2PRUA

Nmr structure of human apos100b at 10c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Analysis of the structure of human apo-S100B at low temperature indicates a unimodal conformational distribution is adopted by calcium-free S100 proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 29
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2pruA00
2JOJA 1UHJA 5DKQA 4C0KA 1IKUA 3LL8B 1QIWA 5FYXA 1V1GA 2JXCA 1IRJA 3I5GB 3O4YA 1N2DA 1U5IA 2LLUA 2I2RE 4F0ZB 2JTTA 1BG1A 1BLQA 1K9UA 2JT8A 1OMDA 2O60A 2ZRTA 4ORAB 2LUCA 4DS7A 4GGFA 1CFPA 1OZSA 1OOJA 1NCZA 1QXPA 1YX8A 1AHRA 2HETA 1KFUS 1TIZA 1BR1B 1NYAA 1SBJA 1A29A 3O78A 3LK1A 1FBVA 3M0WA 4DUQA 2A4JA 1CLBA 2KI6C 2KAYA 2KAXA 1GQMA 1SL9A 3AKBA 1KWOB 2VRGA 5B8IB 1XFXO 2WORA 1S1EA 4MZJA 1B47A 2KQ6A 4NDDA 1IJ5A 2LM5A 5IBWA 2E6WA 4GGFC 1Y1XA 1IG5A 3NSLA 2OS8C 1A2XA 3PFVA 1JC2A 2AMIA 1QV1A 2KYFA 3IQQA 1R2UA 4ZCVA 3OHMB 2LLTA 2IS9A 2HQ8A 1WRLA 1AVSA 1SR6C 1E8AA 1DTLA 2D8NA 1F8HA 3CWGA 1HT9A 2LVKA 2O5GA 4YGEB 2BBMA 1F55A 4MVFA 2MA2A 2TN4A 1KK7Z 2WNDA 1WDCB 1G4YR 1CTRA 2JNFA 1SMGA 2GGMA 2B1UA 2K2FA 2MLFC 1CMGA 1CLMA 4PDZA 1CMFA 3BUOB 4ICBA 4UPGA 2GV5A 3JVTC 1DJZA 4GNKB 4NDCA 3I5FB 1NX0A 4CPVA 2K7OA 1CFCA 4A4CA 2KOTA 1MQ1A 2L5XB 1AJ4A 1MXEA 1OZOA 3SG7A 3VRQA 1CB1A 1J7OA 3FS7A 2PRUA 2M97A 2MRDA 1W7JB 1MF8B 1ALVA 2F33A 1WRKA 2F3ZA 2I18A 1AJ5A 2F3YA 5KSZA 2PMYA 3VRPA 1KK8B 4HREE 1YUTA 2WOSA 3TDIA 4MN0A 4A4BA 3TS5C 2JPTA 1NCYA 4AQJA 1FI5A 4MRXA 4MZLA 5HLVA 4MZKA 1BJFA 3E3RA 3VGOA 2JULA 4PHKA 1FI6A 2JTZA 1DGUA 3I5GC 1J7RA 1PVAA 1QS7A 1FW4A 4QJ5B 2F2OA 1KSMA 1BOCA 3EK8A 5I2QA 4GFTA 1CDPA 3I5IC 2E30A 3D10A 1LKJA 1S6CA 1K8UA 1C7VA 3KPXA 2LMUA 4DRWA 3OX5A 1OE9B 2CXJA 2CNPA 1LINA 1TNXA 1YX7A 3PN7B 3SIAA 1DJHA 3PATA 4YI9A 2KBMA 3A4UB 1KK7Y 2EHBA 4PE4A 1DJXA 1SNLA 5HKWA 4PALA 1YRTB 1A75B 1B1GA 3GK4X 4USLA 4MRYA 1KSOA 3SG5A 2BE6A 2MLEC 2NCPA 1JSAA 1SL8A 1XFVO 5BPJA 4M2OA 1EL4A 2JT0A 3JTDC 4E68A 1SL7A 2H61A 5JJGA 2LC5A 1PALA 3SIBA 1IH0A 1XO5A 1K2HA 1DF0A 2FJUB 4OCIA 1YRUB 2COLB 2M29A 1RWYA 4JWQA 1JFJA 4YGBB 1AK8A 2KI4B 3BYAA 4FQOA 4C0LA 1Y1UA 1TRFA 4PHNA 3PM8A 1KFXL 1WLMA 1RROA 3DF0A 1CM1A 3ZNIA 3TZ1A 2KNEA 4M2QA 1JF0A 1MWNA 5TNCA 1CNPA 3DVEA 1M31A 1RECA 1SRAA 3EK7A 3EVVA 5I2OA 2ZN8A 2V53A 1QASA 2M1KB 1Y1AA 3KEVA 4XJKB 1DT7B 1OSAA 2M7LA 1GGWA 2G2BA 1WRZA 4N1GA 2FCEA 2KDHA 2H2KA 1SKTA 2OTGB 2ZFDA 3ZWHA 3PSRA 3WXAA 2Y4QA 4HRGA 1KQMB 1J55A 3H4SE 2PSRA 4OKHA 3KF9A 1BR4B 4U8DA 1IQ3A 3I5HC 4FTGA 2KHNA 4DIRA 2I94A 3BUMB 3BQ3A 1OMVA 2MHHA 4MLWA 1ZUZA 1NCXA 3O6BA 2NXQA 2ZN9A 3PALA 3AAKA 2DOQA 3IF7A 2LMTA 3ICBA 5AXIA 4CLNA 1V1FA 1TTXA 5JOLA 4I5KA 1XFYO 4I5JA 2KQYA 2JZIA 3BOWA 5CSFA 1FPWA 1SCMC 4GGNA 1A75A 1SPYA 1LA0A 2Y1MA 2LAPA 2M8UA 2QACA 2ZNEA 3C1VA 4ETOA 4ORBB 1AUIB 4BY5A 1B8RA 1CLLA 2K0JA 2KFFA 3SJSA 2L4IA 2LLSA 2WC8A 3IQOA 1XK4A 1M39A 2BECA 1XYDA 5J3XA 1PRWA 1EG3A 1KFXS 3WNXB 5CSJA 1YUUA 2M1UA 2LVIA 2K7BA 2Y1NA 4AOMA 5PALA 1CDNA 5AEQA 2Q4UA 2SASA 1K90D 2K7CA 2KI6D 4GUKA 2CT9A 1L2OB 1MUXA 2HQWA 1X02A 4JPZB 4YGDB 3WHUB 1NPQA 1NIWA 2L4HA 1TNWA 1XK4C 1BMOA 3PLFB 4C0JA 1DJIA 1TN4A 1K96A 1DVIA 3SG4A 1QX7A 1S6IA 3NXAA 3BUNB 2L51A 1MXLC 1UHKA 4MEWA 2ZKMX 2G9BA 1M46A 1ZFSA 4P2YB 1ODBA 1F4QA 3TDZA 1ZACA 1K95A 2PALA 2BKHB 2P6BB 2ZNDA 1S5GY 4QJ4B 2ZRSA 1AP4A 4OR9B 5HLOA 4MBEA 5I2LA 5D69A 2L50A 1Y6WA 5ER5A 2L2EA 1IWQA 2LHIA 2WCBA 1QX2A 3HX4A 4HSZA 2M49B 2LVJA 1GJYA 1H8BA 1B9AA 4YBHB 2LP2A 1OMRA 1PSBA 3DD4A 1UUSA 3FWBA 3KHEA 1XA5A 3CR5X 4P5OE 5HYDA 2JC2A 1J7PA 4PHJA 1M45A 2ISDA 1N65A 2JQ6A 2OS8B 3LCPC 1JFKA 1A03A 1BF5A 1KWOC 1QLKA 2I7AA 4YI8A 4QJ3B 1J1DA 1K9PA 1EH2A 1SR6B 4HRHA 1CKKA 1RTP1 5F6TA 1PSRA 2NZ0A 2F8PA 1PULA 1YURA 2EGDA 2JXLA 4GPLB 4DCKA 1B4CA 4CFRA 3AAJA 3LK0A 2BL0B 4GBAA 1S6JA 2K8MB 4AQIA 3FWCA 2QPTA 4XYNA 1JBAA 1FF1A 1F71A 2MAZA 3EKJA 2CCMA 4NDBA 3JVTB 4PE0A 1WDCC 2PASA 4PE1A 1EJ3A 2KAVA 3RM1A 4MSPA 1BODA 3GK1A 5AANA 2L0PA 2Y5IA 3TUYB 3CLNA 2CBLA 2JRFA 3I5FC 4YRUA 1C7WA 3BXKA 2H61C 3MSEB 1OQPA 1DMOA 2FOTA 4I5LB 2LCPA 1IJ6A 1B8LA 3TDUA 1NUBA 1NX3A 5AERA 2LV7A 4WRIA 2CTNA 5DKRA 3NSKA 3TS5B 1MHOA 1K93D 1M63B 1NX1A 3CR2A 1QATA 4N1FA 1KK8C 1UWOA 3D0YB 4PE7A 3EKHA 4WQ2A 1EG4A 1UHIA 4N5XA 1TCOB 3FIAA 4YGAA 1JWDA 1S5GZ 2KSPA 5KTYA 1R6PA 4R1EA 3VRRA 1K9KA 4D1EA 1KQVA 2LE9B 1TOPA 3I5IB 4TNCA 1QJTA 1DGVA 1ALWA 1UHHA 4YGCB 4JQ0D 1QIVA 2LANA 1A4PA 1JUOA 1EXRA 2MJWB 2F2PA 4M2PA 4NQGA 2LVVA 1SYMA 5I8NA 2BCXA 3CS1A 5CSIA 3GOFA 2EC6B 1BT6A 2WCFA 2Q91A 2KFGA 1LXFC 3EK4A 3NSIA 1NP8A 3PN7C 4GAOA 3SG6A 2AUCA 1QVIY 1UURA 1IGVA 3A8RA 1QV0A 2K7DA 4BY4A 4CIDA 2JT3A 3JTDB 2LP3A 1ZMZA 1XFUO 3K21A 4PHMA 4Q04A 3CTNA 1K94A 1CDLA 3SG2A 5HKYA 3CGAA 2BBNA 1XVJA 1PK0D 3WHTB 2PVBA 1B7TZ 1YUSA 1YVLA 1N0YA 3OX6A 5DKNA 3RLZA 1J1EA 1ZOTB 5ER4X 2BCBA 1RFJA 2OPOA 3HCMA 2BL0C 1VRKA 1SY9A 2LMVA 1RJVA 1C07A 3OP0A 2NCOA 2BKIB 1G8IA 4XJKA 3KO0A 2KI4C 2L98A 3NSOA 1BU3A 3AKAA 3VRNA 1WY9A 2KGRA 3F45A 2M7NA 1LA3A 1F70A 1DF0B 1L7ZA 2JNXA 2LUXA 2M3WA 1B8CA 2AAOA 1NX2A 1DJGA 3TUYC 1SCVA 4WQ3A 1QLSA 3D0YA 5G08A 2FCDA 1CM4A 1S3PA 2M0RA 1DJWA 1IQ5A 2HF5A 1H4BA 3DF0B 1Q80A 1W7IB 1S36A 3EVUA 2LNKA 1G33A 1TCFA 2WCEA 3EVRA 1LVCD 5HKZA 3I5HB 2NLNA 1U5IB 1NSHA 1Y0VH 2OTGC 1CFFA 4CFQA 1KQMC 1KCYA 1UP5A 1RK9A 2RGIA 2JU0A 3CR4X 5KU1A 2KGBC 3O2PA 3DVMA 1CDMA 1UHNA 1SCMB 2R2IA 1XFZO 3VROA 3LLEA 4ORCB 2MBXA 3GK2A 5GQQC 1F4OA 1KFUL 1QTXA 2JWWA 2K2AA 1HQVA 3CZTX 5K89A 2KYCA 1SK6D 4PCWA 1B7TY 1DJYA 1QVIZ 5CSNA 2HPSA 4L9MA 1WLZA 2LHLA 5D7FA 3QRXA 5AFPA 4OVNF 1TNPA 2BE4A 3BOWB 2EC6C 2M9GA 3SG3A 1CFDA 1GGZA 3DVKA 1SW8A 2GGZA 1YTZC 2KBIA 1MR8A 2SCPA 3DVJA 4ZCUA 1D1OA 1J7QA 2KFHA 3OB1B 1JF2A 1PVBA 1XFWO 1TNQA 5CPVA 1L2OC 1YVHA 4I5NB 3BUXB 1S26D 4OV2A 3OB2B 2K61A 1QX5B 1F54A 3BUWB 2BCAA 1NWDA 1YR5A 4IL1A
chains in the Genus database with same CATH superfamily
2JOJA 1UHJA 5DKQA 4IJ7A 4C0KA 1IKUA 3LL8B 1QIWA 5FYXA 3SS4A 1V1GA 2JXCA 2P70A 1IRJA 3I5GB 3O4YA 1N2DA 1U5IA 2LLUA 2I2RE 1Z2CB 3UNWA 4F0ZB 2JTTA 1BG1A 1BLQA 1K9UA 2JT8A 1OMDA 2O60A 2ZRTA 1TUZA 1P28A 2LUCA 3B7AA 4ORAB 4DS7A 4GGFA 1CFPA 1OZSA 1OOJA 1NCZA 1QXPA 1YX8A 1AHRA 3R1OA 2HETA 1KFUS 3BFBA 1TIZA 1BR1B 1NYAA 1SBJA 1A29A 3O78A 3LK1A 1FBVA 3M0WA 4DUQA 2A4JA 1CLBA 2KI6C 2KAYA 2KAXA 1GQMA 1SL9A 2WC6A 3AKBA 1KWOB 3PM2A 2VRGA 5B8IB 1XFXO 2WORA 1S1EA 2PYQA 1B47A 2KQ6A 4MZJA 1IJ5A 2LM5A 4NDDA 5IBWA 2E6WA 4GGFC 1Y1XA 1IG5A 3NSLA 2BCAA 2OS8C 1A2XA 3PFVA 1JC2A 2AMIA 1QV1A 2KYFA 3IQQA 1Z4HA 1R2UA 3OHMB 2LLTA 2IS9A 4ZCVA 2HQ8A 1WRLA 1AVSA 1SR6C 2QEHA 1E8AA 1DTLA 2D8NA 1F8HA 3CWGA 1HT9A 2LVKA 2O5GA 4YGEB 2BBMA 3R72A 1F55A 4MVFA 2MA2A 2TN4A 1KK7Z 2WNDA 1WDCB 1G4YR 2KLDA 1CTRA 2JNFA 1SMGA 2GGMA 3PJIA 2B1UA 2K2FA 2MLFC 1CMGA 1CLMA 4PDZA 1CMFA 2GTEA 3BUOB 4ICBA 4UPGA 2GV5A 3JVTC 1DJZA 4GNKB 4NDCA 3I5FB 1NX0A 4CPVA 2K7OA 1OOIX 1CFCA 4A4CA 2KOTA 1QWVA 1DEKA 1MQ1A 2L5XB 1AJ4A 1MXEA 1OZOA 3SG7A 3VRQA 1CB1A 2P71A 1J7OA 3FS7A 1OW4A 2PRUA 2M97A 3DZTA 2MRDA 1W7JB 1MF8B 1ALVA 2F33A 1WRKA 2F3ZA 2I18A 1AJ5A 2F3YA 5I94A 5KSZA 2PMYA 3VRPA 1KK8B 4HREE 1YUTA 2WOSA 2WCJA 4MN0A 3TDIA 4A4BA 3NHIA 3TS5C 2JPTA 1NCYA 4AQJA 1FI5A 4MRXA 4MZLA 5HLVA 4MZKA 2WC5A 1BJFA 3E3RA 3VGOA 2JULA 4PHKA 1FI6A 2JTZA 1DGUA 3O4XA 3I5GC 3CABA 1J7RA 1PVAA 1QS7A 1FW4A 4QJ5B 2F2OA 1KSMA 1BOCA 3EK8A 5I2QA 4GFTA 1CDPA 3I5IC 2E30A 3D10A 1LKJA 1S6CA 1K8UA 1C7VA 3KPXA 2LMUA 3L4LA 4DRWA 3OX5A 1OE9B 2CXJA 2CNPA 1LINA 1TNXA 1YX7A 3PN7B 3SIAA 1DJHA 3PATA 3BFAA 4YI9A 2KBMA 3A4UB 3S0EA 3S0DA 1KK7Y 2EHBA 4PE4A 1DJXA 1SNLA 5HKWA 4PALA 1YRTB 1A75B 1B1GA 3GK4X 4USLA 4MRYA 1KSOA 3SG5A 2BE6A 2MLEC 2NCPA 1JSAA 3QMEA 1SL8A 1XFVO 5BPJA 4M2OA 1EL4A 1TUJA 2JT0A 3JTDC 4E68A 1SL7A 4INXA 2H61A 5JJGA 2LC5A 1PALA 3SIBA 1IH0A 1XO5A 1K2HA 1DF0A 2FJUB 4OCIA 1YRUB 2COLB 2M29A 1RWYA 4JWQA 1JFJA 4YGBB 1AK8A 2KI4B 3BYAA 4FQOA 4C0LA 1IIOA 1Y1UA 1TRFA 4PHNA 3PM8A 1KFXL 4JKTA 1WLMA 1RROA 5FI7A 3DF0A 1CM1A 3S0FA 3ZNIA 3TZ1A 2KNEA 4M2QA 1JF0A 1MWNA 2JPOA 5TNCA 1CNPA 3D73A 3NGVA 2K60A 1XFRA 3DVEA 1M31A 1RECA 1SRAA 3EK7A 3EVVA 3L4AA 5I2OA 2ZN8A 2V53A 3RZSA 1QASA 2M1KB 1Y1AA 3KEVA 4XJKB 1DT7B 1OSAA 2M7LA 1GGWA 2G2BA 1WRZA 4N1GA 2FCEA 2KDHA 2H2KA 3NHTA 2OTGB 2ZFDA 3ZWHA 3PSRA 3WXAA 2Y4QA 4HRGA 1KQMB 1J55A 3H4SE 2PSRA 4OKHA 3KF9A 1BR4B 4U8DA 1IQ3A 3I5HC 4FTGA 2KHNA 3CZ1A 4DIRA 2I94A 3BUMB 3BQ3A 1OMVA 2MHHA 3B88A 3N7HA 1ZUZA 1NCXA 4MLWA 2H8VA 3O6BA 2NXQA 2ZN9A 3PALA 3AAKA 2DOQA 3IF7A 4FQTA 2LMTA 3ICBA 5AXIA 4CLNA 1V1FA 1TTXA 5JOLA 4I5KA 1XFYO 4I5JA 2KQYA 2JZIA 3BOWA 5CSFA 1FPWA 1SCMC 4GGNA 1A75A 1SPYA 1LA0A 2Y1MA 2LAPA 2M8UA 2QACA 2ZNEA 3C1VA 4ETOA 4ORBB 1AUIB 4BY5A 1B8RA 1CLLA 3CDNA 2K0JA 2KFFA 3SJSA 2L4IA 2L2CA 2LLSA 2WC8A 3IQOA 1XK4A 1M39A 2BECA 1XYDA 5J3XA 1PRWA 1EG3A 1KFXS 3RLZA 3WNXB 5CSJA 1YUUA 2M1UA 2LVIA 2K7BA 2Y1NA 3SS3A 5PALA 4AOMA 1CDNA 5AEQA 3OBVA 4JD9A 2Q4UA 2SASA 2WCKA 1LS8A 1K90D 2K7CA 2KI6D 4GUKA 1MUXA 1L2OB 2CT9A 2HQWA 1X02A 4JPZB 4YGDB 5FI2A 3WHUB 1NPQA 1NIWA 2L4HA 1TNWA 3DY9A 1XK4C 3D76A 1BMOA 3Q8IA 3PLFB 3CZ0A 4C0JA 1DJIA 1DQEA 1TN4A 1K96A 1DVIA 3SG4A 1QX7A 1S6IA 3NXAA 1TWOA 3BUNB 2L51A 1MXLC 1UHKA 4MEWA 2ZKMX 2G9BA 1M46A 1ZFSA 4P2YB 1ODBA 1F4QA 3TDZA 1ZACA 1K95A 2PALA 3R1VA 2BKHB 2P6BB 2ZNDA 3S0AA 1S5GY 4QJ4B 2ZRSA 2ERBA 1AP4A 4OR9B 3DYEA 4MBEA 5HLOA 5I2LA 5D69A 2L50A 1Y6WA 5ER5A 2L2EA 3DXLA 1IWQA 2LHIA 2WCHA 2BAPA 2WCBA 1QX2A 3HX4A 4HSZA 2M49B 2LVJA 1GJYA 1H8BA 1B9AA 4YBHB 2LP2A 1OMRA 1PSBA 3DD4A 1UUSA 3FWBA 3S0BA 3KHEA 1XA5A 3CR5X 4P5OE 5HYDA 2JC2A 3B6XA 4PHJA 1J7PA 3B86A 1M45A 2ISDA 1N65A 2JQ6A 2OS8B 3LCPC 1JFKA 1A03A 1BF5A 1KWOC 1QLKA 2I7AA 4YI8A 4QJ3B 1J1DA 2FJYA 1K9PA 1EH2A 1SR6B 4HRHA 1CKKA 1RTP1 5F6TA 1PSRA 2NZ0A 2F8PA 1PULA 1YURA 2EGDA 2JXLA 4GPLB 4DCKA 1B4CA 3D75A 4CFRA 3AAJA 3LK0A 2BL0B 4GBAA 1S6JA 2K8MB 4AQIA 3FWCA 2QPTA 2QEOA 4XYNA 1JBAA 1FF1A 1F71A 1OOGA 2MAZA 3EKJA 2PQLA 2CCMA 4NDBA 3D78A 3JVTB 4PE0A 1WDCC 2PASA 4PE1A 1EJ3A 1OOHA 2KAVA 3RM1A 4MSPA 1BODA 3EG5B 3GK1A 5AANA 3S0GA 2L0PA 2Y5IA 3TUYB 3CLNA 3CZ2A 2CBLA 2JRFA 3BJHA 3I5FC 4YRUA 1C7WA 3BXKA 2H61C 3MSEB 1OQPA 1DMOA 2FOTA 4I5LB 2LCPA 1IJ6A 1B8LA 3TDUA 1NUBA 1NX3A 5AERA 2L5YA 2LV7A 4WRIA 2CTNA 5DKRA 3SS5A 2YGUA 5HL1A 3NSKA 3TS5B 1MHOA 1K93D 1M63B 1DC1A 1NX1A 3CR2A 1QATA 4N1FA 1KK8C 1UWOA 3D0YB 4PE7A 3EKHA 4WQ2A 1EG4A 1UHIA 3K1EA 1TCOB 3FIAA 4N5XA 4YGAA 1S5GZ 1JWDA 2KSPA 5KTYA 1R6PA 4R1EA 3FE9A 3VRRA 1K9KA 4D1EA 1KQVA 2LE9B 1TOPA 3I5IB 4TNCA 1QJTA 1DGVA 1ALWA 1UHHA 4YGCB 4JQ0D 1QIVA 2LANA 1A4PA 1JUOA 1EXRA 2MJWB 5FI6A 2F2PA 3UO9A 4M2PA 4NQGA 2LVVA 2WCLA 1SYMA 5I8NA 1GM0A 2BCXA 3CS1A 5CSIA 3GOFA 2EC6B 1BT6A 2QEBA 2WCFA 2Q91A 2KFGA 1LXFC 3EK4A 3NSIA 1NP8A 3PN7C 4GAOA 3SG6A 2AUCA 1QVIY 1UURA 1IGVA 3A8RA 1QV0A 1T14A 2K7DA 4BY4A 4CIDA 2JT3A 3JTDB 2LP3A 1ZMZA 1XFUO 3K21A 4PHMA 4Q04A 2BNXA 1K94A 1CDLA 3CTNA 3SG2A 5HKYA 3CGAA 2BBNA 4PT1A 1DELA 1XVJA 1PK0D 3WHTB 2PVBA 1B7TZ 1YUSA 1YVLA 1N0YA 3OX6A 2WCMA 5D3OA 5DKNA 1J1EA 1ZOTB 5ER4X 2BCBA 1RFJA 2OPOA 3HCMA 2BL0C 1VRKA 1SY9A 2LMVA 1RJVA 1C07A 3VB1A 3OP0A 2NCOA 2BKIB 1G8IA 4XJKA 3KO0A 2KI4C 2L98A 3NSOA 1BU3A 3AKAA 3VRNA 3FE8A 1WY9A 2KGRA 3F45A 2M7NA 1LA3A 1F70A 1DF0B 1L7ZA 2JNXA 2LUXA 2M3WA 3IVTA 3B87A 3R1PA 1C3YA 1B8CA 2AAOA 3CYZA 1NX2A 1DJGA 3TUYC 1SCVA 4WQ3A 1QLSA 3D0YA 5G08A 2FCDA 1CM4A 1S3PA 1C3ZA 1SSEB 2M0RA 1DJWA 1IQ5A 2HF5A 1H4BA 3DF0B 1Q80A 1W7IB 1S36A 3D77A 3EVUA 2LNKA 1G33A 1TCFA 2WCEA 3EVRA 1LVCD 5HKZA 3I5HB 2NLNA 1U5IB 1NSHA 1Y0VH 2OTGC 1CFFA 4CFQA 1KQMC 1KCYA 3FE6A 3L47A 1UP5A 3OGNA 4KYNA 1RK9A 2RGIA 2JU0A 3CR4X 5KU1A 2KGBC 3O2PA 3DVMA 1CDMA 2KPHA 1UHNA 1SCMB 2KLEA 2R2IA 1XFZO 3VROA 3LLEA 4ORCB 2MBXA 1W9ZA 3GK2A 5EL2A 5GQQC 1F4OA 1KFUL 3D74A 1QTXA 2JWWA 2K2AA 1HQVA 1OOFA 2QDIA 3CZTX 5K89A 2KYCA 1SK6D 4PCWA 1B7TY 1DJYA 3BFHA 1QVIZ 5CSNA 2QEVA 2HPSA 4L9MA 1WLZA 2LHLA 5D7FA 3QRXA 5AFPA 3V2LA 4OVNF 1TNPA 2BE4A 3BOWB 2EC6C 2M9GA 3SG3A 1CFDA 1GGZA 3DVKA 1SW8A 4F7FA 2GGZA 1YTZC 2KBIA 1MR8A 2SCPA 3DVJA 4ZCUA 1D1OA 1J7QA 2KFHA 3OB1B 1JF2A 1PVBA 1XFWO 1TNQA 4INWA 5CPVA 1ORGA 1L2OC 1YVHA 4I5NB 3BUXB 1S26D 4OV2A 5DICA 3OB2B 2K61A 1QX5B 1F54A 4OZDA 3BUWB 1SKTA 1NWDA 1YR5A 4IL1A
chains in the Genus database with same CATH topology
2JOJA 1UHJA 5DKQA 4C0KA 1IKUA 3LL8B 1QIWA 5FYXA 1V1GA 2JXCA 1IRJA 3I5GB 3O4YA 1N2DA 1U5IA 2LLUA 2I2RE 4F0ZB 2JTTA 1BG1A 1BLQA 1K9UA 2JT8A 1OMDA 2O60A 2ZRTA 4ORAB 2LUCA 4DS7A 4GGFA 1CFPA 1OZSA 1OOJA 1NCZA 1QXPA 1YX8A 1AHRA 2HETA 1KFUS 1TIZA 1BR1B 1NYAA 1SBJA 1A29A 3O78A 3LK1A 1FBVA 3M0WA 4DUQA 2A4JA 1CLBA 2KI6C 2KAYA 2KAXA 1GQMA 1SL9A 3AKBA 1KWOB 2VRGA 5B8IB 1XFXO 2WORA 1S1EA 4MZJA 1B47A 2KQ6A 4NDDA 1IJ5A 2LM5A 5IBWA 2E6WA 4GGFC 1Y1XA 1IG5A 3NSLA 2OS8C 1A2XA 3PFVA 1JC2A 2AMIA 1QV1A 2KYFA 3IQQA 1R2UA 4ZCVA 3OHMB 2LLTA 2IS9A 2HQ8A 1WRLA 1AVSA 1SR6C 1E8AA 1DTLA 2D8NA 1F8HA 3CWGA 1HT9A 2LVKA 2O5GA 4YGEB 2BBMA 1F55A 4MVFA 2MA2A 2TN4A 1KK7Z 2WNDA 1WDCB 1G4YR 1CTRA 2JNFA 1SMGA 2GGMA 2B1UA 2K2FA 2MLFC 1CMGA 1CLMA 4PDZA 1CMFA 3BUOB 4ICBA 4UPGA 2GV5A 3JVTC 1DJZA 4GNKB 4NDCA 3I5FB 1NX0A 4CPVA 2K7OA 1CFCA 4A4CA 2KOTA 1MQ1A 2L5XB 1AJ4A 1MXEA 1OZOA 3SG7A 3VRQA 1CB1A 1J7OA 3FS7A 2PRUA 2M97A 2MRDA 1W7JB 1MF8B 1ALVA 2F33A 1WRKA 2F3ZA 2I18A 1AJ5A 2F3YA 5KSZA 2PMYA 3VRPA 1KK8B 4HREE 1YUTA 2WOSA 3TDIA 4MN0A 4A4BA 3TS5C 2JPTA 1NCYA 4AQJA 1FI5A 4MRXA 4MZLA 5HLVA 4MZKA 1BJFA 3E3RA 3VGOA 2JULA 4PHKA 1FI6A 2JTZA 1DGUA 3I5GC 1J7RA 1PVAA 1QS7A 1FW4A 4QJ5B 2F2OA 1KSMA 1BOCA 3EK8A 5I2QA 4GFTA 1CDPA 3I5IC 2E30A 3D10A 1LKJA 1S6CA 1K8UA 1C7VA 3KPXA 2LMUA 4DRWA 3OX5A 1OE9B 2CXJA 2CNPA 1LINA 1TNXA 1YX7A 3PN7B 3SIAA 1DJHA 3PATA 4YI9A 2KBMA 3A4UB 1KK7Y 2EHBA 4PE4A 1DJXA 1SNLA 5HKWA 4PALA 1YRTB 1A75B 1B1GA 3GK4X 4USLA 4MRYA 1KSOA 3SG5A 2BE6A 2MLEC 2NCPA 1JSAA 1SL8A 1XFVO 5BPJA 4M2OA 1EL4A 2JT0A 3JTDC 4E68A 1SL7A 2H61A 5JJGA 2LC5A 1PALA 3SIBA 1IH0A 1XO5A 1K2HA 1DF0A 2FJUB 4OCIA 1YRUB 2COLB 2M29A 1RWYA 4JWQA 1JFJA 4YGBB 1AK8A 2KI4B 3BYAA 4FQOA 4C0LA 1Y1UA 1TRFA 4PHNA 3PM8A 1KFXL 1WLMA 1RROA 3DF0A 1CM1A 3ZNIA 3TZ1A 2KNEA 4M2QA 1JF0A 1MWNA 5TNCA 1CNPA 3DVEA 1M31A 1RECA 1SRAA 3EK7A 3EVVA 5I2OA 2ZN8A 2V53A 1QASA 2M1KB 1Y1AA 3KEVA 4XJKB 1DT7B 1OSAA 2M7LA 1GGWA 2G2BA 1WRZA 4N1GA 2FCEA 2KDHA 2H2KA 1SKTA 2OTGB 2ZFDA 3ZWHA 3PSRA 3WXAA 2Y4QA 4HRGA 1KQMB 1J55A 3H4SE 2PSRA 4OKHA 3KF9A 1BR4B 4U8DA 1IQ3A 3I5HC 4FTGA 2KHNA 4DIRA 2I94A 3BUMB 3BQ3A 1OMVA 2MHHA 4MLWA 1ZUZA 1NCXA 3O6BA 2NXQA 2ZN9A 3PALA 3AAKA 2DOQA 3IF7A 2LMTA 3ICBA 5AXIA 4CLNA 1V1FA 1TTXA 5JOLA 4I5KA 1XFYO 4I5JA 2KQYA 2JZIA 3BOWA 5CSFA 1FPWA 1SCMC 4GGNA 1A75A 1SPYA 1LA0A 2Y1MA 2LAPA 2M8UA 2QACA 2ZNEA 3C1VA 4ETOA 4ORBB 1AUIB 4BY5A 1B8RA 1CLLA 2K0JA 2KFFA 3SJSA 2L4IA 2LLSA 2WC8A 3IQOA 1XK4A 1M39A 2BECA 1XYDA 5J3XA 1PRWA 1EG3A 1KFXS 3WNXB 5CSJA 1YUUA 2M1UA 2LVIA 2K7BA 2Y1NA 4AOMA 5PALA 1CDNA 5AEQA 2Q4UA 2SASA 1K90D 2K7CA 2KI6D 4GUKA 2CT9A 1L2OB 1MUXA 2HQWA 1X02A 4JPZB 4YGDB 3WHUB 1NPQA 1NIWA 2L4HA 1TNWA 1XK4C 1BMOA 3PLFB 4C0JA 1DJIA 1TN4A 1K96A 1DVIA 3SG4A 1QX7A 1S6IA 3NXAA 3BUNB 2L51A 1MXLC 1UHKA 4MEWA 2ZKMX 2G9BA 1M46A 1ZFSA 4P2YB 1ODBA 1F4QA 3TDZA 1ZACA 1K95A 2PALA 2BKHB 2P6BB 2ZNDA 1S5GY 4QJ4B 2ZRSA 1AP4A 4OR9B 5HLOA 4MBEA 5I2LA 5D69A 2L50A 1Y6WA 5ER5A 2L2EA 1IWQA 2LHIA 2WCBA 1QX2A 3HX4A 4HSZA 2M49B 2LVJA 1GJYA 1H8BA 1B9AA 4YBHB 2LP2A 1OMRA 1PSBA 3DD4A 1UUSA 3FWBA 3KHEA 1XA5A 3CR5X 4P5OE 5HYDA 2JC2A 1J7PA 4PHJA 1M45A 2ISDA 1N65A 2JQ6A 2OS8B 3LCPC 1JFKA 1A03A 1BF5A 1KWOC 1QLKA 2I7AA 4YI8A 4QJ3B 1J1DA 1K9PA 1EH2A 1SR6B 4HRHA 1CKKA 1RTP1 5F6TA 1PSRA 2NZ0A 2F8PA 1PULA 1YURA 2EGDA 2JXLA 4GPLB 4DCKA 1B4CA 4CFRA 3AAJA 3LK0A 2BL0B 4GBAA 1S6JA 2K8MB 4AQIA 3FWCA 2QPTA 4XYNA 1JBAA 1FF1A 1F71A 2MAZA 3EKJA 2CCMA 4NDBA 3JVTB 4PE0A 1WDCC 2PASA 4PE1A 1EJ3A 2KAVA 3RM1A 4MSPA 1BODA 3GK1A 5AANA 2L0PA 2Y5IA 3TUYB 3CLNA 2CBLA 2JRFA 3I5FC 4YRUA 1C7WA 3BXKA 2H61C 3MSEB 1OQPA 1DMOA 2FOTA 4I5LB 2LCPA 1IJ6A 1B8LA 3TDUA 1NUBA 1NX3A 5AERA 2LV7A 4WRIA 2CTNA 5DKRA 3NSKA 3TS5B 1MHOA 1K93D 1M63B 1NX1A 3CR2A 1QATA 4N1FA 1KK8C 1UWOA 3D0YB 4PE7A 3EKHA 4WQ2A 1EG4A 1UHIA 4N5XA 1TCOB 3FIAA 4YGAA 1JWDA 1S5GZ 2KSPA 5KTYA 1R6PA 4R1EA 3VRRA 1K9KA 4D1EA 1KQVA 2LE9B 1TOPA 3I5IB 4TNCA 1QJTA 1DGVA 1ALWA 1UHHA 4YGCB 4JQ0D 1QIVA 2LANA 1A4PA 1JUOA 1EXRA 2MJWB 2F2PA 4M2PA 4NQGA 2LVVA 1SYMA 5I8NA 2BCXA 3CS1A 5CSIA 3GOFA 2EC6B 1BT6A 2WCFA 2Q91A 2KFGA 1LXFC 3EK4A 3NSIA 1NP8A 3PN7C 4GAOA 3SG6A 2AUCA 1QVIY 1UURA 1IGVA 3A8RA 1QV0A 2K7DA 4BY4A 4CIDA 2JT3A 3JTDB 2LP3A 1ZMZA 1XFUO 3K21A 4PHMA 4Q04A 3CTNA 1K94A 1CDLA 3SG2A 5HKYA 3CGAA 2BBNA 1XVJA 1PK0D 3WHTB 2PVBA 1B7TZ 1YUSA 1YVLA 1N0YA 3OX6A 5DKNA 3RLZA 1J1EA 1ZOTB 5ER4X 2BCBA 1RFJA 2OPOA 3HCMA 2BL0C 1VRKA 1SY9A 2LMVA 1RJVA 1C07A 3OP0A 2NCOA 2BKIB 1G8IA 4XJKA 3KO0A 2KI4C 2L98A 3NSOA 1BU3A 3AKAA 3VRNA 1WY9A 2KGRA 3F45A 2M7NA 1LA3A 1F70A 1DF0B 1L7ZA 2JNXA 2LUXA 2M3WA 1B8CA 2AAOA 1NX2A 1DJGA 3TUYC 1SCVA 4WQ3A 1QLSA 3D0YA 5G08A 2FCDA 1CM4A 1S3PA 2M0RA 1DJWA 1IQ5A 2HF5A 1H4BA 3DF0B 1Q80A 1W7IB 1S36A 3EVUA 2LNKA 1G33A 1TCFA 2WCEA 3EVRA 1LVCD 5HKZA 3I5HB 2NLNA 1U5IB 1NSHA 1Y0VH 2OTGC 1CFFA 4CFQA 1KQMC 1KCYA 1UP5A 1RK9A 2RGIA 2JU0A 3CR4X 5KU1A 2KGBC 3O2PA 3DVMA 1CDMA 1UHNA 1SCMB 2R2IA 1XFZO 3VROA 3LLEA 4ORCB 2MBXA 3GK2A 5GQQC 1F4OA 1KFUL 1QTXA 2JWWA 2K2AA 1HQVA 3CZTX 5K89A 2KYCA 1SK6D 4PCWA 1B7TY 1DJYA 1QVIZ 5CSNA 2HPSA 4L9MA 1WLZA 2LHLA 5D7FA 3QRXA 5AFPA 4OVNF 1TNPA 2BE4A 3BOWB 2EC6C 2M9GA 3SG3A 1CFDA 1GGZA 3DVKA 1SW8A 2GGZA 1YTZC 2KBIA 1MR8A 2SCPA 3DVJA 4ZCUA 1D1OA 1J7QA 2KFHA 3OB1B 1JF2A 1PVBA 1XFWO 1TNQA 5CPVA 1L2OC 1YVHA 4I5NB 3BUXB 1S26D 4OV2A 3OB2B 2K61A 1QX5B 1F54A 3BUWB 2BCAA 1NWDA 1YR5A 4IL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOJ A;  1UHJ A;  5DKQ A;  4C0K A;  1IKU A;  3LL8 B;  1QIW A;  5FYX A;  1V1G A;  2JXC A;  1IRJ A;  3I5G B;  3O4Y A;  1N2D A;  1U5I A;  2LLU A;  2I2R E;  4F0Z B;  2JTT A;  1BG1 A;  1BLQ A;  1K9U A;  2JT8 A;  1OMD A;  2O60 A;  2ZRT A;  4ORA B;  2LUC A;  4DS7 A;  4GGF A;  1CFP A;  1OZS A;  1OOJ A;  1NCZ A;  1QXP A;  1YX8 A;  1AHR A;  2HET A;  1KFU S;  1TIZ A;  1BR1 B;  1NYA A;  1SBJ A;  1A29 A;  3O78 A;  3LK1 A;  1FBV A;  3M0W A;  4DUQ A;  2A4J A;  1CLB A;  2KI6 C;  2KAY A;  2KAX A;  1GQM A;  1SL9 A;  3AKB A;  1KWO B;  2VRG A;  5B8I B;  1XFX O;  2WOR A;  1S1E A;  4MZJ A;  1B47 A;  2KQ6 A;  4NDD A;  1IJ5 A;  2LM5 A;  5IBW A;  2E6W A;  4GGF C;  1Y1X A;  1IG5 A;  3NSL A;  2OS8 C;  1A2X A;  3PFV A;  1JC2 A;  2AMI A;  1QV1 A;  2KYF A;  3IQQ A;  1R2U A;  4ZCV A;  3OHM B;  2LLT A;  2IS9 A;  2HQ8 A;  1WRL A;  1AVS A;  1SR6 C;  1E8A A;  1DTL A;  2D8N A;  1F8H A;  3CWG A;  1HT9 A;  2LVK A;  2O5G A;  4YGE B;  2BBM A;  1F55 A;  4MVF A;  2MA2 A;  2TN4 A;  1KK7 Z;  2WND A;  1WDC B;  1G4Y R;  1CTR A;  2JNF A;  1SMG A;  2GGM A;  2B1U A;  2K2F A;  2MLF C;  1CMG A;  1CLM A;  4PDZ A;  1CMF A;  3BUO B;  4ICB A;  4UPG A;  2GV5 A;  3JVT C;  1DJZ A;  4GNK B;  4NDC A;  3I5F B;  1NX0 A;  4CPV A;  2K7O A;  1CFC A;  4A4C A;  2KOT A;  1MQ1 A;  2L5X B;  1AJ4 A;  1MXE A;  1OZO A;  3SG7 A;  3VRQ A;  1CB1 A;  1J7O A;  3FS7 A;  2PRU A;  2M97 A;  2MRD A;  1W7J B;  1MF8 B;  1ALV A;  2F33 A;  1WRK A;  2F3Z A;  2I18 A;  1AJ5 A;  2F3Y A;  5KSZ A;  2PMY A;  3VRP A;  1KK8 B;  4HRE E;  1YUT A;  2WOS A;  3TDI A;  4MN0 A;  4A4B A;  3TS5 C;  2JPT A;  1NCY A;  4AQJ A;  1FI5 A;  4MRX A;  4MZL A;  5HLV A;  4MZK A;  1BJF A;  3E3R A;  3VGO A;  2JUL A;  4PHK A;  1FI6 A;  2JTZ A;  1DGU A;  3I5G C;  1J7R A;  1PVA A;  1QS7 A;  1FW4 A;  4QJ5 B;  2F2O A;  1KSM A;  1BOC A;  3EK8 A;  5I2Q A;  4GFT A;  1CDP A;  3I5I C;  2E30 A;  3D10 A;  1LKJ A;  1S6C A;  1K8U A;  1C7V A;  3KPX A;  2LMU A;  4DRW A;  3OX5 A;  1OE9 B;  2CXJ A;  2CNP A;  1LIN A;  1TNX A;  1YX7 A;  3PN7 B;  3SIA A;  1DJH A;  3PAT A;  4YI9 A;  2KBM A;  3A4U B;  1KK7 Y;  2EHB A;  4PE4 A;  1DJX A;  1SNL A;  5HKW A;  4PAL A;  1YRT B;  1A75 B;  1B1G A;  3GK4 X;  4USL A;  4MRY A;  1KSO A;  3SG5 A;  2BE6 A;  2MLE C;  2NCP A;  1JSA A;  1SL8 A;  1XFV O;  5BPJ A;  4M2O A;  1EL4 A;  2JT0 A;  3JTD C;  4E68 A;  1SL7 A;  2H61 A;  5JJG A;  2LC5 A;  1PAL A;  3SIB A;  1IH0 A;  1XO5 A;  1K2H A;  1DF0 A;  2FJU B;  4OCI A;  1YRU B;  2COL B;  2M29 A;  1RWY A;  4JWQ A;  1JFJ A;  4YGB B;  1AK8 A;  2KI4 B;  3BYA A;  4FQO A;  4C0L A;  1Y1U A;  1TRF A;  4PHN A;  3PM8 A;  1KFX L;  1WLM A;  1RRO A;  3DF0 A;  1CM1 A;  3ZNI A;  3TZ1 A;  2KNE A;  4M2Q A;  1JF0 A;  1MWN A;  5TNC A;  1CNP A;  3DVE A;  1M31 A;  1REC A;  1SRA A;  3EK7 A;  3EVV A;  5I2O A;  2ZN8 A;  2V53 A;  1QAS A;  2M1K B;  1Y1A A;  3KEV A;  4XJK B;  1DT7 B;  1OSA A;  2M7L A;  1GGW A;  2G2B A;  1WRZ A;  4N1G A;  2FCE A;  2KDH A;  2H2K A;  1SKT A;  2OTG B;  2ZFD A;  3ZWH A;  3PSR A;  3WXA A;  2Y4Q A;  4HRG A;  1KQM B;  1J55 A;  3H4S E;  2PSR A;  4OKH A;  3KF9 A;  1BR4 B;  4U8D A;  1IQ3 A;  3I5H C;  4FTG A;  2KHN A;  4DIR A;  2I94 A;  3BUM B;  3BQ3 A;  1OMV A;  2MHH A;  4MLW A;  1ZUZ A;  1NCX A;  3O6B A;  2NXQ A;  2ZN9 A;  3PAL A;  3AAK A;  2DOQ A;  3IF7 A;  2LMT A;  3ICB A;  5AXI A;  4CLN A;  1V1F A;  1TTX A;  5JOL A;  4I5K A;  1XFY O;  4I5J A;  2KQY A;  2JZI A;  3BOW A;  5CSF A;  1FPW A;  1SCM C;  4GGN A;  1A75 A;  1SPY A;  1LA0 A;  2Y1M A;  2LAP A;  2M8U A;  2QAC A;  2ZNE A;  3C1V A;  4ETO A;  4ORB B;  1AUI B;  4BY5 A;  1B8R A;  1CLL A;  2K0J A;  2KFF A;  3SJS A;  2L4I A;  2LLS A;  2WC8 A;  3IQO A;  1XK4 A;  1M39 A;  2BEC A;  1XYD A;  5J3X A;  1PRW A;  1EG3 A;  1KFX S;  3WNX B;  5CSJ A;  1YUU A;  2M1U A;  2LVI A;  2K7B A;  2Y1N A;  4AOM A;  5PAL A;  1CDN A;  5AEQ A;  2Q4U A;  2SAS A;  1K90 D;  2K7C A;  2KI6 D;  4GUK A;  2CT9 A;  1L2O B;  1MUX A;  2HQW A;  1X02 A;  4JPZ B;  4YGD B;  3WHU B;  1NPQ A;  1NIW A;  2L4H A;  1TNW A;  1XK4 C;  1BMO A;  3PLF B;  4C0J A;  1DJI A;  1TN4 A;  1K96 A;  1DVI A;  3SG4 A;  1QX7 A;  1S6I A;  3NXA A;  3BUN B;  2L51 A;  1MXL C;  1UHK A;  4MEW A;  2ZKM X;  2G9B A;  1M46 A;  1ZFS A;  4P2Y B;  1ODB A;  1F4Q A;  3TDZ A;  1ZAC A;  1K95 A;  2PAL A;  2BKH B;  2P6B B;  2ZND A;  1S5G Y;  4QJ4 B;  2ZRS A;  1AP4 A;  4OR9 B;  5HLO A;  4MBE A;  5I2L A;  5D69 A;  2L50 A;  1Y6W A;  5ER5 A;  2L2E A;  1IWQ A;  2LHI A;  2WCB A;  1QX2 A;  3HX4 A;  4HSZ A;  2M49 B;  2LVJ A;  1GJY A;  1H8B A;  1B9A A;  4YBH B;  2LP2 A;  1OMR A;  1PSB A;  3DD4 A;  1UUS A;  3FWB A;  3KHE A;  1XA5 A;  3CR5 X;  4P5O E;  5HYD A;  2JC2 A;  1J7P A;  4PHJ A;  1M45 A;  2ISD A;  1N65 A;  2JQ6 A;  2OS8 B;  3LCP C;  1JFK A;  1A03 A;  1BF5 A;  1KWO C;  1QLK A;  2I7A A;  4YI8 A;  4QJ3 B;  1J1D A;  1K9P A;  1EH2 A;  1SR6 B;  4HRH A;  1CKK A;  1RTP 1;  5F6T A;  1PSR A;  2NZ0 A;  2F8P A;  1PUL A;  1YUR A;  2EGD A;  2JXL A;  4GPL B;  4DCK A;  1B4C A;  4CFR A;  3AAJ A;  3LK0 A;  2BL0 B;  4GBA A;  1S6J A;  2K8M B;  4AQI A;  3FWC A;  2QPT A;  4XYN A;  1JBA A;  1FF1 A;  1F71 A;  2MAZ A;  3EKJ A;  2CCM A;  4NDB A;  3JVT B;  4PE0 A;  1WDC C;  2PAS A;  4PE1 A;  1EJ3 A;  2KAV A;  3RM1 A;  4MSP A;  1BOD A;  3GK1 A;  5AAN A;  2L0P A;  2Y5I A;  3TUY B;  3CLN A;  2CBL A;  2JRF A;  3I5F C;  4YRU A;  1C7W A;  3BXK A;  2H61 C;  3MSE B;  1OQP A;  1DMO A;  2FOT A;  4I5L B;  2LCP A;  1IJ6 A;  1B8L A;  3TDU A;  1NUB A;  1NX3 A;  5AER A;  2LV7 A;  4WRI A;  2CTN A;  5DKR A;  3NSK A;  3TS5 B;  1MHO A;  1K93 D;  1M63 B;  1NX1 A;  3CR2 A;  1QAT A;  4N1F A;  1KK8 C;  1UWO A;  3D0Y B;  4PE7 A;  3EKH A;  4WQ2 A;  1EG4 A;  1UHI A;  4N5X A;  1TCO B;  3FIA A;  4YGA A;  1JWD A;  1S5G Z;  2KSP A;  5KTY A;  1R6P A;  4R1E A;  3VRR A;  1K9K A;  4D1E A;  1KQV A;  2LE9 B;  1TOP A;  3I5I B;  4TNC A;  1QJT A;  1DGV A;  1ALW A;  1UHH A;  4YGC B;  4JQ0 D;  1QIV A;  2LAN A;  1A4P A;  1JUO A;  1EXR A;  2MJW B;  2F2P A;  4M2P A;  4NQG A;  2LVV A;  1SYM A;  5I8N A;  2BCX A;  3CS1 A;  5CSI A;  3GOF A;  2EC6 B;  1BT6 A;  2WCF A;  2Q91 A;  2KFG A;  1LXF C;  3EK4 A;  3NSI A;  1NP8 A;  3PN7 C;  4GAO A;  3SG6 A;  2AUC A;  1QVI Y;  1UUR A;  1IGV A;  3A8R A;  1QV0 A;  2K7D A;  4BY4 A;  4CID A;  2JT3 A;  3JTD B;  2LP3 A;  1ZMZ A;  1XFU O;  3K21 A;  4PHM A;  4Q04 A;  3CTN A;  1K94 A;  1CDL A;  3SG2 A;  5HKY A;  3CGA A;  2BBN A;  1XVJ A;  1PK0 D;  3WHT B;  2PVB A;  1B7T Z;  1YUS A;  1YVL A;  1N0Y A;  3OX6 A;  5DKN A;  3RLZ A;  1J1E A;  1ZOT B;  5ER4 X;  2BCB A;  1RFJ A;  2OPO A;  3HCM A;  2BL0 C;  1VRK A;  1SY9 A;  2LMV A;  1RJV A;  1C07 A;  3OP0 A;  2NCO A;  2BKI B;  1G8I A;  4XJK A;  3KO0 A;  2KI4 C;  2L98 A;  3NSO A;  1BU3 A;  3AKA A;  3VRN A;  1WY9 A;  2KGR A;  3F45 A;  2M7N A;  1LA3 A;  1F70 A;  1DF0 B;  1L7Z A;  2JNX A;  2LUX A;  2M3W A;  1B8C A;  2AAO A;  1NX2 A;  1DJG A;  3TUY C;  1SCV A;  4WQ3 A;  1QLS A;  3D0Y A;  5G08 A;  2FCD A;  1CM4 A;  1S3P A;  2M0R A;  1DJW A;  1IQ5 A;  2HF5 A;  1H4B A;  3DF0 B;  1Q80 A;  1W7I B;  1S36 A;  3EVU A;  2LNK A;  1G33 A;  1TCF A;  2WCE A;  3EVR A;  1LVC D;  5HKZ A;  3I5H B;  2NLN A;  1U5I B;  1NSH A;  1Y0V H;  2OTG C;  1CFF A;  4CFQ A;  1KQM C;  1KCY A;  1UP5 A;  1RK9 A;  2RGI A;  2JU0 A;  3CR4 X;  5KU1 A;  2KGB C;  3O2P A;  3DVM A;  1CDM A;  1UHN A;  1SCM B;  2R2I A;  1XFZ O;  3VRO A;  3LLE A;  4ORC B;  2MBX A;  3GK2 A;  5GQQ C;  1F4O A;  1KFU L;  1QTX A;  2JWW A;  2K2A A;  1HQV A;  3CZT X;  5K89 A;  2KYC A;  1SK6 D;  4PCW A;  1B7T Y;  1DJY A;  1QVI Z;  5CSN A;  2HPS A;  4L9M A;  1WLZ A;  2LHL A;  5D7F A;  3QRX A;  5AFP A;  4OVN F;  1TNP A;  2BE4 A;  3BOW B;  2EC6 C;  2M9G A;  3SG3 A;  1CFD A;  1GGZ A;  3DVK A;  1SW8 A;  2GGZ A;  1YTZ C;  2KBI A;  1MR8 A;  2SCP A;  3DVJ A;  4ZCU A;  1D1O A;  1J7Q A;  2KFH A;  3OB1 B;  1JF2 A;  1PVB A;  1XFW O;  1TNQ A;  5CPV A;  1L2O C;  1YVH A;  4I5N B;  3BUX B;  1S26 D;  4OV2 A;  3OB2 B;  2K61 A;  1QX5 B;  1F54 A;  3BUW B;  2BCA A;  1NWD A;  1YR5 A;  4IL1 A; 
#chains in the Genus database with same CATH topology
 2JOJ A;  1UHJ A;  5DKQ A;  4IJ7 A;  4C0K A;  1IKU A;  3LL8 B;  1QIW A;  5FYX A;  3SS4 A;  1V1G A;  2JXC A;  2P70 A;  1IRJ A;  3I5G B;  3O4Y A;  1N2D A;  1U5I A;  2LLU A;  2I2R E;  1Z2C B;  3UNW A;  4F0Z B;  2JTT A;  1BG1 A;  1BLQ A;  1K9U A;  2JT8 A;  1OMD A;  2O60 A;  2ZRT A;  1TUZ A;  1P28 A;  2LUC A;  3B7A A;  4ORA B;  4DS7 A;  4GGF A;  1CFP A;  1OZS A;  1OOJ A;  1NCZ A;  1QXP A;  1YX8 A;  1AHR A;  3R1O A;  2HET A;  1KFU S;  3BFB A;  1TIZ A;  1BR1 B;  1NYA A;  1SBJ A;  1A29 A;  3O78 A;  3LK1 A;  1FBV A;  3M0W A;  4DUQ A;  2A4J A;  1CLB A;  2KI6 C;  2KAY A;  2KAX A;  1GQM A;  1SL9 A;  2WC6 A;  3AKB A;  1KWO B;  3PM2 A;  2VRG A;  5B8I B;  1XFX O;  2WOR A;  1S1E A;  2PYQ A;  1B47 A;  2KQ6 A;  4MZJ A;  1IJ5 A;  2LM5 A;  4NDD A;  5IBW A;  2E6W A;  4GGF C;  1Y1X A;  1IG5 A;  3NSL A;  2BCA A;  2OS8 C;  1A2X A;  3PFV A;  1JC2 A;  2AMI A;  1QV1 A;  2KYF A;  3IQQ A;  1Z4H A;  1R2U A;  3OHM B;  2LLT A;  2IS9 A;  4ZCV A;  2HQ8 A;  1WRL A;  1AVS A;  1SR6 C;  2QEH A;  1E8A A;  1DTL A;  2D8N A;  1F8H A;  3CWG A;  1HT9 A;  2LVK A;  2O5G A;  4YGE B;  2BBM A;  3R72 A;  1F55 A;  4MVF A;  2MA2 A;  2TN4 A;  1KK7 Z;  2WND A;  1WDC B;  1G4Y R;  2KLD A;  1CTR A;  2JNF A;  1SMG A;  2GGM A;  3PJI A;  2B1U A;  2K2F A;  2MLF C;  1CMG A;  1CLM A;  4PDZ A;  1CMF A;  2GTE A;  3BUO B;  4ICB A;  4UPG A;  2GV5 A;  3JVT C;  1DJZ A;  4GNK B;  4NDC A;  3I5F B;  1NX0 A;  4CPV A;  2K7O A;  1OOI X;  1CFC A;  4A4C A;  2KOT A;  1QWV A;  1DEK A;  1MQ1 A;  2L5X B;  1AJ4 A;  1MXE A;  1OZO A;  3SG7 A;  3VRQ A;  1CB1 A;  2P71 A;  1J7O A;  3FS7 A;  1OW4 A;  2PRU A;  2M97 A;  3DZT A;  2MRD A;  1W7J B;  1MF8 B;  1ALV A;  2F33 A;  1WRK A;  2F3Z A;  2I18 A;  1AJ5 A;  2F3Y A;  5I94 A;  5KSZ A;  2PMY A;  3VRP A;  1KK8 B;  4HRE E;  1YUT A;  2WOS A;  2WCJ A;  4MN0 A;  3TDI A;  4A4B A;  3NHI A;  3TS5 C;  2JPT A;  1NCY A;  4AQJ A;  1FI5 A;  4MRX A;  4MZL A;  5HLV A;  4MZK A;  2WC5 A;  1BJF A;  3E3R A;  3VGO A;  2JUL A;  4PHK A;  1FI6 A;  2JTZ A;  1DGU A;  3O4X A;  3I5G C;  3CAB A;  1J7R A;  1PVA A;  1QS7 A;  1FW4 A;  4QJ5 B;  2F2O A;  1KSM A;  1BOC A;  3EK8 A;  5I2Q A;  4GFT A;  1CDP A;  3I5I C;  2E30 A;  3D10 A;  1LKJ A;  1S6C A;  1K8U A;  1C7V A;  3KPX A;  2LMU A;  3L4L A;  4DRW A;  3OX5 A;  1OE9 B;  2CXJ A;  2CNP A;  1LIN A;  1TNX A;  1YX7 A;  3PN7 B;  3SIA A;  1DJH A;  3PAT A;  3BFA A;  4YI9 A;  2KBM A;  3A4U B;  3S0E A;  3S0D A;  1KK7 Y;  2EHB A;  4PE4 A;  1DJX A;  1SNL A;  5HKW A;  4PAL A;  1YRT B;  1A75 B;  1B1G A;  3GK4 X;  4USL A;  4MRY A;  1KSO A;  3SG5 A;  2BE6 A;  2MLE C;  2NCP A;  1JSA A;  3QME A;  1SL8 A;  1XFV O;  5BPJ A;  4M2O A;  1EL4 A;  1TUJ A;  2JT0 A;  3JTD C;  4E68 A;  1SL7 A;  4INX A;  2H61 A;  5JJG A;  2LC5 A;  1PAL A;  3SIB A;  1IH0 A;  1XO5 A;  1K2H A;  1DF0 A;  2FJU B;  4OCI A;  1YRU B;  2COL B;  2M29 A;  1RWY A;  4JWQ A;  1JFJ A;  4YGB B;  1AK8 A;  2KI4 B;  3BYA A;  4FQO A;  4C0L A;  1IIO A;  1Y1U A;  1TRF A;  4PHN A;  3PM8 A;  1KFX L;  4JKT A;  1WLM A;  1RRO A;  5FI7 A;  3DF0 A;  1CM1 A;  3S0F A;  3ZNI A;  3TZ1 A;  2KNE A;  4M2Q A;  1JF0 A;  1MWN A;  2JPO A;  5TNC A;  1CNP A;  3D73 A;  3NGV A;  2K60 A;  1XFR A;  3DVE A;  1M31 A;  1REC A;  1SRA A;  3EK7 A;  3EVV A;  3L4A A;  5I2O A;  2ZN8 A;  2V53 A;  3RZS A;  1QAS A;  2M1K B;  1Y1A A;  3KEV A;  4XJK B;  1DT7 B;  1OSA A;  2M7L A;  1GGW A;  2G2B A;  1WRZ A;  4N1G A;  2FCE A;  2KDH A;  2H2K A;  3NHT A;  2OTG B;  2ZFD A;  3ZWH A;  3PSR A;  3WXA A;  2Y4Q A;  4HRG A;  1KQM B;  1J55 A;  3H4S E;  2PSR A;  4OKH A;  3KF9 A;  1BR4 B;  4U8D A;  1IQ3 A;  3I5H C;  4FTG A;  2KHN A;  3CZ1 A;  4DIR A;  2I94 A;  3BUM B;  3BQ3 A;  1OMV A;  2MHH A;  3B88 A;  3N7H A;  1ZUZ A;  1NCX A;  4MLW A;  2H8V A;  3O6B A;  2NXQ A;  2ZN9 A;  3PAL A;  3AAK A;  2DOQ A;  3IF7 A;  4FQT A;  2LMT A;  3ICB A;  5AXI A;  4CLN A;  1V1F A;  1TTX A;  5JOL A;  4I5K A;  1XFY O;  4I5J A;  2KQY A;  2JZI A;  3BOW A;  5CSF A;  1FPW A;  1SCM C;  4GGN A;  1A75 A;  1SPY A;  1LA0 A;  2Y1M A;  2LAP A;  2M8U A;  2QAC A;  2ZNE A;  3C1V A;  4ETO A;  4ORB B;  1AUI B;  4BY5 A;  1B8R A;  1CLL A;  3CDN A;  2K0J A;  2KFF A;  3SJS A;  2L4I A;  2L2C A;  2LLS A;  2WC8 A;  3IQO A;  1XK4 A;  1M39 A;  2BEC A;  1XYD A;  5J3X A;  1PRW A;  1EG3 A;  1KFX S;  3RLZ A;  3WNX B;  5CSJ A;  1YUU A;  2M1U A;  2LVI A;  2K7B A;  2Y1N A;  3SS3 A;  5PAL A;  4AOM A;  1CDN A;  5AEQ A;  3OBV A;  4JD9 A;  2Q4U A;  2SAS A;  2WCK A;  1LS8 A;  1K90 D;  2K7C A;  2KI6 D;  4GUK A;  1MUX A;  1L2O B;  2CT9 A;  2HQW A;  1X02 A;  4JPZ B;  4YGD B;  5FI2 A;  3WHU B;  1NPQ A;  1NIW A;  2L4H A;  1TNW A;  3DY9 A;  1XK4 C;  3D76 A;  1BMO A;  3Q8I A;  3PLF B;  3CZ0 A;  4C0J A;  1DJI A;  1DQE A;  1TN4 A;  1K96 A;  1DVI A;  3SG4 A;  1QX7 A;  1S6I A;  3NXA A;  1TWO A;  3BUN B;  2L51 A;  1MXL C;  1UHK A;  4MEW A;  2ZKM X;  2G9B A;  1M46 A;  1ZFS A;  4P2Y B;  1ODB A;  1F4Q A;  3TDZ A;  1ZAC A;  1K95 A;  2PAL A;  3R1V A;  2BKH B;  2P6B B;  2ZND A;  3S0A A;  1S5G Y;  4QJ4 B;  2ZRS A;  2ERB A;  1AP4 A;  4OR9 B;  3DYE A;  4MBE A;  5HLO A;  5I2L A;  5D69 A;  2L50 A;  1Y6W A;  5ER5 A;  2L2E A;  3DXL A;  1IWQ A;  2LHI A;  2WCH A;  2BAP A;  2WCB A;  1QX2 A;  3HX4 A;  4HSZ A;  2M49 B;  2LVJ A;  1GJY A;  1H8B A;  1B9A A;  4YBH B;  2LP2 A;  1OMR A;  1PSB A;  3DD4 A;  1UUS A;  3FWB A;  3S0B A;  3KHE A;  1XA5 A;  3CR5 X;  4P5O E;  5HYD A;  2JC2 A;  3B6X A;  4PHJ A;  1J7P A;  3B86 A;  1M45 A;  2ISD A;  1N65 A;  2JQ6 A;  2OS8 B;  3LCP C;  1JFK A;  1A03 A;  1BF5 A;  1KWO C;  1QLK A;  2I7A A;  4YI8 A;  4QJ3 B;  1J1D A;  2FJY A;  1K9P A;  1EH2 A;  1SR6 B;  4HRH A;  1CKK A;  1RTP 1;  5F6T A;  1PSR A;  2NZ0 A;  2F8P A;  1PUL A;  1YUR A;  2EGD A;  2JXL A;  4GPL B;  4DCK A;  1B4C A;  3D75 A;  4CFR A;  3AAJ A;  3LK0 A;  2BL0 B;  4GBA A;  1S6J A;  2K8M B;  4AQI A;  3FWC A;  2QPT A;  2QEO A;  4XYN A;  1JBA A;  1FF1 A;  1F71 A;  1OOG A;  2MAZ A;  3EKJ A;  2PQL A;  2CCM A;  4NDB A;  3D78 A;  3JVT B;  4PE0 A;  1WDC C;  2PAS A;  4PE1 A;  1EJ3 A;  1OOH A;  2KAV A;  3RM1 A;  4MSP A;  1BOD A;  3EG5 B;  3GK1 A;  5AAN A;  3S0G A;  2L0P A;  2Y5I A;  3TUY B;  3CLN A;  3CZ2 A;  2CBL A;  2JRF A;  3BJH A;  3I5F C;  4YRU A;  1C7W A;  3BXK A;  2H61 C;  3MSE B;  1OQP A;  1DMO A;  2FOT A;  4I5L B;  2LCP A;  1IJ6 A;  1B8L A;  3TDU A;  1NUB A;  1NX3 A;  5AER A;  2L5Y A;  2LV7 A;  4WRI A;  2CTN A;  5DKR A;  3SS5 A;  2YGU A;  5HL1 A;  3NSK A;  3TS5 B;  1MHO A;  1K93 D;  1M63 B;  1DC1 A;  1NX1 A;  3CR2 A;  1QAT A;  4N1F A;  1KK8 C;  1UWO A;  3D0Y B;  4PE7 A;  3EKH A;  4WQ2 A;  1EG4 A;  1UHI A;  3K1E A;  1TCO B;  3FIA A;  4N5X A;  4YGA A;  1S5G Z;  1JWD A;  2KSP A;  5KTY A;  1R6P A;  4R1E A;  3FE9 A;  3VRR A;  1K9K A;  4D1E A;  1KQV A;  2LE9 B;  1TOP A;  3I5I B;  4TNC A;  1QJT A;  1DGV A;  1ALW A;  1UHH A;  4YGC B;  4JQ0 D;  1QIV A;  2LAN A;  1A4P A;  1JUO A;  1EXR A;  2MJW B;  5FI6 A;  2F2P A;  3UO9 A;  4M2P A;  4NQG A;  2LVV A;  2WCL A;  1SYM A;  5I8N A;  1GM0 A;  2BCX A;  3CS1 A;  5CSI A;  3GOF A;  2EC6 B;  1BT6 A;  2QEB A;  2WCF A;  2Q91 A;  2KFG A;  1LXF C;  3EK4 A;  3NSI A;  1NP8 A;  3PN7 C;  4GAO A;  3SG6 A;  2AUC A;  1QVI Y;  1UUR A;  1IGV A;  3A8R A;  1QV0 A;  1T14 A;  2K7D A;  4BY4 A;  4CID A;  2JT3 A;  3JTD B;  2LP3 A;  1ZMZ A;  1XFU O;  3K21 A;  4PHM A;  4Q04 A;  2BNX A;  1K94 A;  1CDL A;  3CTN A;  3SG2 A;  5HKY A;  3CGA A;  2BBN A;  4PT1 A;  1DEL A;  1XVJ A;  1PK0 D;  3WHT B;  2PVB A;  1B7T Z;  1YUS A;  1YVL A;  1N0Y A;  3OX6 A;  2WCM A;  5D3O A;  5DKN A;  1J1E A;  1ZOT B;  5ER4 X;  2BCB A;  1RFJ A;  2OPO A;  3HCM A;  2BL0 C;  1VRK A;  1SY9 A;  2LMV A;  1RJV A;  1C07 A;  3VB1 A;  3OP0 A;  2NCO A;  2BKI B;  1G8I A;  4XJK A;  3KO0 A;  2KI4 C;  2L98 A;  3NSO A;  1BU3 A;  3AKA A;  3VRN A;  3FE8 A;  1WY9 A;  2KGR A;  3F45 A;  2M7N A;  1LA3 A;  1F70 A;  1DF0 B;  1L7Z A;  2JNX A;  2LUX A;  2M3W A;  3IVT A;  3B87 A;  3R1P A;  1C3Y A;  1B8C A;  2AAO A;  3CYZ A;  1NX2 A;  1DJG A;  3TUY C;  1SCV A;  4WQ3 A;  1QLS A;  3D0Y A;  5G08 A;  2FCD A;  1CM4 A;  1S3P A;  1C3Z A;  1SSE B;  2M0R A;  1DJW A;  1IQ5 A;  2HF5 A;  1H4B A;  3DF0 B;  1Q80 A;  1W7I B;  1S36 A;  3D77 A;  3EVU A;  2LNK A;  1G33 A;  1TCF A;  2WCE A;  3EVR A;  1LVC D;  5HKZ A;  3I5H B;  2NLN A;  1U5I B;  1NSH A;  1Y0V H;  2OTG C;  1CFF A;  4CFQ A;  1KQM C;  1KCY A;  3FE6 A;  3L47 A;  1UP5 A;  3OGN A;  4KYN A;  1RK9 A;  2RGI A;  2JU0 A;  3CR4 X;  5KU1 A;  2KGB C;  3O2P A;  3DVM A;  1CDM A;  2KPH A;  1UHN A;  1SCM B;  2KLE A;  2R2I A;  1XFZ O;  3VRO A;  3LLE A;  4ORC B;  2MBX A;  1W9Z A;  3GK2 A;  5EL2 A;  5GQQ C;  1F4O A;  1KFU L;  3D74 A;  1QTX A;  2JWW A;  2K2A A;  1HQV A;  1OOF A;  2QDI A;  3CZT X;  5K89 A;  2KYC A;  1SK6 D;  4PCW A;  1B7T Y;  1DJY A;  3BFH A;  1QVI Z;  5CSN A;  2QEV A;  2HPS A;  4L9M A;  1WLZ A;  2LHL A;  5D7F A;  3QRX A;  5AFP A;  3V2L A;  4OVN F;  1TNP A;  2BE4 A;  3BOW B;  2EC6 C;  2M9G A;  3SG3 A;  1CFD A;  1GGZ A;  3DVK A;  1SW8 A;  4F7F A;  2GGZ A;  1YTZ C;  2KBI A;  1MR8 A;  2SCP A;  3DVJ A;  4ZCU A;  1D1O A;  1J7Q A;  2KFH A;  3OB1 B;  1JF2 A;  1PVB A;  1XFW O;  1TNQ A;  4INW A;  5CPV A;  1ORG A;  1L2O C;  1YVH A;  4I5N B;  3BUX B;  1S26 D;  4OV2 A;  5DIC A;  3OB2 B;  2K61 A;  1QX5 B;  1F54 A;  4OZD A;  3BUW B;  1SKT A;  1NWD A;  1YR5 A;  4IL1 A; 
#chains in the Genus database with same CATH homology
 2JOJ A;  1UHJ A;  5DKQ A;  4C0K A;  1IKU A;  3LL8 B;  1QIW A;  5FYX A;  1V1G A;  2JXC A;  1IRJ A;  3I5G B;  3O4Y A;  1N2D A;  1U5I A;  2LLU A;  2I2R E;  4F0Z B;  2JTT A;  1BG1 A;  1BLQ A;  1K9U A;  2JT8 A;  1OMD A;  2O60 A;  2ZRT A;  4ORA B;  2LUC A;  4DS7 A;  4GGF A;  1CFP A;  1OZS A;  1OOJ A;  1NCZ A;  1QXP A;  1YX8 A;  1AHR A;  2HET A;  1KFU S;  1TIZ A;  1BR1 B;  1NYA A;  1SBJ A;  1A29 A;  3O78 A;  3LK1 A;  1FBV A;  3M0W A;  4DUQ A;  2A4J A;  1CLB A;  2KI6 C;  2KAY A;  2KAX A;  1GQM A;  1SL9 A;  3AKB A;  1KWO B;  2VRG A;  5B8I B;  1XFX O;  2WOR A;  1S1E A;  4MZJ A;  1B47 A;  2KQ6 A;  4NDD A;  1IJ5 A;  2LM5 A;  5IBW A;  2E6W A;  4GGF C;  1Y1X A;  1IG5 A;  3NSL A;  2OS8 C;  1A2X A;  3PFV A;  1JC2 A;  2AMI A;  1QV1 A;  2KYF A;  3IQQ A;  1R2U A;  4ZCV A;  3OHM B;  2LLT A;  2IS9 A;  2HQ8 A;  1WRL A;  1AVS A;  1SR6 C;  1E8A A;  1DTL A;  2D8N A;  1F8H A;  3CWG A;  1HT9 A;  2LVK A;  2O5G A;  4YGE B;  2BBM A;  1F55 A;  4MVF A;  2MA2 A;  2TN4 A;  1KK7 Z;  2WND A;  1WDC B;  1G4Y R;  1CTR A;  2JNF A;  1SMG A;  2GGM A;  2B1U A;  2K2F A;  2MLF C;  1CMG A;  1CLM A;  4PDZ A;  1CMF A;  3BUO B;  4ICB A;  4UPG A;  2GV5 A;  3JVT C;  1DJZ A;  4GNK B;  4NDC A;  3I5F B;  1NX0 A;  4CPV A;  2K7O A;  1CFC A;  4A4C A;  2KOT A;  1MQ1 A;  2L5X B;  1AJ4 A;  1MXE A;  1OZO A;  3SG7 A;  3VRQ A;  1CB1 A;  1J7O A;  3FS7 A;  2PRU A;  2M97 A;  2MRD A;  1W7J B;  1MF8 B;  1ALV A;  2F33 A;  1WRK A;  2F3Z A;  2I18 A;  1AJ5 A;  2F3Y A;  5KSZ A;  2PMY A;  3VRP A;  1KK8 B;  4HRE E;  1YUT A;  2WOS A;  3TDI A;  4MN0 A;  4A4B A;  3TS5 C;  2JPT A;  1NCY A;  4AQJ A;  1FI5 A;  4MRX A;  4MZL A;  5HLV A;  4MZK A;  1BJF A;  3E3R A;  3VGO A;  2JUL A;  4PHK A;  1FI6 A;  2JTZ A;  1DGU A;  3I5G C;  1J7R A;  1PVA A;  1QS7 A;  1FW4 A;  4QJ5 B;  2F2O A;  1KSM A;  1BOC A;  3EK8 A;  5I2Q A;  4GFT A;  1CDP A;  3I5I C;  2E30 A;  3D10 A;  1LKJ A;  1S6C A;  1K8U A;  1C7V A;  3KPX A;  2LMU A;  4DRW A;  3OX5 A;  1OE9 B;  2CXJ A;  2CNP A;  1LIN A;  1TNX A;  1YX7 A;  3PN7 B;  3SIA A;  1DJH A;  3PAT A;  4YI9 A;  2KBM A;  3A4U B;  1KK7 Y;  2EHB A;  4PE4 A;  1DJX A;  1SNL A;  5HKW A;  4PAL A;  1YRT B;  1A75 B;  1B1G A;  3GK4 X;  4USL A;  4MRY A;  1KSO A;  3SG5 A;  2BE6 A;  2MLE C;  2NCP A;  1JSA A;  1SL8 A;  1XFV O;  5BPJ A;  4M2O A;  1EL4 A;  2JT0 A;  3JTD C;  4E68 A;  1SL7 A;  2H61 A;  5JJG A;  2LC5 A;  1PAL A;  3SIB A;  1IH0 A;  1XO5 A;  1K2H A;  1DF0 A;  2FJU B;  4OCI A;  1YRU B;  2COL B;  2M29 A;  1RWY A;  4JWQ A;  1JFJ A;  4YGB B;  1AK8 A;  2KI4 B;  3BYA A;  4FQO A;  4C0L A;  1Y1U A;  1TRF A;  4PHN A;  3PM8 A;  1KFX L;  1WLM A;  1RRO A;  3DF0 A;  1CM1 A;  3ZNI A;  3TZ1 A;  2KNE A;  4M2Q A;  1JF0 A;  1MWN A;  5TNC A;  1CNP A;  3DVE A;  1M31 A;  1REC A;  1SRA A;  3EK7 A;  3EVV A;  5I2O A;  2ZN8 A;  2V53 A;  1QAS A;  2M1K B;  1Y1A A;  3KEV A;  4XJK B;  1DT7 B;  1OSA A;  2M7L A;  1GGW A;  2G2B A;  1WRZ A;  4N1G A;  2FCE A;  2KDH A;  2H2K A;  1SKT A;  2OTG B;  2ZFD A;  3ZWH A;  3PSR A;  3WXA A;  2Y4Q A;  4HRG A;  1KQM B;  1J55 A;  3H4S E;  2PSR A;  4OKH A;  3KF9 A;  1BR4 B;  4U8D A;  1IQ3 A;  3I5H C;  4FTG A;  2KHN A;  4DIR A;  2I94 A;  3BUM B;  3BQ3 A;  1OMV A;  2MHH A;  4MLW A;  1ZUZ A;  1NCX A;  3O6B A;  2NXQ A;  2ZN9 A;  3PAL A;  3AAK A;  2DOQ A;  3IF7 A;  2LMT A;  3ICB A;  5AXI A;  4CLN A;  1V1F A;  1TTX A;  5JOL A;  4I5K A;  1XFY O;  4I5J A;  2KQY A;  2JZI A;  3BOW A;  5CSF A;  1FPW A;  1SCM C;  4GGN A;  1A75 A;  1SPY A;  1LA0 A;  2Y1M A;  2LAP A;  2M8U A;  2QAC A;  2ZNE A;  3C1V A;  4ETO A;  4ORB B;  1AUI B;  4BY5 A;  1B8R A;  1CLL A;  2K0J A;  2KFF A;  3SJS A;  2L4I A;  2LLS A;  2WC8 A;  3IQO A;  1XK4 A;  1M39 A;  2BEC A;  1XYD A;  5J3X A;  1PRW A;  1EG3 A;  1KFX S;  3WNX B;  5CSJ A;  1YUU A;  2M1U A;  2LVI A;  2K7B A;  2Y1N A;  4AOM A;  5PAL A;  1CDN A;  5AEQ A;  2Q4U A;  2SAS A;  1K90 D;  2K7C A;  2KI6 D;  4GUK A;  2CT9 A;  1L2O B;  1MUX A;  2HQW A;  1X02 A;  4JPZ B;  4YGD B;  3WHU B;  1NPQ A;  1NIW A;  2L4H A;  1TNW A;  1XK4 C;  1BMO A;  3PLF B;  4C0J A;  1DJI A;  1TN4 A;  1K96 A;  1DVI A;  3SG4 A;  1QX7 A;  1S6I A;  3NXA A;  3BUN B;  2L51 A;  1MXL C;  1UHK A;  4MEW A;  2ZKM X;  2G9B A;  1M46 A;  1ZFS A;  4P2Y B;  1ODB A;  1F4Q A;  3TDZ A;  1ZAC A;  1K95 A;  2PAL A;  2BKH B;  2P6B B;  2ZND A;  1S5G Y;  4QJ4 B;  2ZRS A;  1AP4 A;  4OR9 B;  5HLO A;  4MBE A;  5I2L A;  5D69 A;  2L50 A;  1Y6W A;  5ER5 A;  2L2E A;  1IWQ A;  2LHI A;  2WCB A;  1QX2 A;  3HX4 A;  4HSZ A;  2M49 B;  2LVJ A;  1GJY A;  1H8B A;  1B9A A;  4YBH B;  2LP2 A;  1OMR A;  1PSB A;  3DD4 A;  1UUS A;  3FWB A;  3KHE A;  1XA5 A;  3CR5 X;  4P5O E;  5HYD A;  2JC2 A;  1J7P A;  4PHJ A;  1M45 A;  2ISD A;  1N65 A;  2JQ6 A;  2OS8 B;  3LCP C;  1JFK A;  1A03 A;  1BF5 A;  1KWO C;  1QLK A;  2I7A A;  4YI8 A;  4QJ3 B;  1J1D A;  1K9P A;  1EH2 A;  1SR6 B;  4HRH A;  1CKK A;  1RTP 1;  5F6T A;  1PSR A;  2NZ0 A;  2F8P A;  1PUL A;  1YUR A;  2EGD A;  2JXL A;  4GPL B;  4DCK A;  1B4C A;  4CFR A;  3AAJ A;  3LK0 A;  2BL0 B;  4GBA A;  1S6J A;  2K8M B;  4AQI A;  3FWC A;  2QPT A;  4XYN A;  1JBA A;  1FF1 A;  1F71 A;  2MAZ A;  3EKJ A;  2CCM A;  4NDB A;  3JVT B;  4PE0 A;  1WDC C;  2PAS A;  4PE1 A;  1EJ3 A;  2KAV A;  3RM1 A;  4MSP A;  1BOD A;  3GK1 A;  5AAN A;  2L0P A;  2Y5I A;  3TUY B;  3CLN A;  2CBL A;  2JRF A;  3I5F C;  4YRU A;  1C7W A;  3BXK A;  2H61 C;  3MSE B;  1OQP A;  1DMO A;  2FOT A;  4I5L B;  2LCP A;  1IJ6 A;  1B8L A;  3TDU A;  1NUB A;  1NX3 A;  5AER A;  2LV7 A;  4WRI A;  2CTN A;  5DKR A;  3NSK A;  3TS5 B;  1MHO A;  1K93 D;  1M63 B;  1NX1 A;  3CR2 A;  1QAT A;  4N1F A;  1KK8 C;  1UWO A;  3D0Y B;  4PE7 A;  3EKH A;  4WQ2 A;  1EG4 A;  1UHI A;  4N5X A;  1TCO B;  3FIA A;  4YGA A;  1JWD A;  1S5G Z;  2KSP A;  5KTY A;  1R6P A;  4R1E A;  3VRR A;  1K9K A;  4D1E A;  1KQV A;  2LE9 B;  1TOP A;  3I5I B;  4TNC A;  1QJT A;  1DGV A;  1ALW A;  1UHH A;  4YGC B;  4JQ0 D;  1QIV A;  2LAN A;  1A4P A;  1JUO A;  1EXR A;  2MJW B;  2F2P A;  4M2P A;  4NQG A;  2LVV A;  1SYM A;  5I8N A;  2BCX A;  3CS1 A;  5CSI A;  3GOF A;  2EC6 B;  1BT6 A;  2WCF A;  2Q91 A;  2KFG A;  1LXF C;  3EK4 A;  3NSI A;  1NP8 A;  3PN7 C;  4GAO A;  3SG6 A;  2AUC A;  1QVI Y;  1UUR A;  1IGV A;  3A8R A;  1QV0 A;  2K7D A;  4BY4 A;  4CID A;  2JT3 A;  3JTD B;  2LP3 A;  1ZMZ A;  1XFU O;  3K21 A;  4PHM A;  4Q04 A;  3CTN A;  1K94 A;  1CDL A;  3SG2 A;  5HKY A;  3CGA A;  2BBN A;  1XVJ A;  1PK0 D;  3WHT B;  2PVB A;  1B7T Z;  1YUS A;  1YVL A;  1N0Y A;  3OX6 A;  5DKN A;  3RLZ A;  1J1E A;  1ZOT B;  5ER4 X;  2BCB A;  1RFJ A;  2OPO A;  3HCM A;  2BL0 C;  1VRK A;  1SY9 A;  2LMV A;  1RJV A;  1C07 A;  3OP0 A;  2NCO A;  2BKI B;  1G8I A;  4XJK A;  3KO0 A;  2KI4 C;  2L98 A;  3NSO A;  1BU3 A;  3AKA A;  3VRN A;  1WY9 A;  2KGR A;  3F45 A;  2M7N A;  1LA3 A;  1F70 A;  1DF0 B;  1L7Z A;  2JNX A;  2LUX A;  2M3W A;  1B8C A;  2AAO A;  1NX2 A;  1DJG A;  3TUY C;  1SCV A;  4WQ3 A;  1QLS A;  3D0Y A;  5G08 A;  2FCD A;  1CM4 A;  1S3P A;  2M0R A;  1DJW A;  1IQ5 A;  2HF5 A;  1H4B A;  3DF0 B;  1Q80 A;  1W7I B;  1S36 A;  3EVU A;  2LNK A;  1G33 A;  1TCF A;  2WCE A;  3EVR A;  1LVC D;  5HKZ A;  3I5H B;  2NLN A;  1U5I B;  1NSH A;  1Y0V H;  2OTG C;  1CFF A;  4CFQ A;  1KQM C;  1KCY A;  1UP5 A;  1RK9 A;  2RGI A;  2JU0 A;  3CR4 X;  5KU1 A;  2KGB C;  3O2P A;  3DVM A;  1CDM A;  1UHN A;  1SCM B;  2R2I A;  1XFZ O;  3VRO A;  3LLE A;  4ORC B;  2MBX A;  3GK2 A;  5GQQ C;  1F4O A;  1KFU L;  1QTX A;  2JWW A;  2K2A A;  1HQV A;  3CZT X;  5K89 A;  2KYC A;  1SK6 D;  4PCW A;  1B7T Y;  1DJY A;  1QVI Z;  5CSN A;  2HPS A;  4L9M A;  1WLZ A;  2LHL A;  5D7F A;  3QRX A;  5AFP A;  4OVN F;  1TNP A;  2BE4 A;  3BOW B;  2EC6 C;  2M9G A;  3SG3 A;  1CFD A;  1GGZ A;  3DVK A;  1SW8 A;  2GGZ A;  1YTZ C;  2KBI A;  1MR8 A;  2SCP A;  3DVJ A;  4ZCU A;  1D1O A;  1J7Q A;  2KFH A;  3OB1 B;  1JF2 A;  1PVB A;  1XFW O;  1TNQ A;  5CPV A;  1L2O C;  1YVH A;  4I5N B;  3BUX B;  1S26 D;  4OV2 A;  3OB2 B;  2K61 A;  1QX5 B;  1F54 A;  3BUW B;  2BCA A;  1NWD A;  1YR5 A;  4IL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...