4ICBA

Proline cis-trans isomers in calbindin d9k observed by x-ray crystallography
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
MKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Proline cis-trans isomers in calbindin D9k observed by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1991-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4icbA00
1G33A 3CZTX 1Q80A 2FCEA 5JOLA 1J7QA 1QLSA 3PFVA 1F55A 3M0WA 3DVEA 3I5HC 1K9KA 1BF5A 1H8BA 1DF0B 1SBJA 5CPVA 3SG2A 3E3RA 3NXAA 2JC2A 4AOMA 1JF0A 1V1FA 1XFXO 1OE9B 3I5IB 1QIWA 1OMVA 1QX7A 1SL7A 1AP4A 5DKRA 1SW8A 1UHKA 1S5GZ 4I5NB 1WLZA 4XYNA 1NCXA 1ALVA 3HX4A 1IGVA 2BBMA 2M9GA 1YRUB 3FS7A 4R1EA 1L2OB 3FWCA 1B8RA 5DKNA 1TCFA 2F33A 1TNQA 5AERA 1JUOA 1SNLA 4ORAB 1F4OA 1TOPA 3CS1A 5CSJA 4PHNA 1F70A 1HT9A 1S5GY 2JT3A 4WRIA 1M63B 2ZRTA 3IQOA 4FTGA 1TNPA 2I94A 3VRQA 1TNWA 4Q04A 1EH2A 2BBNA 3JVTB 1WDCC 1QV0A 2BE4A 1CLBA 2JXCA 2WCFA 3ZWHA 3GOFA 1KQMB 1CM4A 2BL0C 1L7ZA 2AAOA 2L4HA 2K7DA 2WORA 1CMGA 3CGAA 1J1DA 1XFWO 3PM8A 1QASA 4GPLB 4GAOA 3I5IC 1U5IB 1OZSA 1DJIA 2KAXA 1EJ3A 1A03A 1NIWA 2PALA 4JWQA 2HQWA 2LV7A 1SPYA 1TNXA 4NQGA 1B4CA 1AHRA 1QX5B 2ZRSA 3I5FC 2TN4A 2ZN8A 5HKYA 2K7CA 3DVKA 1GGWA 1DJWA 1ZACA 1YUSA 2NCPA 2IS9A 5KTYA 2CT9A 1XO5A 2Y5IA 2FJUB 3NSKA 1PSRA 3H4SE 2K61A 1U5IA 4MLWA 4PDZA 1NPQA 4GGNA 3VGOA 1PULA 1S36A 1MF8B 1SCMB 2NZ0A 4M2QA 1MQ1A 2BKIB 2LMTA 2D8NA 1IQ5A 2LP3A 2PSRA 1MR8A 3WHTB 3I5HB 2KAVA 2HF5A 1K8UA 2BE6A 2LANA 1J55A 1MXLC 3DF0A 1M31A 1UHJA 2M29A 2ZNEA 2F8PA 1CM1A 1KSMA 1OSAA 1QS7A 4N1FA 1YX7A 3SG5A 3LL8B 4P5OE 3IF7A 1NWDA 3EK7A 1K95A 1N65A 4WQ3A 5J3XA 3F45A 3BUXB 2JT0A 1D1OA 4PALA 2WC8A 3PALA 3WNXB 1IJ6A 1M46A 2LLUA 1NCZA 2JRFA 2F2PA 2LUCA 3EKJA 3PATA 3PN7C 5TNCA 2LNKA 3RM1A 4JPZB 2LVJA 2LVVA 2LAPA 3ZNIA 3GK2A 1LVCD 1E8AA 1KWOC 3DVMA 1H4BA 1DGVA 3SIBA 1CDPA 4PHMA 2F3ZA 1IRJA 5CSIA 4D1EA 3SG3A 4ETOA 1ZUZA 2PVBA 3AAKA 1NP8A 1UWOA 1NUBA 2ZNDA 4YBHB 1SRAA 1YUUA 2LMUA 3NSLA 2GGZA 4CFRA 5KU1A 4MEWA 3BYAA 3EVUA 2EHBA 4YI9A 1AJ4A 1K96A 2K7BA 2LLSA 4C0LA 4PE7A 1BMOA 5K89A 5CSNA 1GJYA 2KFGA 3K21A 1SL9A 2LHIA 2R2IA 5ER5A 1MHOA 2KI6C 3SG7A 1FF1A 2KQYA 5ER4X 2BL0B 3KF9A 4WQ2A 1JC2A 4QJ5B 3O4YA 4BY5A 2ISDA 1CB1A 2Q91A 1XK4C 5DKQA 1K9UA 2M8UA 2WNDA 3PLFB 2MLFC 1R6PA 3BUMB 4E68A 4MZLA 1JFKA 3CLNA 2P6BB 5G08A 1A4PA 1UUSA 4C0JA 3VRRA 2JU0A 2BECA 4F0ZB 4HSZA 3I5FB 4CLNA 2ZFDA 4YGCB 3AAJA 4GGFC 2K0JA 2JOJA 1RFJA 1CFFA 4NDBA 1SR6C 1YUTA 4YRUA 2OTGC 1KFXL 2GV5A 1PVAA 3MSEB 1YX8A 4MRYA 4AQJA 5AXIA 1PK0D 3SJSA 5IBWA 3SG4A 1DJHA 2KSPA 4U8DA 2B1UA 1VRKA 2LP2A 2ZN9A 4JQ0D 1YVHA 1X02A 1FW4A 1YURA 1ZOTB 1UHHA 4OVNF 4YGEB 1S3PA 2KQ6A 1UURA 4TNCA 1CDNA 3I5GC 3EK8A 2Q4UA 2LVKA 4XJKB 4GNKB 3WHUB 1EL4A 1FBVA 4ORBB 3DD4A 1WLMA 1DJZA 2PMYA 4CFQA 1M45A 4UPGA 1ALWA 2JTZA 2G2BA 2FCDA 2MJWB 4OKHA 4BY4A 2M1KB 3PN7B 3OP0A 5I8NA 1IH0A 1LXFC 2M97A 1SL8A 1KWOB 2NXQA 1F54A 2NLNA 1NYAA 1B47A 4IL1A 3RLZA 1YVLA 4DUQA 2MHHA 3EVRA 4XJKA 1KK8C 1XFVO 4ZCUA 2LE9B 2NCOA 1CLLA 1J7RA 1QV1A 2LM5A 2KBMA 1ZFSA 1QTXA 1OZOA 3DF0B 2WCBA 3BXKA 1AJ5A 1XA5A 1PALA 5I2OA 1CFPA 1XFZO 1QIVA 2CBLA 1C7VA 3OB1B 1S1EA 1WRZA 1TTXA 4N1GA 4OCIA 5D69A 1F71A 1GGZA 4PHJA 2Y4QA 1J1EA 3NSIA 1DMOA 1QX2A 2L4IA 2H2KA 2M0RA 1CFDA 1WY9A 2HPSA 5CSFA 4PCWA 1FI6A 2OS8C 2E6WA 1OMDA 2L50A 4MSPA 4HREE 3O78A 1NX0A 1NX3A 1QLKA 2KBIA 1ZMZA 2QACA 1WRLA 1LINA 4ICBA 1Y1XA 3VRNA 3BQ3A 1NX1A 1JBAA 2KGBC 1OQPA 1CLMA 2CNPA 2KHNA 4MZJA 1YRTB 4ZCVA 5AEQA 2QPTA 3TS5C 1KQVA 2F2OA 1PVBA 2CXJA 1KK7Z 2HETA 2LCPA 2KNEA 2F3YA 1DVIA 2LHLA 1Y1UA 1XK4A 3NSOA 1BG1A 1SR6B 2G9BA 4N5XA 1S26D 3D0YB 2OTGB 3WXAA 2M1UA 2JPTA 2EGDA 2WOSA 2KOTA 3GK4X 2K7OA 3FWBA 1BR1B 1NSHA 1SCVA 2Y1MA 1BJFA 4PE4A 4DRWA 2JTTA 3CR5X 1R2UA 2K8MB 2A4JA 1YR5A 2KAYA 2SASA 3OX5A 1EXRA 1K94A 1KK7Y 1AK8A 1UHIA 3EK4A 2LVIA 4GBAA 1CNPA 1RK9A 3TDUA 2RGIA 4GGFA 3TUYB 2BCAA 5AFPA 1IG5A 2COLB 1HQVA 5HKZA 1DJYA 3D0YA 1K93D 4OR9B 1M39A 2Y1NA 1LA3A 4I5LB 1JSAA 2L51A 1RECA 3I5GB 2I18A 2LLTA 3KHEA 3TDZA 1CKKA 1B9AA 2ZKMX 2MAZA 5HYDA 2JNXA 3BUWB 4NDCA 2H61A 4YGDB 2KYFA 1N0YA 5GQQC 1XYDA 1TN4A 3KO0A 1DGUA 2JZIA 4AQIA 2E30A 2JULA 3DVJA 2MRDA 3JTDC 4A4CA 4YGBB 1TCOB 3CR4X 3CTNA 4QJ4B 1OMRA 1KK8B 3EKHA 4DS7A 3ICBA 2LMVA 3AKBA 1K9PA 2L5XB 1EG4A 4USLA 2JQ6A 4I5JA 4CIDA 1K2HA 4GUKA 1KCYA 1YTZC 2M49B 1BODA 1LA0A 5D7FA 1Y6WA 3LLEA 1DJXA 3O2PA 2H61C 1JF2A 1SYMA 1CMFA 3TUYC 2KFHA 1PSBA 3OHMB 2BCXA 1KSOA 2KI4C 1DF0A 4YGAA 2OS8B 3OX6A 1NCYA 1RROA 5HLVA 4DIRA 2I7AA 1B8LA 3A8RA 2M3WA 2MLEC 1DJGA 1IWQA 4DCKA 1UP5A 3FIAA 1G4YR 1G8IA 1XFUO 4HRHA 4M2OA 1SK6D 4NDDA 3TDIA 3TS5B 3C1VA 1N2DA 1SMGA 1BU3A 1QVIZ 1AUIB 1KFUS 3LK1A 5KSZA 1CDMA 1FPWA 1UHNA 3KPXA 4CPVA 5HKWA 3CR2A 1QXPA 1XVJA 1BR4B 3BUNB 1A75B 3BOWB 3QRXA 2L2EA 1JFJA 5HLOA 1QVIY 2O60A 4I5KA 5JJGA 1Y0VH 1PRWA 2KGRA 3KEVA 1RWYA 3SIAA 3VROA 4A4BA 1Y1AA 2KFFA 1OOJA 1A29A 1S6JA 2KI6D 1C07A 1DTLA 5I2QA 2K2AA 4MVFA 1A75A 4PHKA 2O5GA 3BOWA 1L2OC 3OB2B 1MWNA 1CDLA 1KFXS 2JWWA 1IKUA 2CTNA 3BUOB 3EVVA 2CCMA 2AUCA 1BOCA 1MUXA 3A4UB 2BCBA 5B8IB 1W7JB 4PE0A 4L9MA 4MBEA 2JNFA 2GGMA 2I2RE 2EC6B 1B1GA 1TRFA 3JTDB 2SCPA 1SY9A 2KDHA 4PE1A 2OPOA 2LC5A 1XFYO 3CWGA 4C0KA 1V1GA 2L98A 3JVTC 4FQOA 4HRGA 1EG3A 3D10A 2VRGA 1NX2A 2MBXA 2KYCA 1BT6A 1F8HA 3LK0A 4P2YB 2K2FA 1K90D 1B7TZ 4YI8A 2M7LA 1KQMC 1S6IA 4MRXA 4MN0A 5BPJA 4MZKA 2LUXA 5PALA 4M2PA 1BLQA 1J7PA 1JWDA 2DOQA 1B8CA 2L0PA 1F4QA 3LCPC 1TIZA 1QATA 2FOTA 2BKHB 3O6BA 1WRKA 1A2XA 2KI4B 1J7OA 4OV2A 2V53A 2HQ8A 5AANA 3VRPA 5FYXA 2M7NA 1FI5A 1B7TY 1W7IB 5I2LA 3IQQA 3HCMA 1S6CA 1GQMA 1SKTA 3SG6A 2JT8A 1RJVA 1MXEA 2WCEA 2MA2A 1CFCA 1LKJA 1QJTA 1IJ5A 2AMIA 4QJ3B 1ODBA 1C7WA 3GK1A 2PASA 3TZ1A 2JXLA 2PRUA 4GFTA 3AKAA 1DT7B 1WDCB 1IQ3A 5F6TA 4ORCB 1AVSA 2EC6C 1CTRA 3PSRA 1SCMC 1KFUL 1RTP1
chains in the Genus database with same CATH superfamily
1G33A 3CZTX 1Q80A 2FCEA 5JOLA 1J7QA 1QLSA 3PFVA 1F55A 3M0WA 3DVEA 3I5HC 1K9KA 1BF5A 1H8BA 1DF0B 1SBJA 5CPVA 3SG2A 3E3RA 3NXAA 2JC2A 4AOMA 1JF0A 1V1FA 1XFXO 1OE9B 3I5IB 3OGNA 1QIWA 3V2LA 1OMVA 3S0BA 1QX7A 1SL7A 1GM0A 1AP4A 5DKRA 1SW8A 1UHKA 1S5GZ 2QEBA 2QEVA 4I5NB 1WLZA 4XYNA 1NCXA 1ALVA 3HX4A 1IGVA 2BBMA 2M9GA 1YRUB 3FS7A 4R1EA 1L2OB 3FWCA 3CABA 1B8RA 3S0EA 5DKNA 1TCFA 2F33A 1TNQA 1TUJA 5AERA 1JUOA 1SNLA 4ORAB 1F4OA 2GTEA 1TOPA 3CS1A 5CSJA 4PHNA 1F70A 1HT9A 1S5GY 2JT3A 2WCHA 1M63B 2ZRTA 4WRIA 5FI2A 3IQOA 3UO9A 3NGVA 4FTGA 3D77A 1TNPA 2I94A 3VRQA 1TNWA 4Q04A 1EH2A 2BBNA 3JVTB 1WDCC 1QV0A 2PQLA 2BE4A 1CLBA 2JXCA 2WCFA 3ZWHA 2WC6A 3GOFA 1KQMB 1CM4A 2BL0C 1L7ZA 2AAOA 2L4HA 2K7DA 2WORA 1CMGA 3CGAA 1J1DA 1XFWO 3PM8A 1QASA 1XFRA 4GPLB 4GAOA 3I5IC 1U5IB 1OZSA 1DJIA 2KAXA 1EJ3A 3IVTA 1A03A 1NIWA 2PALA 4JWQA 2HQWA 2LV7A 1SPYA 1TNXA 3K1EA 4NQGA 1B4CA 1AHRA 1QX5B 2ZRSA 3I5FC 2TN4A 2ZN8A 5HKYA 2K7CA 3DVKA 1GGWA 1DJWA 1ZACA 1YUSA 2NCPA 2IS9A 5KTYA 2CT9A 1XO5A 2Y5IA 2FJUB 3CYZA 1P28A 3NSKA 1PSRA 3H4SE 2K61A 1U5IA 4MLWA 4PDZA 1NPQA 4GGNA 3VGOA 1PULA 1S36A 1MF8B 1SCMB 2NZ0A 4M2QA 1MQ1A 2BKIB 2LMTA 4INXA 2D8NA 1IQ5A 2LP3A 2PSRA 1MR8A 2L2CA 3WHTB 3I5HB 2KAVA 1DEKA 1K8UA 2BE6A 1Z4HA 1J55A 2HF5A 2LANA 1MXLC 3DF0A 1M31A 1UHJA 2M29A 2ZNEA 2F8PA 1CM1A 1KSMA 1OSAA 1QS7A 4N1FA 3S0AA 1YX7A 1OOIX 3R1PA 3SG5A 3LL8B 4P5OE 3IF7A 1NWDA 2P71A 1K95A 1N65A 3EK7A 4WQ3A 5J3XA 3F45A 3BUXB 2JT0A 1D1OA 4PALA 2WC8A 3PALA 3O4XA 3N7HA 3WNXB 1IJ6A 1M46A 2LLUA 1NCZA 2JRFA 2F2PA 2LUCA 3EKJA 3PATA 3PN7C 5TNCA 3DZTA 2LNKA 3RM1A 4JPZB 2LVJA 2LVVA 2LAPA 3ZNIA 3GK2A 1LVCD 1E8AA 1KWOC 3DVMA 1H4BA 1DGVA 3SIBA 1CDPA 1DELA 4PHMA 2F3ZA 1IRJA 5CSIA 4D1EA 3SG3A 4ETOA 1ZUZA 2PVBA 3AAKA 1NP8A 1UWOA 1NUBA 2ZNDA 4YBHB 1SRAA 1YUUA 4KYNA 2LMUA 3NSLA 2GGZA 4CFRA 5KU1A 4MEWA 3BYAA 3EVUA 1OOGA 2EHBA 3D78A 4YI9A 1AJ4A 1K96A 2JPOA 2K7BA 2LLSA 4C0LA 3DXLA 4PE7A 1ORGA 1BMOA 5K89A 5CSNA 3NHIA 1GJYA 2KFGA 3K21A 1SL9A 2LHIA 2R2IA 5ER5A 1MHOA 2KI6C 3FE9A 3D74A 3SG7A 2KQYA 5ER4X 1FF1A 2BL0B 3KF9A 4WQ2A 1JC2A 4QJ5B 3O4YA 4BY5A 2ISDA 1DC1A 1CB1A 2Q91A 1XK4C 5DKQA 1K9UA 2M8UA 2WNDA 3PLFB 2MLFC 1R6PA 3BUMB 3QMEA 4E68A 4MZLA 1JFKA 1OOFA 1QWVA 3CLNA 2P6BB 2QEOA 1A4PA 5G08A 3B86A 1UUSA 4C0JA 3VRRA 2JU0A 2BECA 4F0ZB 4HSZA 3I5FB 4CLNA 2ZFDA 1IIOA 4YGCB 3AAJA 4JD9A 3CZ0A 2K0JA 4GGFC 4PT1A 2JOJA 1RFJA 1CFFA 4NDBA 1SR6C 1TUZA 1YUTA 4YRUA 2OTGC 1KFXL 2GV5A 1PVAA 3MSEB 1T14A 1YX8A 4MRYA 4AQJA 5AXIA 3L4AA 1PK0D 5FI7A 3SJSA 5IBWA 3SG4A 1DJHA 2KSPA 4U8DA 2B1UA 1VRKA 2LP2A 2WC5A 2ZN9A 4JQ0D 1YVHA 1X02A 1FW4A 1YURA 1ZOTB 1UHHA 4OVNF 4YGEB 3SS3A 1S3PA 2KQ6A 1UURA 4TNCA 1CDNA 3I5GC 3EK8A 2Q4UA 2LVKA 4XJKB 4GNKB 3WHUB 1EL4A 1FBVA 4ORBB 3DD4A 1WLMA 1DJZA 2PMYA 4CFQA 1M45A 4OZDA 4UPGA 1ALWA 2JTZA 2G2BA 2FCDA 2MJWB 4OKHA 4BY4A 2M1KB 3PN7B 3OP0A 5I8NA 1IH0A 1LXFC 2M97A 1SL8A 1KWOB 2NXQA 1F54A 2NLNA 1NYAA 1B47A 4IL1A 3RLZA 1YVLA 4DUQA 2MHHA 3CZ1A 3EVRA 4XJKA 3NHTA 1KK8C 1XFVO 4ZCUA 2LE9B 2NCOA 1CLLA 2WCMA 1J7RA 1QV1A 2LM5A 2KBMA 1ZFSA 3PJIA 1QTXA 1OZOA 3DF0B 2WCBA 3BXKA 1AJ5A 1XA5A 1PALA 3EG5B 5I2OA 1CFPA 1XFZO 1QIVA 2CBLA 1C7VA 3OB1B 1S1EA 1WRZA 1TTXA 1LS8A 4N1GA 4OCIA 5D69A 1C3YA 1F71A 1GGZA 3DYEA 4PHJA 2Y4QA 1J1EA 3NSIA 1DMOA 1QX2A 2L4IA 2H2KA 2M0RA 2WCKA 3S0GA 1CFDA 1WY9A 2HPSA 5CSFA 4PCWA 1FI6A 2OS8C 2E6WA 1OMDA 2L50A 4MSPA 4HREE 3O78A 1NX0A 1NX3A 1QLKA 2KBIA 1ZMZA 2QACA 1WRLA 1LINA 4ICBA 1Y1XA 3VRNA 3R1VA 3BQ3A 1Z2CB 1NX1A 1JBAA 2KGBC 1OW4A 3B88A 1OQPA 1CLMA 2CNPA 2KHNA 4FQTA 1YRTB 4MZJA 4ZCVA 2QPTA 5AEQA 3TS5C 1KQVA 2F2OA 1PVBA 2CXJA 1KK7Z 2HETA 2LCPA 2KNEA 2F3YA 1DVIA 2LHLA 1Y1UA 1XK4A 3NSOA 5I94A 3BJHA 1SR6B 1BG1A 2G9BA 4N5XA 1S26D 3D0YB 2OTGB 2L5YA 3WXAA 3PM2A 2M1UA 2JPTA 2EGDA 2WOSA 2KOTA 3GK4X 2K7OA 3FWBA 2QDIA 1BR1B 1NSHA 1SCVA 2Y1MA 1BJFA 4PE4A 5EL2A 2JTTA 3CR5X 4DRWA 1R2UA 2K8MB 5D3OA 2A4JA 1YR5A 2KAYA 2SASA 3OX5A 1EXRA 1K94A 1KK7Y 1AK8A 1UHIA 2QEHA 2LVIA 3EK4A 4GBAA 1CNPA 1RK9A 3TDUA 2RGIA 4GGFA 4JKTA 2BCAA 3S0DA 3TUYB 5AFPA 1IG5A 2COLB 1HQVA 5HKZA 1DJYA 3D0YA 1K93D 4OR9B 1M39A 2Y1NA 1LA3A 4I5LB 1JSAA 2L51A 1RECA 3I5GB 2I18A 2LLTA 3KHEA 1DQEA 3TDZA 1CKKA 1B9AA 2ZKMX 2MAZA 5HYDA 3R72A 2JNXA 3BUWB 2WCLA 4NDCA 2H61A 4YGDB 2KYFA 3D73A 2PYQA 1N0YA 5GQQC 1XYDA 2BAPA 1TN4A 3KO0A 1DGUA 2JZIA 4AQIA 3B6XA 2E30A 2JULA 3DVJA 2MRDA 3JTDC 4A4CA 4YGBB 1TCOB 3CR4X 3CTNA 3CZ2A 4QJ4B 3B87A 1OMRA 1KK8B 3EKHA 4DS7A 3L47A 3ICBA 2LMVA 3AKBA 1K9PA 2K60A 2L5XB 1EG4A 4USLA 2JQ6A 3CDNA 4I5JA 4CIDA 1K2HA 4GUKA 1KCYA 5FI6A 1YTZC 2M49B 4IJ7A 1BODA 1LA0A 3Q8IA 5D7FA 1Y6WA 3D75A 3LLEA 1DJXA 3O2PA 2H61C 1JF2A 1SYMA 1CMFA 3TUYC 2KFHA 1PSBA 4INWA 3OHMB 2BCXA 1KSOA 2KI4C 1DF0A 1SSEB 4YGAA 2OS8B 3BFBA 3OX6A 1NCYA 1W9ZA 1RROA 1TWOA 3BFHA 2I7AA 5HLVA 4DIRA 4F7FA 1B8LA 3A8RA 2M3WA 2MLEC 1DJGA 1IWQA 4DCKA 1OOHA 1UP5A 3FIAA 1G4YR 1G8IA 1XFUO 4HRHA 4M2OA 1SK6D 4NDDA 3TDIA 3TS5B 3C1VA 1N2DA 1SMGA 1BU3A 1QVIZ 2BNXA 1AUIB 1KFUS 3LK1A 5DICA 1C3ZA 5KSZA 1CDMA 1FPWA 3SS4A 1UHNA 3KPXA 4CPVA 5HKWA 3CR2A 2FJYA 1QXPA 1XVJA 1BR4B 3BUNB 1A75B 3BOWB 3QRXA 2L2EA 3VB1A 5HLOA 5HL1A 1JFJA 1QVIY 3RZSA 2O60A 4I5KA 5JJGA 1Y0VH 1PRWA 2KGRA 3KEVA 1RWYA 2YGUA 3SIAA 3BFAA 3VROA 4A4BA 1Y1AA 2KFFA 1OOJA 1A29A 1S6JA 2KI6D 2H8VA 1C07A 1DTLA 5I2QA 2K2AA 4MVFA 1A75A 4PHKA 2O5GA 3BOWA 1L2OC 3OB2B 1MWNA 1CDLA 1KFXS 2JWWA 1IKUA 2CTNA 3BUOB 3EVVA 2CCMA 2AUCA 3FE6A 1BOCA 1MUXA 3A4UB 2BCBA 3FE8A 5B8IB 1W7JB 4PE0A 3UNWA 4L9MA 4MBEA 2JNFA 2GGMA 2I2RE 2KLEA 2EC6B 1B1GA 1TRFA 3JTDB 2SCPA 1SY9A 2KDHA 3OBVA 2WCJA 4PE1A 2OPOA 2LC5A 1XFYO 3CWGA 4C0KA 1V1GA 2L98A 3JVTC 4FQOA 3S0FA 4HRGA 1EG3A 3D10A 2VRGA 1NX2A 2MBXA 2KYCA 1BT6A 3R1OA 1F8HA 3D76A 3LK0A 4P2YB 3DY9A 2K2FA 1K90D 3SS5A 1B7TZ 4YI8A 2KLDA 2M7LA 1KQMC 1S6IA 4MRXA 4MN0A 5BPJA 4MZKA 2LUXA 5PALA 4M2PA 1BLQA 1J7PA 1JWDA 2DOQA 1B8CA 2L0PA 1F4QA 3LCPC 1TIZA 1QATA 2ERBA 2FOTA 2BKHB 3O6BA 1WRKA 1A2XA 2KI4B 1J7OA 4OV2A 2V53A 2HQ8A 5AANA 3VRPA 5FYXA 2M7NA 3L4LA 1FI5A 1B7TY 1W7IB 5I2LA 3IQQA 3HCMA 1S6CA 1GQMA 1SKTA 3SG6A 3B7AA 2JT8A 1RJVA 1MXEA 2WCEA 2MA2A 1CFCA 1LKJA 1QJTA 1IJ5A 2AMIA 4QJ3B 1ODBA 1C7WA 3GK1A 2PASA 3TZ1A 2JXLA 2PRUA 4GFTA 3AKAA 1DT7B 1WDCB 1IQ3A 5F6TA 4ORCB 1AVSA 2EC6C 1CTRA 2P70A 1SCMC 3PSRA 2KPHA 1KFUL 1RTP1
chains in the Genus database with same CATH topology
1G33A 3CZTX 1Q80A 2FCEA 5JOLA 1J7QA 1QLSA 3PFVA 1F55A 3M0WA 3DVEA 3I5HC 1K9KA 1BF5A 1H8BA 1DF0B 1SBJA 5CPVA 3SG2A 3E3RA 3NXAA 2JC2A 4AOMA 1JF0A 1V1FA 1XFXO 1OE9B 3I5IB 1QIWA 1OMVA 1QX7A 1SL7A 1AP4A 5DKRA 1SW8A 1UHKA 1S5GZ 4I5NB 1WLZA 4XYNA 1NCXA 1ALVA 3HX4A 1IGVA 2BBMA 2M9GA 1YRUB 3FS7A 4R1EA 1L2OB 3FWCA 1B8RA 5DKNA 1TCFA 2F33A 1TNQA 5AERA 1JUOA 1SNLA 4ORAB 1F4OA 1TOPA 3CS1A 5CSJA 4PHNA 1F70A 1HT9A 1S5GY 2JT3A 4WRIA 1M63B 2ZRTA 3IQOA 4FTGA 1TNPA 2I94A 3VRQA 1TNWA 4Q04A 1EH2A 2BBNA 3JVTB 1WDCC 1QV0A 2BE4A 1CLBA 2JXCA 2WCFA 3ZWHA 3GOFA 1KQMB 1CM4A 2BL0C 1L7ZA 2AAOA 2L4HA 2K7DA 2WORA 1CMGA 3CGAA 1J1DA 1XFWO 3PM8A 1QASA 4GPLB 4GAOA 3I5IC 1U5IB 1OZSA 1DJIA 2KAXA 1EJ3A 1A03A 1NIWA 2PALA 4JWQA 2HQWA 2LV7A 1SPYA 1TNXA 4NQGA 1B4CA 1AHRA 1QX5B 2ZRSA 3I5FC 2TN4A 2ZN8A 5HKYA 2K7CA 3DVKA 1GGWA 1DJWA 1ZACA 1YUSA 2NCPA 2IS9A 5KTYA 2CT9A 1XO5A 2Y5IA 2FJUB 3NSKA 1PSRA 3H4SE 2K61A 1U5IA 4MLWA 4PDZA 1NPQA 4GGNA 3VGOA 1PULA 1S36A 1MF8B 1SCMB 2NZ0A 4M2QA 1MQ1A 2BKIB 2LMTA 2D8NA 1IQ5A 2LP3A 2PSRA 1MR8A 3WHTB 3I5HB 2KAVA 2HF5A 1K8UA 2BE6A 2LANA 1J55A 1MXLC 3DF0A 1M31A 1UHJA 2M29A 2ZNEA 2F8PA 1CM1A 1KSMA 1OSAA 1QS7A 4N1FA 1YX7A 3SG5A 3LL8B 4P5OE 3IF7A 1NWDA 3EK7A 1K95A 1N65A 4WQ3A 5J3XA 3F45A 3BUXB 2JT0A 1D1OA 4PALA 2WC8A 3PALA 3WNXB 1IJ6A 1M46A 2LLUA 1NCZA 2JRFA 2F2PA 2LUCA 3EKJA 3PATA 3PN7C 5TNCA 2LNKA 3RM1A 4JPZB 2LVJA 2LVVA 2LAPA 3ZNIA 3GK2A 1LVCD 1E8AA 1KWOC 3DVMA 1H4BA 1DGVA 3SIBA 1CDPA 4PHMA 2F3ZA 1IRJA 5CSIA 4D1EA 3SG3A 4ETOA 1ZUZA 2PVBA 3AAKA 1NP8A 1UWOA 1NUBA 2ZNDA 4YBHB 1SRAA 1YUUA 2LMUA 3NSLA 2GGZA 4CFRA 5KU1A 4MEWA 3BYAA 3EVUA 2EHBA 4YI9A 1AJ4A 1K96A 2K7BA 2LLSA 4C0LA 4PE7A 1BMOA 5K89A 5CSNA 1GJYA 2KFGA 3K21A 1SL9A 2LHIA 2R2IA 5ER5A 1MHOA 2KI6C 3SG7A 1FF1A 2KQYA 5ER4X 2BL0B 3KF9A 4WQ2A 1JC2A 4QJ5B 3O4YA 4BY5A 2ISDA 1CB1A 2Q91A 1XK4C 5DKQA 1K9UA 2M8UA 2WNDA 3PLFB 2MLFC 1R6PA 3BUMB 4E68A 4MZLA 1JFKA 3CLNA 2P6BB 5G08A 1A4PA 1UUSA 4C0JA 3VRRA 2JU0A 2BECA 4F0ZB 4HSZA 3I5FB 4CLNA 2ZFDA 4YGCB 3AAJA 4GGFC 2K0JA 2JOJA 1RFJA 1CFFA 4NDBA 1SR6C 1YUTA 4YRUA 2OTGC 1KFXL 2GV5A 1PVAA 3MSEB 1YX8A 4MRYA 4AQJA 5AXIA 1PK0D 3SJSA 5IBWA 3SG4A 1DJHA 2KSPA 4U8DA 2B1UA 1VRKA 2LP2A 2ZN9A 4JQ0D 1YVHA 1X02A 1FW4A 1YURA 1ZOTB 1UHHA 4OVNF 4YGEB 1S3PA 2KQ6A 1UURA 4TNCA 1CDNA 3I5GC 3EK8A 2Q4UA 2LVKA 4XJKB 4GNKB 3WHUB 1EL4A 1FBVA 4ORBB 3DD4A 1WLMA 1DJZA 2PMYA 4CFQA 1M45A 4UPGA 1ALWA 2JTZA 2G2BA 2FCDA 2MJWB 4OKHA 4BY4A 2M1KB 3PN7B 3OP0A 5I8NA 1IH0A 1LXFC 2M97A 1SL8A 1KWOB 2NXQA 1F54A 2NLNA 1NYAA 1B47A 4IL1A 3RLZA 1YVLA 4DUQA 2MHHA 3EVRA 4XJKA 1KK8C 1XFVO 4ZCUA 2LE9B 2NCOA 1CLLA 1J7RA 1QV1A 2LM5A 2KBMA 1ZFSA 1QTXA 1OZOA 3DF0B 2WCBA 3BXKA 1AJ5A 1XA5A 1PALA 5I2OA 1CFPA 1XFZO 1QIVA 2CBLA 1C7VA 3OB1B 1S1EA 1WRZA 1TTXA 4N1GA 4OCIA 5D69A 1F71A 1GGZA 4PHJA 2Y4QA 1J1EA 3NSIA 1DMOA 1QX2A 2L4IA 2H2KA 2M0RA 1CFDA 1WY9A 2HPSA 5CSFA 4PCWA 1FI6A 2OS8C 2E6WA 1OMDA 2L50A 4MSPA 4HREE 3O78A 1NX0A 1NX3A 1QLKA 2KBIA 1ZMZA 2QACA 1WRLA 1LINA 4ICBA 1Y1XA 3VRNA 3BQ3A 1NX1A 1JBAA 2KGBC 1OQPA 1CLMA 2CNPA 2KHNA 4MZJA 1YRTB 4ZCVA 5AEQA 2QPTA 3TS5C 1KQVA 2F2OA 1PVBA 2CXJA 1KK7Z 2HETA 2LCPA 2KNEA 2F3YA 1DVIA 2LHLA 1Y1UA 1XK4A 3NSOA 1BG1A 1SR6B 2G9BA 4N5XA 1S26D 3D0YB 2OTGB 3WXAA 2M1UA 2JPTA 2EGDA 2WOSA 2KOTA 3GK4X 2K7OA 3FWBA 1BR1B 1NSHA 1SCVA 2Y1MA 1BJFA 4PE4A 4DRWA 2JTTA 3CR5X 1R2UA 2K8MB 2A4JA 1YR5A 2KAYA 2SASA 3OX5A 1EXRA 1K94A 1KK7Y 1AK8A 1UHIA 3EK4A 2LVIA 4GBAA 1CNPA 1RK9A 3TDUA 2RGIA 4GGFA 3TUYB 2BCAA 5AFPA 1IG5A 2COLB 1HQVA 5HKZA 1DJYA 3D0YA 1K93D 4OR9B 1M39A 2Y1NA 1LA3A 4I5LB 1JSAA 2L51A 1RECA 3I5GB 2I18A 2LLTA 3KHEA 3TDZA 1CKKA 1B9AA 2ZKMX 2MAZA 5HYDA 2JNXA 3BUWB 4NDCA 2H61A 4YGDB 2KYFA 1N0YA 5GQQC 1XYDA 1TN4A 3KO0A 1DGUA 2JZIA 4AQIA 2E30A 2JULA 3DVJA 2MRDA 3JTDC 4A4CA 4YGBB 1TCOB 3CR4X 3CTNA 4QJ4B 1OMRA 1KK8B 3EKHA 4DS7A 3ICBA 2LMVA 3AKBA 1K9PA 2L5XB 1EG4A 4USLA 2JQ6A 4I5JA 4CIDA 1K2HA 4GUKA 1KCYA 1YTZC 2M49B 1BODA 1LA0A 5D7FA 1Y6WA 3LLEA 1DJXA 3O2PA 2H61C 1JF2A 1SYMA 1CMFA 3TUYC 2KFHA 1PSBA 3OHMB 2BCXA 1KSOA 2KI4C 1DF0A 4YGAA 2OS8B 3OX6A 1NCYA 1RROA 5HLVA 4DIRA 2I7AA 1B8LA 3A8RA 2M3WA 2MLEC 1DJGA 1IWQA 4DCKA 1UP5A 3FIAA 1G4YR 1G8IA 1XFUO 4HRHA 4M2OA 1SK6D 4NDDA 3TDIA 3TS5B 3C1VA 1N2DA 1SMGA 1BU3A 1QVIZ 1AUIB 1KFUS 3LK1A 5KSZA 1CDMA 1FPWA 1UHNA 3KPXA 4CPVA 5HKWA 3CR2A 1QXPA 1XVJA 1BR4B 3BUNB 1A75B 3BOWB 3QRXA 2L2EA 1JFJA 5HLOA 1QVIY 2O60A 4I5KA 5JJGA 1Y0VH 1PRWA 2KGRA 3KEVA 1RWYA 3SIAA 3VROA 4A4BA 1Y1AA 2KFFA 1OOJA 1A29A 1S6JA 2KI6D 1C07A 1DTLA 5I2QA 2K2AA 4MVFA 1A75A 4PHKA 2O5GA 3BOWA 1L2OC 3OB2B 1MWNA 1CDLA 1KFXS 2JWWA 1IKUA 2CTNA 3BUOB 3EVVA 2CCMA 2AUCA 1BOCA 1MUXA 3A4UB 2BCBA 5B8IB 1W7JB 4PE0A 4L9MA 4MBEA 2JNFA 2GGMA 2I2RE 2EC6B 1B1GA 1TRFA 3JTDB 2SCPA 1SY9A 2KDHA 4PE1A 2OPOA 2LC5A 1XFYO 3CWGA 4C0KA 1V1GA 2L98A 3JVTC 4FQOA 4HRGA 1EG3A 3D10A 2VRGA 1NX2A 2MBXA 2KYCA 1BT6A 1F8HA 3LK0A 4P2YB 2K2FA 1K90D 1B7TZ 4YI8A 2M7LA 1KQMC 1S6IA 4MRXA 4MN0A 5BPJA 4MZKA 2LUXA 5PALA 4M2PA 1BLQA 1J7PA 1JWDA 2DOQA 1B8CA 2L0PA 1F4QA 3LCPC 1TIZA 1QATA 2FOTA 2BKHB 3O6BA 1WRKA 1A2XA 2KI4B 1J7OA 4OV2A 2V53A 2HQ8A 5AANA 3VRPA 5FYXA 2M7NA 1FI5A 1B7TY 1W7IB 5I2LA 3IQQA 3HCMA 1S6CA 1GQMA 1SKTA 3SG6A 2JT8A 1RJVA 1MXEA 2WCEA 2MA2A 1CFCA 1LKJA 1QJTA 1IJ5A 2AMIA 4QJ3B 1ODBA 1C7WA 3GK1A 2PASA 3TZ1A 2JXLA 2PRUA 4GFTA 3AKAA 1DT7B 1WDCB 1IQ3A 5F6TA 4ORCB 1AVSA 2EC6C 1CTRA 3PSRA 1SCMC 1KFUL 1RTP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G33 A;  3CZT X;  1Q80 A;  2FCE A;  5JOL A;  1J7Q A;  1QLS A;  3PFV A;  1F55 A;  3M0W A;  3DVE A;  3I5H C;  1K9K A;  1BF5 A;  1H8B A;  1DF0 B;  1SBJ A;  5CPV A;  3SG2 A;  3E3R A;  3NXA A;  2JC2 A;  4AOM A;  1JF0 A;  1V1F A;  1XFX O;  1OE9 B;  3I5I B;  1QIW A;  1OMV A;  1QX7 A;  1SL7 A;  1AP4 A;  5DKR A;  1SW8 A;  1UHK A;  1S5G Z;  4I5N B;  1WLZ A;  4XYN A;  1NCX A;  1ALV A;  3HX4 A;  1IGV A;  2BBM A;  2M9G A;  1YRU B;  3FS7 A;  4R1E A;  1L2O B;  3FWC A;  1B8R A;  5DKN A;  1TCF A;  2F33 A;  1TNQ A;  5AER A;  1JUO A;  1SNL A;  4ORA B;  1F4O A;  1TOP A;  3CS1 A;  5CSJ A;  4PHN A;  1F70 A;  1HT9 A;  1S5G Y;  2JT3 A;  4WRI A;  1M63 B;  2ZRT A;  3IQO A;  4FTG A;  1TNP A;  2I94 A;  3VRQ A;  1TNW A;  4Q04 A;  1EH2 A;  2BBN A;  3JVT B;  1WDC C;  1QV0 A;  2BE4 A;  1CLB A;  2JXC A;  2WCF A;  3ZWH A;  3GOF A;  1KQM B;  1CM4 A;  2BL0 C;  1L7Z A;  2AAO A;  2L4H A;  2K7D A;  2WOR A;  1CMG A;  3CGA A;  1J1D A;  1XFW O;  3PM8 A;  1QAS A;  4GPL B;  4GAO A;  3I5I C;  1U5I B;  1OZS A;  1DJI A;  2KAX A;  1EJ3 A;  1A03 A;  1NIW A;  2PAL A;  4JWQ A;  2HQW A;  2LV7 A;  1SPY A;  1TNX A;  4NQG A;  1B4C A;  1AHR A;  1QX5 B;  2ZRS A;  3I5F C;  2TN4 A;  2ZN8 A;  5HKY A;  2K7C A;  3DVK A;  1GGW A;  1DJW A;  1ZAC A;  1YUS A;  2NCP A;  2IS9 A;  5KTY A;  2CT9 A;  1XO5 A;  2Y5I A;  2FJU B;  3NSK A;  1PSR A;  3H4S E;  2K61 A;  1U5I A;  4MLW A;  4PDZ A;  1NPQ A;  4GGN A;  3VGO A;  1PUL A;  1S36 A;  1MF8 B;  1SCM B;  2NZ0 A;  4M2Q A;  1MQ1 A;  2BKI B;  2LMT A;  2D8N A;  1IQ5 A;  2LP3 A;  2PSR A;  1MR8 A;  3WHT B;  3I5H B;  2KAV A;  2HF5 A;  1K8U A;  2BE6 A;  2LAN A;  1J55 A;  1MXL C;  3DF0 A;  1M31 A;  1UHJ A;  2M29 A;  2ZNE A;  2F8P A;  1CM1 A;  1KSM A;  1OSA A;  1QS7 A;  4N1F A;  1YX7 A;  3SG5 A;  3LL8 B;  4P5O E;  3IF7 A;  1NWD A;  3EK7 A;  1K95 A;  1N65 A;  4WQ3 A;  5J3X A;  3F45 A;  3BUX B;  2JT0 A;  1D1O A;  4PAL A;  2WC8 A;  3PAL A;  3WNX B;  1IJ6 A;  1M46 A;  2LLU A;  1NCZ A;  2JRF A;  2F2P A;  2LUC A;  3EKJ A;  3PAT A;  3PN7 C;  5TNC A;  2LNK A;  3RM1 A;  4JPZ B;  2LVJ A;  2LVV A;  2LAP A;  3ZNI A;  3GK2 A;  1LVC D;  1E8A A;  1KWO C;  3DVM A;  1H4B A;  1DGV A;  3SIB A;  1CDP A;  4PHM A;  2F3Z A;  1IRJ A;  5CSI A;  4D1E A;  3SG3 A;  4ETO A;  1ZUZ A;  2PVB A;  3AAK A;  1NP8 A;  1UWO A;  1NUB A;  2ZND A;  4YBH B;  1SRA A;  1YUU A;  2LMU A;  3NSL A;  2GGZ A;  4CFR A;  5KU1 A;  4MEW A;  3BYA A;  3EVU A;  2EHB A;  4YI9 A;  1AJ4 A;  1K96 A;  2K7B A;  2LLS A;  4C0L A;  4PE7 A;  1BMO A;  5K89 A;  5CSN A;  1GJY A;  2KFG A;  3K21 A;  1SL9 A;  2LHI A;  2R2I A;  5ER5 A;  1MHO A;  2KI6 C;  3SG7 A;  1FF1 A;  2KQY A;  5ER4 X;  2BL0 B;  3KF9 A;  4WQ2 A;  1JC2 A;  4QJ5 B;  3O4Y A;  4BY5 A;  2ISD A;  1CB1 A;  2Q91 A;  1XK4 C;  5DKQ A;  1K9U A;  2M8U A;  2WND A;  3PLF B;  2MLF C;  1R6P A;  3BUM B;  4E68 A;  4MZL A;  1JFK A;  3CLN A;  2P6B B;  5G08 A;  1A4P A;  1UUS A;  4C0J A;  3VRR A;  2JU0 A;  2BEC A;  4F0Z B;  4HSZ A;  3I5F B;  4CLN A;  2ZFD A;  4YGC B;  3AAJ A;  4GGF C;  2K0J A;  2JOJ A;  1RFJ A;  1CFF A;  4NDB A;  1SR6 C;  1YUT A;  4YRU A;  2OTG C;  1KFX L;  2GV5 A;  1PVA A;  3MSE B;  1YX8 A;  4MRY A;  4AQJ A;  5AXI A;  1PK0 D;  3SJS A;  5IBW A;  3SG4 A;  1DJH A;  2KSP A;  4U8D A;  2B1U A;  1VRK A;  2LP2 A;  2ZN9 A;  4JQ0 D;  1YVH A;  1X02 A;  1FW4 A;  1YUR A;  1ZOT B;  1UHH A;  4OVN F;  4YGE B;  1S3P A;  2KQ6 A;  1UUR A;  4TNC A;  1CDN A;  3I5G C;  3EK8 A;  2Q4U A;  2LVK A;  4XJK B;  4GNK B;  3WHU B;  1EL4 A;  1FBV A;  4ORB B;  3DD4 A;  1WLM A;  1DJZ A;  2PMY A;  4CFQ A;  1M45 A;  4UPG A;  1ALW A;  2JTZ A;  2G2B A;  2FCD A;  2MJW B;  4OKH A;  4BY4 A;  2M1K B;  3PN7 B;  3OP0 A;  5I8N A;  1IH0 A;  1LXF C;  2M97 A;  1SL8 A;  1KWO B;  2NXQ A;  1F54 A;  2NLN A;  1NYA A;  1B47 A;  4IL1 A;  3RLZ A;  1YVL A;  4DUQ A;  2MHH A;  3EVR A;  4XJK A;  1KK8 C;  1XFV O;  4ZCU A;  2LE9 B;  2NCO A;  1CLL A;  1J7R A;  1QV1 A;  2LM5 A;  2KBM A;  1ZFS A;  1QTX A;  1OZO A;  3DF0 B;  2WCB A;  3BXK A;  1AJ5 A;  1XA5 A;  1PAL A;  5I2O A;  1CFP A;  1XFZ O;  1QIV A;  2CBL A;  1C7V A;  3OB1 B;  1S1E A;  1WRZ A;  1TTX A;  4N1G A;  4OCI A;  5D69 A;  1F71 A;  1GGZ A;  4PHJ A;  2Y4Q A;  1J1E A;  3NSI A;  1DMO A;  1QX2 A;  2L4I A;  2H2K A;  2M0R A;  1CFD A;  1WY9 A;  2HPS A;  5CSF A;  4PCW A;  1FI6 A;  2OS8 C;  2E6W A;  1OMD A;  2L50 A;  4MSP A;  4HRE E;  3O78 A;  1NX0 A;  1NX3 A;  1QLK A;  2KBI A;  1ZMZ A;  2QAC A;  1WRL A;  1LIN A;  4ICB A;  1Y1X A;  3VRN A;  3BQ3 A;  1NX1 A;  1JBA A;  2KGB C;  1OQP A;  1CLM A;  2CNP A;  2KHN A;  4MZJ A;  1YRT B;  4ZCV A;  5AEQ A;  2QPT A;  3TS5 C;  1KQV A;  2F2O A;  1PVB A;  2CXJ A;  1KK7 Z;  2HET A;  2LCP A;  2KNE A;  2F3Y A;  1DVI A;  2LHL A;  1Y1U A;  1XK4 A;  3NSO A;  1BG1 A;  1SR6 B;  2G9B A;  4N5X A;  1S26 D;  3D0Y B;  2OTG B;  3WXA A;  2M1U A;  2JPT A;  2EGD A;  2WOS A;  2KOT A;  3GK4 X;  2K7O A;  3FWB A;  1BR1 B;  1NSH A;  1SCV A;  2Y1M A;  1BJF A;  4PE4 A;  4DRW A;  2JTT A;  3CR5 X;  1R2U A;  2K8M B;  2A4J A;  1YR5 A;  2KAY A;  2SAS A;  3OX5 A;  1EXR A;  1K94 A;  1KK7 Y;  1AK8 A;  1UHI A;  3EK4 A;  2LVI A;  4GBA A;  1CNP A;  1RK9 A;  3TDU A;  2RGI A;  4GGF A;  3TUY B;  2BCA A;  5AFP A;  1IG5 A;  2COL B;  1HQV A;  5HKZ A;  1DJY A;  3D0Y A;  1K93 D;  4OR9 B;  1M39 A;  2Y1N A;  1LA3 A;  4I5L B;  1JSA A;  2L51 A;  1REC A;  3I5G B;  2I18 A;  2LLT A;  3KHE A;  3TDZ A;  1CKK A;  1B9A A;  2ZKM X;  2MAZ A;  5HYD A;  2JNX A;  3BUW B;  4NDC A;  2H61 A;  4YGD B;  2KYF A;  1N0Y A;  5GQQ C;  1XYD A;  1TN4 A;  3KO0 A;  1DGU A;  2JZI A;  4AQI A;  2E30 A;  2JUL A;  3DVJ A;  2MRD A;  3JTD C;  4A4C A;  4YGB B;  1TCO B;  3CR4 X;  3CTN A;  4QJ4 B;  1OMR A;  1KK8 B;  3EKH A;  4DS7 A;  3ICB A;  2LMV A;  3AKB A;  1K9P A;  2L5X B;  1EG4 A;  4USL A;  2JQ6 A;  4I5J A;  4CID A;  1K2H A;  4GUK A;  1KCY A;  1YTZ C;  2M49 B;  1BOD A;  1LA0 A;  5D7F A;  1Y6W A;  3LLE A;  1DJX A;  3O2P A;  2H61 C;  1JF2 A;  1SYM A;  1CMF A;  3TUY C;  2KFH A;  1PSB A;  3OHM B;  2BCX A;  1KSO A;  2KI4 C;  1DF0 A;  4YGA A;  2OS8 B;  3OX6 A;  1NCY A;  1RRO A;  5HLV A;  4DIR A;  2I7A A;  1B8L A;  3A8R A;  2M3W A;  2MLE C;  1DJG A;  1IWQ A;  4DCK A;  1UP5 A;  3FIA A;  1G4Y R;  1G8I A;  1XFU O;  4HRH A;  4M2O A;  1SK6 D;  4NDD A;  3TDI A;  3TS5 B;  3C1V A;  1N2D A;  1SMG A;  1BU3 A;  1QVI Z;  1AUI B;  1KFU S;  3LK1 A;  5KSZ A;  1CDM A;  1FPW A;  1UHN A;  3KPX A;  4CPV A;  5HKW A;  3CR2 A;  1QXP A;  1XVJ A;  1BR4 B;  3BUN B;  1A75 B;  3BOW B;  3QRX A;  2L2E A;  1JFJ A;  5HLO A;  1QVI Y;  2O60 A;  4I5K A;  5JJG A;  1Y0V H;  1PRW A;  2KGR A;  3KEV A;  1RWY A;  3SIA A;  3VRO A;  4A4B A;  1Y1A A;  2KFF A;  1OOJ A;  1A29 A;  1S6J A;  2KI6 D;  1C07 A;  1DTL A;  5I2Q A;  2K2A A;  4MVF A;  1A75 A;  4PHK A;  2O5G A;  3BOW A;  1L2O C;  3OB2 B;  1MWN A;  1CDL A;  1KFX S;  2JWW A;  1IKU A;  2CTN A;  3BUO B;  3EVV A;  2CCM A;  2AUC A;  1BOC A;  1MUX A;  3A4U B;  2BCB A;  5B8I B;  1W7J B;  4PE0 A;  4L9M A;  4MBE A;  2JNF A;  2GGM A;  2I2R E;  2EC6 B;  1B1G A;  1TRF A;  3JTD B;  2SCP A;  1SY9 A;  2KDH A;  4PE1 A;  2OPO A;  2LC5 A;  1XFY O;  3CWG A;  4C0K A;  1V1G A;  2L98 A;  3JVT C;  4FQO A;  4HRG A;  1EG3 A;  3D10 A;  2VRG A;  1NX2 A;  2MBX A;  2KYC A;  1BT6 A;  1F8H A;  3LK0 A;  4P2Y B;  2K2F A;  1K90 D;  1B7T Z;  4YI8 A;  2M7L A;  1KQM C;  1S6I A;  4MRX A;  4MN0 A;  5BPJ A;  4MZK A;  2LUX A;  5PAL A;  4M2P A;  1BLQ A;  1J7P A;  1JWD A;  2DOQ A;  1B8C A;  2L0P A;  1F4Q A;  3LCP C;  1TIZ A;  1QAT A;  2FOT A;  2BKH B;  3O6B A;  1WRK A;  1A2X A;  2KI4 B;  1J7O A;  4OV2 A;  2V53 A;  2HQ8 A;  5AAN A;  3VRP A;  5FYX A;  2M7N A;  1FI5 A;  1B7T Y;  1W7I B;  5I2L A;  3IQQ A;  3HCM A;  1S6C A;  1GQM A;  1SKT A;  3SG6 A;  2JT8 A;  1RJV A;  1MXE A;  2WCE A;  2MA2 A;  1CFC A;  1LKJ A;  1QJT A;  1IJ5 A;  2AMI A;  4QJ3 B;  1ODB A;  1C7W A;  3GK1 A;  2PAS A;  3TZ1 A;  2JXL A;  2PRU A;  4GFT A;  3AKA A;  1DT7 B;  1WDC B;  1IQ3 A;  5F6T A;  4ORC B;  1AVS A;  2EC6 C;  1CTR A;  3PSR A;  1SCM C;  1KFU L;  1RTP 1; 
#chains in the Genus database with same CATH topology
 1G33 A;  3CZT X;  1Q80 A;  2FCE A;  5JOL A;  1J7Q A;  1QLS A;  3PFV A;  1F55 A;  3M0W A;  3DVE A;  3I5H C;  1K9K A;  1BF5 A;  1H8B A;  1DF0 B;  1SBJ A;  5CPV A;  3SG2 A;  3E3R A;  3NXA A;  2JC2 A;  4AOM A;  1JF0 A;  1V1F A;  1XFX O;  1OE9 B;  3I5I B;  3OGN A;  1QIW A;  3V2L A;  1OMV A;  3S0B A;  1QX7 A;  1SL7 A;  1GM0 A;  1AP4 A;  5DKR A;  1SW8 A;  1UHK A;  1S5G Z;  2QEB A;  2QEV A;  4I5N B;  1WLZ A;  4XYN A;  1NCX A;  1ALV A;  3HX4 A;  1IGV A;  2BBM A;  2M9G A;  1YRU B;  3FS7 A;  4R1E A;  1L2O B;  3FWC A;  3CAB A;  1B8R A;  3S0E A;  5DKN A;  1TCF A;  2F33 A;  1TNQ A;  1TUJ A;  5AER A;  1JUO A;  1SNL A;  4ORA B;  1F4O A;  2GTE A;  1TOP A;  3CS1 A;  5CSJ A;  4PHN A;  1F70 A;  1HT9 A;  1S5G Y;  2JT3 A;  2WCH A;  1M63 B;  2ZRT A;  4WRI A;  5FI2 A;  3IQO A;  3UO9 A;  3NGV A;  4FTG A;  3D77 A;  1TNP A;  2I94 A;  3VRQ A;  1TNW A;  4Q04 A;  1EH2 A;  2BBN A;  3JVT B;  1WDC C;  1QV0 A;  2PQL A;  2BE4 A;  1CLB A;  2JXC A;  2WCF A;  3ZWH A;  2WC6 A;  3GOF A;  1KQM B;  1CM4 A;  2BL0 C;  1L7Z A;  2AAO A;  2L4H A;  2K7D A;  2WOR A;  1CMG A;  3CGA A;  1J1D A;  1XFW O;  3PM8 A;  1QAS A;  1XFR A;  4GPL B;  4GAO A;  3I5I C;  1U5I B;  1OZS A;  1DJI A;  2KAX A;  1EJ3 A;  3IVT A;  1A03 A;  1NIW A;  2PAL A;  4JWQ A;  2HQW A;  2LV7 A;  1SPY A;  1TNX A;  3K1E A;  4NQG A;  1B4C A;  1AHR A;  1QX5 B;  2ZRS A;  3I5F C;  2TN4 A;  2ZN8 A;  5HKY A;  2K7C A;  3DVK A;  1GGW A;  1DJW A;  1ZAC A;  1YUS A;  2NCP A;  2IS9 A;  5KTY A;  2CT9 A;  1XO5 A;  2Y5I A;  2FJU B;  3CYZ A;  1P28 A;  3NSK A;  1PSR A;  3H4S E;  2K61 A;  1U5I A;  4MLW A;  4PDZ A;  1NPQ A;  4GGN A;  3VGO A;  1PUL A;  1S36 A;  1MF8 B;  1SCM B;  2NZ0 A;  4M2Q A;  1MQ1 A;  2BKI B;  2LMT A;  4INX A;  2D8N A;  1IQ5 A;  2LP3 A;  2PSR A;  1MR8 A;  2L2C A;  3WHT B;  3I5H B;  2KAV A;  1DEK A;  1K8U A;  2BE6 A;  1Z4H A;  1J55 A;  2HF5 A;  2LAN A;  1MXL C;  3DF0 A;  1M31 A;  1UHJ A;  2M29 A;  2ZNE A;  2F8P A;  1CM1 A;  1KSM A;  1OSA A;  1QS7 A;  4N1F A;  3S0A A;  1YX7 A;  1OOI X;  3R1P A;  3SG5 A;  3LL8 B;  4P5O E;  3IF7 A;  1NWD A;  2P71 A;  1K95 A;  1N65 A;  3EK7 A;  4WQ3 A;  5J3X A;  3F45 A;  3BUX B;  2JT0 A;  1D1O A;  4PAL A;  2WC8 A;  3PAL A;  3O4X A;  3N7H A;  3WNX B;  1IJ6 A;  1M46 A;  2LLU A;  1NCZ A;  2JRF A;  2F2P A;  2LUC A;  3EKJ A;  3PAT A;  3PN7 C;  5TNC A;  3DZT A;  2LNK A;  3RM1 A;  4JPZ B;  2LVJ A;  2LVV A;  2LAP A;  3ZNI A;  3GK2 A;  1LVC D;  1E8A A;  1KWO C;  3DVM A;  1H4B A;  1DGV A;  3SIB A;  1CDP A;  1DEL A;  4PHM A;  2F3Z A;  1IRJ A;  5CSI A;  4D1E A;  3SG3 A;  4ETO A;  1ZUZ A;  2PVB A;  3AAK A;  1NP8 A;  1UWO A;  1NUB A;  2ZND A;  4YBH B;  1SRA A;  1YUU A;  4KYN A;  2LMU A;  3NSL A;  2GGZ A;  4CFR A;  5KU1 A;  4MEW A;  3BYA A;  3EVU A;  1OOG A;  2EHB A;  3D78 A;  4YI9 A;  1AJ4 A;  1K96 A;  2JPO A;  2K7B A;  2LLS A;  4C0L A;  3DXL A;  4PE7 A;  1ORG A;  1BMO A;  5K89 A;  5CSN A;  3NHI A;  1GJY A;  2KFG A;  3K21 A;  1SL9 A;  2LHI A;  2R2I A;  5ER5 A;  1MHO A;  2KI6 C;  3FE9 A;  3D74 A;  3SG7 A;  2KQY A;  5ER4 X;  1FF1 A;  2BL0 B;  3KF9 A;  4WQ2 A;  1JC2 A;  4QJ5 B;  3O4Y A;  4BY5 A;  2ISD A;  1DC1 A;  1CB1 A;  2Q91 A;  1XK4 C;  5DKQ A;  1K9U A;  2M8U A;  2WND A;  3PLF B;  2MLF C;  1R6P A;  3BUM B;  3QME A;  4E68 A;  4MZL A;  1JFK A;  1OOF A;  1QWV A;  3CLN A;  2P6B B;  2QEO A;  1A4P A;  5G08 A;  3B86 A;  1UUS A;  4C0J A;  3VRR A;  2JU0 A;  2BEC A;  4F0Z B;  4HSZ A;  3I5F B;  4CLN A;  2ZFD A;  1IIO A;  4YGC B;  3AAJ A;  4JD9 A;  3CZ0 A;  2K0J A;  4GGF C;  4PT1 A;  2JOJ A;  1RFJ A;  1CFF A;  4NDB A;  1SR6 C;  1TUZ A;  1YUT A;  4YRU A;  2OTG C;  1KFX L;  2GV5 A;  1PVA A;  3MSE B;  1T14 A;  1YX8 A;  4MRY A;  4AQJ A;  5AXI A;  3L4A A;  1PK0 D;  5FI7 A;  3SJS A;  5IBW A;  3SG4 A;  1DJH A;  2KSP A;  4U8D A;  2B1U A;  1VRK A;  2LP2 A;  2WC5 A;  2ZN9 A;  4JQ0 D;  1YVH A;  1X02 A;  1FW4 A;  1YUR A;  1ZOT B;  1UHH A;  4OVN F;  4YGE B;  3SS3 A;  1S3P A;  2KQ6 A;  1UUR A;  4TNC A;  1CDN A;  3I5G C;  3EK8 A;  2Q4U A;  2LVK A;  4XJK B;  4GNK B;  3WHU B;  1EL4 A;  1FBV A;  4ORB B;  3DD4 A;  1WLM A;  1DJZ A;  2PMY A;  4CFQ A;  1M45 A;  4OZD A;  4UPG A;  1ALW A;  2JTZ A;  2G2B A;  2FCD A;  2MJW B;  4OKH A;  4BY4 A;  2M1K B;  3PN7 B;  3OP0 A;  5I8N A;  1IH0 A;  1LXF C;  2M97 A;  1SL8 A;  1KWO B;  2NXQ A;  1F54 A;  2NLN A;  1NYA A;  1B47 A;  4IL1 A;  3RLZ A;  1YVL A;  4DUQ A;  2MHH A;  3CZ1 A;  3EVR A;  4XJK A;  3NHT A;  1KK8 C;  1XFV O;  4ZCU A;  2LE9 B;  2NCO A;  1CLL A;  2WCM A;  1J7R A;  1QV1 A;  2LM5 A;  2KBM A;  1ZFS A;  3PJI A;  1QTX A;  1OZO A;  3DF0 B;  2WCB A;  3BXK A;  1AJ5 A;  1XA5 A;  1PAL A;  3EG5 B;  5I2O A;  1CFP A;  1XFZ O;  1QIV A;  2CBL A;  1C7V A;  3OB1 B;  1S1E A;  1WRZ A;  1TTX A;  1LS8 A;  4N1G A;  4OCI A;  5D69 A;  1C3Y A;  1F71 A;  1GGZ A;  3DYE A;  4PHJ A;  2Y4Q A;  1J1E A;  3NSI A;  1DMO A;  1QX2 A;  2L4I A;  2H2K A;  2M0R A;  2WCK A;  3S0G A;  1CFD A;  1WY9 A;  2HPS A;  5CSF A;  4PCW A;  1FI6 A;  2OS8 C;  2E6W A;  1OMD A;  2L50 A;  4MSP A;  4HRE E;  3O78 A;  1NX0 A;  1NX3 A;  1QLK A;  2KBI A;  1ZMZ A;  2QAC A;  1WRL A;  1LIN A;  4ICB A;  1Y1X A;  3VRN A;  3R1V A;  3BQ3 A;  1Z2C B;  1NX1 A;  1JBA A;  2KGB C;  1OW4 A;  3B88 A;  1OQP A;  1CLM A;  2CNP A;  2KHN A;  4FQT A;  1YRT B;  4MZJ A;  4ZCV A;  2QPT A;  5AEQ A;  3TS5 C;  1KQV A;  2F2O A;  1PVB A;  2CXJ A;  1KK7 Z;  2HET A;  2LCP A;  2KNE A;  2F3Y A;  1DVI A;  2LHL A;  1Y1U A;  1XK4 A;  3NSO A;  5I94 A;  3BJH A;  1SR6 B;  1BG1 A;  2G9B A;  4N5X A;  1S26 D;  3D0Y B;  2OTG B;  2L5Y A;  3WXA A;  3PM2 A;  2M1U A;  2JPT A;  2EGD A;  2WOS A;  2KOT A;  3GK4 X;  2K7O A;  3FWB A;  2QDI A;  1BR1 B;  1NSH A;  1SCV A;  2Y1M A;  1BJF A;  4PE4 A;  5EL2 A;  2JTT A;  3CR5 X;  4DRW A;  1R2U A;  2K8M B;  5D3O A;  2A4J A;  1YR5 A;  2KAY A;  2SAS A;  3OX5 A;  1EXR A;  1K94 A;  1KK7 Y;  1AK8 A;  1UHI A;  2QEH A;  2LVI A;  3EK4 A;  4GBA A;  1CNP A;  1RK9 A;  3TDU A;  2RGI A;  4GGF A;  4JKT A;  2BCA A;  3S0D A;  3TUY B;  5AFP A;  1IG5 A;  2COL B;  1HQV A;  5HKZ A;  1DJY A;  3D0Y A;  1K93 D;  4OR9 B;  1M39 A;  2Y1N A;  1LA3 A;  4I5L B;  1JSA A;  2L51 A;  1REC A;  3I5G B;  2I18 A;  2LLT A;  3KHE A;  1DQE A;  3TDZ A;  1CKK A;  1B9A A;  2ZKM X;  2MAZ A;  5HYD A;  3R72 A;  2JNX A;  3BUW B;  2WCL A;  4NDC A;  2H61 A;  4YGD B;  2KYF A;  3D73 A;  2PYQ A;  1N0Y A;  5GQQ C;  1XYD A;  2BAP A;  1TN4 A;  3KO0 A;  1DGU A;  2JZI A;  4AQI A;  3B6X A;  2E30 A;  2JUL A;  3DVJ A;  2MRD A;  3JTD C;  4A4C A;  4YGB B;  1TCO B;  3CR4 X;  3CTN A;  3CZ2 A;  4QJ4 B;  3B87 A;  1OMR A;  1KK8 B;  3EKH A;  4DS7 A;  3L47 A;  3ICB A;  2LMV A;  3AKB A;  1K9P A;  2K60 A;  2L5X B;  1EG4 A;  4USL A;  2JQ6 A;  3CDN A;  4I5J A;  4CID A;  1K2H A;  4GUK A;  1KCY A;  5FI6 A;  1YTZ C;  2M49 B;  4IJ7 A;  1BOD A;  1LA0 A;  3Q8I A;  5D7F A;  1Y6W A;  3D75 A;  3LLE A;  1DJX A;  3O2P A;  2H61 C;  1JF2 A;  1SYM A;  1CMF A;  3TUY C;  2KFH A;  1PSB A;  4INW A;  3OHM B;  2BCX A;  1KSO A;  2KI4 C;  1DF0 A;  1SSE B;  4YGA A;  2OS8 B;  3BFB A;  3OX6 A;  1NCY A;  1W9Z A;  1RRO A;  1TWO A;  3BFH A;  2I7A A;  5HLV A;  4DIR A;  4F7F A;  1B8L A;  3A8R A;  2M3W A;  2MLE C;  1DJG A;  1IWQ A;  4DCK A;  1OOH A;  1UP5 A;  3FIA A;  1G4Y R;  1G8I A;  1XFU O;  4HRH A;  4M2O A;  1SK6 D;  4NDD A;  3TDI A;  3TS5 B;  3C1V A;  1N2D A;  1SMG A;  1BU3 A;  1QVI Z;  2BNX A;  1AUI B;  1KFU S;  3LK1 A;  5DIC A;  1C3Z A;  5KSZ A;  1CDM A;  1FPW A;  3SS4 A;  1UHN A;  3KPX A;  4CPV A;  5HKW A;  3CR2 A;  2FJY A;  1QXP A;  1XVJ A;  1BR4 B;  3BUN B;  1A75 B;  3BOW B;  3QRX A;  2L2E A;  3VB1 A;  5HLO A;  5HL1 A;  1JFJ A;  1QVI Y;  3RZS A;  2O60 A;  4I5K A;  5JJG A;  1Y0V H;  1PRW A;  2KGR A;  3KEV A;  1RWY A;  2YGU A;  3SIA A;  3BFA A;  3VRO A;  4A4B A;  1Y1A A;  2KFF A;  1OOJ A;  1A29 A;  1S6J A;  2KI6 D;  2H8V A;  1C07 A;  1DTL A;  5I2Q A;  2K2A A;  4MVF A;  1A75 A;  4PHK A;  2O5G A;  3BOW A;  1L2O C;  3OB2 B;  1MWN A;  1CDL A;  1KFX S;  2JWW A;  1IKU A;  2CTN A;  3BUO B;  3EVV A;  2CCM A;  2AUC A;  3FE6 A;  1BOC A;  1MUX A;  3A4U B;  2BCB A;  3FE8 A;  5B8I B;  1W7J B;  4PE0 A;  3UNW A;  4L9M A;  4MBE A;  2JNF A;  2GGM A;  2I2R E;  2KLE A;  2EC6 B;  1B1G A;  1TRF A;  3JTD B;  2SCP A;  1SY9 A;  2KDH A;  3OBV A;  2WCJ A;  4PE1 A;  2OPO A;  2LC5 A;  1XFY O;  3CWG A;  4C0K A;  1V1G A;  2L98 A;  3JVT C;  4FQO A;  3S0F A;  4HRG A;  1EG3 A;  3D10 A;  2VRG A;  1NX2 A;  2MBX A;  2KYC A;  1BT6 A;  3R1O A;  1F8H A;  3D76 A;  3LK0 A;  4P2Y B;  3DY9 A;  2K2F A;  1K90 D;  3SS5 A;  1B7T Z;  4YI8 A;  2KLD A;  2M7L A;  1KQM C;  1S6I A;  4MRX A;  4MN0 A;  5BPJ A;  4MZK A;  2LUX A;  5PAL A;  4M2P A;  1BLQ A;  1J7P A;  1JWD A;  2DOQ A;  1B8C A;  2L0P A;  1F4Q A;  3LCP C;  1TIZ A;  1QAT A;  2ERB A;  2FOT A;  2BKH B;  3O6B A;  1WRK A;  1A2X A;  2KI4 B;  1J7O A;  4OV2 A;  2V53 A;  2HQ8 A;  5AAN A;  3VRP A;  5FYX A;  2M7N A;  3L4L A;  1FI5 A;  1B7T Y;  1W7I B;  5I2L A;  3IQQ A;  3HCM A;  1S6C A;  1GQM A;  1SKT A;  3SG6 A;  3B7A A;  2JT8 A;  1RJV A;  1MXE A;  2WCE A;  2MA2 A;  1CFC A;  1LKJ A;  1QJT A;  1IJ5 A;  2AMI A;  4QJ3 B;  1ODB A;  1C7W A;  3GK1 A;  2PAS A;  3TZ1 A;  2JXL A;  2PRU A;  4GFT A;  3AKA A;  1DT7 B;  1WDC B;  1IQ3 A;  5F6T A;  4ORC B;  1AVS A;  2EC6 C;  1CTR A;  2P70 A;  1SCM C;  3PSR A;  2KPH A;  1KFU L;  1RTP 1; 
#chains in the Genus database with same CATH homology
 1G33 A;  3CZT X;  1Q80 A;  2FCE A;  5JOL A;  1J7Q A;  1QLS A;  3PFV A;  1F55 A;  3M0W A;  3DVE A;  3I5H C;  1K9K A;  1BF5 A;  1H8B A;  1DF0 B;  1SBJ A;  5CPV A;  3SG2 A;  3E3R A;  3NXA A;  2JC2 A;  4AOM A;  1JF0 A;  1V1F A;  1XFX O;  1OE9 B;  3I5I B;  1QIW A;  1OMV A;  1QX7 A;  1SL7 A;  1AP4 A;  5DKR A;  1SW8 A;  1UHK A;  1S5G Z;  4I5N B;  1WLZ A;  4XYN A;  1NCX A;  1ALV A;  3HX4 A;  1IGV A;  2BBM A;  2M9G A;  1YRU B;  3FS7 A;  4R1E A;  1L2O B;  3FWC A;  1B8R A;  5DKN A;  1TCF A;  2F33 A;  1TNQ A;  5AER A;  1JUO A;  1SNL A;  4ORA B;  1F4O A;  1TOP A;  3CS1 A;  5CSJ A;  4PHN A;  1F70 A;  1HT9 A;  1S5G Y;  2JT3 A;  4WRI A;  1M63 B;  2ZRT A;  3IQO A;  4FTG A;  1TNP A;  2I94 A;  3VRQ A;  1TNW A;  4Q04 A;  1EH2 A;  2BBN A;  3JVT B;  1WDC C;  1QV0 A;  2BE4 A;  1CLB A;  2JXC A;  2WCF A;  3ZWH A;  3GOF A;  1KQM B;  1CM4 A;  2BL0 C;  1L7Z A;  2AAO A;  2L4H A;  2K7D A;  2WOR A;  1CMG A;  3CGA A;  1J1D A;  1XFW O;  3PM8 A;  1QAS A;  4GPL B;  4GAO A;  3I5I C;  1U5I B;  1OZS A;  1DJI A;  2KAX A;  1EJ3 A;  1A03 A;  1NIW A;  2PAL A;  4JWQ A;  2HQW A;  2LV7 A;  1SPY A;  1TNX A;  4NQG A;  1B4C A;  1AHR A;  1QX5 B;  2ZRS A;  3I5F C;  2TN4 A;  2ZN8 A;  5HKY A;  2K7C A;  3DVK A;  1GGW A;  1DJW A;  1ZAC A;  1YUS A;  2NCP A;  2IS9 A;  5KTY A;  2CT9 A;  1XO5 A;  2Y5I A;  2FJU B;  3NSK A;  1PSR A;  3H4S E;  2K61 A;  1U5I A;  4MLW A;  4PDZ A;  1NPQ A;  4GGN A;  3VGO A;  1PUL A;  1S36 A;  1MF8 B;  1SCM B;  2NZ0 A;  4M2Q A;  1MQ1 A;  2BKI B;  2LMT A;  2D8N A;  1IQ5 A;  2LP3 A;  2PSR A;  1MR8 A;  3WHT B;  3I5H B;  2KAV A;  2HF5 A;  1K8U A;  2BE6 A;  2LAN A;  1J55 A;  1MXL C;  3DF0 A;  1M31 A;  1UHJ A;  2M29 A;  2ZNE A;  2F8P A;  1CM1 A;  1KSM A;  1OSA A;  1QS7 A;  4N1F A;  1YX7 A;  3SG5 A;  3LL8 B;  4P5O E;  3IF7 A;  1NWD A;  3EK7 A;  1K95 A;  1N65 A;  4WQ3 A;  5J3X A;  3F45 A;  3BUX B;  2JT0 A;  1D1O A;  4PAL A;  2WC8 A;  3PAL A;  3WNX B;  1IJ6 A;  1M46 A;  2LLU A;  1NCZ A;  2JRF A;  2F2P A;  2LUC A;  3EKJ A;  3PAT A;  3PN7 C;  5TNC A;  2LNK A;  3RM1 A;  4JPZ B;  2LVJ A;  2LVV A;  2LAP A;  3ZNI A;  3GK2 A;  1LVC D;  1E8A A;  1KWO C;  3DVM A;  1H4B A;  1DGV A;  3SIB A;  1CDP A;  4PHM A;  2F3Z A;  1IRJ A;  5CSI A;  4D1E A;  3SG3 A;  4ETO A;  1ZUZ A;  2PVB A;  3AAK A;  1NP8 A;  1UWO A;  1NUB A;  2ZND A;  4YBH B;  1SRA A;  1YUU A;  2LMU A;  3NSL A;  2GGZ A;  4CFR A;  5KU1 A;  4MEW A;  3BYA A;  3EVU A;  2EHB A;  4YI9 A;  1AJ4 A;  1K96 A;  2K7B A;  2LLS A;  4C0L A;  4PE7 A;  1BMO A;  5K89 A;  5CSN A;  1GJY A;  2KFG A;  3K21 A;  1SL9 A;  2LHI A;  2R2I A;  5ER5 A;  1MHO A;  2KI6 C;  3SG7 A;  1FF1 A;  2KQY A;  5ER4 X;  2BL0 B;  3KF9 A;  4WQ2 A;  1JC2 A;  4QJ5 B;  3O4Y A;  4BY5 A;  2ISD A;  1CB1 A;  2Q91 A;  1XK4 C;  5DKQ A;  1K9U A;  2M8U A;  2WND A;  3PLF B;  2MLF C;  1R6P A;  3BUM B;  4E68 A;  4MZL A;  1JFK A;  3CLN A;  2P6B B;  5G08 A;  1A4P A;  1UUS A;  4C0J A;  3VRR A;  2JU0 A;  2BEC A;  4F0Z B;  4HSZ A;  3I5F B;  4CLN A;  2ZFD A;  4YGC B;  3AAJ A;  4GGF C;  2K0J A;  2JOJ A;  1RFJ A;  1CFF A;  4NDB A;  1SR6 C;  1YUT A;  4YRU A;  2OTG C;  1KFX L;  2GV5 A;  1PVA A;  3MSE B;  1YX8 A;  4MRY A;  4AQJ A;  5AXI A;  1PK0 D;  3SJS A;  5IBW A;  3SG4 A;  1DJH A;  2KSP A;  4U8D A;  2B1U A;  1VRK A;  2LP2 A;  2ZN9 A;  4JQ0 D;  1YVH A;  1X02 A;  1FW4 A;  1YUR A;  1ZOT B;  1UHH A;  4OVN F;  4YGE B;  1S3P A;  2KQ6 A;  1UUR A;  4TNC A;  1CDN A;  3I5G C;  3EK8 A;  2Q4U A;  2LVK A;  4XJK B;  4GNK B;  3WHU B;  1EL4 A;  1FBV A;  4ORB B;  3DD4 A;  1WLM A;  1DJZ A;  2PMY A;  4CFQ A;  1M45 A;  4UPG A;  1ALW A;  2JTZ A;  2G2B A;  2FCD A;  2MJW B;  4OKH A;  4BY4 A;  2M1K B;  3PN7 B;  3OP0 A;  5I8N A;  1IH0 A;  1LXF C;  2M97 A;  1SL8 A;  1KWO B;  2NXQ A;  1F54 A;  2NLN A;  1NYA A;  1B47 A;  4IL1 A;  3RLZ A;  1YVL A;  4DUQ A;  2MHH A;  3EVR A;  4XJK A;  1KK8 C;  1XFV O;  4ZCU A;  2LE9 B;  2NCO A;  1CLL A;  1J7R A;  1QV1 A;  2LM5 A;  2KBM A;  1ZFS A;  1QTX A;  1OZO A;  3DF0 B;  2WCB A;  3BXK A;  1AJ5 A;  1XA5 A;  1PAL A;  5I2O A;  1CFP A;  1XFZ O;  1QIV A;  2CBL A;  1C7V A;  3OB1 B;  1S1E A;  1WRZ A;  1TTX A;  4N1G A;  4OCI A;  5D69 A;  1F71 A;  1GGZ A;  4PHJ A;  2Y4Q A;  1J1E A;  3NSI A;  1DMO A;  1QX2 A;  2L4I A;  2H2K A;  2M0R A;  1CFD A;  1WY9 A;  2HPS A;  5CSF A;  4PCW A;  1FI6 A;  2OS8 C;  2E6W A;  1OMD A;  2L50 A;  4MSP A;  4HRE E;  3O78 A;  1NX0 A;  1NX3 A;  1QLK A;  2KBI A;  1ZMZ A;  2QAC A;  1WRL A;  1LIN A;  4ICB A;  1Y1X A;  3VRN A;  3BQ3 A;  1NX1 A;  1JBA A;  2KGB C;  1OQP A;  1CLM A;  2CNP A;  2KHN A;  4MZJ A;  1YRT B;  4ZCV A;  5AEQ A;  2QPT A;  3TS5 C;  1KQV A;  2F2O A;  1PVB A;  2CXJ A;  1KK7 Z;  2HET A;  2LCP A;  2KNE A;  2F3Y A;  1DVI A;  2LHL A;  1Y1U A;  1XK4 A;  3NSO A;  1BG1 A;  1SR6 B;  2G9B A;  4N5X A;  1S26 D;  3D0Y B;  2OTG B;  3WXA A;  2M1U A;  2JPT A;  2EGD A;  2WOS A;  2KOT A;  3GK4 X;  2K7O A;  3FWB A;  1BR1 B;  1NSH A;  1SCV A;  2Y1M A;  1BJF A;  4PE4 A;  4DRW A;  2JTT A;  3CR5 X;  1R2U A;  2K8M B;  2A4J A;  1YR5 A;  2KAY A;  2SAS A;  3OX5 A;  1EXR A;  1K94 A;  1KK7 Y;  1AK8 A;  1UHI A;  3EK4 A;  2LVI A;  4GBA A;  1CNP A;  1RK9 A;  3TDU A;  2RGI A;  4GGF A;  3TUY B;  2BCA A;  5AFP A;  1IG5 A;  2COL B;  1HQV A;  5HKZ A;  1DJY A;  3D0Y A;  1K93 D;  4OR9 B;  1M39 A;  2Y1N A;  1LA3 A;  4I5L B;  1JSA A;  2L51 A;  1REC A;  3I5G B;  2I18 A;  2LLT A;  3KHE A;  3TDZ A;  1CKK A;  1B9A A;  2ZKM X;  2MAZ A;  5HYD A;  2JNX A;  3BUW B;  4NDC A;  2H61 A;  4YGD B;  2KYF A;  1N0Y A;  5GQQ C;  1XYD A;  1TN4 A;  3KO0 A;  1DGU A;  2JZI A;  4AQI A;  2E30 A;  2JUL A;  3DVJ A;  2MRD A;  3JTD C;  4A4C A;  4YGB B;  1TCO B;  3CR4 X;  3CTN A;  4QJ4 B;  1OMR A;  1KK8 B;  3EKH A;  4DS7 A;  3ICB A;  2LMV A;  3AKB A;  1K9P A;  2L5X B;  1EG4 A;  4USL A;  2JQ6 A;  4I5J A;  4CID A;  1K2H A;  4GUK A;  1KCY A;  1YTZ C;  2M49 B;  1BOD A;  1LA0 A;  5D7F A;  1Y6W A;  3LLE A;  1DJX A;  3O2P A;  2H61 C;  1JF2 A;  1SYM A;  1CMF A;  3TUY C;  2KFH A;  1PSB A;  3OHM B;  2BCX A;  1KSO A;  2KI4 C;  1DF0 A;  4YGA A;  2OS8 B;  3OX6 A;  1NCY A;  1RRO A;  5HLV A;  4DIR A;  2I7A A;  1B8L A;  3A8R A;  2M3W A;  2MLE C;  1DJG A;  1IWQ A;  4DCK A;  1UP5 A;  3FIA A;  1G4Y R;  1G8I A;  1XFU O;  4HRH A;  4M2O A;  1SK6 D;  4NDD A;  3TDI A;  3TS5 B;  3C1V A;  1N2D A;  1SMG A;  1BU3 A;  1QVI Z;  1AUI B;  1KFU S;  3LK1 A;  5KSZ A;  1CDM A;  1FPW A;  1UHN A;  3KPX A;  4CPV A;  5HKW A;  3CR2 A;  1QXP A;  1XVJ A;  1BR4 B;  3BUN B;  1A75 B;  3BOW B;  3QRX A;  2L2E A;  1JFJ A;  5HLO A;  1QVI Y;  2O60 A;  4I5K A;  5JJG A;  1Y0V H;  1PRW A;  2KGR A;  3KEV A;  1RWY A;  3SIA A;  3VRO A;  4A4B A;  1Y1A A;  2KFF A;  1OOJ A;  1A29 A;  1S6J A;  2KI6 D;  1C07 A;  1DTL A;  5I2Q A;  2K2A A;  4MVF A;  1A75 A;  4PHK A;  2O5G A;  3BOW A;  1L2O C;  3OB2 B;  1MWN A;  1CDL A;  1KFX S;  2JWW A;  1IKU A;  2CTN A;  3BUO B;  3EVV A;  2CCM A;  2AUC A;  1BOC A;  1MUX A;  3A4U B;  2BCB A;  5B8I B;  1W7J B;  4PE0 A;  4L9M A;  4MBE A;  2JNF A;  2GGM A;  2I2R E;  2EC6 B;  1B1G A;  1TRF A;  3JTD B;  2SCP A;  1SY9 A;  2KDH A;  4PE1 A;  2OPO A;  2LC5 A;  1XFY O;  3CWG A;  4C0K A;  1V1G A;  2L98 A;  3JVT C;  4FQO A;  4HRG A;  1EG3 A;  3D10 A;  2VRG A;  1NX2 A;  2MBX A;  2KYC A;  1BT6 A;  1F8H A;  3LK0 A;  4P2Y B;  2K2F A;  1K90 D;  1B7T Z;  4YI8 A;  2M7L A;  1KQM C;  1S6I A;  4MRX A;  4MN0 A;  5BPJ A;  4MZK A;  2LUX A;  5PAL A;  4M2P A;  1BLQ A;  1J7P A;  1JWD A;  2DOQ A;  1B8C A;  2L0P A;  1F4Q A;  3LCP C;  1TIZ A;  1QAT A;  2FOT A;  2BKH B;  3O6B A;  1WRK A;  1A2X A;  2KI4 B;  1J7O A;  4OV2 A;  2V53 A;  2HQ8 A;  5AAN A;  3VRP A;  5FYX A;  2M7N A;  1FI5 A;  1B7T Y;  1W7I B;  5I2L A;  3IQQ A;  3HCM A;  1S6C A;  1GQM A;  1SKT A;  3SG6 A;  2JT8 A;  1RJV A;  1MXE A;  2WCE A;  2MA2 A;  1CFC A;  1LKJ A;  1QJT A;  1IJ5 A;  2AMI A;  4QJ3 B;  1ODB A;  1C7W A;  3GK1 A;  2PAS A;  3TZ1 A;  2JXL A;  2PRU A;  4GFT A;  3AKA A;  1DT7 B;  1WDC B;  1IQ3 A;  5F6T A;  4ORC B;  1AVS A;  2EC6 C;  1CTR A;  3PSR A;  1SCM C;  1KFU L;  1RTP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...