2PRUA

Nmr structure of human apos100b at 10c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure of human apo-S100B at low temperature indicates a unimodal conformational distribution is adopted by calcium-free S100 proteins.
pubmed doi rcsb
molecule keywords Protein S100-B
source organism Homo sapiens
molecule tags Metal binding protein
total genus 29
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2pruA00
3SG4A 1EXRA 4C0KA 1TNPA 2KQYA 2KAYA 3A4UB 3JTDB 3LL8B 4I5LB 2WCFA 5HLOA 2Y1MA 1NCZA 1QX7A 1S6CA 4CPVA 1MF8B 2H61C 1BJFA 1NCXA 1PVBA 2MLFC 4JWQA 1BT6A 2JWWA 4GFTA 1YUTA 1TTXA 3EKJA 5D7FA 1A2XA 1V1GA 3NSIA 1WRZA 2CCMA 1UUSA 1R6PA 2EGDA 4FTGA 3JVTC 1DTLA 3A8RA 1IJ6A 3CR5X 1J7PA 1PSBA 1L2OC 1ODBA 2LP2A 3PM8A 2FCEA 1MXEA 2JC2A 3HX4A 1K93D 1QASA 1KFXS 3PFVA 4HRHA 5AEQA 3SG3A 3VRRA 5DKRA 1LXFC 1TNQA 3PN7B 1WY9A 3EK7A 3O6BA 1YUSA 2JULA 2WCBA 5I2OA 3I5IB 3D10A 2OPOA 1AUIB 4N5XA 2KYFA 2JNXA 2KDHA 1CM4A 1TN4A 1XFVO 2NLNA 4P2YB 1M39A 4PDZA 1TCOB 2KYCA 1KWOC 1PK0D 1YURA 2LHLA 2M1KB 3DD4A 3NXAA 3VRPA 1J7QA 1F71A 3LCPC 4OCIA 1QTXA 1YUUA 3H4SE 2LCPA 2NCPA 1XFYO 2F2OA 1A03A 1UWOA 4QJ5B 4JPZB 1W7IB 1K96A 3GOFA 3TDIA 4DUQA 1B7TZ 1CFPA 3TS5C 1Y1UA 2F2PA 5CSFA 1BR4B 1S26D 1SYMA 1QATA 3SIAA 2ZRTA 2CT9A 1AK8A 1K9UA 1YX8A 2LLUA 1DVIA 1XFZO 2AMIA 1GGWA 1K95A 1LVCD 5KSZA 2MAZA 2PALA 2LNKA 3FWCA 4OVNF 1WRKA 1QX5B 5HKYA 3LK0A 1EJ3A 4MRYA 1DJXA 1ZFSA 3PN7C 1RROA 2G2BA 1KFUL 3CR2A 1QX2A 3CLNA 4NDCA 2CNPA 3I5FC 1DMOA 2K7OA 4CIDA 2OS8C 4MN0A 1QIWA 5HKWA 1OQPA 2ZNDA 4L9MA 1OMDA 2E30A 1NX1A 3I5HB 1QLKA 1Y0VH 2M7LA 3SJSA 1NSHA 1OZSA 1SL7A 2BBNA 2JT8A 4GAOA 4I5NB 4TNCA 1QV0A 1QVIZ 2LVKA 1QVIY 1SK6D 2OTGB 1BOCA 2L51A 1S3PA 4YI9A 4FQOA 1CNPA 2EHBA 2R2IA 5AXIA 1NX3A 1PALA 1SPYA 3GK1A 5TNCA 1K8UA 1S1EA 2KFGA 1K90D 1WDCB 1IG5A 4ZCUA 2LHIA 1SCMB 1NIWA 2L0PA 1FW4A 4GPLB 3BYAA 1XYDA 4PALA 1W7JB 2P6BB 3BUMB 1Y1AA 2L50A 2F8PA 1S5GY 2I2RE 4GUKA 1BU3A 1DJWA 1K2HA 2HPSA 2M97A 3FS7A 2HF5A 1IWQA 2SCPA 2Y5IA 1B1GA 1BF5A 3OHMB 3RLZA 2BBMA 4C0LA 3AKAA 2KI6D 1Y6WA 1M31A 1UURA 1ZACA 3C1VA 1AJ4A 1GGZA 1UHIA 2LANA 2HQ8A 1RECA 4YI8A 3FIAA 1AHRA 4AQJA 3SG7A 4BY5A 4E68A 1TOPA 1JBAA 4YGDB 1IQ3A 2JQ6A 1JUOA 2AAOA 2F33A 1NP8A 3DVEA 2IS9A 1A75B 1G4YR 2OTGC 1RWYA 1NCYA 4USLA 1TIZA 1U5IA 2KAVA 3EVVA 3TUYC 3OB1B 1F4OA 1SL9A 2M3WA 1KK7Z 1WDCC 1KK7Y 2PVBA 3BUWB 2SASA 4CFQA 4GGFC 3GK4X 2LMVA 1SCMC 2M9GA 2V53A 2PRUA 2M0RA 2M29A 1ZOTB 5I2QA 1XK4A 3KO0A 4R1EA 1RJVA 1LA0A 1OSAA 4A4CA 1CDPA 2K2FA 5JOLA 5DKNA 1CDLA 1QJTA 3EKHA 3BUOB 1DJYA 1DF0A 3D0YB 2Y4QA 2KQ6A 2Q91A 2FOTA 1MUXA 4CLNA 4BY4A 1EL4A 4MZKA 5DKQA 5G08A 1CKKA 1JSAA 1SKTA 4NDBA 1F54A 4WQ3A 1M46A 3CS1A 1X02A 4Q04A 4ETOA 2BL0B 3PSRA 1A4PA 3O2PA 4NQGA 1BG1A 1F70A 1UHHA 4UPGA 1MXLC 3JTDC 2JOJA 2L4HA 5I8NA 2WC8A 1BMOA 1ALWA 4I5KA 3TZ1A 4PE4A 3IQOA 2H61A 2E6WA 2KSPA 2L98A 3MSEB 2KBIA 1OE9B 4YGEB 2LAPA 3KPXA 3CR4X 3NSOA 1KQMB 1B7TY 2M8UA 2BCAA 1KK8B 2I7AA 3ZNIA 3AAJA 1TNXA 2ZFDA 4MLWA 5AERA 1N2DA 4M2PA 2BKHB 3O78A 1MQ1A 2LP3A 3PATA 3KEVA 1SW8A 3F45A 1KFUS 4DRWA 3DF0B 1CMGA 1G33A 3VGOA 2KI4B 1SCVA 4HRGA 2JTZA 1JC2A 3KF9A 2JT3A 4WRIA 1EG3A 3WNXB 3WHTB 1U5IB 3I5IC 1Y1XA 3BOWA 2GV5A 2PASA 3DVMA 3E3RA 2QACA 4MEWA 2B1UA 1C07A 2KGBC 2COLB 2KGRA 2LVVA 1DJHA 4OR9B 1PRWA 1IGVA 4YBHB 2BKIB 4PHKA 4XJKA 1VRKA 4JQ0D 1QXPA 1XVJA 1CFDA 1D1OA 3TDUA 1A29A 1UHJA 3HCMA 5HYDA 2M7NA 1KQMC 4U8DA 1J55A 4HREE 2NZ0A 5J3XA 3AAKA 2O5GA 1SL8A 3BUNB 1BR1B 1K9PA 1NUBA 2LVJA 1F8HA 1M45A 5I2LA 4YGAA 2A4JA 4GBAA 2M1UA 1C7VA 3I5GB 1L7ZA 4ORAB 3EVRA 1YX7A 1S36A 4ZCVA 2KI4C 1IH0A 3EVUA 2JXLA 1QIVA 4MZJA 2DOQA 2I18A 4PHJA 1PVAA 1BODA 1SR6B 4C0JA 4PE1A 3BUXB 2LMUA 2M49B 1H8BA 2O60A 1YR5A 2ZRSA 5PALA 1J7OA 1SNLA 5BPJA 2L2EA 4ORCB 3I5HC 4AQIA 1QLSA 3BXKA 1WRLA 2MHHA 3PLFB 1AJ5A 3JVTB 2LE9B 2K2AA 3SG2A 1GJYA 1B47A 2BE4A 1CFCA 2ZNEA 2VRGA 3OP0A 3IF7A 3WHUB 1FPWA 2JTTA 4PE0A 1J1EA 2JU0A 1CB1A 2AUCA 1EH2A 1RTP1 4GGNA 4I5JA 4M2QA 4D1EA 3QRXA 2JRFA 2KFHA 4OKHA 1YVHA 3SIBA 4YRUA 2WNDA 2LMTA 5F6TA 1KCYA 2LV7A 3I5GC 1ALVA 3OX5A 1IJ5A 2KBMA 5FYXA 3BOWB 1YTZC 4A4BA 1J1DA 2LUXA 5CPVA 1RFJA 1KWOB 4MSPA 1NX2A 2KAXA 2PMYA 2CBLA 3DVKA 1CFFA 3ZWHA 1SR6C 4DS7A 1CMFA 2ZN8A 4N1FA 1CDNA 4XJKB 2KI6C 5HLVA 5CSIA 1J7RA 1NX0A 1MHOA 1IQ5A 5KU1A 2FJUB 1DJZA 3TS5B 1RK9A 2H2KA 4YGBB 1Q80A 1N65A 5HKZA 1B4CA 4WQ2A 2NCOA 1FI5A 2NXQA 2LLTA 1DJGA 1DGVA 1MR8A 3CGAA 2HETA 4QJ3B 3RM1A 2ZKMX 1CDMA 4PE7A 1K94A 3DVJA 1JF2A 1NYAA 1V1FA 4ORBB 5K89A 1CTRA 2D8NA 4PHNA 2CTNA 2G9BA 3NSKA 1IRJA 4MVFA 4CFRA 4GGFA 1OZOA 3WXAA 4M2OA 2MJWB 2QPTA 2CXJA 1UP5A 3TDZA 4GNKB 1PULA 5CSNA 2Q4UA 3CZTX 2K7CA 1HQVA 2LUCA 3KHEA 1B9AA 2EC6B 3OB2B 3I5FB 5JJGA 2OS8B 1KFXL 1XFUO 2GGZA 2JZIA 1K9KA 2Y1NA 1FF1A 1SBJA 1R2UA 4QJ4B 2LC5A 4MZLA 1CLBA 3VROA 3VRNA 1YRTB 3LLEA 1LINA 3BQ3A 1G8IA 1CM1A 2JNFA 1GQMA 2K8MB 1KSOA 1CLLA 3O4YA 5AANA 2ISDA 1MWNA 2RGIA 1E8AA 4IL1A 3OX6A 3CWGA 1A75A 1OOJA 2BL0C 2TN4A 1H4BA 1OMRA 1DGUA 4MRXA 3SG5A 3M0WA 5CSJA 4YGCB 1UHNA 2JXCA 1BLQA 2K61A 4P5OE 1DJIA 2F3YA 2HQWA 2L4IA 5B8IB 1DT7B 2LM5A 1AVSA 5ER5A 4N1GA 1JWDA 3SG6A 5GQQC 1B8RA 2KHNA 2BCXA 1SRAA 1WLMA 1M63B 2PSRA 1FI6A 3NSLA 1AP4A 1JFKA 1NPQA 2GGMA 1XFXO 2MRDA 2EC6C 1KK8C 2K7DA 1IKUA 4OV2A 2LVIA 4PHMA 5KTYA 3GK2A 1F4QA 2BCBA 2I94A 1XA5A 2JPTA 1DF0B 1WLZA 1FBVA 1B8LA 1ZUZA 2MBXA 1TNWA 2K7BA 2K0JA 2KNEA 5IBWA 2BE6A 5AFPA 3D0YA 2L5XB 1S6IA 1XO5A 3AKBA 1B8CA 3FWBA 1SY9A 4XYNA 1ZMZA 1HT9A 4F0ZB 3TUYB 1JFJA 2JT0A 2KFFA 3IQQA 2WOSA 3ICBA 4PCWA 1NWDA 1KQVA 3VRQA 1C7WA 2MA2A 3K21A 4DCKA 4MBEA 1S6JA 1LKJA 1S5GZ 1LA3A 1N0YA 2MLEC 4DIRA 4AOMA 5ER4X 1L2OB 2WORA 1TRFA 1XK4C 3EK4A 1KSMA 1CLMA 2ZN9A 2KOTA 1YVLA 1QV1A 3EK8A 5D69A 1EG4A 2F3ZA 4HSZA 1UHKA 2BECA 1JF0A 1PSRA 1OMVA 2WCEA 4NDDA 2LLSA 1QS7A 3PALA 3DF0A 4ICBA 2FCDA 1F55A 1TCFA 1YRUB 1SMGA 3LK1A 3CTNA 1XFWO
chains in the Genus database with same CATH superfamily
3SG4A 1EXRA 4C0KA 1TNPA 2KQYA 2KAYA 3A4UB 3JTDB 3LL8B 4I5LB 3SS5A 2WCFA 5HLOA 2FJYA 2Y1MA 1NCZA 1QX7A 1S6CA 4CPVA 1TUJA 1MF8B 2H61C 1BJFA 1NCXA 1PVBA 2MLFC 3NHTA 4JWQA 1BT6A 2JWWA 4GFTA 1YUTA 1TTXA 3EKJA 5D7FA 1A2XA 1V1GA 3NSIA 1WRZA 2CCMA 1UUSA 1R6PA 2EGDA 2GTEA 3JVTC 1DTLA 1T14A 4FTGA 3A8RA 1IJ6A 3CR5X 1J7PA 1PSBA 1L2OC 3DY9A 1ODBA 1W9ZA 2LP2A 3PM8A 2FCEA 1MXEA 2JC2A 3HX4A 1K93D 1XFRA 1QASA 1KFXS 3PFVA 4HRHA 5AEQA 3SG3A 3VRRA 3B7AA 5DKRA 1LXFC 1TNQA 3D73A 3PN7B 1WY9A 3EK7A 3O6BA 1YUSA 2JULA 2WCBA 5I2OA 3I5IB 3D10A 2OPOA 1AUIB 4N5XA 3B88A 2KYFA 2JNXA 2KDHA 1CM4A 1TN4A 1XFVO 2NLNA 4P2YB 1M39A 1OW4A 4PDZA 1TCOB 2KYCA 1KWOC 1PK0D 1YURA 2LHLA 2M1KB 3DD4A 3NXAA 3VRPA 1J7QA 1F71A 3LCPC 4OCIA 1QTXA 1YUUA 2PQLA 3H4SE 2LCPA 2NCPA 1XFYO 2F2OA 1A03A 1UWOA 4QJ5B 4JPZB 1W7IB 1K96A 3GOFA 3TDIA 4DUQA 1B7TZ 1CFPA 3TS5C 1Y1UA 3Q8IA 2F2PA 5CSFA 1BR4B 1S26D 1SYMA 2QEBA 1QATA 3SIAA 3UO9A 2ZRTA 2CT9A 1AK8A 5I8NA 1K9UA 1YX8A 2LLUA 1DVIA 1XFZO 2AMIA 1GGWA 1K95A 1LVCD 5KSZA 2MAZA 2PALA 2LNKA 2WCLA 3FWCA 4OVNF 1WRKA 4JKTA 1QX5B 5HKYA 3LK0A 2JPOA 1EJ3A 4MRYA 1DJXA 1ZFSA 3PN7C 1RROA 2G2BA 1KFUL 3CR2A 3O4XA 1QX2A 3CLNA 4NDCA 2CNPA 3I5FC 1DMOA 2K7OA 4CIDA 2OS8C 4MN0A 1QIWA 2WCHA 5HKWA 1OQPA 2ZNDA 4L9MA 1OMDA 2E30A 1NX1A 3I5HB 3DYEA 1QLKA 1Y0VH 2M7LA 3SJSA 1NSHA 1OZSA 1SL7A 2BBNA 2JT8A 4GAOA 4I5NB 4TNCA 1QV0A 1QVIZ 2LVKA 1QVIY 1SK6D 2OTGB 1BOCA 2L51A 1S3PA 4YI9A 4FQOA 1CNPA 2EHBA 2R2IA 5AXIA 1NX3A 2WC6A 1PALA 1SPYA 3GK1A 5TNCA 1K8UA 1S1EA 2KFGA 1K90D 3R72A 1WDCB 1IG5A 4ZCUA 2LHIA 3CZ0A 1SCMB 1NIWA 2L0PA 1FW4A 4GPLB 3BYAA 1XYDA 4PALA 1W7JB 2P6BB 3R1PA 3BUMB 1Y1AA 2L50A 2F8PA 1S5GY 2I2RE 3VB1A 4GUKA 1BU3A 1DJWA 1GM0A 1K2HA 2HPSA 1TUZA 2M97A 3FS7A 1IIOA 2HF5A 1IWQA 2SCPA 2Y5IA 1B1GA 1BF5A 3CZ1A 3OHMB 3RLZA 2BBMA 4C0LA 3AKAA 2KI6D 1Y6WA 3B87A 1M31A 1UURA 1ZACA 3C1VA 1AJ4A 1GGZA 1UHIA 2LANA 2HQ8A 1RECA 4YI8A 3FIAA 5HL1A 1AHRA 5EL2A 3B6XA 4AQJA 3SG7A 4BY5A 4E68A 1TOPA 2BAPA 4YGDB 1JBAA 1IQ3A 2JQ6A 3PJIA 1JUOA 2AAOA 2F33A 1NP8A 3CYZA 2IS9A 3DVEA 1A75B 1G4YR 2OTGC 1RWYA 1OOIX 3L47A 1NCYA 4USLA 1TIZA 1U5IA 2KAVA 3EVVA 1C3YA 3TUYC 3OB1B 1F4OA 1SL9A 2M3WA 1KK7Z 1WDCC 1KK7Y 2PVBA 3BUWB 2SASA 3R1VA 4CFQA 4GGFC 3GK4X 2LMVA 2P70A 1SCMC 2M9GA 2V53A 2PRUA 2KPHA 2M0RA 2M29A 1ZOTB 5I2QA 1XK4A 3KO0A 4R1EA 1RJVA 1LA0A 1OSAA 4A4CA 1CDPA 2K2FA 2L2CA 3IVTA 5JOLA 5DKNA 1CDLA 1QJTA 3EKHA 3BUOB 4KYNA 3NGVA 1DJYA 1DF0A 3D0YB 2Y4QA 2KQ6A 2Q91A 2FOTA 2KLDA 1MUXA 4CLNA 4BY4A 1EL4A 1OOFA 3SS4A 4MZKA 5DKQA 5G08A 1CKKA 1JSAA 1SKTA 4NDBA 1F54A 4WQ3A 1M46A 3CS1A 1X02A 4Q04A 4ETOA 2BL0B 3PSRA 1A4PA 3O2PA 4NQGA 1BG1A 1F70A 3S0GA 3CDNA 1UHHA 3D74A 4UPGA 1MXLC 3JTDC 2JOJA 2L4HA 4PT1A 2WC8A 1BMOA 1ALWA 5DICA 4I5KA 3TZ1A 4PE4A 3IQOA 2H61A 2E6WA 2KSPA 3S0DA 2L98A 2L5YA 3MSEB 2KBIA 1OE9B 4YGEB 2LAPA 3KPXA 3CR4X 3D77A 3NSOA 1KQMB 1B7TY 2M8UA 2BCAA 1KK8B 2I7AA 3ZNIA 3AAJA 1TNXA 2ZFDA 3OBVA 4MLWA 5AERA 1N2DA 3D78A 2BKHB 3O78A 4M2PA 1MQ1A 2LP3A 3PATA 4INWA 3KEVA 3OGNA 1SW8A 3F45A 1KFUS 4DRWA 2WC5A 3DF0B 1CMGA 2YGUA 1G33A 2WCMA 3VGOA 2KI4B 1SCVA 4HRGA 2JTZA 1JC2A 3KF9A 2JT3A 4WRIA 1EG3A 3WNXB 3WHTB 1U5IB 3I5IC 1Y1XA 2QDIA 1P28A 2GV5A 2PASA 3BOWA 3DVMA 3E3RA 2BNXA 3S0FA 3RZSA 2QACA 4MEWA 2B1UA 1C07A 3FE6A 5FI6A 2KGBC 2COLB 1Z2CB 2KGRA 2QEHA 2LVVA 1DJHA 4OR9B 1PRWA 1IGVA 4YBHB 3S0BA 2BKIB 4PHKA 4XJKA 1VRKA 3DZTA 1QXPA 4JQ0D 1XVJA 1CFDA 1D1OA 3TDUA 1A29A 1UHJA 3HCMA 5HYDA 2M7NA 1KQMC 4U8DA 1J55A 4HREE 2NZ0A 5J3XA 3AAKA 2O5GA 1SL8A 3BUNB 3K1EA 1BR1B 3UNWA 1K9PA 1NUBA 2LVJA 4JD9A 1M45A 5I2LA 1F8HA 4YGAA 2A4JA 4GBAA 2M1UA 1C7VA 3I5GB 1L7ZA 4ORAB 3D75A 3EVRA 1OOHA 1YX7A 1S36A 1DEKA 4ZCVA 2KI4C 1IH0A 3EVUA 3FE9A 2JXLA 1QIVA 3S0EA 3D76A 4MZJA 2DOQA 2I18A 4PHJA 1PVAA 1BODA 1SR6B 2PYQA 4C0JA 4PE1A 3BUXB 2LMUA 2M49B 1H8BA 2O60A 1YR5A 2ZRSA 5PALA 1J7OA 1SNLA 5BPJA 2L2EA 4ORCB 3I5HC 4AQIA 1QLSA 1Z4HA 3BXKA 5FI2A 1WRLA 2MHHA 3PLFB 1AJ5A 3JVTB 2LE9B 2K2AA 3SG2A 1GJYA 1B47A 2BE4A 1CFCA 2ZNEA 2VRGA 3OP0A 3IF7A 3WHUB 1FPWA 2JTTA 4PE0A 1J1EA 2JU0A 1CB1A 2AUCA 1EH2A 1RTP1 2KLEA 4GGNA 4I5JA 2QEVA 4M2QA 5FI7A 4D1EA 3QRXA 2JRFA 2KFHA 4OKHA 1YVHA 1DQEA 3SIBA 4YRUA 2WNDA 2LMTA 2H8VA 5F6TA 1KCYA 2LV7A 3I5GC 1ALVA 1TWOA 1IJ5A 2QEOA 2KBMA 3OX5A 3R1OA 3BOWB 1YTZC 5FYXA 5I94A 4A4BA 1J1DA 2LUXA 2WCJA 1OOGA 5CPVA 1RFJA 1KWOB 4MSPA 1NX2A 2K60A 3CABA 1DELA 2KAXA 2PMYA 2CBLA 3DVKA 1CFFA 3BJHA 3ZWHA 1SR6C 4DS7A 1CMFA 2ZN8A 4N1FA 1CDNA 4XJKB 2ERBA 2KI6C 5HLVA 5CSIA 1J7RA 1NX0A 1MHOA 1IQ5A 5KU1A 2FJUB 1DJZA 3TS5B 1RK9A 2H2KA 4YGBB 1Q80A 1N65A 3B86A 5HKZA 4WQ2A 2NCOA 1B4CA 2NXQA 2LLTA 1FI5A 1DJGA 1DGVA 1MR8A 3CGAA 2HETA 4QJ3B 3RM1A 2ZKMX 4F7FA 1CDMA 4PE7A 1K94A 3SS3A 3DVJA 1JF2A 1NYAA 1V1FA 4ORBB 5K89A 2WCKA 1CTRA 2D8NA 4PHNA 2CTNA 2G9BA 3NSKA 1IRJA 4FQTA 4MVFA 4CFRA 4GGFA 1OZOA 3WXAA 4M2OA 1C3ZA 2MJWB 2CXJA 1UP5A 2QPTA 3TDZA 4GNKB 1PULA 5CSNA 2Q4UA 3CZTX 2K7CA 1HQVA 2LUCA 3DXLA 3KHEA 1B9AA 2EC6B 3OB2B 3I5FB 4INXA 2OS8B 5JJGA 1KFXL 1XFUO 2GGZA 2JZIA 1K9KA 2Y1NA 1FF1A 1SBJA 1R2UA 4QJ4B 2LC5A 3CZ2A 4MZLA 1CLBA 3VROA 3VRNA 1YRTB 3LLEA 1LINA 3BQ3A 1G8IA 1CM1A 2JNFA 1GQMA 2K8MB 1KSOA 1CLLA 3O4YA 5AANA 2ISDA 1MWNA 4IJ7A 2RGIA 1E8AA 4IL1A 3L4AA 3OX6A 3CWGA 1A75A 1OOJA 2BL0C 2TN4A 1H4BA 1OMRA 1DGUA 1LS8A 4MRXA 3M0WA 5CSJA 3SG5A 4YGCB 1UHNA 2JXCA 1BLQA 2K61A 2P71A 4P5OE 1DJIA 2F3YA 2HQWA 2L4IA 5B8IB 1DT7B 2LM5A 1AVSA 3L4LA 5ER5A 4N1GA 1JWDA 3SG6A 5GQQC 1B8RA 2KHNA 2BCXA 1SRAA 1WLMA 1M63B 2PSRA 1FI6A 3NSLA 1AP4A 1JFKA 1NPQA 2GGMA 1XFXO 2MRDA 3EG5B 2EC6C 1KK8C 2K7DA 1IKUA 4OV2A 2LVIA 4PHMA 5KTYA 3S0AA 3GK2A 1F4QA 2BCBA 2I94A 1XA5A 2JPTA 1DF0B 1WLZA 1FBVA 1B8LA 1ZUZA 5D3OA 1TNWA 2K7BA 2K0JA 2KNEA 2MBXA 2BE6A 5AFPA 5IBWA 3D0YA 2L5XB 1S6IA 3PM2A 1XO5A 3AKBA 1B8CA 3FWBA 1SY9A 4XYNA 1ZMZA 1HT9A 4F0ZB 4OZDA 3TUYB 1JFJA 2JT0A 2KFFA 3IQQA 1ORGA 1SSEB 2WOSA 3FE8A 3ICBA 4PCWA 3V2LA 1NWDA 1KQVA 3VRQA 1C7WA 2MA2A 3K21A 4DCKA 3NHIA 4MBEA 1S6JA 1LKJA 1S5GZ 3BFBA 1LA3A 1N0YA 3BFAA 2MLEC 4DIRA 4AOMA 5ER4X 1L2OB 2WORA 1TRFA 1XK4C 1DC1A 3EK4A 1KSMA 1CLMA 2ZN9A 2KOTA 1YVLA 1QV1A 3EK8A 3BFHA 5D69A 1EG4A 2F3ZA 3QMEA 4HSZA 1UHKA 2BECA 1JF0A 1PSRA 1OMVA 2WCEA 4NDDA 2LLSA 1QS7A 3N7HA 3DF0A 3PALA 4ICBA 2FCDA 1F55A 1TCFA 1YRUB 1SMGA 3LK1A 3CTNA 1QWVA 1XFWO
chains in the Genus database with same CATH topology
3SG4A 1EXRA 4C0KA 1TNPA 2KQYA 2KAYA 3A4UB 3JTDB 3LL8B 4I5LB 2WCFA 5HLOA 2Y1MA 1NCZA 1QX7A 1S6CA 4CPVA 1MF8B 2H61C 1BJFA 1NCXA 1PVBA 2MLFC 4JWQA 1BT6A 2JWWA 4GFTA 1YUTA 1TTXA 3EKJA 5D7FA 1A2XA 1V1GA 3NSIA 1WRZA 2CCMA 1UUSA 1R6PA 2EGDA 4FTGA 3JVTC 1DTLA 3A8RA 1IJ6A 3CR5X 1J7PA 1PSBA 1L2OC 1ODBA 2LP2A 3PM8A 2FCEA 1MXEA 2JC2A 3HX4A 1K93D 1QASA 1KFXS 3PFVA 4HRHA 5AEQA 3SG3A 3VRRA 5DKRA 1LXFC 1TNQA 3PN7B 1WY9A 3EK7A 3O6BA 1YUSA 2JULA 2WCBA 5I2OA 3I5IB 3D10A 2OPOA 1AUIB 4N5XA 2KYFA 2JNXA 2KDHA 1CM4A 1TN4A 1XFVO 2NLNA 4P2YB 1M39A 4PDZA 1TCOB 2KYCA 1KWOC 1PK0D 1YURA 2LHLA 2M1KB 3DD4A 3NXAA 3VRPA 1J7QA 1F71A 3LCPC 4OCIA 1QTXA 1YUUA 3H4SE 2LCPA 2NCPA 1XFYO 2F2OA 1A03A 1UWOA 4QJ5B 4JPZB 1W7IB 1K96A 3GOFA 3TDIA 4DUQA 1B7TZ 1CFPA 3TS5C 1Y1UA 2F2PA 5CSFA 1BR4B 1S26D 1SYMA 1QATA 3SIAA 2ZRTA 2CT9A 1AK8A 1K9UA 1YX8A 2LLUA 1DVIA 1XFZO 2AMIA 1GGWA 1K95A 1LVCD 5KSZA 2MAZA 2PALA 2LNKA 3FWCA 4OVNF 1WRKA 1QX5B 5HKYA 3LK0A 1EJ3A 4MRYA 1DJXA 1ZFSA 3PN7C 1RROA 2G2BA 1KFUL 3CR2A 1QX2A 3CLNA 4NDCA 2CNPA 3I5FC 1DMOA 2K7OA 4CIDA 2OS8C 4MN0A 1QIWA 5HKWA 1OQPA 2ZNDA 4L9MA 1OMDA 2E30A 1NX1A 3I5HB 1QLKA 1Y0VH 2M7LA 3SJSA 1NSHA 1OZSA 1SL7A 2BBNA 2JT8A 4GAOA 4I5NB 4TNCA 1QV0A 1QVIZ 2LVKA 1QVIY 1SK6D 2OTGB 1BOCA 2L51A 1S3PA 4YI9A 4FQOA 1CNPA 2EHBA 2R2IA 5AXIA 1NX3A 1PALA 1SPYA 3GK1A 5TNCA 1K8UA 1S1EA 2KFGA 1K90D 1WDCB 1IG5A 4ZCUA 2LHIA 1SCMB 1NIWA 2L0PA 1FW4A 4GPLB 3BYAA 1XYDA 4PALA 1W7JB 2P6BB 3BUMB 1Y1AA 2L50A 2F8PA 1S5GY 2I2RE 4GUKA 1BU3A 1DJWA 1K2HA 2HPSA 2M97A 3FS7A 2HF5A 1IWQA 2SCPA 2Y5IA 1B1GA 1BF5A 3OHMB 3RLZA 2BBMA 4C0LA 3AKAA 2KI6D 1Y6WA 1M31A 1UURA 1ZACA 3C1VA 1AJ4A 1GGZA 1UHIA 2LANA 2HQ8A 1RECA 4YI8A 3FIAA 1AHRA 4AQJA 3SG7A 4BY5A 4E68A 1TOPA 1JBAA 4YGDB 1IQ3A 2JQ6A 1JUOA 2AAOA 2F33A 1NP8A 3DVEA 2IS9A 1A75B 1G4YR 2OTGC 1RWYA 1NCYA 4USLA 1TIZA 1U5IA 2KAVA 3EVVA 3TUYC 3OB1B 1F4OA 1SL9A 2M3WA 1KK7Z 1WDCC 1KK7Y 2PVBA 3BUWB 2SASA 4CFQA 4GGFC 3GK4X 2LMVA 1SCMC 2M9GA 2V53A 2PRUA 2M0RA 2M29A 1ZOTB 5I2QA 1XK4A 3KO0A 4R1EA 1RJVA 1LA0A 1OSAA 4A4CA 1CDPA 2K2FA 5JOLA 5DKNA 1CDLA 1QJTA 3EKHA 3BUOB 1DJYA 1DF0A 3D0YB 2Y4QA 2KQ6A 2Q91A 2FOTA 1MUXA 4CLNA 4BY4A 1EL4A 4MZKA 5DKQA 5G08A 1CKKA 1JSAA 1SKTA 4NDBA 1F54A 4WQ3A 1M46A 3CS1A 1X02A 4Q04A 4ETOA 2BL0B 3PSRA 1A4PA 3O2PA 4NQGA 1BG1A 1F70A 1UHHA 4UPGA 1MXLC 3JTDC 2JOJA 2L4HA 5I8NA 2WC8A 1BMOA 1ALWA 4I5KA 3TZ1A 4PE4A 3IQOA 2H61A 2E6WA 2KSPA 2L98A 3MSEB 2KBIA 1OE9B 4YGEB 2LAPA 3KPXA 3CR4X 3NSOA 1KQMB 1B7TY 2M8UA 2BCAA 1KK8B 2I7AA 3ZNIA 3AAJA 1TNXA 2ZFDA 4MLWA 5AERA 1N2DA 4M2PA 2BKHB 3O78A 1MQ1A 2LP3A 3PATA 3KEVA 1SW8A 3F45A 1KFUS 4DRWA 3DF0B 1CMGA 1G33A 3VGOA 2KI4B 1SCVA 4HRGA 2JTZA 1JC2A 3KF9A 2JT3A 4WRIA 1EG3A 3WNXB 3WHTB 1U5IB 3I5IC 1Y1XA 3BOWA 2GV5A 2PASA 3DVMA 3E3RA 2QACA 4MEWA 2B1UA 1C07A 2KGBC 2COLB 2KGRA 2LVVA 1DJHA 4OR9B 1PRWA 1IGVA 4YBHB 2BKIB 4PHKA 4XJKA 1VRKA 4JQ0D 1QXPA 1XVJA 1CFDA 1D1OA 3TDUA 1A29A 1UHJA 3HCMA 5HYDA 2M7NA 1KQMC 4U8DA 1J55A 4HREE 2NZ0A 5J3XA 3AAKA 2O5GA 1SL8A 3BUNB 1BR1B 1K9PA 1NUBA 2LVJA 1F8HA 1M45A 5I2LA 4YGAA 2A4JA 4GBAA 2M1UA 1C7VA 3I5GB 1L7ZA 4ORAB 3EVRA 1YX7A 1S36A 4ZCVA 2KI4C 1IH0A 3EVUA 2JXLA 1QIVA 4MZJA 2DOQA 2I18A 4PHJA 1PVAA 1BODA 1SR6B 4C0JA 4PE1A 3BUXB 2LMUA 2M49B 1H8BA 2O60A 1YR5A 2ZRSA 5PALA 1J7OA 1SNLA 5BPJA 2L2EA 4ORCB 3I5HC 4AQIA 1QLSA 3BXKA 1WRLA 2MHHA 3PLFB 1AJ5A 3JVTB 2LE9B 2K2AA 3SG2A 1GJYA 1B47A 2BE4A 1CFCA 2ZNEA 2VRGA 3OP0A 3IF7A 3WHUB 1FPWA 2JTTA 4PE0A 1J1EA 2JU0A 1CB1A 2AUCA 1EH2A 1RTP1 4GGNA 4I5JA 4M2QA 4D1EA 3QRXA 2JRFA 2KFHA 4OKHA 1YVHA 3SIBA 4YRUA 2WNDA 2LMTA 5F6TA 1KCYA 2LV7A 3I5GC 1ALVA 3OX5A 1IJ5A 2KBMA 5FYXA 3BOWB 1YTZC 4A4BA 1J1DA 2LUXA 5CPVA 1RFJA 1KWOB 4MSPA 1NX2A 2KAXA 2PMYA 2CBLA 3DVKA 1CFFA 3ZWHA 1SR6C 4DS7A 1CMFA 2ZN8A 4N1FA 1CDNA 4XJKB 2KI6C 5HLVA 5CSIA 1J7RA 1NX0A 1MHOA 1IQ5A 5KU1A 2FJUB 1DJZA 3TS5B 1RK9A 2H2KA 4YGBB 1Q80A 1N65A 5HKZA 1B4CA 4WQ2A 2NCOA 1FI5A 2NXQA 2LLTA 1DJGA 1DGVA 1MR8A 3CGAA 2HETA 4QJ3B 3RM1A 2ZKMX 1CDMA 4PE7A 1K94A 3DVJA 1JF2A 1NYAA 1V1FA 4ORBB 5K89A 1CTRA 2D8NA 4PHNA 2CTNA 2G9BA 3NSKA 1IRJA 4MVFA 4CFRA 4GGFA 1OZOA 3WXAA 4M2OA 2MJWB 2QPTA 2CXJA 1UP5A 3TDZA 4GNKB 1PULA 5CSNA 2Q4UA 3CZTX 2K7CA 1HQVA 2LUCA 3KHEA 1B9AA 2EC6B 3OB2B 3I5FB 5JJGA 2OS8B 1KFXL 1XFUO 2GGZA 2JZIA 1K9KA 2Y1NA 1FF1A 1SBJA 1R2UA 4QJ4B 2LC5A 4MZLA 1CLBA 3VROA 3VRNA 1YRTB 3LLEA 1LINA 3BQ3A 1G8IA 1CM1A 2JNFA 1GQMA 2K8MB 1KSOA 1CLLA 3O4YA 5AANA 2ISDA 1MWNA 2RGIA 1E8AA 4IL1A 3OX6A 3CWGA 1A75A 1OOJA 2BL0C 2TN4A 1H4BA 1OMRA 1DGUA 4MRXA 3SG5A 3M0WA 5CSJA 4YGCB 1UHNA 2JXCA 1BLQA 2K61A 4P5OE 1DJIA 2F3YA 2HQWA 2L4IA 5B8IB 1DT7B 2LM5A 1AVSA 5ER5A 4N1GA 1JWDA 3SG6A 5GQQC 1B8RA 2KHNA 2BCXA 1SRAA 1WLMA 1M63B 2PSRA 1FI6A 3NSLA 1AP4A 1JFKA 1NPQA 2GGMA 1XFXO 2MRDA 2EC6C 1KK8C 2K7DA 1IKUA 4OV2A 2LVIA 4PHMA 5KTYA 3GK2A 1F4QA 2BCBA 2I94A 1XA5A 2JPTA 1DF0B 1WLZA 1FBVA 1B8LA 1ZUZA 2MBXA 1TNWA 2K7BA 2K0JA 2KNEA 5IBWA 2BE6A 5AFPA 3D0YA 2L5XB 1S6IA 1XO5A 3AKBA 1B8CA 3FWBA 1SY9A 4XYNA 1ZMZA 1HT9A 4F0ZB 3TUYB 1JFJA 2JT0A 2KFFA 3IQQA 2WOSA 3ICBA 4PCWA 1NWDA 1KQVA 3VRQA 1C7WA 2MA2A 3K21A 4DCKA 4MBEA 1S6JA 1LKJA 1S5GZ 1LA3A 1N0YA 2MLEC 4DIRA 4AOMA 5ER4X 1L2OB 2WORA 1TRFA 1XK4C 3EK4A 1KSMA 1CLMA 2ZN9A 2KOTA 1YVLA 1QV1A 3EK8A 5D69A 1EG4A 2F3ZA 4HSZA 1UHKA 2BECA 1JF0A 1PSRA 1OMVA 2WCEA 4NDDA 2LLSA 1QS7A 3PALA 3DF0A 4ICBA 2FCDA 1F55A 1TCFA 1YRUB 1SMGA 3LK1A 3CTNA 1XFWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG4 A;  1EXR A;  4C0K A;  1TNP A;  2KQY A;  2KAY A;  3A4U B;  3JTD B;  3LL8 B;  4I5L B;  2WCF A;  5HLO A;  2Y1M A;  1NCZ A;  1QX7 A;  1S6C A;  4CPV A;  1MF8 B;  2H61 C;  1BJF A;  1NCX A;  1PVB A;  2MLF C;  4JWQ A;  1BT6 A;  2JWW A;  4GFT A;  1YUT A;  1TTX A;  3EKJ A;  5D7F A;  1A2X A;  1V1G A;  3NSI A;  1WRZ A;  2CCM A;  1UUS A;  1R6P A;  2EGD A;  4FTG A;  3JVT C;  1DTL A;  3A8R A;  1IJ6 A;  3CR5 X;  1J7P A;  1PSB A;  1L2O C;  1ODB A;  2LP2 A;  3PM8 A;  2FCE A;  1MXE A;  2JC2 A;  3HX4 A;  1K93 D;  1QAS A;  1KFX S;  3PFV A;  4HRH A;  5AEQ A;  3SG3 A;  3VRR A;  5DKR A;  1LXF C;  1TNQ A;  3PN7 B;  1WY9 A;  3EK7 A;  3O6B A;  1YUS A;  2JUL A;  2WCB A;  5I2O A;  3I5I B;  3D10 A;  2OPO A;  1AUI B;  4N5X A;  2KYF A;  2JNX A;  2KDH A;  1CM4 A;  1TN4 A;  1XFV O;  2NLN A;  4P2Y B;  1M39 A;  4PDZ A;  1TCO B;  2KYC A;  1KWO C;  1PK0 D;  1YUR A;  2LHL A;  2M1K B;  3DD4 A;  3NXA A;  3VRP A;  1J7Q A;  1F71 A;  3LCP C;  4OCI A;  1QTX A;  1YUU A;  3H4S E;  2LCP A;  2NCP A;  1XFY O;  2F2O A;  1A03 A;  1UWO A;  4QJ5 B;  4JPZ B;  1W7I B;  1K96 A;  3GOF A;  3TDI A;  4DUQ A;  1B7T Z;  1CFP A;  3TS5 C;  1Y1U A;  2F2P A;  5CSF A;  1BR4 B;  1S26 D;  1SYM A;  1QAT A;  3SIA A;  2ZRT A;  2CT9 A;  1AK8 A;  1K9U A;  1YX8 A;  2LLU A;  1DVI A;  1XFZ O;  2AMI A;  1GGW A;  1K95 A;  1LVC D;  5KSZ A;  2MAZ A;  2PAL A;  2LNK A;  3FWC A;  4OVN F;  1WRK A;  1QX5 B;  5HKY A;  3LK0 A;  1EJ3 A;  4MRY A;  1DJX A;  1ZFS A;  3PN7 C;  1RRO A;  2G2B A;  1KFU L;  3CR2 A;  1QX2 A;  3CLN A;  4NDC A;  2CNP A;  3I5F C;  1DMO A;  2K7O A;  4CID A;  2OS8 C;  4MN0 A;  1QIW A;  5HKW A;  1OQP A;  2ZND A;  4L9M A;  1OMD A;  2E30 A;  1NX1 A;  3I5H B;  1QLK A;  1Y0V H;  2M7L A;  3SJS A;  1NSH A;  1OZS A;  1SL7 A;  2BBN A;  2JT8 A;  4GAO A;  4I5N B;  4TNC A;  1QV0 A;  1QVI Z;  2LVK A;  1QVI Y;  1SK6 D;  2OTG B;  1BOC A;  2L51 A;  1S3P A;  4YI9 A;  4FQO A;  1CNP A;  2EHB A;  2R2I A;  5AXI A;  1NX3 A;  1PAL A;  1SPY A;  3GK1 A;  5TNC A;  1K8U A;  1S1E A;  2KFG A;  1K90 D;  1WDC B;  1IG5 A;  4ZCU A;  2LHI A;  1SCM B;  1NIW A;  2L0P A;  1FW4 A;  4GPL B;  3BYA A;  1XYD A;  4PAL A;  1W7J B;  2P6B B;  3BUM B;  1Y1A A;  2L50 A;  2F8P A;  1S5G Y;  2I2R E;  4GUK A;  1BU3 A;  1DJW A;  1K2H A;  2HPS A;  2M97 A;  3FS7 A;  2HF5 A;  1IWQ A;  2SCP A;  2Y5I A;  1B1G A;  1BF5 A;  3OHM B;  3RLZ A;  2BBM A;  4C0L A;  3AKA A;  2KI6 D;  1Y6W A;  1M31 A;  1UUR A;  1ZAC A;  3C1V A;  1AJ4 A;  1GGZ A;  1UHI A;  2LAN A;  2HQ8 A;  1REC A;  4YI8 A;  3FIA A;  1AHR A;  4AQJ A;  3SG7 A;  4BY5 A;  4E68 A;  1TOP A;  1JBA A;  4YGD B;  1IQ3 A;  2JQ6 A;  1JUO A;  2AAO A;  2F33 A;  1NP8 A;  3DVE A;  2IS9 A;  1A75 B;  1G4Y R;  2OTG C;  1RWY A;  1NCY A;  4USL A;  1TIZ A;  1U5I A;  2KAV A;  3EVV A;  3TUY C;  3OB1 B;  1F4O A;  1SL9 A;  2M3W A;  1KK7 Z;  1WDC C;  1KK7 Y;  2PVB A;  3BUW B;  2SAS A;  4CFQ A;  4GGF C;  3GK4 X;  2LMV A;  1SCM C;  2M9G A;  2V53 A;  2PRU A;  2M0R A;  2M29 A;  1ZOT B;  5I2Q A;  1XK4 A;  3KO0 A;  4R1E A;  1RJV A;  1LA0 A;  1OSA A;  4A4C A;  1CDP A;  2K2F A;  5JOL A;  5DKN A;  1CDL A;  1QJT A;  3EKH A;  3BUO B;  1DJY A;  1DF0 A;  3D0Y B;  2Y4Q A;  2KQ6 A;  2Q91 A;  2FOT A;  1MUX A;  4CLN A;  4BY4 A;  1EL4 A;  4MZK A;  5DKQ A;  5G08 A;  1CKK A;  1JSA A;  1SKT A;  4NDB A;  1F54 A;  4WQ3 A;  1M46 A;  3CS1 A;  1X02 A;  4Q04 A;  4ETO A;  2BL0 B;  3PSR A;  1A4P A;  3O2P A;  4NQG A;  1BG1 A;  1F70 A;  1UHH A;  4UPG A;  1MXL C;  3JTD C;  2JOJ A;  2L4H A;  5I8N A;  2WC8 A;  1BMO A;  1ALW A;  4I5K A;  3TZ1 A;  4PE4 A;  3IQO A;  2H61 A;  2E6W A;  2KSP A;  2L98 A;  3MSE B;  2KBI A;  1OE9 B;  4YGE B;  2LAP A;  3KPX A;  3CR4 X;  3NSO A;  1KQM B;  1B7T Y;  2M8U A;  2BCA A;  1KK8 B;  2I7A A;  3ZNI A;  3AAJ A;  1TNX A;  2ZFD A;  4MLW A;  5AER A;  1N2D A;  4M2P A;  2BKH B;  3O78 A;  1MQ1 A;  2LP3 A;  3PAT A;  3KEV A;  1SW8 A;  3F45 A;  1KFU S;  4DRW A;  3DF0 B;  1CMG A;  1G33 A;  3VGO A;  2KI4 B;  1SCV A;  4HRG A;  2JTZ A;  1JC2 A;  3KF9 A;  2JT3 A;  4WRI A;  1EG3 A;  3WNX B;  3WHT B;  1U5I B;  3I5I C;  1Y1X A;  3BOW A;  2GV5 A;  2PAS A;  3DVM A;  3E3R A;  2QAC A;  4MEW A;  2B1U A;  1C07 A;  2KGB C;  2COL B;  2KGR A;  2LVV A;  1DJH A;  4OR9 B;  1PRW A;  1IGV A;  4YBH B;  2BKI B;  4PHK A;  4XJK A;  1VRK A;  4JQ0 D;  1QXP A;  1XVJ A;  1CFD A;  1D1O A;  3TDU A;  1A29 A;  1UHJ A;  3HCM A;  5HYD A;  2M7N A;  1KQM C;  4U8D A;  1J55 A;  4HRE E;  2NZ0 A;  5J3X A;  3AAK A;  2O5G A;  1SL8 A;  3BUN B;  1BR1 B;  1K9P A;  1NUB A;  2LVJ A;  1F8H A;  1M45 A;  5I2L A;  4YGA A;  2A4J A;  4GBA A;  2M1U A;  1C7V A;  3I5G B;  1L7Z A;  4ORA B;  3EVR A;  1YX7 A;  1S36 A;  4ZCV A;  2KI4 C;  1IH0 A;  3EVU A;  2JXL A;  1QIV A;  4MZJ A;  2DOQ A;  2I18 A;  4PHJ A;  1PVA A;  1BOD A;  1SR6 B;  4C0J A;  4PE1 A;  3BUX B;  2LMU A;  2M49 B;  1H8B A;  2O60 A;  1YR5 A;  2ZRS A;  5PAL A;  1J7O A;  1SNL A;  5BPJ A;  2L2E A;  4ORC B;  3I5H C;  4AQI A;  1QLS A;  3BXK A;  1WRL A;  2MHH A;  3PLF B;  1AJ5 A;  3JVT B;  2LE9 B;  2K2A A;  3SG2 A;  1GJY A;  1B47 A;  2BE4 A;  1CFC A;  2ZNE A;  2VRG A;  3OP0 A;  3IF7 A;  3WHU B;  1FPW A;  2JTT A;  4PE0 A;  1J1E A;  2JU0 A;  1CB1 A;  2AUC A;  1EH2 A;  1RTP 1;  4GGN A;  4I5J A;  4M2Q A;  4D1E A;  3QRX A;  2JRF A;  2KFH A;  4OKH A;  1YVH A;  3SIB A;  4YRU A;  2WND A;  2LMT A;  5F6T A;  1KCY A;  2LV7 A;  3I5G C;  1ALV A;  3OX5 A;  1IJ5 A;  2KBM A;  5FYX A;  3BOW B;  1YTZ C;  4A4B A;  1J1D A;  2LUX A;  5CPV A;  1RFJ A;  1KWO B;  4MSP A;  1NX2 A;  2KAX A;  2PMY A;  2CBL A;  3DVK A;  1CFF A;  3ZWH A;  1SR6 C;  4DS7 A;  1CMF A;  2ZN8 A;  4N1F A;  1CDN A;  4XJK B;  2KI6 C;  5HLV A;  5CSI A;  1J7R A;  1NX0 A;  1MHO A;  1IQ5 A;  5KU1 A;  2FJU B;  1DJZ A;  3TS5 B;  1RK9 A;  2H2K A;  4YGB B;  1Q80 A;  1N65 A;  5HKZ A;  1B4C A;  4WQ2 A;  2NCO A;  1FI5 A;  2NXQ A;  2LLT A;  1DJG A;  1DGV A;  1MR8 A;  3CGA A;  2HET A;  4QJ3 B;  3RM1 A;  2ZKM X;  1CDM A;  4PE7 A;  1K94 A;  3DVJ A;  1JF2 A;  1NYA A;  1V1F A;  4ORB B;  5K89 A;  1CTR A;  2D8N A;  4PHN A;  2CTN A;  2G9B A;  3NSK A;  1IRJ A;  4MVF A;  4CFR A;  4GGF A;  1OZO A;  3WXA A;  4M2O A;  2MJW B;  2QPT A;  2CXJ A;  1UP5 A;  3TDZ A;  4GNK B;  1PUL A;  5CSN A;  2Q4U A;  3CZT X;  2K7C A;  1HQV A;  2LUC A;  3KHE A;  1B9A A;  2EC6 B;  3OB2 B;  3I5F B;  5JJG A;  2OS8 B;  1KFX L;  1XFU O;  2GGZ A;  2JZI A;  1K9K A;  2Y1N A;  1FF1 A;  1SBJ A;  1R2U A;  4QJ4 B;  2LC5 A;  4MZL A;  1CLB A;  3VRO A;  3VRN A;  1YRT B;  3LLE A;  1LIN A;  3BQ3 A;  1G8I A;  1CM1 A;  2JNF A;  1GQM A;  2K8M B;  1KSO A;  1CLL A;  3O4Y A;  5AAN A;  2ISD A;  1MWN A;  2RGI A;  1E8A A;  4IL1 A;  3OX6 A;  3CWG A;  1A75 A;  1OOJ A;  2BL0 C;  2TN4 A;  1H4B A;  1OMR A;  1DGU A;  4MRX A;  3SG5 A;  3M0W A;  5CSJ A;  4YGC B;  1UHN A;  2JXC A;  1BLQ A;  2K61 A;  4P5O E;  1DJI A;  2F3Y A;  2HQW A;  2L4I A;  5B8I B;  1DT7 B;  2LM5 A;  1AVS A;  5ER5 A;  4N1G A;  1JWD A;  3SG6 A;  5GQQ C;  1B8R A;  2KHN A;  2BCX A;  1SRA A;  1WLM A;  1M63 B;  2PSR A;  1FI6 A;  3NSL A;  1AP4 A;  1JFK A;  1NPQ A;  2GGM A;  1XFX O;  2MRD A;  2EC6 C;  1KK8 C;  2K7D A;  1IKU A;  4OV2 A;  2LVI A;  4PHM A;  5KTY A;  3GK2 A;  1F4Q A;  2BCB A;  2I94 A;  1XA5 A;  2JPT A;  1DF0 B;  1WLZ A;  1FBV A;  1B8L A;  1ZUZ A;  2MBX A;  1TNW A;  2K7B A;  2K0J A;  2KNE A;  5IBW A;  2BE6 A;  5AFP A;  3D0Y A;  2L5X B;  1S6I A;  1XO5 A;  3AKB A;  1B8C A;  3FWB A;  1SY9 A;  4XYN A;  1ZMZ A;  1HT9 A;  4F0Z B;  3TUY B;  1JFJ A;  2JT0 A;  2KFF A;  3IQQ A;  2WOS A;  3ICB A;  4PCW A;  1NWD A;  1KQV A;  3VRQ A;  1C7W A;  2MA2 A;  3K21 A;  4DCK A;  4MBE A;  1S6J A;  1LKJ A;  1S5G Z;  1LA3 A;  1N0Y A;  2MLE C;  4DIR A;  4AOM A;  5ER4 X;  1L2O B;  2WOR A;  1TRF A;  1XK4 C;  3EK4 A;  1KSM A;  1CLM A;  2ZN9 A;  2KOT A;  1YVL A;  1QV1 A;  3EK8 A;  5D69 A;  1EG4 A;  2F3Z A;  4HSZ A;  1UHK A;  2BEC A;  1JF0 A;  1PSR A;  1OMV A;  2WCE A;  4NDD A;  2LLS A;  1QS7 A;  3PAL A;  3DF0 A;  4ICB A;  2FCD A;  1F55 A;  1TCF A;  1YRU B;  1SMG A;  3LK1 A;  3CTN A;  1XFW O; 
#chains in the Genus database with same CATH topology
 3SG4 A;  1EXR A;  4C0K A;  1TNP A;  2KQY A;  2KAY A;  3A4U B;  3JTD B;  3LL8 B;  4I5L B;  3SS5 A;  2WCF A;  5HLO A;  2FJY A;  2Y1M A;  1NCZ A;  1QX7 A;  1S6C A;  4CPV A;  1TUJ A;  1MF8 B;  2H61 C;  1BJF A;  1NCX A;  1PVB A;  2MLF C;  3NHT A;  4JWQ A;  1BT6 A;  2JWW A;  4GFT A;  1YUT A;  1TTX A;  3EKJ A;  5D7F A;  1A2X A;  1V1G A;  3NSI A;  1WRZ A;  2CCM A;  1UUS A;  1R6P A;  2EGD A;  2GTE A;  3JVT C;  1DTL A;  1T14 A;  4FTG A;  3A8R A;  1IJ6 A;  3CR5 X;  1J7P A;  1PSB A;  1L2O C;  3DY9 A;  1ODB A;  1W9Z A;  2LP2 A;  3PM8 A;  2FCE A;  1MXE A;  2JC2 A;  3HX4 A;  1K93 D;  1XFR A;  1QAS A;  1KFX S;  3PFV A;  4HRH A;  5AEQ A;  3SG3 A;  3VRR A;  3B7A A;  5DKR A;  1LXF C;  1TNQ A;  3D73 A;  3PN7 B;  1WY9 A;  3EK7 A;  3O6B A;  1YUS A;  2JUL A;  2WCB A;  5I2O A;  3I5I B;  3D10 A;  2OPO A;  1AUI B;  4N5X A;  3B88 A;  2KYF A;  2JNX A;  2KDH A;  1CM4 A;  1TN4 A;  1XFV O;  2NLN A;  4P2Y B;  1M39 A;  1OW4 A;  4PDZ A;  1TCO B;  2KYC A;  1KWO C;  1PK0 D;  1YUR A;  2LHL A;  2M1K B;  3DD4 A;  3NXA A;  3VRP A;  1J7Q A;  1F71 A;  3LCP C;  4OCI A;  1QTX A;  1YUU A;  2PQL A;  3H4S E;  2LCP A;  2NCP A;  1XFY O;  2F2O A;  1A03 A;  1UWO A;  4QJ5 B;  4JPZ B;  1W7I B;  1K96 A;  3GOF A;  3TDI A;  4DUQ A;  1B7T Z;  1CFP A;  3TS5 C;  1Y1U A;  3Q8I A;  2F2P A;  5CSF A;  1BR4 B;  1S26 D;  1SYM A;  2QEB A;  1QAT A;  3SIA A;  3UO9 A;  2ZRT A;  2CT9 A;  1AK8 A;  5I8N A;  1K9U A;  1YX8 A;  2LLU A;  1DVI A;  1XFZ O;  2AMI A;  1GGW A;  1K95 A;  1LVC D;  5KSZ A;  2MAZ A;  2PAL A;  2LNK A;  2WCL A;  3FWC A;  4OVN F;  1WRK A;  4JKT A;  1QX5 B;  5HKY A;  3LK0 A;  2JPO A;  1EJ3 A;  4MRY A;  1DJX A;  1ZFS A;  3PN7 C;  1RRO A;  2G2B A;  1KFU L;  3CR2 A;  3O4X A;  1QX2 A;  3CLN A;  4NDC A;  2CNP A;  3I5F C;  1DMO A;  2K7O A;  4CID A;  2OS8 C;  4MN0 A;  1QIW A;  2WCH A;  5HKW A;  1OQP A;  2ZND A;  4L9M A;  1OMD A;  2E30 A;  1NX1 A;  3I5H B;  3DYE A;  1QLK A;  1Y0V H;  2M7L A;  3SJS A;  1NSH A;  1OZS A;  1SL7 A;  2BBN A;  2JT8 A;  4GAO A;  4I5N B;  4TNC A;  1QV0 A;  1QVI Z;  2LVK A;  1QVI Y;  1SK6 D;  2OTG B;  1BOC A;  2L51 A;  1S3P A;  4YI9 A;  4FQO A;  1CNP A;  2EHB A;  2R2I A;  5AXI A;  1NX3 A;  2WC6 A;  1PAL A;  1SPY A;  3GK1 A;  5TNC A;  1K8U A;  1S1E A;  2KFG A;  1K90 D;  3R72 A;  1WDC B;  1IG5 A;  4ZCU A;  2LHI A;  3CZ0 A;  1SCM B;  1NIW A;  2L0P A;  1FW4 A;  4GPL B;  3BYA A;  1XYD A;  4PAL A;  1W7J B;  2P6B B;  3R1P A;  3BUM B;  1Y1A A;  2L50 A;  2F8P A;  1S5G Y;  2I2R E;  3VB1 A;  4GUK A;  1BU3 A;  1DJW A;  1GM0 A;  1K2H A;  2HPS A;  1TUZ A;  2M97 A;  3FS7 A;  1IIO A;  2HF5 A;  1IWQ A;  2SCP A;  2Y5I A;  1B1G A;  1BF5 A;  3CZ1 A;  3OHM B;  3RLZ A;  2BBM A;  4C0L A;  3AKA A;  2KI6 D;  1Y6W A;  3B87 A;  1M31 A;  1UUR A;  1ZAC A;  3C1V A;  1AJ4 A;  1GGZ A;  1UHI A;  2LAN A;  2HQ8 A;  1REC A;  4YI8 A;  3FIA A;  5HL1 A;  1AHR A;  5EL2 A;  3B6X A;  4AQJ A;  3SG7 A;  4BY5 A;  4E68 A;  1TOP A;  2BAP A;  4YGD B;  1JBA A;  1IQ3 A;  2JQ6 A;  3PJI A;  1JUO A;  2AAO A;  2F33 A;  1NP8 A;  3CYZ A;  2IS9 A;  3DVE A;  1A75 B;  1G4Y R;  2OTG C;  1RWY A;  1OOI X;  3L47 A;  1NCY A;  4USL A;  1TIZ A;  1U5I A;  2KAV A;  3EVV A;  1C3Y A;  3TUY C;  3OB1 B;  1F4O A;  1SL9 A;  2M3W A;  1KK7 Z;  1WDC C;  1KK7 Y;  2PVB A;  3BUW B;  2SAS A;  3R1V A;  4CFQ A;  4GGF C;  3GK4 X;  2LMV A;  2P70 A;  1SCM C;  2M9G A;  2V53 A;  2PRU A;  2KPH A;  2M0R A;  2M29 A;  1ZOT B;  5I2Q A;  1XK4 A;  3KO0 A;  4R1E A;  1RJV A;  1LA0 A;  1OSA A;  4A4C A;  1CDP A;  2K2F A;  2L2C A;  3IVT A;  5JOL A;  5DKN A;  1CDL A;  1QJT A;  3EKH A;  3BUO B;  4KYN A;  3NGV A;  1DJY A;  1DF0 A;  3D0Y B;  2Y4Q A;  2KQ6 A;  2Q91 A;  2FOT A;  2KLD A;  1MUX A;  4CLN A;  4BY4 A;  1EL4 A;  1OOF A;  3SS4 A;  4MZK A;  5DKQ A;  5G08 A;  1CKK A;  1JSA A;  1SKT A;  4NDB A;  1F54 A;  4WQ3 A;  1M46 A;  3CS1 A;  1X02 A;  4Q04 A;  4ETO A;  2BL0 B;  3PSR A;  1A4P A;  3O2P A;  4NQG A;  1BG1 A;  1F70 A;  3S0G A;  3CDN A;  1UHH A;  3D74 A;  4UPG A;  1MXL C;  3JTD C;  2JOJ A;  2L4H A;  4PT1 A;  2WC8 A;  1BMO A;  1ALW A;  5DIC A;  4I5K A;  3TZ1 A;  4PE4 A;  3IQO A;  2H61 A;  2E6W A;  2KSP A;  3S0D A;  2L98 A;  2L5Y A;  3MSE B;  2KBI A;  1OE9 B;  4YGE B;  2LAP A;  3KPX A;  3CR4 X;  3D77 A;  3NSO A;  1KQM B;  1B7T Y;  2M8U A;  2BCA A;  1KK8 B;  2I7A A;  3ZNI A;  3AAJ A;  1TNX A;  2ZFD A;  3OBV A;  4MLW A;  5AER A;  1N2D A;  3D78 A;  2BKH B;  3O78 A;  4M2P A;  1MQ1 A;  2LP3 A;  3PAT A;  4INW A;  3KEV A;  3OGN A;  1SW8 A;  3F45 A;  1KFU S;  4DRW A;  2WC5 A;  3DF0 B;  1CMG A;  2YGU A;  1G33 A;  2WCM A;  3VGO A;  2KI4 B;  1SCV A;  4HRG A;  2JTZ A;  1JC2 A;  3KF9 A;  2JT3 A;  4WRI A;  1EG3 A;  3WNX B;  3WHT B;  1U5I B;  3I5I C;  1Y1X A;  2QDI A;  1P28 A;  2GV5 A;  2PAS A;  3BOW A;  3DVM A;  3E3R A;  2BNX A;  3S0F A;  3RZS A;  2QAC A;  4MEW A;  2B1U A;  1C07 A;  3FE6 A;  5FI6 A;  2KGB C;  2COL B;  1Z2C B;  2KGR A;  2QEH A;  2LVV A;  1DJH A;  4OR9 B;  1PRW A;  1IGV A;  4YBH B;  3S0B A;  2BKI B;  4PHK A;  4XJK A;  1VRK A;  3DZT A;  1QXP A;  4JQ0 D;  1XVJ A;  1CFD A;  1D1O A;  3TDU A;  1A29 A;  1UHJ A;  3HCM A;  5HYD A;  2M7N A;  1KQM C;  4U8D A;  1J55 A;  4HRE E;  2NZ0 A;  5J3X A;  3AAK A;  2O5G A;  1SL8 A;  3BUN B;  3K1E A;  1BR1 B;  3UNW A;  1K9P A;  1NUB A;  2LVJ A;  4JD9 A;  1M45 A;  5I2L A;  1F8H A;  4YGA A;  2A4J A;  4GBA A;  2M1U A;  1C7V A;  3I5G B;  1L7Z A;  4ORA B;  3D75 A;  3EVR A;  1OOH A;  1YX7 A;  1S36 A;  1DEK A;  4ZCV A;  2KI4 C;  1IH0 A;  3EVU A;  3FE9 A;  2JXL A;  1QIV A;  3S0E A;  3D76 A;  4MZJ A;  2DOQ A;  2I18 A;  4PHJ A;  1PVA A;  1BOD A;  1SR6 B;  2PYQ A;  4C0J A;  4PE1 A;  3BUX B;  2LMU A;  2M49 B;  1H8B A;  2O60 A;  1YR5 A;  2ZRS A;  5PAL A;  1J7O A;  1SNL A;  5BPJ A;  2L2E A;  4ORC B;  3I5H C;  4AQI A;  1QLS A;  1Z4H A;  3BXK A;  5FI2 A;  1WRL A;  2MHH A;  3PLF B;  1AJ5 A;  3JVT B;  2LE9 B;  2K2A A;  3SG2 A;  1GJY A;  1B47 A;  2BE4 A;  1CFC A;  2ZNE A;  2VRG A;  3OP0 A;  3IF7 A;  3WHU B;  1FPW A;  2JTT A;  4PE0 A;  1J1E A;  2JU0 A;  1CB1 A;  2AUC A;  1EH2 A;  1RTP 1;  2KLE A;  4GGN A;  4I5J A;  2QEV A;  4M2Q A;  5FI7 A;  4D1E A;  3QRX A;  2JRF A;  2KFH A;  4OKH A;  1YVH A;  1DQE A;  3SIB A;  4YRU A;  2WND A;  2LMT A;  2H8V A;  5F6T A;  1KCY A;  2LV7 A;  3I5G C;  1ALV A;  1TWO A;  1IJ5 A;  2QEO A;  2KBM A;  3OX5 A;  3R1O A;  3BOW B;  1YTZ C;  5FYX A;  5I94 A;  4A4B A;  1J1D A;  2LUX A;  2WCJ A;  1OOG A;  5CPV A;  1RFJ A;  1KWO B;  4MSP A;  1NX2 A;  2K60 A;  3CAB A;  1DEL A;  2KAX A;  2PMY A;  2CBL A;  3DVK A;  1CFF A;  3BJH A;  3ZWH A;  1SR6 C;  4DS7 A;  1CMF A;  2ZN8 A;  4N1F A;  1CDN A;  4XJK B;  2ERB A;  2KI6 C;  5HLV A;  5CSI A;  1J7R A;  1NX0 A;  1MHO A;  1IQ5 A;  5KU1 A;  2FJU B;  1DJZ A;  3TS5 B;  1RK9 A;  2H2K A;  4YGB B;  1Q80 A;  1N65 A;  3B86 A;  5HKZ A;  4WQ2 A;  2NCO A;  1B4C A;  2NXQ A;  2LLT A;  1FI5 A;  1DJG A;  1DGV A;  1MR8 A;  3CGA A;  2HET A;  4QJ3 B;  3RM1 A;  2ZKM X;  4F7F A;  1CDM A;  4PE7 A;  1K94 A;  3SS3 A;  3DVJ A;  1JF2 A;  1NYA A;  1V1F A;  4ORB B;  5K89 A;  2WCK A;  1CTR A;  2D8N A;  4PHN A;  2CTN A;  2G9B A;  3NSK A;  1IRJ A;  4FQT A;  4MVF A;  4CFR A;  4GGF A;  1OZO A;  3WXA A;  4M2O A;  1C3Z A;  2MJW B;  2CXJ A;  1UP5 A;  2QPT A;  3TDZ A;  4GNK B;  1PUL A;  5CSN A;  2Q4U A;  3CZT X;  2K7C A;  1HQV A;  2LUC A;  3DXL A;  3KHE A;  1B9A A;  2EC6 B;  3OB2 B;  3I5F B;  4INX A;  2OS8 B;  5JJG A;  1KFX L;  1XFU O;  2GGZ A;  2JZI A;  1K9K A;  2Y1N A;  1FF1 A;  1SBJ A;  1R2U A;  4QJ4 B;  2LC5 A;  3CZ2 A;  4MZL A;  1CLB A;  3VRO A;  3VRN A;  1YRT B;  3LLE A;  1LIN A;  3BQ3 A;  1G8I A;  1CM1 A;  2JNF A;  1GQM A;  2K8M B;  1KSO A;  1CLL A;  3O4Y A;  5AAN A;  2ISD A;  1MWN A;  4IJ7 A;  2RGI A;  1E8A A;  4IL1 A;  3L4A A;  3OX6 A;  3CWG A;  1A75 A;  1OOJ A;  2BL0 C;  2TN4 A;  1H4B A;  1OMR A;  1DGU A;  1LS8 A;  4MRX A;  3M0W A;  5CSJ A;  3SG5 A;  4YGC B;  1UHN A;  2JXC A;  1BLQ A;  2K61 A;  2P71 A;  4P5O E;  1DJI A;  2F3Y A;  2HQW A;  2L4I A;  5B8I B;  1DT7 B;  2LM5 A;  1AVS A;  3L4L A;  5ER5 A;  4N1G A;  1JWD A;  3SG6 A;  5GQQ C;  1B8R A;  2KHN A;  2BCX A;  1SRA A;  1WLM A;  1M63 B;  2PSR A;  1FI6 A;  3NSL A;  1AP4 A;  1JFK A;  1NPQ A;  2GGM A;  1XFX O;  2MRD A;  3EG5 B;  2EC6 C;  1KK8 C;  2K7D A;  1IKU A;  4OV2 A;  2LVI A;  4PHM A;  5KTY A;  3S0A A;  3GK2 A;  1F4Q A;  2BCB A;  2I94 A;  1XA5 A;  2JPT A;  1DF0 B;  1WLZ A;  1FBV A;  1B8L A;  1ZUZ A;  5D3O A;  1TNW A;  2K7B A;  2K0J A;  2KNE A;  2MBX A;  2BE6 A;  5AFP A;  5IBW A;  3D0Y A;  2L5X B;  1S6I A;  3PM2 A;  1XO5 A;  3AKB A;  1B8C A;  3FWB A;  1SY9 A;  4XYN A;  1ZMZ A;  1HT9 A;  4F0Z B;  4OZD A;  3TUY B;  1JFJ A;  2JT0 A;  2KFF A;  3IQQ A;  1ORG A;  1SSE B;  2WOS A;  3FE8 A;  3ICB A;  4PCW A;  3V2L A;  1NWD A;  1KQV A;  3VRQ A;  1C7W A;  2MA2 A;  3K21 A;  4DCK A;  3NHI A;  4MBE A;  1S6J A;  1LKJ A;  1S5G Z;  3BFB A;  1LA3 A;  1N0Y A;  3BFA A;  2MLE C;  4DIR A;  4AOM A;  5ER4 X;  1L2O B;  2WOR A;  1TRF A;  1XK4 C;  1DC1 A;  3EK4 A;  1KSM A;  1CLM A;  2ZN9 A;  2KOT A;  1YVL A;  1QV1 A;  3EK8 A;  3BFH A;  5D69 A;  1EG4 A;  2F3Z A;  3QME A;  4HSZ A;  1UHK A;  2BEC A;  1JF0 A;  1PSR A;  1OMV A;  2WCE A;  4NDD A;  2LLS A;  1QS7 A;  3N7H A;  3DF0 A;  3PAL A;  4ICB A;  2FCD A;  1F55 A;  1TCF A;  1YRU B;  1SMG A;  3LK1 A;  3CTN A;  1QWV A;  1XFW O; 
#chains in the Genus database with same CATH homology
 3SG4 A;  1EXR A;  4C0K A;  1TNP A;  2KQY A;  2KAY A;  3A4U B;  3JTD B;  3LL8 B;  4I5L B;  2WCF A;  5HLO A;  2Y1M A;  1NCZ A;  1QX7 A;  1S6C A;  4CPV A;  1MF8 B;  2H61 C;  1BJF A;  1NCX A;  1PVB A;  2MLF C;  4JWQ A;  1BT6 A;  2JWW A;  4GFT A;  1YUT A;  1TTX A;  3EKJ A;  5D7F A;  1A2X A;  1V1G A;  3NSI A;  1WRZ A;  2CCM A;  1UUS A;  1R6P A;  2EGD A;  4FTG A;  3JVT C;  1DTL A;  3A8R A;  1IJ6 A;  3CR5 X;  1J7P A;  1PSB A;  1L2O C;  1ODB A;  2LP2 A;  3PM8 A;  2FCE A;  1MXE A;  2JC2 A;  3HX4 A;  1K93 D;  1QAS A;  1KFX S;  3PFV A;  4HRH A;  5AEQ A;  3SG3 A;  3VRR A;  5DKR A;  1LXF C;  1TNQ A;  3PN7 B;  1WY9 A;  3EK7 A;  3O6B A;  1YUS A;  2JUL A;  2WCB A;  5I2O A;  3I5I B;  3D10 A;  2OPO A;  1AUI B;  4N5X A;  2KYF A;  2JNX A;  2KDH A;  1CM4 A;  1TN4 A;  1XFV O;  2NLN A;  4P2Y B;  1M39 A;  4PDZ A;  1TCO B;  2KYC A;  1KWO C;  1PK0 D;  1YUR A;  2LHL A;  2M1K B;  3DD4 A;  3NXA A;  3VRP A;  1J7Q A;  1F71 A;  3LCP C;  4OCI A;  1QTX A;  1YUU A;  3H4S E;  2LCP A;  2NCP A;  1XFY O;  2F2O A;  1A03 A;  1UWO A;  4QJ5 B;  4JPZ B;  1W7I B;  1K96 A;  3GOF A;  3TDI A;  4DUQ A;  1B7T Z;  1CFP A;  3TS5 C;  1Y1U A;  2F2P A;  5CSF A;  1BR4 B;  1S26 D;  1SYM A;  1QAT A;  3SIA A;  2ZRT A;  2CT9 A;  1AK8 A;  1K9U A;  1YX8 A;  2LLU A;  1DVI A;  1XFZ O;  2AMI A;  1GGW A;  1K95 A;  1LVC D;  5KSZ A;  2MAZ A;  2PAL A;  2LNK A;  3FWC A;  4OVN F;  1WRK A;  1QX5 B;  5HKY A;  3LK0 A;  1EJ3 A;  4MRY A;  1DJX A;  1ZFS A;  3PN7 C;  1RRO A;  2G2B A;  1KFU L;  3CR2 A;  1QX2 A;  3CLN A;  4NDC A;  2CNP A;  3I5F C;  1DMO A;  2K7O A;  4CID A;  2OS8 C;  4MN0 A;  1QIW A;  5HKW A;  1OQP A;  2ZND A;  4L9M A;  1OMD A;  2E30 A;  1NX1 A;  3I5H B;  1QLK A;  1Y0V H;  2M7L A;  3SJS A;  1NSH A;  1OZS A;  1SL7 A;  2BBN A;  2JT8 A;  4GAO A;  4I5N B;  4TNC A;  1QV0 A;  1QVI Z;  2LVK A;  1QVI Y;  1SK6 D;  2OTG B;  1BOC A;  2L51 A;  1S3P A;  4YI9 A;  4FQO A;  1CNP A;  2EHB A;  2R2I A;  5AXI A;  1NX3 A;  1PAL A;  1SPY A;  3GK1 A;  5TNC A;  1K8U A;  1S1E A;  2KFG A;  1K90 D;  1WDC B;  1IG5 A;  4ZCU A;  2LHI A;  1SCM B;  1NIW A;  2L0P A;  1FW4 A;  4GPL B;  3BYA A;  1XYD A;  4PAL A;  1W7J B;  2P6B B;  3BUM B;  1Y1A A;  2L50 A;  2F8P A;  1S5G Y;  2I2R E;  4GUK A;  1BU3 A;  1DJW A;  1K2H A;  2HPS A;  2M97 A;  3FS7 A;  2HF5 A;  1IWQ A;  2SCP A;  2Y5I A;  1B1G A;  1BF5 A;  3OHM B;  3RLZ A;  2BBM A;  4C0L A;  3AKA A;  2KI6 D;  1Y6W A;  1M31 A;  1UUR A;  1ZAC A;  3C1V A;  1AJ4 A;  1GGZ A;  1UHI A;  2LAN A;  2HQ8 A;  1REC A;  4YI8 A;  3FIA A;  1AHR A;  4AQJ A;  3SG7 A;  4BY5 A;  4E68 A;  1TOP A;  1JBA A;  4YGD B;  1IQ3 A;  2JQ6 A;  1JUO A;  2AAO A;  2F33 A;  1NP8 A;  3DVE A;  2IS9 A;  1A75 B;  1G4Y R;  2OTG C;  1RWY A;  1NCY A;  4USL A;  1TIZ A;  1U5I A;  2KAV A;  3EVV A;  3TUY C;  3OB1 B;  1F4O A;  1SL9 A;  2M3W A;  1KK7 Z;  1WDC C;  1KK7 Y;  2PVB A;  3BUW B;  2SAS A;  4CFQ A;  4GGF C;  3GK4 X;  2LMV A;  1SCM C;  2M9G A;  2V53 A;  2PRU A;  2M0R A;  2M29 A;  1ZOT B;  5I2Q A;  1XK4 A;  3KO0 A;  4R1E A;  1RJV A;  1LA0 A;  1OSA A;  4A4C A;  1CDP A;  2K2F A;  5JOL A;  5DKN A;  1CDL A;  1QJT A;  3EKH A;  3BUO B;  1DJY A;  1DF0 A;  3D0Y B;  2Y4Q A;  2KQ6 A;  2Q91 A;  2FOT A;  1MUX A;  4CLN A;  4BY4 A;  1EL4 A;  4MZK A;  5DKQ A;  5G08 A;  1CKK A;  1JSA A;  1SKT A;  4NDB A;  1F54 A;  4WQ3 A;  1M46 A;  3CS1 A;  1X02 A;  4Q04 A;  4ETO A;  2BL0 B;  3PSR A;  1A4P A;  3O2P A;  4NQG A;  1BG1 A;  1F70 A;  1UHH A;  4UPG A;  1MXL C;  3JTD C;  2JOJ A;  2L4H A;  5I8N A;  2WC8 A;  1BMO A;  1ALW A;  4I5K A;  3TZ1 A;  4PE4 A;  3IQO A;  2H61 A;  2E6W A;  2KSP A;  2L98 A;  3MSE B;  2KBI A;  1OE9 B;  4YGE B;  2LAP A;  3KPX A;  3CR4 X;  3NSO A;  1KQM B;  1B7T Y;  2M8U A;  2BCA A;  1KK8 B;  2I7A A;  3ZNI A;  3AAJ A;  1TNX A;  2ZFD A;  4MLW A;  5AER A;  1N2D A;  4M2P A;  2BKH B;  3O78 A;  1MQ1 A;  2LP3 A;  3PAT A;  3KEV A;  1SW8 A;  3F45 A;  1KFU S;  4DRW A;  3DF0 B;  1CMG A;  1G33 A;  3VGO A;  2KI4 B;  1SCV A;  4HRG A;  2JTZ A;  1JC2 A;  3KF9 A;  2JT3 A;  4WRI A;  1EG3 A;  3WNX B;  3WHT B;  1U5I B;  3I5I C;  1Y1X A;  3BOW A;  2GV5 A;  2PAS A;  3DVM A;  3E3R A;  2QAC A;  4MEW A;  2B1U A;  1C07 A;  2KGB C;  2COL B;  2KGR A;  2LVV A;  1DJH A;  4OR9 B;  1PRW A;  1IGV A;  4YBH B;  2BKI B;  4PHK A;  4XJK A;  1VRK A;  4JQ0 D;  1QXP A;  1XVJ A;  1CFD A;  1D1O A;  3TDU A;  1A29 A;  1UHJ A;  3HCM A;  5HYD A;  2M7N A;  1KQM C;  4U8D A;  1J55 A;  4HRE E;  2NZ0 A;  5J3X A;  3AAK A;  2O5G A;  1SL8 A;  3BUN B;  1BR1 B;  1K9P A;  1NUB A;  2LVJ A;  1F8H A;  1M45 A;  5I2L A;  4YGA A;  2A4J A;  4GBA A;  2M1U A;  1C7V A;  3I5G B;  1L7Z A;  4ORA B;  3EVR A;  1YX7 A;  1S36 A;  4ZCV A;  2KI4 C;  1IH0 A;  3EVU A;  2JXL A;  1QIV A;  4MZJ A;  2DOQ A;  2I18 A;  4PHJ A;  1PVA A;  1BOD A;  1SR6 B;  4C0J A;  4PE1 A;  3BUX B;  2LMU A;  2M49 B;  1H8B A;  2O60 A;  1YR5 A;  2ZRS A;  5PAL A;  1J7O A;  1SNL A;  5BPJ A;  2L2E A;  4ORC B;  3I5H C;  4AQI A;  1QLS A;  3BXK A;  1WRL A;  2MHH A;  3PLF B;  1AJ5 A;  3JVT B;  2LE9 B;  2K2A A;  3SG2 A;  1GJY A;  1B47 A;  2BE4 A;  1CFC A;  2ZNE A;  2VRG A;  3OP0 A;  3IF7 A;  3WHU B;  1FPW A;  2JTT A;  4PE0 A;  1J1E A;  2JU0 A;  1CB1 A;  2AUC A;  1EH2 A;  1RTP 1;  4GGN A;  4I5J A;  4M2Q A;  4D1E A;  3QRX A;  2JRF A;  2KFH A;  4OKH A;  1YVH A;  3SIB A;  4YRU A;  2WND A;  2LMT A;  5F6T A;  1KCY A;  2LV7 A;  3I5G C;  1ALV A;  3OX5 A;  1IJ5 A;  2KBM A;  5FYX A;  3BOW B;  1YTZ C;  4A4B A;  1J1D A;  2LUX A;  5CPV A;  1RFJ A;  1KWO B;  4MSP A;  1NX2 A;  2KAX A;  2PMY A;  2CBL A;  3DVK A;  1CFF A;  3ZWH A;  1SR6 C;  4DS7 A;  1CMF A;  2ZN8 A;  4N1F A;  1CDN A;  4XJK B;  2KI6 C;  5HLV A;  5CSI A;  1J7R A;  1NX0 A;  1MHO A;  1IQ5 A;  5KU1 A;  2FJU B;  1DJZ A;  3TS5 B;  1RK9 A;  2H2K A;  4YGB B;  1Q80 A;  1N65 A;  5HKZ A;  1B4C A;  4WQ2 A;  2NCO A;  1FI5 A;  2NXQ A;  2LLT A;  1DJG A;  1DGV A;  1MR8 A;  3CGA A;  2HET A;  4QJ3 B;  3RM1 A;  2ZKM X;  1CDM A;  4PE7 A;  1K94 A;  3DVJ A;  1JF2 A;  1NYA A;  1V1F A;  4ORB B;  5K89 A;  1CTR A;  2D8N A;  4PHN A;  2CTN A;  2G9B A;  3NSK A;  1IRJ A;  4MVF A;  4CFR A;  4GGF A;  1OZO A;  3WXA A;  4M2O A;  2MJW B;  2QPT A;  2CXJ A;  1UP5 A;  3TDZ A;  4GNK B;  1PUL A;  5CSN A;  2Q4U A;  3CZT X;  2K7C A;  1HQV A;  2LUC A;  3KHE A;  1B9A A;  2EC6 B;  3OB2 B;  3I5F B;  5JJG A;  2OS8 B;  1KFX L;  1XFU O;  2GGZ A;  2JZI A;  1K9K A;  2Y1N A;  1FF1 A;  1SBJ A;  1R2U A;  4QJ4 B;  2LC5 A;  4MZL A;  1CLB A;  3VRO A;  3VRN A;  1YRT B;  3LLE A;  1LIN A;  3BQ3 A;  1G8I A;  1CM1 A;  2JNF A;  1GQM A;  2K8M B;  1KSO A;  1CLL A;  3O4Y A;  5AAN A;  2ISD A;  1MWN A;  2RGI A;  1E8A A;  4IL1 A;  3OX6 A;  3CWG A;  1A75 A;  1OOJ A;  2BL0 C;  2TN4 A;  1H4B A;  1OMR A;  1DGU A;  4MRX A;  3SG5 A;  3M0W A;  5CSJ A;  4YGC B;  1UHN A;  2JXC A;  1BLQ A;  2K61 A;  4P5O E;  1DJI A;  2F3Y A;  2HQW A;  2L4I A;  5B8I B;  1DT7 B;  2LM5 A;  1AVS A;  5ER5 A;  4N1G A;  1JWD A;  3SG6 A;  5GQQ C;  1B8R A;  2KHN A;  2BCX A;  1SRA A;  1WLM A;  1M63 B;  2PSR A;  1FI6 A;  3NSL A;  1AP4 A;  1JFK A;  1NPQ A;  2GGM A;  1XFX O;  2MRD A;  2EC6 C;  1KK8 C;  2K7D A;  1IKU A;  4OV2 A;  2LVI A;  4PHM A;  5KTY A;  3GK2 A;  1F4Q A;  2BCB A;  2I94 A;  1XA5 A;  2JPT A;  1DF0 B;  1WLZ A;  1FBV A;  1B8L A;  1ZUZ A;  2MBX A;  1TNW A;  2K7B A;  2K0J A;  2KNE A;  5IBW A;  2BE6 A;  5AFP A;  3D0Y A;  2L5X B;  1S6I A;  1XO5 A;  3AKB A;  1B8C A;  3FWB A;  1SY9 A;  4XYN A;  1ZMZ A;  1HT9 A;  4F0Z B;  3TUY B;  1JFJ A;  2JT0 A;  2KFF A;  3IQQ A;  2WOS A;  3ICB A;  4PCW A;  1NWD A;  1KQV A;  3VRQ A;  1C7W A;  2MA2 A;  3K21 A;  4DCK A;  4MBE A;  1S6J A;  1LKJ A;  1S5G Z;  1LA3 A;  1N0Y A;  2MLE C;  4DIR A;  4AOM A;  5ER4 X;  1L2O B;  2WOR A;  1TRF A;  1XK4 C;  3EK4 A;  1KSM A;  1CLM A;  2ZN9 A;  2KOT A;  1YVL A;  1QV1 A;  3EK8 A;  5D69 A;  1EG4 A;  2F3Z A;  4HSZ A;  1UHK A;  2BEC A;  1JF0 A;  1PSR A;  1OMV A;  2WCE A;  4NDD A;  2LLS A;  1QS7 A;  3PAL A;  3DF0 A;  4ICB A;  2FCD A;  1F55 A;  1TCF A;  1YRU B;  1SMG A;  3LK1 A;  3CTN A;  1XFW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...