ0A 4E68A 1ODBA 1BU3A 1JF2A 2OTGC 3FIAA 1XA5A 1IQ5A 4GGFA 1Y1AA 1BODA 2CT9A 1QLKA 1WDCC 1BLQA 1KWOB 2ZFDA 1J1DA 1YRUB 3IQQA 4ICBA 4ZCVA 1G4YR 1K94A 4C0KA 4C0JA 2MAZA 4YGDB 1EG3A 1L2OB 4A4CA 4CLNA 2MLEC 1HT9A 2ZRTA 1IH0A 1OOJA 2LVJA 4YGBB 2LHIA 1F71A 1SY9A 1L7ZA 2AMIA 2LMVA 2L0PA 2AAOA 3IQOA 3KPXA 1NIWA 1SW8A 2COLB 3JTDC 4YGAA 1CDPA 1YUSA 5CSJA 4CPVA 4PE4A 1ZOTB 2I7AA 1U5IA 1IJ5A 2ZKMX 3LL8B 1CM4A 1MWNA 2F33A 2KI6D 2E6WA 1SBJA 2CCMA 2BE4A 1QV0A 1B4CA 2F3YA 4FTGA 1CLLA 2K7DA 4DCKA 1D1OA 1M31A 3BYAA 2FCEA 2LMTA 2LMUA 1OMVA 4DS7A 4A4BA 1SYMA 5KU1A 2FCDA 3WHTB 1NX1A 1G33A 1CKKA 1EG4A 3TDZA 1B7TZ 1B9AA 2MRDA 4GGNA 1J7QA 1DJHA 1LXFC 3EKJA 1TNQA 2KFGA 3HCMA 1PSBA 1DMOA 4PHJA 3NSIA 1B8LA 3IF7A 3LLEA 1N2DA 3VRRA 3DVKA 1TNWA 2JNXA 3EKHA 1CDLA 2CNPA 3SG4A 2JC2A 2M0RA 1YX8A 2H2KA 2JT0A 4PE7A 1QX5B 1Y1UA 2PASA 1PALA 1KFXS 1KK7Y 1V1FA 4L9MA 2B1UA 1LA0A 3SIAA 2O60A 3NSLA 1QX7A 5K89A 1NYAA 1QLSA 1DJIA 2NCOA 2R2IA 4USLA 2JZIA 1CB1A 5JOLA 1B8RA 1J7OA 1A75A 2JNFA 2JT3A 1KFUS 2H61A 4YGEB 5G08A 3SG7A 2F3ZA 1B8CA 2Q4UA 1QX2A 1QV1A 1KK8B 2LV7A 2BCBA 2ZNDA 1SR6B 2NCPA 3KO0A 3WNXB 3ZNIA 1YRTB 1Y0VH 4N1FA 4PDZA 2BE6A 2WC8A 4CFQA 1DF0B 1HQVA 1MHOA 1AP4A 1H4BA 3E3RA 1B1GA 4ORCB 1SCVA 3CGAA 2JRFA 5FYXA 2Q91A 1F4QA 2KQYA 1R6PA 5I2LA 3QRXA 2SASA 1XK4A 1EJ3A 2HF5A 2OPOA 1GJYA 3LK0A 4TNCA 2KI4B 1AJ5A 1IG5A 4U8DA 3A4UB 4ZCUA 4FQOA 4PHMA 3NSOA 2GGMA 3DF0A 1JC2A 1QS7A 1KQVA 5DKNA 2BKHB 1XFXO 2L98A 3I5GC 1W7JB 2WCFA 1XFWO 3SG2A 1MXEA 1V1GA 1ZACA 2EC6B 2L5XB 2LVIA 1ZUZA 3AAKA 2K0JA 3DD4A 3PN7C 5HKYA 1CLBA 2A4JA 5KSZA 1F54A 4MZLA 5CPVA 2KHNA 2LVVA 3PLFB 4PALA 3WXAA 2V53A 2EHBA 1JWDA 3BOWA 2QPTA 3TUYB 1DJXA 1DVIA 2QACA 1N0YA 2L2EA 3GK1A 1XK4C 5AXIA 2BL0C 4M2QA 1FPWA 3SJSA 5BPJA 1KQMC 1PSRA 1M63B 3PSRA 1QTXA 5AERA 2LVKA 3TS5B 1GGWA 2M97A 2PVBA 4HRGA 5HKZA 2LNKA 3SG6A 1E8AA 1RFJA 1N65A 1OE9B 2KDHA 4QJ4B 4MBEA 1DJGA 2JQ6A 4MLWA 3CR4X 1RK9A 1NX0A 4M2OA 5J3XA 5AANA 1C07A 1CMFA 1YUTA 4XJKA 1SK6D 3D0YA 4PCWA 4C0LA 1EH2A 1EXRA 2NXQA 2KAYA 2KGBC 3OX5A 1MQ1A 4I5JA 4MSPA 1PK0D 2WCBA 2VRGA 1SCMB 5DKRA 3JVTC 1OQPA 1RWYA 2LLTA 4IL1A 3BUNB 2KFHA 5I2OA 1YR5A 1SNLA 1XFVO 1UHKA 4ORAB 2BBNA 1OSAA 1F70A 1M45A 2JTTA 2MA2A 2RGIA 3VRNA 3F45A 2GV5A 4MRYA 1LVCD 4I5KA 2HPSA 2SCPA 2M7NA 4AQIA 3EVUA 5ER5A 1CFFA 1K2HA 4DIRA 1NCYA 3PFVA 3I5IC 4GPLB 3ICBA 1OZOA 3FWBA 1UURA 1WLZA 3I5FC 4MEWA 1XVJA 2P6BB 1BOCA 4F0ZB 2M29A 1MXLC 4WQ3A 1LA3A 3O2PA 4MZKA 1RJVA 1KCYA 1NWDA 1RTP1 3AKBA 2JULA 5F6TA 1CDNA 1Q80A 1BMOA 3OHMB 5ER4X 1J7RA 3BUXB 4QJ5B 4R1EA 3KHEA 1TRFA 2BCXA 2LLUA 1F55A 3DF0B 1YTZC 1BR4B 2KYFA 4N1GA 3CWGA 2OTGB 5HLVA 1OMRA 3BUWB 1BJFA 2CBLA 3OP0A 5IBWA 1WDCB 1YVHA 1M39A 1MF8B 1SMGA 4WQ2A 1ALWA
chains in the Genus database with same CATH superfamily
1XYDA 2ZN9A 2IS9A 4JPZB 4P5OE 1PVAA 4QJ3B 3MSEB 2JWWA 1SL8A 3I5HC 3BUMB 4N5XA 2ZRSA 3IVTA 3JTDB 4NQGA 1WLMA 3VROA 1RECA 1A4PA 1WRLA 2FJUB 2WCEA 1QVIY 5I2QA 1K8UA 3O4XA 2WOSA 1UHHA 3H4SE 3CR2A 2OS8C 3OB2B 1S36A 2KNEA 3PALA 2LUXA 1A29A 1NUBA 3DYEA 3RM1A 4I5NB 2WORA 1NCZA 2HQWA 1DJZA 3Q8IA 3S0GA 5CSNA 5TNCA 2FJYA 2ISDA 4AOMA 2F2OA 1TWOA 4BY4A 1DGUA 5D7FA 2DOQA 1KWOC 4OR9B 1C3YA 2K2AA 1WY9A 1QATA 3S0DA 1XFZO 1DT7B 1GGZA 1AVSA 3K21A 3SS3A 5I8NA 1LS8A 1L2OC 1SSEB 2G2BA 2WC6A 1RROA 1KSOA 1W7IB 1NP8A 3GK2A 4OKHA 2KFFA 4XYNA 3V2LA 1SL7A 1TCFA 2M8UA 3BFHA 2PMYA 1U5IB 1OZSA 1PVBA 2KOTA 1ALVA 2JT8A 2JOJA 2M49B 1AUIB 4FQTA 3SS4A 3FS7A 1NPQA 1Y6WA 3LK1A 4Q04A 4PHNA 3PM8A 1WRKA 2F2PA 2K7CA 1K95A 5PALA 1JF0A 1BR1B 2L5YA 4JQ0D 4D1EA 3D75A 1XFYO 4PE0A 2JPTA 2LM5A 4MVFA 2WC5A 2BBMA 2K60A 2KPHA 3SG3A 3A8RA 1SPYA 2QEOA 5AFPA 1CFDA 3BUOB 2K7OA 5FI7A 4I5LB 3VRPA 1B7TY 1TIZA 1H8BA 3FWCA 4JKTA 3L4LA 1TNXA 4OVNF 1FBVA 2L4HA 3AAJA 5CSFA 1QJTA 3WHUB 1S1EA 1K9KA 1YUUA 4MN0A 1ZFSA 1F4OA 4YGCB 5D3OA 1BG1A 3VGOA 3TZ1A 1S5GZ 2Y1NA 2ZN8A 2ZNEA 2M3WA 4ETOA 1UWOA 1DF0A 1UUSA 3SG5A 1IQ3A 2K8MB 2QEHA 4YRUA 1QIVA 3SIBA 1AK8A 2BECA 4HSZA 4MZJA 4YBHB 1TN4A 4INXA 4OV2A 5HKWA 2L2CA 1FF1A 2KGRA 3EK7A 2I18A 2L51A 4GFTA 1FI5A 1QASA 2F8PA 2TN4A 3K1EA 5AEQA 1CMGA 1S6JA 2PQLA 3O4YA 2L50A 2L4IA 3AKAA 1C7VA 1FI6A 1A75B 4P2YB 1YVLA 1S6CA 1EL4A 3CLNA 1NX2A 1UP5A 1PRWA 2CTNA 1DGVA 3B7AA 4AQJA 2MBXA 3BQ3A 1B47A 1LINA 2K2FA 2LE9B 2LHLA 1KK8C 3EVVA 1NSHA 2E30A 3I5GB 4CFRA 2JU0A 1SR6C 3B88A 4DRWA 3NXAA 3BFBA 3B87A 1S26D 2M7LA 2CXJA 3PN7B 2BKIB 2KBIA 3D77A 4UPGA 4CIDA 1TCOB 1C7WA 2M1UA 2JXCA 4WRIA 3KF9A 1VRKA 1IGVA 1A03A 2M9GA 4HREE 1SKTA 4M2PA 5FI6A 5DKQA 3CYZA 3GOFA 2HETA 1S6IA 4GGFC 2BL0B 2P71A 2K7BA 2WCKA 2G9BA 3TDIA 1IKUA 1QXPA 1KQMB 3EK4A 4GBAA 1IWQA 4MRXA 2KI4C 1UHJA 1UHNA 1DEKA 3CDNA 4DUQA 3LCPC 3O78A 1OOIX 1IJ6A 1G8IA 1OMDA 4YI8A 1KFXL 1A2XA 1NCXA 1X02A 1CFCA 2MHHA 2LLSA 4NDDA 1TNPA 1KSMA 2WCLA 1TTXA 2PSRA 3UO9A 2EGDA 1S3PA 1JUOA 2Y4QA 3DXLA 2MJWB 1J1EA 2EC6C 1KFUL 3FE6A 3QMEA 1IRJA 2PRUA 3BOWB 2NLNA 1NX3A 1DJYA 2BAPA 3L47A 1FW4A 4PHKA 5HLOA 1K93D 5JJGA 3TUYC 1LKJA 1CDMA 1K9PA 2KAXA 3JVTB 2YGUA 3O6BA 2ERBA 1XFUO 3OB1B 1OOHA 2LP2A 3EK8A 3OX6A 2D8NA 3CS1A 1YX7A 1Y1XA 2K61A 1BF5A 1J55A 1R2UA 5KTYA 3CR5X 2LUCA 1CFPA 3NSKA 2O5GA 2M1KB 2KYCA 1M46A 1TOPA 1K96A 1YURA 3TS5C 2QEBA 2LC5A 3DVJA 1MR8A 2GGZA 1BT6A 3S0FA 1DC1A 1F8HA 1K9UA 3M0WA 2I2RE 1XO5A 1DJWA 3I5IB 2KAVA 4XJKB 2HQ8A 3CZTX 3DVMA 3D0YB 3VB1A 3I5FB 1GQMA 5HYDA 3EG5B 1AHRA 1S5GY 1JFJA 1UHIA 1PULA 1QIWA 2JXLA 2WNDA 1JSAA 2QEVA 3CZ0A 3HX4A 1SRAA 2KQ6A 4YI9A 1JFKA 3OBVA 1WRZA 1SCMC 1K90D 3KEVA 1AJ4A 2AUCA 4KYNA 1ZMZA 2Y1MA 5I94A 1JBAA 2LP3A 3D10A 1CLMA 2H61C 4NDBA 1GM0A 2PALA 1KK7Z 2LCPA 2KSPA 4JWQA 4PE1A 2BCAA 3C1VA 1SL9A 2JTZA 3CTNA 3R1PA 3RLZA 2LANA 5B8IB 1ORGA 3VRQA 3NHTA 4OCIA 5GQQC 5D69A 3TDUA 3BXKA 2BNXA 4HRHA 4GNKB 4NDCA 2LAPA 5CSIA 5EL2A 1DTLA 4GAOA 3PATA 4GUKA 4BY5A 3ZWHA 3I5HB 2MLFC 3GK4X 4OZDA 2FOTA 2I94A 1CM1A 2JPOA 2KBMA 1QVIZ 2Y5IA 1J7PA 4JD9A 5FI2A 2OS8B 1CNPA 1CTRA 1MUXA 3EVRA 3DVEA 4ORBB 2KI6C 2NZ0A 3L4AA 4E68A 1ODBA 4PT1A 1BU3A 1JF2A 2OTGC 3FIAA 1XA5A 2KLDA 1IQ5A 4GGFA 1Y1AA 1BODA 2CT9A 1QLKA 1WDCC 1BLQA 1KWOB 2ZFDA 1J1DA 1YRUB 3IQQA 4ICBA 4ZCVA 1G4YR 1K94A 4C0KA 4C0JA 2MAZA 4YGDB 2PYQA 1EG3A 1L2OB 4A4CA 4CLNA 2MLEC 1HT9A 2ZRTA 1IH0A 1OOJA 2LVJA 4YGBB 2LHIA 1F71A 1SY9A 1L7ZA 2WCJA 2AMIA 3D73A 2LMVA 2L0PA 2AAOA 3IQOA 3KPXA 1NIWA 1SW8A 2COLB 3JTDC 3OGNA 4YGAA 1CDPA 1YUSA 5CSJA 4CPVA 3BJHA 1ZOTB 2I7AA 1U5IA 1IJ5A 2ZKMX 3LL8B 1CM4A 4PE4A 1MWNA 2F33A 2KI6D 2E6WA 1SBJA 2CCMA 2BE4A 1QV0A 1B4CA 2F3YA 4FTGA 1CLLA 2K7DA 4DCKA 1D1OA 1M31A 3BYAA 2FCEA 2LMTA 2LMUA 1OW4A 3S0AA 1OMVA 4DS7A 4A4BA 3SS5A 1SYMA 1TUJA 2FCDA 3FE8A 5KU1A 3PM2A 3WHTB 1NX1A 1G33A 1DQEA 1CKKA 1EG4A 3TDZA 1B7TZ 1B9AA 2GTEA 2MRDA 4GGNA 1J7QA 1Z2CB 1DJHA 1LXFC 3EKJA 1TNQA 2KFGA 3HCMA 1PSBA 1DMOA 4PHJA 3NSIA 5HL1A 1B8LA 3R72A 3IF7A 3LLEA 3N7HA 1N2DA 3D76A 3VRRA 3DVKA 1TNWA 2JNXA 3EKHA 1CDLA 2CNPA 3SG4A 2JC2A 2M0RA 2WCMA 1C3ZA 1YX8A 2H2KA 2JT0A 4PE7A 1QX5B 1Y1UA 2PASA 1PALA 1KFXS 1KK7Y 3FE9A 1V1FA 4L9MA 2B1UA 1LA0A 3SIAA 1XFRA 2O60A 3NSLA 1QX7A 5K89A 1NYAA 1QLSA 1DJIA 2NCOA 2R2IA 4USLA 2JZIA 1CB1A 5JOLA 1B8RA 1J7OA 1A75A 2JNFA 2JT3A 1KFUS 2H61A 4YGEB 5G08A 3SG7A 2F3ZA 1B8CA 2Q4UA 1QX2A 1QV1A 1OOFA 1KK8B 2LV7A 2BCBA 2ZNDA 1SR6B 2NCPA 3KO0A 3WNXB 3ZNIA 1YRTB 1Y0VH 3CABA 4N1FA 4PDZA 2BE6A 1IIOA 2WC8A 3D78A 3S0BA 4CFQA 4INWA 2QDIA 1DF0B 1HQVA 1MHOA 1AP4A 1H4BA 3E3RA 1B1GA 4ORCB 1SCVA 3CGAA 2JRFA 3B6XA 5FYXA 2Q91A 1F4QA 2KQYA 1DELA 1R6PA 5I2LA 3QRXA 3S0EA 2SASA 1XK4A 1EJ3A 2HF5A 2OPOA 1GJYA 3LK0A 4TNCA 2KI4B 1AJ5A 1IG5A 4U8DA 3A4UB 4ZCUA 4FQOA 4PHMA 1OOGA 3NSOA 2GGMA 3DF0A 1JC2A 1QS7A 1KQVA 5DKNA 2BKHB 1XFXO 2L98A 3I5GC 1W7JB 2WCFA 1XFWO 3SG2A 1MXEA 1V1GA 3R1OA 1P28A 1ZACA 2EC6B 2L5XB 2LVIA 1ZUZA 3AAKA 2K0JA 3DD4A 3PN7C 5HKYA 1CLBA 2A4JA 5KSZA 1F54A 4MZLA 5CPVA 3UNWA 2KHNA 2LVVA 3PLFB 4PALA 1T14A 3WXAA 2V53A 2EHBA 3R1VA 1JWDA 3BOWA 2QPTA 3B86A 3TUYB 1DJXA 1DVIA 2QACA 1N0YA 3DZTA 2L2EA 5DICA 3GK1A 1XK4C 5AXIA 2WCHA 2BL0C 4M2QA 1FPWA 3DY9A 3SJSA 3NHIA 5BPJA 1KQMC 1PSRA 1M63B 3PSRA 1W9ZA 1QTXA 4F7FA 5AERA 2LVKA 3TS5B 1GGWA 2M97A 2PVBA 4HRGA 5HKZA 2LNKA 3SG6A 1E8AA 1RFJA 1N65A 1OE9B 2KDHA 2P70A 4QJ4B 4MBEA 1DJGA 2JQ6A 4MLWA 3CR4X 1RK9A 1NX0A 4M2OA 5J3XA 5AANA 1C07A 1CMFA 1YUTA 4XJKA 1SK6D 3D0YA 4PCWA 4C0LA 1EH2A 1EXRA 2NXQA 2KAYA 2KGBC 3OX5A 1MQ1A 4I5JA 4MSPA 1PK0D 2WCBA 2VRGA 1SCMB 5DKRA 3JVTC 1OQPA 1RWYA 2LLTA 1Z4HA 2KLEA 4IL1A 3BUNB 2KFHA 5I2OA 1YR5A 1SNLA 1XFVO 1UHKA 4ORAB 2BBNA 3BFAA 1OSAA 1F70A 1M45A 2JTTA 2MA2A 2RGIA 3VRNA 3F45A 2GV5A 3PJIA 4MRYA 1LVCD 4I5KA 2HPSA 2SCPA 2M7NA 4AQIA 3EVUA 5ER5A 1CFFA 1K2HA 4DIRA 1NCYA 1QWVA 3PFVA 3I5IC 4GPLB 3ICBA 1OZOA 3FWBA 1UURA 1WLZA 3I5FC 4MEWA 1XVJA 2P6BB 1BOCA 1TUZA 4F0ZB 2M29A 1MXLC 3CZ2A 4WQ3A 1LA3A 3O2PA 4MZKA 4IJ7A 1RJVA 1KCYA 3D74A 1NWDA 1RTP1 2H8VA 2JULA 3AKBA 5F6TA 1CDNA 1Q80A 1BMOA 3OHMB 5ER4X 1J7RA 3BUXB 4QJ5B 4R1EA 3KHEA 1TRFA 2BCXA 2LLUA 1F55A 3DF0B 1YTZC 1BR4B 2KYFA 4N1GA 3CWGA 3NGVA 3CZ1A 2OTGB 5HLVA 1OMRA 3BUWB 1BJFA 2CBLA 3OP0A 5IBWA 1WDCB 1YVHA 1M39A 1MF8B 1SMGA 4WQ2A 3RZSA 1ALWA
chains in the Genus database with same CATH topology
1XYDA 2ZN9A 2IS9A 4JPZB 4P5OE 1PVAA 4QJ3B 3MSEB 2JWWA 1SL8A 3I5HC 3BUMB 4N5XA 2ZRSA 3JTDB 4NQGA 1WLMA 3VROA 1RECA 1A4PA 1WRLA 2FJUB 2WCEA 1QVIY 5I2QA 1K8UA 2WOSA 1UHHA 3H4SE 3CR2A 2OS8C 3OB2B 1S36A 2KNEA 3PALA 2LUXA 1A29A 1NUBA 3RM1A 4I5NB 2WORA 1NCZA 2HQWA 1DJZA 5CSNA 5TNCA 2ISDA 4AOMA 2F2OA 4BY4A 1DGUA 5D7FA 2DOQA 1KWOC 4OR9B 2K2AA 1WY9A 1QATA 1DT7B 1XFZO 1GGZA 1AVSA 3K21A 5I8NA 1L2OC 2G2BA 1RROA 1KSOA 1W7IB 1NP8A 3GK2A 4OKHA 2KFFA 4XYNA 1SL7A 1TCFA 2M8UA 2PMYA 1U5IB 1OZSA 1PVBA 2KOTA 1ALVA 2JT8A 2JOJA 2M49B 1AUIB 3FS7A 1NPQA 1Y6WA 3LK1A 4Q04A 4PHNA 3PM8A 1WRKA 2F2PA 2K7CA 1K95A 5PALA 1JF0A 1BR1B 4JQ0D 4D1EA 1XFYO 4PE0A 2JPTA 2LM5A 4MVFA 2BBMA 3SG3A 3A8RA 1SPYA 5AFPA 1CFDA 3BUOB 2K7OA 4I5LB 3VRPA 1B7TY 1TIZA 1H8BA 3FWCA 1TNXA 4OVNF 1FBVA 2L4HA 3AAJA 5CSFA 1QJTA 3WHUB 1S1EA 1K9KA 1YUUA 4MN0A 1ZFSA 1F4OA 4YGCB 1BG1A 3VGOA 3TZ1A 1S5GZ 2Y1NA 2ZN8A 2ZNEA 2M3WA 4ETOA 1UWOA 1DF0A 1UUSA 3SG5A 1IQ3A 2K8MB 4YRUA 1AK8A 1QIVA 3SIBA 2BECA 4HSZA 4MZJA 4YBHB 1TN4A 1FF1A 4OV2A 5HKWA 2KGRA 3EK7A 2I18A 2L51A 4GFTA 1FI5A 1QASA 2F8PA 2TN4A 5AEQA 1CMGA 1S6JA 3O4YA 2L50A 2L4IA 3AKAA 1C7VA 1FI6A 1A75B 4P2YB 1YVLA 1S6CA 1EL4A 3CLNA 1NX2A 1UP5A 1PRWA 2CTNA 1DGVA 4AQJA 2MBXA 3BQ3A 1B47A 1LINA 2K2FA 2LE9B 2LHLA 1KK8C 3EVVA 1NSHA 2E30A 3I5GB 4CFRA 2JU0A 1SR6C 4DRWA 3NXAA 1S26D 2M7LA 2CXJA 3PN7B 2BKIB 2KBIA 4UPGA 4CIDA 1TCOB 1C7WA 2M1UA 2JXCA 4WRIA 3KF9A 1VRKA 1IGVA 1A03A 2M9GA 4HREE 1SKTA 4M2PA 5DKQA 3GOFA 2HETA 1S6IA 4GGFC 2BL0B 2K7BA 2G9BA 3TDIA 1IKUA 1QXPA 1KQMB 3EK4A 4GBAA 1IWQA 4MRXA 2KI4C 1UHJA 1UHNA 4DUQA 3LCPC 3O78A 1IJ6A 1G8IA 1OMDA 4YI8A 1KFXL 1A2XA 1NCXA 1X02A 1CFCA 2MHHA 2LLSA 4NDDA 1TNPA 1KSMA 1TTXA 2PSRA 2EGDA 1S3PA 1JUOA 2Y4QA 2MJWB 1J1EA 2EC6C 1KFUL 1IRJA 2PRUA 3BOWB 2NLNA 1NX3A 1DJYA 1FW4A 4PHKA 5HLOA 1K93D 5JJGA 3TUYC 1LKJA 1CDMA 1K9PA 2KAXA 3JVTB 3O6BA 1XFUO 3OB1B 2LP2A 3EK8A 3OX6A 2D8NA 3CS1A 1YX7A 1Y1XA 2K61A 1BF5A 1J55A 1R2UA 5KTYA 3CR5X 2LUCA 1CFPA 3NSKA 2O5GA 2M1KB 2KYCA 1M46A 1TOPA 1K96A 1YURA 3TS5C 2LC5A 3DVJA 1MR8A 2GGZA 1BT6A 1F8HA 1K9UA 3M0WA 2I2RE 1XO5A 1DJWA 3I5IB 2KAVA 4XJKB 2HQ8A 3CZTX 3DVMA 3D0YB 3I5FB 1GQMA 5HYDA 1AHRA 1S5GY 1JFJA 1UHIA 1PULA 1QIWA 2JXLA 2WNDA 1JSAA 3HX4A 1SRAA 2KQ6A 4YI9A 1JFKA 1WRZA 1SCMC 1K90D 3KEVA 1AJ4A 2AUCA 1ZMZA 2Y1MA 1JBAA 2LP3A 3D10A 1CLMA 2H61C 4NDBA 2PALA 1KK7Z 2LCPA 2KSPA 4JWQA 4PE1A 2BCAA 3C1VA 1SL9A 2JTZA 3CTNA 3RLZA 2LANA 5B8IB 3VRQA 4OCIA 5GQQC 5D69A 3TDUA 3BXKA 4HRHA 4GNKB 4NDCA 2LAPA 5CSIA 1DTLA 4GAOA 3PATA 4GUKA 4BY5A 3ZWHA 3I5HB 2MLFC 3GK4X 2FOTA 2I94A 1CM1A 2KBMA 1QVIZ 2Y5IA 1J7PA 2OS8B 1CNPA 1CTRA 1MUXA 3EVRA 3DVEA 4ORBB 2KI6C 2NZ0A 4E68A 1ODBA 1BU3A 1JF2A 2OTGC 3FIAA 1XA5A 1IQ5A 4GGFA 1Y1AA 1BODA 2CT9A 1QLKA 1WDCC 1BLQA 1KWOB 2ZFDA 1J1DA 1YRUB 3IQQA 4ICBA 4ZCVA 1G4YR 1K94A 4C0KA 4C0JA 2MAZA 4YGDB 1EG3A 1L2OB 4A4CA 4CLNA 2MLEC 1HT9A 2ZRTA 1IH0A 1OOJA 2LVJA 4YGBB 2LHIA 1F71A 1SY9A 1L7ZA 2AMIA 2LMVA 2L0PA 2AAOA 3IQOA 3KPXA 1NIWA 1SW8A 2COLB 3JTDC 4YGAA 1CDPA 1YUSA 5CSJA 4CPVA 4PE4A 1ZOTB 2I7AA 1U5IA 1IJ5A 2ZKMX 3LL8B 1CM4A 1MWNA 2F33A 2KI6D 2E6WA 1SBJA 2CCMA 2BE4A 1QV0A 1B4CA 2F3YA 4FTGA 1CLLA 2K7DA 4DCKA 1D1OA 1M31A 3BYAA 2FCEA 2LMTA 2LMUA 1OMVA 4DS7A 4A4BA 1SYMA 5KU1A 2FCDA 3WHTB 1NX1A 1G33A 1CKKA 1EG4A 3TDZA 1B7TZ 1B9AA 2MRDA 4GGNA 1J7QA 1DJHA 1LXFC 3EKJA 1TNQA 2KFGA 3HCMA 1PSBA 1DMOA 4PHJA 3NSIA 1B8LA 3IF7A 3LLEA 1N2DA 3VRRA 3DVKA 1TNWA 2JNXA 3EKHA 1CDLA 2CNPA 3SG4A 2JC2A 2M0RA 1YX8A 2H2KA 2JT0A 4PE7A 1QX5B 1Y1UA 2PASA 1PALA 1KFXS 1KK7Y 1V1FA 4L9MA 2B1UA 1LA0A 3SIAA 2O60A 3NSLA 1QX7A 5K89A 1NYAA 1QLSA 1DJIA 2NCOA 2R2IA 4USLA 2JZIA 1CB1A 5JOLA 1B8RA 1J7OA 1A75A 2JNFA 2JT3A 1KFUS 2H61A 4YGEB 5G08A 3SG7A 2F3ZA 1B8CA 2Q4UA 1QX2A 1QV1A 1KK8B 2LV7A 2BCBA 2ZNDA 1SR6B 2NCPA 3KO0A 3WNXB 3ZNIA 1YRTB 1Y0VH 4N1FA 4PDZA 2BE6A 2WC8A 4CFQA 1DF0B 1HQVA 1MHOA 1AP4A 1H4BA 3E3RA 1B1GA 4ORCB 1SCVA 3CGAA 2JRFA 5FYXA 2Q91A 1F4QA 2KQYA 1R6PA 5I2LA 3QRXA 2SASA 1XK4A 1EJ3A 2HF5A 2OPOA 1GJYA 3LK0A 4TNCA 2KI4B 1AJ5A 1IG5A 4U8DA 3A4UB 4ZCUA 4FQOA 4PHMA 3NSOA 2GGMA 3DF0A 1JC2A 1QS7A 1KQVA 5DKNA 2BKHB 1XFXO 2L98A 3I5GC 1W7JB 2WCFA 1XFWO 3SG2A 1MXEA 1V1GA 1ZACA 2EC6B 2L5XB 2LVIA 1ZUZA 3AAKA 2K0JA 3DD4A 3PN7C 5HKYA 1CLBA 2A4JA 5KSZA 1F54A 4MZLA 5CPVA 2KHNA 2LVVA 3PLFB 4PALA 3WXAA 2V53A 2EHBA 1JWDA 3BOWA 2QPTA 3TUYB 1DJXA 1DVIA 2QACA 1N0YA 2L2EA 3GK1A 1XK4C 5AXIA 2BL0C 4M2QA 1FPWA 3SJSA 5BPJA 1KQMC 1PSRA 1M63B 3PSRA 1QTXA 5AERA 2LVKA 3TS5B 1GGWA 2M97A 2PVBA 4HRGA 5HKZA 2LNKA 3SG6A 1E8AA 1RFJA 1N65A 1OE9B 2KDHA 4QJ4B 4MBEA 1DJGA 2JQ6A 4MLWA 3CR4X 1RK9A 1NX0A 4M2OA 5J3XA 5AANA 1C07A 1CMFA 1YUTA 4XJKA 1SK6D 3D0YA 4PCWA 4C0LA 1EH2A 1EXRA 2NXQA 2KAYA 2KGBC 3OX5A 1MQ1A 4I5JA 4MSPA 1PK0D 2WCBA 2VRGA 1SCMB 5DKRA 3JVTC 1OQPA 1RWYA 2LLTA 4IL1A 3BUNB 2KFHA 5I2OA 1YR5A 1SNLA 1XFVO 1UHKA 4ORAB 2BBNA 1OSAA 1F70A 1M45A 2JTTA 2MA2A 2RGIA 3VRNA 3F45A 2GV5A 4MRYA 1LVCD 4I5KA 2HPSA 2SCPA 2M7NA 4AQIA 3EVUA 5ER5A 1CFFA 1K2HA 4DIRA 1NCYA 3PFVA 3I5IC 4GPLB 3ICBA 1OZOA 3FWBA 1UURA 1WLZA 3I5FC 4MEWA 1XVJA 2P6BB 1BOCA 4F0ZB 2M29A 1MXLC 4WQ3A 1LA3A 3O2PA 4MZKA 1RJVA 1KCYA 1NWDA 1RTP1 3AKBA 2JULA 5F6TA 1CDNA 1Q80A 1BMOA 3OHMB 5ER4X 1J7RA 3BUXB 4QJ5B 4R1EA 3KHEA 1TRFA 2BCXA 2LLUA 1F55A 3DF0B 1YTZC 1BR4B 2KYFA 4N1GA 3CWGA 2OTGB 5HLVA 1OMRA 3BUWB 1BJFA 2CBLA 3OP0A 5IBWA 1WDCB 1YVHA 1M39A 1MF8B 1SMGA 4WQ2A 1ALWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XYD A;  2ZN9 A;  2IS9 A;  4JPZ B;  4P5O E;  1PVA A;  4QJ3 B;  3MSE B;  2JWW A;  1SL8 A;  3I5H C;  3BUM B;  4N5X A;  2ZRS A;  3JTD B;  4NQG A;  1WLM A;  3VRO A;  1REC A;  1A4P A;  1WRL A;  2FJU B;  2WCE A;  1QVI Y;  5I2Q A;  1K8U A;  2WOS A;  1UHH A;  3H4S E;  3CR2 A;  2OS8 C;  3OB2 B;  1S36 A;  2KNE A;  3PAL A;  2LUX A;  1A29 A;  1NUB A;  3RM1 A;  4I5N B;  2WOR A;  1NCZ A;  2HQW A;  1DJZ A;  5CSN A;  5TNC A;  2ISD A;  4AOM A;  2F2O A;  4BY4 A;  1DGU A;  5D7F A;  2DOQ A;  1KWO C;  4OR9 B;  2K2A A;  1WY9 A;  1QAT A;  1DT7 B;  1XFZ O;  1GGZ A;  1AVS A;  3K21 A;  5I8N A;  1L2O C;  2G2B A;  1RRO A;  1KSO A;  1W7I B;  1NP8 A;  3GK2 A;  4OKH A;  2KFF A;  4XYN A;  1SL7 A;  1TCF A;  2M8U A;  2PMY A;  1U5I B;  1OZS A;  1PVB A;  2KOT A;  1ALV A;  2JT8 A;  2JOJ A;  2M49 B;  1AUI B;  3FS7 A;  1NPQ A;  1Y6W A;  3LK1 A;  4Q04 A;  4PHN A;  3PM8 A;  1WRK A;  2F2P A;  2K7C A;  1K95 A;  5PAL A;  1JF0 A;  1BR1 B;  4JQ0 D;  4D1E A;  1XFY O;  4PE0 A;  2JPT A;  2LM5 A;  4MVF A;  2BBM A;  3SG3 A;  3A8R A;  1SPY A;  5AFP A;  1CFD A;  3BUO B;  2K7O A;  4I5L B;  3VRP A;  1B7T Y;  1TIZ A;  1H8B A;  3FWC A;  1TNX A;  4OVN F;  1FBV A;  2L4H A;  3AAJ A;  5CSF A;  1QJT A;  3WHU B;  1S1E A;  1K9K A;  1YUU A;  4MN0 A;  1ZFS A;  1F4O A;  4YGC B;  1BG1 A;  3VGO A;  3TZ1 A;  1S5G Z;  2Y1N A;  2ZN8 A;  2ZNE A;  2M3W A;  4ETO A;  1UWO A;  1DF0 A;  1UUS A;  3SG5 A;  1IQ3 A;  2K8M B;  4YRU A;  1AK8 A;  1QIV A;  3SIB A;  2BEC A;  4HSZ A;  4MZJ A;  4YBH B;  1TN4 A;  1FF1 A;  4OV2 A;  5HKW A;  2KGR A;  3EK7 A;  2I18 A;  2L51 A;  4GFT A;  1FI5 A;  1QAS A;  2F8P A;  2TN4 A;  5AEQ A;  1CMG A;  1S6J A;  3O4Y A;  2L50 A;  2L4I A;  3AKA A;  1C7V A;  1FI6 A;  1A75 B;  4P2Y B;  1YVL A;  1S6C A;  1EL4 A;  3CLN A;  1NX2 A;  1UP5 A;  1PRW A;  2CTN A;  1DGV A;  4AQJ A;  2MBX A;  3BQ3 A;  1B47 A;  1LIN A;  2K2F A;  2LE9 B;  2LHL A;  1KK8 C;  3EVV A;  1NSH A;  2E30 A;  3I5G B;  4CFR A;  2JU0 A;  1SR6 C;  4DRW A;  3NXA A;  1S26 D;  2M7L A;  2CXJ A;  3PN7 B;  2BKI B;  2KBI A;  4UPG A;  4CID A;  1TCO B;  1C7W A;  2M1U A;  2JXC A;  4WRI A;  3KF9 A;  1VRK A;  1IGV A;  1A03 A;  2M9G A;  4HRE E;  1SKT A;  4M2P A;  5DKQ A;  3GOF A;  2HET A;  1S6I A;  4GGF C;  2BL0 B;  2K7B A;  2G9B A;  3TDI A;  1IKU A;  1QXP A;  1KQM B;  3EK4 A;  4GBA A;  1IWQ A;  4MRX A;  2KI4 C;  1UHJ A;  1UHN A;  4DUQ A;  3LCP C;  3O78 A;  1IJ6 A;  1G8I A;  1OMD A;  4YI8 A;  1KFX L;  1A2X A;  1NCX A;  1X02 A;  1CFC A;  2MHH A;  2LLS A;  4NDD A;  1TNP A;  1KSM A;  1TTX A;  2PSR A;  2EGD A;  1S3P A;  1JUO A;  2Y4Q A;  2MJW B;  1J1E A;  2EC6 C;  1KFU L;  1IRJ A;  2PRU A;  3BOW B;  2NLN A;  1NX3 A;  1DJY A;  1FW4 A;  4PHK A;  5HLO A;  1K93 D;  5JJG A;  3TUY C;  1LKJ A;  1CDM A;  1K9P A;  2KAX A;  3JVT B;  3O6B A;  1XFU O;  3OB1 B;  2LP2 A;  3EK8 A;  3OX6 A;  2D8N A;  3CS1 A;  1YX7 A;  1Y1X A;  2K61 A;  1BF5 A;  1J55 A;  1R2U A;  5KTY A;  3CR5 X;  2LUC A;  1CFP A;  3NSK A;  2O5G A;  2M1K B;  2KYC A;  1M46 A;  1TOP A;  1K96 A;  1YUR A;  3TS5 C;  2LC5 A;  3DVJ A;  1MR8 A;  2GGZ A;  1BT6 A;  1F8H A;  1K9U A;  3M0W A;  2I2R E;  1XO5 A;  1DJW A;  3I5I B;  2KAV A;  4XJK B;  2HQ8 A;  3CZT X;  3DVM A;  3D0Y B;  3I5F B;  1GQM A;  5HYD A;  1AHR A;  1S5G Y;  1JFJ A;  1UHI A;  1PUL A;  1QIW A;  2JXL A;  2WND A;  1JSA A;  3HX4 A;  1SRA A;  2KQ6 A;  4YI9 A;  1JFK A;  1WRZ A;  1SCM C;  1K90 D;  3KEV A;  1AJ4 A;  2AUC A;  1ZMZ A;  2Y1M A;  1JBA A;  2LP3 A;  3D10 A;  1CLM A;  2H61 C;  4NDB A;  2PAL A;  1KK7 Z;  2LCP A;  2KSP A;  4JWQ A;  4PE1 A;  2BCA A;  3C1V A;  1SL9 A;  2JTZ A;  3CTN A;  3RLZ A;  2LAN A;  5B8I B;  3VRQ A;  4OCI A;  5GQQ C;  5D69 A;  3TDU A;  3BXK A;  4HRH A;  4GNK B;  4NDC A;  2LAP A;  5CSI A;  1DTL A;  4GAO A;  3PAT A;  4GUK A;  4BY5 A;  3ZWH A;  3I5H B;  2MLF C;  3GK4 X;  2FOT A;  2I94 A;  1CM1 A;  2KBM A;  1QVI Z;  2Y5I A;  1J7P A;  2OS8 B;  1CNP A;  1CTR A;  1MUX A;  3EVR A;  3DVE A;  4ORB B;  2KI6 C;  2NZ0 A;  4E68 A;  1ODB A;  1BU3 A;  1JF2 A;  2OTG C;  3FIA A;  1XA5 A;  1IQ5 A;  4GGF A;  1Y1A A;  1BOD A;  2CT9 A;  1QLK A;  1WDC C;  1BLQ A;  1KWO B;  2ZFD A;  1J1D A;  1YRU B;  3IQQ A;  4ICB A;  4ZCV A;  1G4Y R;  1K94 A;  4C0K A;  4C0J A;  2MAZ A;  4YGD B;  1EG3 A;  1L2O B;  4A4C A;  4CLN A;  2MLE C;  1HT9 A;  2ZRT A;  1IH0 A;  1OOJ A;  2LVJ A;  4YGB B;  2LHI A;  1F71 A;  1SY9 A;  1L7Z A;  2AMI A;  2LMV A;  2L0P A;  2AAO A;  3IQO A;  3KPX A;  1NIW A;  1SW8 A;  2COL B;  3JTD C;  4YGA A;  1CDP A;  1YUS A;  5CSJ A;  4CPV A;  4PE4 A;  1ZOT B;  2I7A A;  1U5I A;  1IJ5 A;  2ZKM X;  3LL8 B;  1CM4 A;  1MWN A;  2F33 A;  2KI6 D;  2E6W A;  1SBJ A;  2CCM A;  2BE4 A;  1QV0 A;  1B4C A;  2F3Y A;  4FTG A;  1CLL A;  2K7D A;  4DCK A;  1D1O A;  1M31 A;  3BYA A;  2FCE A;  2LMT A;  2LMU A;  1OMV A;  4DS7 A;  4A4B A;  1SYM A;  5KU1 A;  2FCD A;  3WHT B;  1NX1 A;  1G33 A;  1CKK A;  1EG4 A;  3TDZ A;  1B7T Z;  1B9A A;  2MRD A;  4GGN A;  1J7Q A;  1DJH A;  1LXF C;  3EKJ A;  1TNQ A;  2KFG A;  3HCM A;  1PSB A;  1DMO A;  4PHJ A;  3NSI A;  1B8L A;  3IF7 A;  3LLE A;  1N2D A;  3VRR A;  3DVK A;  1TNW A;  2JNX A;  3EKH A;  1CDL A;  2CNP A;  3SG4 A;  2JC2 A;  2M0R A;  1YX8 A;  2H2K A;  2JT0 A;  4PE7 A;  1QX5 B;  1Y1U A;  2PAS A;  1PAL A;  1KFX S;  1KK7 Y;  1V1F A;  4L9M A;  2B1U A;  1LA0 A;  3SIA A;  2O60 A;  3NSL A;  1QX7 A;  5K89 A;  1NYA A;  1QLS A;  1DJI A;  2NCO A;  2R2I A;  4USL A;  2JZI A;  1CB1 A;  5JOL A;  1B8R A;  1J7O A;  1A75 A;  2JNF A;  2JT3 A;  1KFU S;  2H61 A;  4YGE B;  5G08 A;  3SG7 A;  2F3Z A;  1B8C A;  2Q4U A;  1QX2 A;  1QV1 A;  1KK8 B;  2LV7 A;  2BCB A;  2ZND A;  1SR6 B;  2NCP A;  3KO0 A;  3WNX B;  3ZNI A;  1YRT B;  1Y0V H;  4N1F A;  4PDZ A;  2BE6 A;  2WC8 A;  4CFQ A;  1DF0 B;  1HQV A;  1MHO A;  1AP4 A;  1H4B A;  3E3R A;  1B1G A;  4ORC B;  1SCV A;  3CGA A;  2JRF A;  5FYX A;  2Q91 A;  1F4Q A;  2KQY A;  1R6P A;  5I2L A;  3QRX A;  2SAS A;  1XK4 A;  1EJ3 A;  2HF5 A;  2OPO A;  1GJY A;  3LK0 A;  4TNC A;  2KI4 B;  1AJ5 A;  1IG5 A;  4U8D A;  3A4U B;  4ZCU A;  4FQO A;  4PHM A;  3NSO A;  2GGM A;  3DF0 A;  1JC2 A;  1QS7 A;  1KQV A;  5DKN A;  2BKH B;  1XFX O;  2L98 A;  3I5G C;  1W7J B;  2WCF A;  1XFW O;  3SG2 A;  1MXE A;  1V1G A;  1ZAC A;  2EC6 B;  2L5X B;  2LVI A;  1ZUZ A;  3AAK A;  2K0J A;  3DD4 A;  3PN7 C;  5HKY A;  1CLB A;  2A4J A;  5KSZ A;  1F54 A;  4MZL A;  5CPV A;  2KHN A;  2LVV A;  3PLF B;  4PAL A;  3WXA A;  2V53 A;  2EHB A;  1JWD A;  3BOW A;  2QPT A;  3TUY B;  1DJX A;  1DVI A;  2QAC A;  1N0Y A;  2L2E A;  3GK1 A;  1XK4 C;  5AXI A;  2BL0 C;  4M2Q A;  1FPW A;  3SJS A;  5BPJ A;  1KQM C;  1PSR A;  1M63 B;  3PSR A;  1QTX A;  5AER A;  2LVK A;  3TS5 B;  1GGW A;  2M97 A;  2PVB A;  4HRG A;  5HKZ A;  2LNK A;  3SG6 A;  1E8A A;  1RFJ A;  1N65 A;  1OE9 B;  2KDH A;  4QJ4 B;  4MBE A;  1DJG A;  2JQ6 A;  4MLW A;  3CR4 X;  1RK9 A;  1NX0 A;  4M2O A;  5J3X A;  5AAN A;  1C07 A;  1CMF A;  1YUT A;  4XJK A;  1SK6 D;  3D0Y A;  4PCW A;  4C0L A;  1EH2 A;  1EXR A;  2NXQ A;  2KAY A;  2KGB C;  3OX5 A;  1MQ1 A;  4I5J A;  4MSP A;  1PK0 D;  2WCB A;  2VRG A;  1SCM B;  5DKR A;  3JVT C;  1OQP A;  1RWY A;  2LLT A;  4IL1 A;  3BUN B;  2KFH A;  5I2O A;  1YR5 A;  1SNL A;  1XFV O;  1UHK A;  4ORA B;  2BBN A;  1OSA A;  1F70 A;  1M45 A;  2JTT A;  2MA2 A;  2RGI A;  3VRN A;  3F45 A;  2GV5 A;  4MRY A;  1LVC D;  4I5K A;  2HPS A;  2SCP A;  2M7N A;  4AQI A;  3EVU A;  5ER5 A;  1CFF A;  1K2H A;  4DIR A;  1NCY A;  3PFV A;  3I5I C;  4GPL B;  3ICB A;  1OZO A;  3FWB A;  1UUR A;  1WLZ A;  3I5F C;  4MEW A;  1XVJ A;  2P6B B;  1BOC A;  4F0Z B;  2M29 A;  1MXL C;  4WQ3 A;  1LA3 A;  3O2P A;  4MZK A;  1RJV A;  1KCY A;  1NWD A;  1RTP 1;  3AKB A;  2JUL A;  5F6T A;  1CDN A;  1Q80 A;  1BMO A;  3OHM B;  5ER4 X;  1J7R A;  3BUX B;  4QJ5 B;  4R1E A;  3KHE A;  1TRF A;  2BCX A;  2LLU A;  1F55 A;  3DF0 B;  1YTZ C;  1BR4 B;  2KYF A;  4N1G A;  3CWG A;  2OTG B;  5HLV A;  1OMR A;  3BUW B;  1BJF A;  2CBL A;  3OP0 A;  5IBW A;  1WDC B;  1YVH A;  1M39 A;  1MF8 B;  1SMG A;  4WQ2 A;  1ALW A; 
#chains in the Genus database with same CATH topology
 1XYD A;  2ZN9 A;  2IS9 A;  4JPZ B;  4P5O E;  1PVA A;  4QJ3 B;  3MSE B;  2JWW A;  1SL8 A;  3I5H C;  3BUM B;  4N5X A;  2ZRS A;  3IVT A;  3JTD B;  4NQG A;  1WLM A;  3VRO A;  1REC A;  1A4P A;  1WRL A;  2FJU B;  2WCE A;  1QVI Y;  5I2Q A;  1K8U A;  3O4X A;  2WOS A;  1UHH A;  3H4S E;  3CR2 A;  2OS8 C;  3OB2 B;  1S36 A;  2KNE A;  3PAL A;  2LUX A;  1A29 A;  1NUB A;  3DYE A;  3RM1 A;  4I5N B;  2WOR A;  1NCZ A;  2HQW A;  1DJZ A;  3Q8I A;  3S0G A;  5CSN A;  5TNC A;  2FJY A;  2ISD A;  4AOM A;  2F2O A;  1TWO A;  4BY4 A;  1DGU A;  5D7F A;  2DOQ A;  1KWO C;  4OR9 B;  1C3Y A;  2K2A A;  1WY9 A;  1QAT A;  3S0D A;  1XFZ O;  1DT7 B;  1GGZ A;  1AVS A;  3K21 A;  3SS3 A;  5I8N A;  1LS8 A;  1L2O C;  1SSE B;  2G2B A;  2WC6 A;  1RRO A;  1KSO A;  1W7I B;  1NP8 A;  3GK2 A;  4OKH A;  2KFF A;  4XYN A;  3V2L A;  1SL7 A;  1TCF A;  2M8U A;  3BFH A;  2PMY A;  1U5I B;  1OZS A;  1PVB A;  2KOT A;  1ALV A;  2JT8 A;  2JOJ A;  2M49 B;  1AUI B;  4FQT A;  3SS4 A;  3FS7 A;  1NPQ A;  1Y6W A;  3LK1 A;  4Q04 A;  4PHN A;  3PM8 A;  1WRK A;  2F2P A;  2K7C A;  1K95 A;  5PAL A;  1JF0 A;  1BR1 B;  2L5Y A;  4JQ0 D;  4D1E A;  3D75 A;  1XFY O;  4PE0 A;  2JPT A;  2LM5 A;  4MVF A;  2WC5 A;  2BBM A;  2K60 A;  2KPH A;  3SG3 A;  3A8R A;  1SPY A;  2QEO A;  5AFP A;  1CFD A;  3BUO B;  2K7O A;  5FI7 A;  4I5L B;  3VRP A;  1B7T Y;  1TIZ A;  1H8B A;  3FWC A;  4JKT A;  3L4L A;  1TNX A;  4OVN F;  1FBV A;  2L4H A;  3AAJ A;  5CSF A;  1QJT A;  3WHU B;  1S1E A;  1K9K A;  1YUU A;  4MN0 A;  1ZFS A;  1F4O A;  4YGC B;  5D3O A;  1BG1 A;  3VGO A;  3TZ1 A;  1S5G Z;  2Y1N A;  2ZN8 A;  2ZNE A;  2M3W A;  4ETO A;  1UWO A;  1DF0 A;  1UUS A;  3SG5 A;  1IQ3 A;  2K8M B;  2QEH A;  4YRU A;  1QIV A;  3SIB A;  1AK8 A;  2BEC A;  4HSZ A;  4MZJ A;  4YBH B;  1TN4 A;  4INX A;  4OV2 A;  5HKW A;  2L2C A;  1FF1 A;  2KGR A;  3EK7 A;  2I18 A;  2L51 A;  4GFT A;  1FI5 A;  1QAS A;  2F8P A;  2TN4 A;  3K1E A;  5AEQ A;  1CMG A;  1S6J A;  2PQL A;  3O4Y A;  2L50 A;  2L4I A;  3AKA A;  1C7V A;  1FI6 A;  1A75 B;  4P2Y B;  1YVL A;  1S6C A;  1EL4 A;  3CLN A;  1NX2 A;  1UP5 A;  1PRW A;  2CTN A;  1DGV A;  3B7A A;  4AQJ A;  2MBX A;  3BQ3 A;  1B47 A;  1LIN A;  2K2F A;  2LE9 B;  2LHL A;  1KK8 C;  3EVV A;  1NSH A;  2E30 A;  3I5G B;  4CFR A;  2JU0 A;  1SR6 C;  3B88 A;  4DRW A;  3NXA A;  3BFB A;  3B87 A;  1S26 D;  2M7L A;  2CXJ A;  3PN7 B;  2BKI B;  2KBI A;  3D77 A;  4UPG A;  4CID A;  1TCO B;  1C7W A;  2M1U A;  2JXC A;  4WRI A;  3KF9 A;  1VRK A;  1IGV A;  1A03 A;  2M9G A;  4HRE E;  1SKT A;  4M2P A;  5FI6 A;  5DKQ A;  3CYZ A;  3GOF A;  2HET A;  1S6I A;  4GGF C;  2BL0 B;  2P71 A;  2K7B A;  2WCK A;  2G9B A;  3TDI A;  1IKU A;  1QXP A;  1KQM B;  3EK4 A;  4GBA A;  1IWQ A;  4MRX A;  2KI4 C;  1UHJ A;  1UHN A;  1DEK A;  3CDN A;  4DUQ A;  3LCP C;  3O78 A;  1OOI X;  1IJ6 A;  1G8I A;  1OMD A;  4YI8 A;  1KFX L;  1A2X A;  1NCX A;  1X02 A;  1CFC A;  2MHH A;  2LLS A;  4NDD A;  1TNP A;  1KSM A;  2WCL A;  1TTX A;  2PSR A;  3UO9 A;  2EGD A;  1S3P A;  1JUO A;  2Y4Q A;  3DXL A;  2MJW B;  1J1E A;  2EC6 C;  1KFU L;  3FE6 A;  3QME A;  1IRJ A;  2PRU A;  3BOW B;  2NLN A;  1NX3 A;  1DJY A;  2BAP A;  3L47 A;  1FW4 A;  4PHK A;  5HLO A;  1K93 D;  5JJG A;  3TUY C;  1LKJ A;  1CDM A;  1K9P A;  2KAX A;  3JVT B;  2YGU A;  3O6B A;  2ERB A;  1XFU O;  3OB1 B;  1OOH A;  2LP2 A;  3EK8 A;  3OX6 A;  2D8N A;  3CS1 A;  1YX7 A;  1Y1X A;  2K61 A;  1BF5 A;  1J55 A;  1R2U A;  5KTY A;  3CR5 X;  2LUC A;  1CFP A;  3NSK A;  2O5G A;  2M1K B;  2KYC A;  1M46 A;  1TOP A;  1K96 A;  1YUR A;  3TS5 C;  2QEB A;  2LC5 A;  3DVJ A;  1MR8 A;  2GGZ A;  1BT6 A;  3S0F A;  1DC1 A;  1F8H A;  1K9U A;  3M0W A;  2I2R E;  1XO5 A;  1DJW A;  3I5I B;  2KAV A;  4XJK B;  2HQ8 A;  3CZT X;  3DVM A;  3D0Y B;  3VB1 A;  3I5F B;  1GQM A;  5HYD A;  3EG5 B;  1AHR A;  1S5G Y;  1JFJ A;  1UHI A;  1PUL A;  1QIW A;  2JXL A;  2WND A;  1JSA A;  2QEV A;  3CZ0 A;  3HX4 A;  1SRA A;  2KQ6 A;  4YI9 A;  1JFK A;  3OBV A;  1WRZ A;  1SCM C;  1K90 D;  3KEV A;  1AJ4 A;  2AUC A;  4KYN A;  1ZMZ A;  2Y1M A;  5I94 A;  1JBA A;  2LP3 A;  3D10 A;  1CLM A;  2H61 C;  4NDB A;  1GM0 A;  2PAL A;  1KK7 Z;  2LCP A;  2KSP A;  4JWQ A;  4PE1 A;  2BCA A;  3C1V A;  1SL9 A;  2JTZ A;  3CTN A;  3R1P A;  3RLZ A;  2LAN A;  5B8I B;  1ORG A;  3VRQ A;  3NHT A;  4OCI A;  5GQQ C;  5D69 A;  3TDU A;  3BXK A;  2BNX A;  4HRH A;  4GNK B;  4NDC A;  2LAP A;  5CSI A;  5EL2 A;  1DTL A;  4GAO A;  3PAT A;  4GUK A;  4BY5 A;  3ZWH A;  3I5H B;  2MLF C;  3GK4 X;  4OZD A;  2FOT A;  2I94 A;  1CM1 A;  2JPO A;  2KBM A;  1QVI Z;  2Y5I A;  1J7P A;  4JD9 A;  5FI2 A;  2OS8 B;  1CNP A;  1CTR A;  1MUX A;  3EVR A;  3DVE A;  4ORB B;  2KI6 C;  2NZ0 A;  3L4A A;  4E68 A;  1ODB A;  4PT1 A;  1BU3 A;  1JF2 A;  2OTG C;  3FIA A;  1XA5 A;  2KLD A;  1IQ5 A;  4GGF A;  1Y1A A;  1BOD A;  2CT9 A;  1QLK A;  1WDC C;  1BLQ A;  1KWO B;  2ZFD A;  1J1D A;  1YRU B;  3IQQ A;  4ICB A;  4ZCV A;  1G4Y R;  1K94 A;  4C0K A;  4C0J A;  2MAZ A;  4YGD B;  2PYQ A;  1EG3 A;  1L2O B;  4A4C A;  4CLN A;  2MLE C;  1HT9 A;  2ZRT A;  1IH0 A;  1OOJ A;  2LVJ A;  4YGB B;  2LHI A;  1F71 A;  1SY9 A;  1L7Z A;  2WCJ A;  2AMI A;  3D73 A;  2LMV A;  2L0P A;  2AAO A;  3IQO A;  3KPX A;  1NIW A;  1SW8 A;  2COL B;  3JTD C;  3OGN A;  4YGA A;  1CDP A;  1YUS A;  5CSJ A;  4CPV A;  3BJH A;  1ZOT B;  2I7A A;  1U5I A;  1IJ5 A;  2ZKM X;  3LL8 B;  1CM4 A;  4PE4 A;  1MWN A;  2F33 A;  2KI6 D;  2E6W A;  1SBJ A;  2CCM A;  2BE4 A;  1QV0 A;  1B4C A;  2F3Y A;  4FTG A;  1CLL A;  2K7D A;  4DCK A;  1D1O A;  1M31 A;  3BYA A;  2FCE A;  2LMT A;  2LMU A;  1OW4 A;  3S0A A;  1OMV A;  4DS7 A;  4A4B A;  3SS5 A;  1SYM A;  1TUJ A;  2FCD A;  3FE8 A;  5KU1 A;  3PM2 A;  3WHT B;  1NX1 A;  1G33 A;  1DQE A;  1CKK A;  1EG4 A;  3TDZ A;  1B7T Z;  1B9A A;  2GTE A;  2MRD A;  4GGN A;  1J7Q A;  1Z2C B;  1DJH A;  1LXF C;  3EKJ A;  1TNQ A;  2KFG A;  3HCM A;  1PSB A;  1DMO A;  4PHJ A;  3NSI A;  5HL1 A;  1B8L A;  3R72 A;  3IF7 A;  3LLE A;  3N7H A;  1N2D A;  3D76 A;  3VRR A;  3DVK A;  1TNW A;  2JNX A;  3EKH A;  1CDL A;  2CNP A;  3SG4 A;  2JC2 A;  2M0R A;  2WCM A;  1C3Z A;  1YX8 A;  2H2K A;  2JT0 A;  4PE7 A;  1QX5 B;  1Y1U A;  2PAS A;  1PAL A;  1KFX S;  1KK7 Y;  3FE9 A;  1V1F A;  4L9M A;  2B1U A;  1LA0 A;  3SIA A;  1XFR A;  2O60 A;  3NSL A;  1QX7 A;  5K89 A;  1NYA A;  1QLS A;  1DJI A;  2NCO A;  2R2I A;  4USL A;  2JZI A;  1CB1 A;  5JOL A;  1B8R A;  1J7O A;  1A75 A;  2JNF A;  2JT3 A;  1KFU S;  2H61 A;  4YGE B;  5G08 A;  3SG7 A;  2F3Z A;  1B8C A;  2Q4U A;  1QX2 A;  1QV1 A;  1OOF A;  1KK8 B;  2LV7 A;  2BCB A;  2ZND A;  1SR6 B;  2NCP A;  3KO0 A;  3WNX B;  3ZNI A;  1YRT B;  1Y0V H;  3CAB A;  4N1F A;  4PDZ A;  2BE6 A;  1IIO A;  2WC8 A;  3D78 A;  3S0B A;  4CFQ A;  4INW A;  2QDI A;  1DF0 B;  1HQV A;  1MHO A;  1AP4 A;  1H4B A;  3E3R A;  1B1G A;  4ORC B;  1SCV A;  3CGA A;  2JRF A;  3B6X A;  5FYX A;  2Q91 A;  1F4Q A;  2KQY A;  1DEL A;  1R6P A;  5I2L A;  3QRX A;  3S0E A;  2SAS A;  1XK4 A;  1EJ3 A;  2HF5 A;  2OPO A;  1GJY A;  3LK0 A;  4TNC A;  2KI4 B;  1AJ5 A;  1IG5 A;  4U8D A;  3A4U B;  4ZCU A;  4FQO A;  4PHM A;  1OOG A;  3NSO A;  2GGM A;  3DF0 A;  1JC2 A;  1QS7 A;  1KQV A;  5DKN A;  2BKH B;  1XFX O;  2L98 A;  3I5G C;  1W7J B;  2WCF A;  1XFW O;  3SG2 A;  1MXE A;  1V1G A;  3R1O A;  1P28 A;  1ZAC A;  2EC6 B;  2L5X B;  2LVI A;  1ZUZ A;  3AAK A;  2K0J A;  3DD4 A;  3PN7 C;  5HKY A;  1CLB A;  2A4J A;  5KSZ A;  1F54 A;  4MZL A;  5CPV A;  3UNW A;  2KHN A;  2LVV A;  3PLF B;  4PAL A;  1T14 A;  3WXA A;  2V53 A;  2EHB A;  3R1V A;  1JWD A;  3BOW A;  2QPT A;  3B86 A;  3TUY B;  1DJX A;  1DVI A;  2QAC A;  1N0Y A;  3DZT A;  2L2E A;  5DIC A;  3GK1 A;  1XK4 C;  5AXI A;  2WCH A;  2BL0 C;  4M2Q A;  1FPW A;  3DY9 A;  3SJS A;  3NHI A;  5BPJ A;  1KQM C;  1PSR A;  1M63 B;  3PSR A;  1W9Z A;  1QTX A;  4F7F A;  5AER A;  2LVK A;  3TS5 B;  1GGW A;  2M97 A;  2PVB A;  4HRG A;  5HKZ A;  2LNK A;  3SG6 A;  1E8A A;  1RFJ A;  1N65 A;  1OE9 B;  2KDH A;  2P70 A;  4QJ4 B;  4MBE A;  1DJG A;  2JQ6 A;  4MLW A;  3CR4 X;  1RK9 A;  1NX0 A;  4M2O A;  5J3X A;  5AAN A;  1C07 A;  1CMF A;  1YUT A;  4XJK A;  1SK6 D;  3D0Y A;  4PCW A;  4C0L A;  1EH2 A;  1EXR A;  2NXQ A;  2KAY A;  2KGB C;  3OX5 A;  1MQ1 A;  4I5J A;  4MSP A;  1PK0 D;  2WCB A;  2VRG A;  1SCM B;  5DKR A;  3JVT C;  1OQP A;  1RWY A;  2LLT A;  1Z4H A;  2KLE A;  4IL1 A;  3BUN B;  2KFH A;  5I2O A;  1YR5 A;  1SNL A;  1XFV O;  1UHK A;  4ORA B;  2BBN A;  3BFA A;  1OSA A;  1F70 A;  1M45 A;  2JTT A;  2MA2 A;  2RGI A;  3VRN A;  3F45 A;  2GV5 A;  3PJI A;  4MRY A;  1LVC D;  4I5K A;  2HPS A;  2SCP A;  2M7N A;  4AQI A;  3EVU A;  5ER5 A;  1CFF A;  1K2H A;  4DIR A;  1NCY A;  1QWV A;  3PFV A;  3I5I C;  4GPL B;  3ICB A;  1OZO A;  3FWB A;  1UUR A;  1WLZ A;  3I5F C;  4MEW A;  1XVJ A;  2P6B B;  1BOC A;  1TUZ A;  4F0Z B;  2M29 A;  1MXL C;  3CZ2 A;  4WQ3 A;  1LA3 A;  3O2P A;  4MZK A;  4IJ7 A;  1RJV A;  1KCY A;  3D74 A;  1NWD A;  1RTP 1;  2H8V A;  2JUL A;  3AKB A;  5F6T A;  1CDN A;  1Q80 A;  1BMO A;  3OHM B;  5ER4 X;  1J7R A;  3BUX B;  4QJ5 B;  4R1E A;  3KHE A;  1TRF A;  2BCX A;  2LLU A;  1F55 A;  3DF0 B;  1YTZ C;  1BR4 B;  2KYF A;  4N1G A;  3CWG A;  3NGV A;  3CZ1 A;  2OTG B;  5HLV A;  1OMR A;  3BUW B;  1BJF A;  2CBL A;  3OP0 A;  5IBW A;  1WDC B;  1YVH A;  1M39 A;  1MF8 B;  1SMG A;  4WQ2 A;  3RZS A;  1ALW A; 
#chains in the Genus database with same CATH homology
 1XYD A;  2ZN9 A;  2IS9 A;  4JPZ B;  4P5O E;  1PVA A;  4QJ3 B;  3MSE B;  2JWW A;  1SL8 A;  3I5H C;  3BUM B;  4N5X A;  2ZRS A;  3JTD B;  4NQG A;  1WLM A;  3VRO A;  1REC A;  1A4P A;  1WRL A;  2FJU B;  2WCE A;  1QVI Y;  5I2Q A;  1K8U A;  2WOS A;  1UHH A;  3H4S E;  3CR2 A;  2OS8 C;  3OB2 B;  1S36 A;  2KNE A;  3PAL A;  2LUX A;  1A29 A;  1NUB A;  3RM1 A;  4I5N B;  2WOR A;  1NCZ A;  2HQW A;  1DJZ A;  5CSN A;  5TNC A;  2ISD A;  4AOM A;  2F2O A;  4BY4 A;  1DGU A;  5D7F A;  2DOQ A;  1KWO C;  4OR9 B;  2K2A A;  1WY9 A;  1QAT A;  1DT7 B;  1XFZ O;  1GGZ A;  1AVS A;  3K21 A;  5I8N A;  1L2O C;  2G2B A;  1RRO A;  1KSO A;  1W7I B;  1NP8 A;  3GK2 A;  4OKH A;  2KFF A;  4XYN A;  1SL7 A;  1TCF A;  2M8U A;  2PMY A;  1U5I B;  1OZS A;  1PVB A;  2KOT A;  1ALV A;  2JT8 A;  2JOJ A;  2M49 B;  1AUI B;  3FS7 A;  1NPQ A;  1Y6W A;  3LK1 A;  4Q04 A;  4PHN A;  3PM8 A;  1WRK A;  2F2P A;  2K7C A;  1K95 A;  5PAL A;  1JF0 A;  1BR1 B;  4JQ0 D;  4D1E A;  1XFY O;  4PE0 A;  2JPT A;  2LM5 A;  4MVF A;  2BBM A;  3SG3 A;  3A8R A;  1SPY A;  5AFP A;  1CFD A;  3BUO B;  2K7O A;  4I5L B;  3VRP A;  1B7T Y;  1TIZ A;  1H8B A;  3FWC A;  1TNX A;  4OVN F;  1FBV A;  2L4H A;  3AAJ A;  5CSF A;  1QJT A;  3WHU B;  1S1E A;  1K9K A;  1YUU A;  4MN0 A;  1ZFS A;  1F4O A;  4YGC B;  1BG1 A;  3VGO A;  3TZ1 A;  1S5G Z;  2Y1N A;  2ZN8 A;  2ZNE A;  2M3W A;  4ETO A;  1UWO A;  1DF0 A;  1UUS A;  3SG5 A;  1IQ3 A;  2K8M B;  4YRU A;  1AK8 A;  1QIV A;  3SIB A;  2BEC A;  4HSZ A;  4MZJ A;  4YBH B;  1TN4 A;  1FF1 A;  4OV2 A;  5HKW A;  2KGR A;  3EK7 A;  2I18 A;  2L51 A;  4GFT A;  1FI5 A;  1QAS A;  2F8P A;  2TN4 A;  5AEQ A;  1CMG A;  1S6J A;  3O4Y A;  2L50 A;  2L4I A;  3AKA A;  1C7V A;  1FI6 A;  1A75 B;  4P2Y B;  1YVL A;  1S6C A;  1EL4 A;  3CLN A;  1NX2 A;  1UP5 A;  1PRW A;  2CTN A;  1DGV A;  4AQJ A;  2MBX A;  3BQ3 A;  1B47 A;  1LIN A;  2K2F A;  2LE9 B;  2LHL A;  1KK8 C;  3EVV A;  1NSH A;  2E30 A;  3I5G B;  4CFR A;  2JU0 A;  1SR6 C;  4DRW A;  3NXA A;  1S26 D;  2M7L A;  2CXJ A;  3PN7 B;  2BKI B;  2KBI A;  4UPG A;  4CID A;  1TCO B;  1C7W A;  2M1U A;  2JXC A;  4WRI A;  3KF9 A;  1VRK A;  1IGV A;  1A03 A;  2M9G A;  4HRE E;  1SKT A;  4M2P A;  5DKQ A;  3GOF A;  2HET A;  1S6I A;  4GGF C;  2BL0 B;  2K7B A;  2G9B A;  3TDI A;  1IKU A;  1QXP A;  1KQM B;  3EK4 A;  4GBA A;  1IWQ A;  4MRX A;  2KI4 C;  1UHJ A;  1UHN A;  4DUQ A;  3LCP C;  3O78 A;  1IJ6 A;  1G8I A;  1OMD A;  4YI8 A;  1KFX L;  1A2X A;  1NCX A;  1X02 A;  1CFC A;  2MHH A;  2LLS A;  4NDD A;  1TNP A;  1KSM A;  1TTX A;  2PSR A;  2EGD A;  1S3P A;  1JUO A;  2Y4Q A;  2MJW B;  1J1E A;  2EC6 C;  1KFU L;  1IRJ A;  2PRU A;  3BOW B;  2NLN A;  1NX3 A;  1DJY A;  1FW4 A;  4PHK A;  5HLO A;  1K93 D;  5JJG A;  3TUY C;  1LKJ A;  1CDM A;  1K9P A;  2KAX A;  3JVT B;  3O6B A;  1XFU O;  3OB1 B;  2LP2 A;  3EK8 A;  3OX6 A;  2D8N A;  3CS1 A;  1YX7 A;  1Y1X A;  2K61 A;  1BF5 A;  1J55 A;  1R2U A;  5KTY A;  3CR5 X;  2LUC A;  1CFP A;  3NSK A;  2O5G A;  2M1K B;  2KYC A;  1M46 A;  1TOP A;  1K96 A;  1YUR A;  3TS5 C;  2LC5 A;  3DVJ A;  1MR8 A;  2GGZ A;  1BT6 A;  1F8H A;  1K9U A;  3M0W A;  2I2R E;  1XO5 A;  1DJW A;  3I5I B;  2KAV A;  4XJK B;  2HQ8 A;  3CZT X;  3DVM A;  3D0Y B;  3I5F B;  1GQM A;  5HYD A;  1AHR A;  1S5G Y;  1JFJ A;  1UHI A;  1PUL A;  1QIW A;  2JXL A;  2WND A;  1JSA A;  3HX4 A;  1SRA A;  2KQ6 A;  4YI9 A;  1JFK A;  1WRZ A;  1SCM C;  1K90 D;  3KEV A;  1AJ4 A;  2AUC A;  1ZMZ A;  2Y1M A;  1JBA A;  2LP3 A;  3D10 A;  1CLM A;  2H61 C;  4NDB A;  2PAL A;  1KK7 Z;  2LCP A;  2KSP A;  4JWQ A;  4PE1 A;  2BCA A;  3C1V A;  1SL9 A;  2JTZ A;  3CTN A;  3RLZ A;  2LAN A;  5B8I B;  3VRQ A;  4OCI A;  5GQQ C;  5D69 A;  3TDU A;  3BXK A;  4HRH A;  4GNK B;  4NDC A;  2LAP A;  5CSI A;  1DTL A;  4GAO A;  3PAT A;  4GUK A;  4BY5 A;  3ZWH A;  3I5H B;  2MLF C;  3GK4 X;  2FOT A;  2I94 A;  1CM1 A;  2KBM A;  1QVI Z;  2Y5I A;  1J7P A;  2OS8 B;  1CNP A;  1CTR A;  1MUX A;  3EVR A;  3DVE A;  4ORB B;  2KI6 C;  2NZ0 A;  4E68 A;  1ODB A;  1BU3 A;  1JF2 A;  2OTG C;  3FIA A;  1XA5 A;  1IQ5 A;  4GGF A;  1Y1A A;  1BOD A;  2CT9 A;  1QLK A;  1WDC C;  1BLQ A;  1KWO B;  2ZFD A;  1J1D A;  1YRU B;  3IQQ A;  4ICB A;  4ZCV A;  1G4Y R;  1K94 A;  4C0K A;  4C0J A;  2MAZ A;  4YGD B;  1EG3 A;  1L2O B;  4A4C A;  4CLN A;  2MLE C;  1HT9 A;  2ZRT A;  1IH0 A;  1OOJ A;  2LVJ A;  4YGB B;  2LHI A;  1F71 A;  1SY9 A;  1L7Z A;  2AMI A;  2LMV A;  2L0P A;  2AAO A;  3IQO A;  3KPX A;  1NIW A;  1SW8 A;  2COL B;  3JTD C;  4YGA A;  1CDP A;  1YUS A;  5CSJ A;  4CPV A;  4PE4 A;  1ZOT B;  2I7A A;  1U5I A;  1IJ5 A;  2ZKM X;  3LL8 B;  1CM4 A;  1MWN A;  2F33 A;  2KI6 D;  2E6W A;  1SBJ A;  2CCM A;  2BE4 A;  1QV0 A;  1B4C A;  2F3Y A;  4FTG A;  1CLL A;  2K7D A;  4DCK A;  1D1O A;  1M31 A;  3BYA A;  2FCE A;  2LMT A;  2LMU A;  1OMV A;  4DS7 A;  4A4B A;  1SYM A;  5KU1 A;  2FCD A;  3WHT B;  1NX1 A;  1G33 A;  1CKK A;  1EG4 A;  3TDZ A;  1B7T Z;  1B9A A;  2MRD A;  4GGN A;  1J7Q A;  1DJH A;  1LXF C;  3EKJ A;  1TNQ A;  2KFG A;  3HCM A;  1PSB A;  1DMO A;  4PHJ A;  3NSI A;  1B8L A;  3IF7 A;  3LLE A;  1N2D A;  3VRR A;  3DVK A;  1TNW A;  2JNX A;  3EKH A;  1CDL A;  2CNP A;  3SG4 A;  2JC2 A;  2M0R A;  1YX8 A;  2H2K A;  2JT0 A;  4PE7 A;  1QX5 B;  1Y1U A;  2PAS A;  1PAL A;  1KFX S;  1KK7 Y;  1V1F A;  4L9M A;  2B1U A;  1LA0 A;  3SIA A;  2O60 A;  3NSL A;  1QX7 A;  5K89 A;  1NYA A;  1QLS A;  1DJI A;  2NCO A;  2R2I A;  4USL A;  2JZI A;  1CB1 A;  5JOL A;  1B8R A;  1J7O A;  1A75 A;  2JNF A;  2JT3 A;  1KFU S;  2H61 A;  4YGE B;  5G08 A;  3SG7 A;  2F3Z A;  1B8C A;  2Q4U A;  1QX2 A;  1QV1 A;  1KK8 B;  2LV7 A;  2BCB A;  2ZND A;  1SR6 B;  2NCP A;  3KO0 A;  3WNX B;  3ZNI A;  1YRT B;  1Y0V H;  4N1F A;  4PDZ A;  2BE6 A;  2WC8 A;  4CFQ A;  1DF0 B;  1HQV A;  1MHO A;  1AP4 A;  1H4B A;  3E3R A;  1B1G A;  4ORC B;  1SCV A;  3CGA A;  2JRF A;  5FYX A;  2Q91 A;  1F4Q A;  2KQY A;  1R6P A;  5I2L A;  3QRX A;  2SAS A;  1XK4 A;  1EJ3 A;  2HF5 A;  2OPO A;  1GJY A;  3LK0 A;  4TNC A;  2KI4 B;  1AJ5 A;  1IG5 A;  4U8D A;  3A4U B;  4ZCU A;  4FQO A;  4PHM A;  3NSO A;  2GGM A;  3DF0 A;  1JC2 A;  1QS7 A;  1KQV A;  5DKN A;  2BKH B;  1XFX O;  2L98 A;  3I5G C;  1W7J B;  2WCF A;  1XFW O;  3SG2 A;  1MXE A;  1V1G A;  1ZAC A;  2EC6 B;  2L5X B;  2LVI A;  1ZUZ A;  3AAK A;  2K0J A;  3DD4 A;  3PN7 C;  5HKY A;  1CLB A;  2A4J A;  5KSZ A;  1F54 A;  4MZL A;  5CPV A;  2KHN A;  2LVV A;  3PLF B;  4PAL A;  3WXA A;  2V53 A;  2EHB A;  1JWD A;  3BOW A;  2QPT A;  3TUY B;  1DJX A;  1DVI A;  2QAC A;  1N0Y A;  2L2E A;  3GK1 A;  1XK4 C;  5AXI A;  2BL0 C;  4M2Q A;  1FPW A;  3SJS A;  5BPJ A;  1KQM C;  1PSR A;  1M63 B;  3PSR A;  1QTX A;  5AER A;  2LVK A;  3TS5 B;  1GGW A;  2M97 A;  2PVB A;  4HRG A;  5HKZ A;  2LNK A;  3SG6 A;  1E8A A;  1RFJ A;  1N65 A;  1OE9 B;  2KDH A;  4QJ4 B;  4MBE A;  1DJG A;  2JQ6 A;  4MLW A;  3CR4 X;  1RK9 A;  1NX0 A;  4M2O A;  5J3X A;  5AAN A;  1C07 A;  1CMF A;  1YUT A;  4XJK A;  1SK6 D;  3D0Y A;  4PCW A;  4C0L A;  1EH2 A;  1EXR A;  2NXQ A;  2KAY A;  2KGB C;  3OX5 A;  1MQ1 A;  4I5J A;  4MSP A;  1PK0 D;  2WCB A;  2VRG A;  1SCM B;  5DKR A;  3JVT C;  1OQP A;  1RWY A;  2LLT A;  4IL1 A;  3BUN B;  2KFH A;  5I2O A;  1YR5 A;  1SNL A;  1XFV O;  1UHK A;  4ORA B;  2BBN A;  1OSA A;  1F70 A;  1M45 A;  2JTT A;  2MA2 A;  2RGI A;  3VRN A;  3F45 A;  2GV5 A;  4MRY A;  1LVC D;  4I5K A;  2HPS A;  2SCP A;  2M7N A;  4AQI A;  3EVU A;  5ER5 A;  1CFF A;  1K2H A;  4DIR A;  1NCY A;  3PFV A;  3I5I C;  4GPL B;  3ICB A;  1OZO A;  3FWB A;  1UUR A;  1WLZ A;  3I5F C;  4MEW A;  1XVJ A;  2P6B B;  1BOC A;  4F0Z B;  2M29 A;  1MXL C;  4WQ3 A;  1LA3 A;  3O2P A;  4MZK A;  1RJV A;  1KCY A;  1NWD A;  1RTP 1;  3AKB A;  2JUL A;  5F6T A;  1CDN A;  1Q80 A;  1BMO A;  3OHM B;  5ER4 X;  1J7R A;  3BUX B;  4QJ5 B;  4R1E A;  3KHE A;  1TRF A;  2BCX A;  2LLU A;  1F55 A;  3DF0 B;  1YTZ C;  1BR4 B;  2KYF A;  4N1G A;  3CWG A;  2OTG B;  5HLV A;  1OMR A;  3BUW B;  1BJF A;  2CBL A;  3OP0 A;  5IBW A;  1WDC B;  1YVH A;  1M39 A;  1MF8 B;  1SMG A;  4WQ2 A;  1ALW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...