4ICBA

Proline cis-trans isomers in calbindin d9k observed by x-ray crystallography
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
MKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
publication title Proline cis-trans isomers in calbindin D9k observed by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1991-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4icbA00
1NX0A 3VRRA 4U8DA 1TNWA 1KSOA 5AXIA 3SG5A 1EL4A 4PHMA 2JU0A 4GBAA 3CLNA 2JTZA 4YGDB 1IKUA 2L51A 4JWQA 4GNKB 3LK1A 2JXLA 1BR4B 1YRTB 1F70A 2BBNA 4YRUA 1SCMB 2L4HA 1BODA 3O4YA 1CMFA 1SL9A 2BE4A 2LUCA 2LANA 5G08A 4AQIA 1TN4A 5HLVA 1MQ1A 2KFGA 4CPVA 2LNKA 4DS7A 4F0ZB 1PVBA 5D69A 2O60A 1JFJA 5AEQA 1FW4A 4I5JA 4P2YB 2F3YA 4MSPA 1DGVA 3SG3A 3TZ1A 2LLTA 2HQWA 4YBHB 1CDNA 4CLNA 2ZN9A 2KNEA 2OTGC 1JC2A 1DVIA 1XO5A 1B8RA 1UURA 1YUUA 3WHTB 4ICBA 2EC6B 3BOWB 1UHJA 2NCOA 1PSRA 1R2UA 2Q4UA 1L2OB 1QS7A 1J7QA 3RM1A 3OHMB 2MRDA 1DTLA 3O78A 4I5NB 1C7VA 1XA5A 1OMRA 4ORCB 4GAOA 1F71A 1Y1XA 2CXJA 5CPVA 1NIWA 3H4SE 1QVIZ 2BL0C 3BXKA 3IQOA 4IL1A 4MRYA 4UPGA 1MHOA 1SCMC 1SKTA 2LVVA 2K7CA 4PE0A 2M97A 5KTYA 1PALA 2WNDA 1DJIA 1U5IB 4FTGA 2LCPA 4USLA 4TNCA 2KI4B 2M1UA 1RECA 3O2PA 1KK7Z 4I5KA 1B7TZ 3PN7B 2ZNDA 1M31A 1Y0VH 1BMOA 1QX2A 3SIBA 3VRPA 1RTP1 5ER5A 3AKBA 1G33A 1SCVA 5HLOA 3VRQA 4Q04A 2F2PA 1JBAA 2WCFA 1BOCA 2LMVA 3PFVA 1V1FA 1AVSA 1L2OC 2LVJA 2SCPA 4PHJA 1KQMB 2WORA 1TNPA 1M39A 3WXAA 1YUTA 1LA0A 3CR5X 1QXPA 2JOJA 4NDDA 2KI6D 1OSAA 2M8UA 2FCEA 2GV5A 3ICBA 4GPLB 2MBXA 3EVUA 3SG4A 1QJTA 2ZN8A 4AOMA 1PSBA 2LHLA 1J7PA 5CSFA 1SYMA 1EG4A 2KI4C 5I8NA 1K93D 4BY4A 1CMGA 4CIDA 1AJ4A 1OE9B 3PSRA 1L7ZA 1S26D 4N5XA 2BKIB 5PALA 1XK4A 1CLBA 1DT7B 2DOQA 3FWCA 2COLB 2K7DA 2M0RA 1K8UA 1SBJA 1SK6D 2M49B 4N1GA 1KQMC 1S5GY 2PASA 4I5LB 4MBEA 2Y1MA 1GGZA 2K61A 4JPZB 4MRXA 1MUXA 3M0WA 1JSAA 2O5GA 1S3PA 2MLEC 1F4OA 4MEWA 3LL8B 1LA3A 1NPQA 4ETOA 3GK1A 1NCXA 5JJGA 2G9BA 1S36A 2KYCA 4HRGA 4D1EA 2BECA 4M2PA 4GGNA 1K90D 4AQJA 2MHHA 4WQ2A 4QJ3B 1OMDA 1CLLA 1MF8B 1J7OA 1IGVA 3AAJA 1G8IA 1YX7A 3WHUB 2KBMA 1MXLC 3CGAA 1XYDA 3LK0A 1KFUL 2LM5A 1K95A 1YR5A 2F33A 4A4CA 2BL0B 3HX4A 3EVVA 1C07A 1WLMA 1JF0A 3EK7A 1K94A 4YI8A 3PALA 4DUQA 4YGAA 1GJYA 1D1OA 1QX5B 1NUBA 4NDBA 2KGBC 2JPTA 1K9PA 2AMIA 2I2RE 1KK8B 3SG2A 5KSZA 2F3ZA 1DGUA 1J55A 1B9AA 4P5OE 2OS8C 3E3RA 1ZOTB 2FJUB 1AUIB 1MR8A 1S1EA 1WY9A 2Y4QA 2JQ6A 4XYNA 3D10A 3DVKA 1S6IA 1EJ3A 2LMTA 2K2FA 4GGFC 1OMVA 1QASA 3KHEA 1NCYA 1SPYA 3F45A 5DKNA 3NXAA 1CM4A 1NWDA 3NSKA 3BUXB 5F6TA 4N1FA 2V53A 3I5HC 2KAVA 3BUOB 1EH2A 3BOWA 1QV1A 1IH0A 2GGZA 3TDIA 3BUMB 5B8IB 4MZJA 1IWQA 5HKYA 1KCYA 2CT9A 4XJKB 1NP8A 2CCMA 1CLMA 2CNPA 1BLQA 1CDLA 1TCFA 1M45A 3KPXA 1KK8C 1J1DA 3ZNIA 4OV2A 1Y1AA 1BT6A 1WRZA 1IJ6A 1HT9A 2L98A 1TOPA 1ZUZA 1JUOA 1U5IA 3D0YB 1QVIY 4MZLA 1DF0B 4ORAB 1AK8A 4XJKA 5I2QA 4PCWA 1DJGA 4PE4A 1TIZA 2Q91A 1TNXA 2MAZA 4GUKA 4A4BA 1ZACA 1ZMZA 5HYDA 3BUNB 3SIAA 2L50A 2LVKA 3BYAA 3I5GB 4YGEB 3HCMA 2EGDA 2ZFDA 3AKAA 2MLFC 1KK7Y 2ZRTA 2K7OA 1CDPA 2JXCA 1M46A 3DVMA 1B7TY 4MZKA 2BCAA 2E30A 1NX3A 3FWBA 1KSMA 1N0YA 2D8NA 1SRAA 2GGMA 2L2EA 3CTNA 1KWOB 2JWWA 2LUXA 2BCBA 1FF1A 1Q80A 1M63B 1QLKA 2LLUA 1YURA 1IRJA 2LV7A 1QIWA 2MJWB 2QACA 3K21A 2ISDA 1AHRA 1CDMA 4WRIA 2I18A 4C0KA 2BKHB 3CZTX 2A4JA 1XFYO 2LVIA 2VRGA 2JT3A 1W7JB 1K2HA 2SASA 1MWNA 2JULA 2JTTA 1UP5A 3I5IB 3TS5B 2PVBA 1UHKA 2EHBA 3PATA 3AAKA 3JVTC 1EXRA 2H61A 3I5GC 3NSOA 1JF2A 2M3WA 3BUWB 1Y6WA 5FYXA 2NZ0A 3CS1A 4PHKA 1PRWA 3QRXA 1JFKA 2LP2A 3EK4A 1FBVA 4MLWA 4M2OA 4CFRA 1G4YR 3TDUA 1C7WA 1UWOA 1K9KA 1XFVO 1V1GA 2LLSA 5CSJA 2L0PA 1MXEA 1S6JA 1DJHA 3VGOA 1SR6C 2M7NA 1LVCD 3FIAA 3I5FB 1H8BA 4NQGA 1KWOC 5CSNA 1ALVA 2OS8B 3TDZA 4R1EA 4DCKA 2LP3A 1IQ3A 4C0JA 2H61C 4JQ0D 2WOSA 3OB2B 1QTXA 4BY5A 5DKQA 1LINA 1OZOA 2FCDA 1F8HA 1LXFC 1DJWA 1HQVA 1QIVA 2PSRA 3OX5A 3I5HB 1Y1UA 3DVEA 4YGCB 2K7BA 4DRWA 1B8CA 1BJFA 3I5IC 3TS5C 1FI6A 1H4BA 2NCPA 2BBMA 2LMUA 2K8MB 1KFXS 1YUSA 4GGFA 5I2LA 1WDCB 2KHNA 1OZSA 2KBIA 1K96A 3KO0A 1DJZA 3CR2A 4QJ4B 1SL8A 1NX2A 1S6CA 1W7IB 1DMOA 1SL7A 3PLFB 2KGRA 1CFCA 3EKHA 3I5FC 1PVAA 3IF7A 2F2OA 3RLZA 2PALA 3VRNA 5BPJA 2KYFA 2M7LA 2JNXA 2KI6C 1ALWA 1CM1A 2H2KA 2KFHA 5IBWA 3IQQA 1IJ5A 2RGIA 4HRHA 5D7FA 1WRKA 1B47A 1KFXL 4FQOA 2PMYA 1XFZO 2ZRSA 2G2BA 2I94A 2M29A 4DIRA 1B4CA 2P6BB 1WLZA 3DVJA 1A03A 2KSPA 2TN4A 3SG6A 1A4PA 1J7RA 1N2DA 1R6PA 2NXQA 2LHIA 5HKZA 3JTDB 1SW8A 5AANA 1J1EA 2L4IA 1WDCC 3TUYB 1FI5A 1X02A 3MSEB 1BU3A 4CFQA 1XFWO 2IS9A 4NDCA 4C0LA 2PRUA 5I2OA 1EG3A 4OKHA 1PULA 3CR4X 3LCPC 2KQYA 1GQMA 4YGBB 1CTRA 2NLNA 1PK0D 1TNQA 1LKJA 3PM8A 2AUCA 2K2AA 2M9GA 5GQQC 1WRLA 1RWYA 5KU1A 3GK4X 1YVLA 2JT8A 1K9UA 2MA2A 1UUSA 1DJXA 3CWGA 2OPOA 3LLEA 4YI9A 3GOFA 1RJVA 1ODBA 1VRKA 3JVTB 1BG1A 4OVNF 4L9MA 3ZWHA 1CNPA 3EVRA 1F4QA 1SNLA 3DD4A 1RFJA 3D0YA 1JWDA 2JZIA 4PE1A 1DF0A 1RROA 2KDHA 3BQ3A 3JTDC 4HSZA 2KAYA 1QX7A 3TUYC 2KAXA 2E6WA 1BF5A 4MN0A 2EC6C 3EK8A 1YTZC 1SR6B 2Y1NA 3FS7A 5ER4X 5AERA 2JT0A 2LC5A 4PHNA 2WCEA 1CFPA 2JNFA 1NCZA 2HF5A 1SY9A 2LAPA 2WC8A 5DKRA 1AP4A 1TTXA 5AFPA 1UHHA 1B1GA 4MVFA 2CBLA 2B1UA 4WQ3A 5HKWA 1S5GZ 3SG7A 2KQ6A 4E68A 1CB1A 2M1KB 2HETA 1GGWA 1B8LA 1YVHA 2Y5IA 1QV0A 1F55A 1A2XA 2BE6A 2R2IA 3OB1B 3PN7C 3EKJA 3OX6A 4ZCVA 1OOJA 1F54A 4OCIA 2CTNA 2WCBA 2HPSA 1NSHA 1E8AA 1IG5A 2ZNEA 4PALA 3A4UB 2F8PA 1NYAA 1ZFSA 1KQVA 3KEVA 1A29A 1NX1A 1OQPA 1XVJA 2K0JA 1CKKA 2JC2A 2LE9B 4ORBB 5CSIA 3WNXB 2BCXA 3DF0B 2FOTA 1N65A 1YRUB 1DJYA 1RK9A 1KFUS 1A75B 3O6BA 3A8RA 4GFTA 2JRFA 3VROA 4PDZA 4ZCUA 5K89A 3NSLA 1TRFA 2QPTA 4HREE 1CFFA 3C1VA 1YX8A 2AAOA 4M2QA 1XFXO 1TCOB 4QJ5B 5J3XA 2HQ8A 1QLSA 1SMGA 1XFUO 4PE7A 3DF0A 5TNCA 1BR1B 3OP0A 4OR9B 3SJSA 1XK4C 1CFDA 1A75A 1UHNA 2KOTA 1UHIA 1AJ5A 3GK2A 2L5XB 2OTGB 1FPWA 3KF9A 2ZKMX 5JOLA 1QATA 1IQ5A 2KFFA 3NSIA 2I7AA
chains in the Genus database with same CATH superfamily
1NX0A 3VRRA 4U8DA 1TNWA 3FE9A 1KSOA 5AXIA 3SG5A 1EL4A 4PHMA 2JU0A 2KLEA 4GBAA 3CLNA 2JTZA 4YGDB 1IKUA 2L51A 4JWQA 4GNKB 3LK1A 2JXLA 3BJHA 1BR4B 1YRTB 1F70A 2BBNA 5FI6A 4YRUA 1SCMB 2L4HA 1BODA 3O4YA 3CYZA 1SL9A 2BE4A 2LUCA 1CMFA 2LANA 5G08A 4AQIA 1TN4A 5HLVA 1MQ1A 2KFGA 4CPVA 2LNKA 4DS7A 4F0ZB 1PVBA 3S0EA 5D69A 2O60A 1JFJA 5AEQA 1FW4A 4I5JA 4P2YB 2F3YA 4MSPA 1DGVA 3SG3A 3TZ1A 2LLTA 2HQWA 4YBHB 1CDNA 4CLNA 2ZN9A 2KNEA 2OTGC 1JC2A 1DVIA 1XO5A 1B8RA 1UURA 1YUUA 3WHTB 4ICBA 2EC6B 4KYNA 3BOWB 1UHJA 2NCOA 1PSRA 2P70A 3B88A 1R2UA 2Q4UA 1DC1A 1L2OB 1QS7A 1J7QA 3RM1A 3OHMB 2MRDA 1DTLA 3O78A 4I5NB 1C7VA 1XA5A 1OMRA 4ORCB 3L4LA 4GAOA 1F71A 1Y1XA 2CXJA 5CPVA 1NIWA 3H4SE 1QVIZ 2BL0C 2BNXA 3BXKA 3DYEA 3IQOA 4IL1A 4MRYA 4UPGA 1MHOA 1SCMC 1SKTA 2LVVA 2K7CA 4PE0A 2M97A 3V2LA 1OOHA 5KTYA 1PALA 2WNDA 1DJIA 1U5IB 5D3OA 1GM0A 2JPOA 4FTGA 2LCPA 4USLA 4TNCA 3Q8IA 2KI4B 2M1UA 1RECA 3O2PA 1KK7Z 4I5KA 1Z4HA 1B7TZ 3PN7B 2YGUA 2ZNDA 1M31A 1Y0VH 1BMOA 1QX2A 3SIBA 3VRPA 1RTP1 5ER5A 2KLDA 1G33A 1SCVA 3AKBA 3OBVA 4Q04A 5HLOA 3VRQA 2F2PA 1JBAA 2WCFA 1BOCA 2LMVA 3PFVA 1V1FA 1AVSA 2L5YA 1L2OC 2LVJA 2SCPA 4PHJA 3S0DA 1KQMB 2WORA 1TNPA 1M39A 4INWA 3WXAA 1YUTA 1LA0A 3CR5X 1QXPA 2JOJA 4NDDA 2KI6D 1OSAA 2M8UA 2FCEA 2GV5A 3ICBA 4GPLB 2MBXA 3EVUA 3SG4A 1QJTA 2ZN8A 4AOMA 1PSBA 2LHLA 1J7PA 3D74A 5CSFA 1SYMA 1EG4A 2KI4C 5I8NA 3CZ0A 3PM2A 3B6XA 2PQLA 1K93D 4BY4A 1CMGA 4CIDA 1AJ4A 1OE9B 3PSRA 1TUJA 1L7ZA 1S26D 4N5XA 2BKIB 5PALA 1XK4A 1CLBA 1DT7B 2DOQA 3FWCA 2COLB 2K7DA 1OOFA 2M0RA 1K8UA 1SBJA 1SK6D 2M49B 4N1GA 1KQMC 1S5GY 2PASA 3SS4A 4I5LB 4MBEA 2PYQA 2Y1MA 3SS3A 1GGZA 2K61A 2WCLA 4JPZB 4MRXA 1MUXA 3M0WA 1JSAA 2O5GA 2H8VA 1S3PA 2MLEC 1F4OA 4MEWA 3LL8B 1LA3A 1NPQA 4ETOA 1LS8A 3GK1A 3CZ1A 1NCXA 5JJGA 2G9BA 1S36A 1DELA 2KYCA 4HRGA 3D73A 3D78A 3R72A 4D1EA 2BECA 4M2PA 4GGNA 1K90D 4AQJA 2MHHA 4WQ2A 4QJ3B 1OMDA 1Z2CB 1CLLA 1MF8B 2ERBA 1J7OA 1IGVA 3AAJA 1G8IA 1YX7A 3WHUB 2KBMA 2P71A 1MXLC 3S0AA 3CGAA 1XYDA 2FJYA 3LK0A 1KFUL 2LM5A 1K95A 1YR5A 2F33A 4A4CA 2BL0B 1ORGA 3HX4A 3EVVA 1C07A 1WLMA 3CZ2A 1JF0A 3EK7A 1K94A 4YI8A 3PALA 4DUQA 3D75A 4YGAA 1GJYA 1C3ZA 3S0GA 1D1OA 1QX5B 1NUBA 3OGNA 4NDBA 2KGBC 2JPTA 4F7FA 1K9PA 2AMIA 2I2RE 1KK8B 3SG2A 5KSZA 2F3ZA 1DGUA 1J55A 1B9AA 4P5OE 2OS8C 3E3RA 1ZOTB 2FJUB 1AUIB 1MR8A 1S1EA 1WY9A 2Y4QA 2JQ6A 1TUZA 4IJ7A 4XYNA 5DICA 3D10A 3DVKA 1S6IA 1EJ3A 2LMTA 2K2FA 4GGFC 1OMVA 1QASA 3KHEA 1NCYA 3CDNA 1SPYA 3F45A 5DKNA 3NXAA 1CM4A 1NWDA 3NSKA 3BUXB 2BAPA 5EL2A 5F6TA 4N1FA 2V53A 3I5HC 3NHTA 4PT1A 2KAVA 3BUOB 1EH2A 3BFBA 3RZSA 3BOWA 1QV1A 1OOGA 2QEHA 1B4CA 1IH0A 2GGZA 3TDIA 3BUMB 5B8IB 4MZJA 1IWQA 5HKYA 1KCYA 2CT9A 4XJKB 1NP8A 2CCMA 1CLMA 2CNPA 3K1EA 1BLQA 1CDLA 1TCFA 1M45A 3KPXA 1KK8C 4JKTA 1J1DA 3ZNIA 4OV2A 1Y1AA 1BT6A 1WRZA 1IJ6A 1HT9A 2L98A 1TOPA 1ZUZA 1JUOA 1U5IA 3D0YB 1QVIY 3DY9A 4MZLA 1DF0B 1IIOA 4ORAB 5I94A 1AK8A 4XJKA 5I2QA 4PCWA 1DJGA 4PE4A 1TIZA 2Q91A 1TNXA 2MAZA 4GUKA 4A4BA 1ZACA 1ZMZA 3BFHA 3BUNB 5HYDA 4FQTA 3SIAA 2L50A 2LVKA 3BYAA 3I5GB 4YGEB 3HCMA 2EGDA 2ZFDA 3AKAA 2MLFC 1KK7Y 2ZRTA 2K7OA 1CDPA 2JXCA 3BFAA 3R1OA 1M46A 3DVMA 1B7TY 4MZKA 2BCAA 2E30A 1NX3A 3FWBA 1KSMA 1N0YA 2D8NA 1SRAA 2GGMA 2L2EA 3CTNA 1KWOB 2JWWA 2LUXA 2BCBA 1FF1A 1Q80A 1M63B 1QLKA 2LLUA 1YURA 1IRJA 2LV7A 1QIWA 2MJWB 2QACA 3K21A 2ISDA 1AHRA 1CDMA 1C3YA 4WRIA 2I18A 4C0KA 2BKHB 3CZTX 2A4JA 1XFYO 2LVIA 2VRGA 2JT3A 1W7JB 4OZDA 1K2HA 2SASA 1MWNA 2JULA 2JTTA 1UP5A 3UNWA 3I5IB 3TS5B 2PVBA 1UHKA 2EHBA 3PATA 3AAKA 3JVTC 1EXRA 2H61A 3I5GC 3NSOA 1JF2A 2M3WA 3BUWB 1Y6WA 3B87A 5FYXA 2NZ0A 3CS1A 4PHKA 1PRWA 3QRXA 1JFKA 2LP2A 3EK4A 1FBVA 4MLWA 4M2OA 3UO9A 1G4YR 5FI7A 1C7WA 1UWOA 1K9KA 1XFVO 1V1GA 3TDUA 2LLSA 3S0FA 5CSJA 2L0PA 1MXEA 1S6JA 4CFRA 1DJHA 3VGOA 1XFRA 1SR6C 2M7NA 1LVCD 3FIAA 3I5FB 1H8BA 4NQGA 1KWOC 5CSNA 1ALVA 2OS8B 3TDZA 4R1EA 4DCKA 2LP3A 1IQ3A 4C0JA 2H61C 4JQ0D 2WOSA 3OB2B 1QTXA 3D77A 4BY5A 5DKQA 1TWOA 1LINA 1OZOA 2FCDA 1F8HA 1LXFC 1DJWA 1HQVA 1QIVA 2PSRA 3OX5A 3I5HB 1Y1UA 1OW4A 3DVEA 2K7BA 4YGCB 3VB1A 4DRWA 1B8CA 1BJFA 3I5IC 2KPHA 3TS5C 1FI6A 1H4BA 2WCMA 2NCPA 2BBMA 2LMUA 1SSEB 1KFXS 2K8MB 2QEOA 1YUSA 3NGVA 4GGFA 5I2LA 1WDCB 2KHNA 1OZSA 2KBIA 1K96A 2K60A 3KO0A 1DJZA 3CR2A 4QJ4B 1SL8A 1NX2A 1S6CA 1W7IB 1DMOA 3QMEA 1SL7A 3PLFB 2KGRA 1CFCA 3EKHA 3FE6A 3I5FC 1PVAA 3IF7A 2F2OA 3RLZA 2PALA 3VRNA 5FI2A 5BPJA 3B7AA 1OOIX 2KYFA 2M7LA 2JNXA 2KI6C 1ALWA 1CM1A 2H2KA 2KFHA 5IBWA 3IQQA 1IJ5A 2RGIA 4HRHA 5D7FA 1WRKA 1B47A 1KFXL 4FQOA 2PMYA 1XFZO 2ZRSA 2G2BA 2GTEA 2I94A 2M29A 4DIRA 2P6BB 1WLZA 3DVJA 4JD9A 1A03A 2KSPA 2TN4A 3SG6A 1A4PA 1J7RA 1N2DA 1R6PA 2NXQA 2LHIA 5HKZA 3DZTA 3R1VA 3JTDB 1SW8A 5AANA 1J1EA 4INXA 2L4IA 1WDCC 3TUYB 1FI5A 1X02A 2WCHA 3MSEB 1BU3A 4CFQA 1DQEA 3R1PA 3PJIA 1DEKA 3SS5A 1XFWO 2IS9A 4NDCA 4C0LA 2PRUA 5I2OA 3CABA 1EG3A 4OKHA 1PULA 3CR4X 3LCPC 2KQYA 1GQMA 1T14A 4YGBB 1CTRA 2NLNA 5HL1A 1PK0D 1TNQA 1LKJA 3PM8A 2AUCA 2K2AA 2M9GA 2QEVA 1WRLA 5GQQC 1RWYA 5KU1A 3GK4X 1YVLA 2JT8A 1K9UA 2MA2A 1UUSA 1DJXA 3EG5B 3CWGA 2OPOA 3LLEA 4YI9A 3NHIA 3GOFA 1RJVA 1ODBA 1VRKA 3JVTB 1BG1A 4OVNF 4L9MA 3ZWHA 1CNPA 3EVRA 1F4QA 1SNLA 3DD4A 1RFJA 3D0YA 1JWDA 2JZIA 4PE1A 1DF0A 1RROA 2KDHA 3BQ3A 3JTDC 4HSZA 2KAYA 1QX7A 3TUYC 2KAXA 2E6WA 3L4AA 2QEBA 1BF5A 4MN0A 2EC6C 3EK8A 1YTZC 1SR6B 3O4XA 2Y1NA 3FS7A 5ER4X 5AERA 2JT0A 2LC5A 4PHNA 2WCEA 1CFPA 2JNFA 1NCZA 2HF5A 1SY9A 2LAPA 2WC8A 3DXLA 5DKRA 1AP4A 2WCJA 1TTXA 2WC5A 5AFPA 1UHHA 1W9ZA 3B86A 4MVFA 2CBLA 2B1UA 1B1GA 4WQ3A 5HKWA 1S5GZ 1QWVA 3SG7A 2KQ6A 4E68A 1CB1A 2M1KB 2HETA 3N7HA 1GGWA 1B8LA 1YVHA 2Y5IA 1QV0A 1F55A 1A2XA 2BE6A 2R2IA 3OB1B 3PN7C 3EKJA 3OX6A 2WC6A 1OOJA 4ZCVA 4OCIA 1F54A 2CTNA 2WCBA 2HPSA 1NSHA 1E8AA 1IG5A 2ZNEA 4PALA 3A4UB 2F8PA 1NYAA 1ZFSA 1KQVA 3KEVA 1A29A 1NX1A 1OQPA 1XVJA 2K0JA 1CKKA 2JC2A 2LE9B 4ORBB 5CSIA 3WNXB 2BCXA 3DF0B 2FOTA 1N65A 1YRUB 1DJYA 1RK9A 1KFUS 1A75B 3IVTA 3A8RA 3O6BA 2JRFA 4GFTA 3VROA 4PDZA 4ZCUA 5K89A 3NSLA 1TRFA 2QPTA 4HREE 1CFFA 3C1VA 3FE8A 1YX8A 2AAOA 4M2QA 1XFXO 1TCOB 4QJ5B 5J3XA 2HQ8A 2L2CA 3S0BA 1QLSA 1SMGA 1XFUO 3D76A 3DF0A 4PE7A 1BR1B 3OP0A 4OR9B 5TNCA 3SJSA 1XK4C 1CFDA 3L47A 1A75A 2WCKA 1UHNA 2KOTA 1P28A 1UHIA 1AJ5A 3GK2A 2L5XB 2OTGB 1FPWA 3KF9A 2ZKMX 5JOLA 2QDIA 1QATA 1IQ5A 2KFFA 3NSIA 2I7AA
chains in the Genus database with same CATH topology
1NX0A 3VRRA 4U8DA 1TNWA 1KSOA 5AXIA 3SG5A 1EL4A 4PHMA 2JU0A 4GBAA 3CLNA 2JTZA 4YGDB 1IKUA 2L51A 4JWQA 4GNKB 3LK1A 2JXLA 1BR4B 1YRTB 1F70A 2BBNA 4YRUA 1SCMB 2L4HA 1BODA 3O4YA 1CMFA 1SL9A 2BE4A 2LUCA 2LANA 5G08A 4AQIA 1TN4A 5HLVA 1MQ1A 2KFGA 4CPVA 2LNKA 4DS7A 4F0ZB 1PVBA 5D69A 2O60A 1JFJA 5AEQA 1FW4A 4I5JA 4P2YB 2F3YA 4MSPA 1DGVA 3SG3A 3TZ1A 2LLTA 2HQWA 4YBHB 1CDNA 4CLNA 2ZN9A 2KNEA 2OTGC 1JC2A 1DVIA 1XO5A 1B8RA 1UURA 1YUUA 3WHTB 4ICBA 2EC6B 3BOWB 1UHJA 2NCOA 1PSRA 1R2UA 2Q4UA 1L2OB 1QS7A 1J7QA 3RM1A 3OHMB 2MRDA 1DTLA 3O78A 4I5NB 1C7VA 1XA5A 1OMRA 4ORCB 4GAOA 1F71A 1Y1XA 2CXJA 5CPVA 1NIWA 3H4SE 1QVIZ 2BL0C 3BXKA 3IQOA 4IL1A 4MRYA 4UPGA 1MHOA 1SCMC 1SKTA 2LVVA 2K7CA 4PE0A 2M97A 5KTYA 1PALA 2WNDA 1DJIA 1U5IB 4FTGA 2LCPA 4USLA 4TNCA 2KI4B 2M1UA 1RECA 3O2PA 1KK7Z 4I5KA 1B7TZ 3PN7B 2ZNDA 1M31A 1Y0VH 1BMOA 1QX2A 3SIBA 3VRPA 1RTP1 5ER5A 3AKBA 1G33A 1SCVA 5HLOA 3VRQA 4Q04A 2F2PA 1JBAA 2WCFA 1BOCA 2LMVA 3PFVA 1V1FA 1AVSA 1L2OC 2LVJA 2SCPA 4PHJA 1KQMB 2WORA 1TNPA 1M39A 3WXAA 1YUTA 1LA0A 3CR5X 1QXPA 2JOJA 4NDDA 2KI6D 1OSAA 2M8UA 2FCEA 2GV5A 3ICBA 4GPLB 2MBXA 3EVUA 3SG4A 1QJTA 2ZN8A 4AOMA 1PSBA 2LHLA 1J7PA 5CSFA 1SYMA 1EG4A 2KI4C 5I8NA 1K93D 4BY4A 1CMGA 4CIDA 1AJ4A 1OE9B 3PSRA 1L7ZA 1S26D 4N5XA 2BKIB 5PALA 1XK4A 1CLBA 1DT7B 2DOQA 3FWCA 2COLB 2K7DA 2M0RA 1K8UA 1SBJA 1SK6D 2M49B 4N1GA 1KQMC 1S5GY 2PASA 4I5LB 4MBEA 2Y1MA 1GGZA 2K61A 4JPZB 4MRXA 1MUXA 3M0WA 1JSAA 2O5GA 1S3PA 2MLEC 1F4OA 4MEWA 3LL8B 1LA3A 1NPQA 4ETOA 3GK1A 1NCXA 5JJGA 2G9BA 1S36A 2KYCA 4HRGA 4D1EA 2BECA 4M2PA 4GGNA 1K90D 4AQJA 2MHHA 4WQ2A 4QJ3B 1OMDA 1CLLA 1MF8B 1J7OA 1IGVA 3AAJA 1G8IA 1YX7A 3WHUB 2KBMA 1MXLC 3CGAA 1XYDA 3LK0A 1KFUL 2LM5A 1K95A 1YR5A 2F33A 4A4CA 2BL0B 3HX4A 3EVVA 1C07A 1WLMA 1JF0A 3EK7A 1K94A 4YI8A 3PALA 4DUQA 4YGAA 1GJYA 1D1OA 1QX5B 1NUBA 4NDBA 2KGBC 2JPTA 1K9PA 2AMIA 2I2RE 1KK8B 3SG2A 5KSZA 2F3ZA 1DGUA 1J55A 1B9AA 4P5OE 2OS8C 3E3RA 1ZOTB 2FJUB 1AUIB 1MR8A 1S1EA 1WY9A 2Y4QA 2JQ6A 4XYNA 3D10A 3DVKA 1S6IA 1EJ3A 2LMTA 2K2FA 4GGFC 1OMVA 1QASA 3KHEA 1NCYA 1SPYA 3F45A 5DKNA 3NXAA 1CM4A 1NWDA 3NSKA 3BUXB 5F6TA 4N1FA 2V53A 3I5HC 2KAVA 3BUOB 1EH2A 3BOWA 1QV1A 1IH0A 2GGZA 3TDIA 3BUMB 5B8IB 4MZJA 1IWQA 5HKYA 1KCYA 2CT9A 4XJKB 1NP8A 2CCMA 1CLMA 2CNPA 1BLQA 1CDLA 1TCFA 1M45A 3KPXA 1KK8C 1J1DA 3ZNIA 4OV2A 1Y1AA 1BT6A 1WRZA 1IJ6A 1HT9A 2L98A 1TOPA 1ZUZA 1JUOA 1U5IA 3D0YB 1QVIY 4MZLA 1DF0B 4ORAB 1AK8A 4XJKA 5I2QA 4PCWA 1DJGA 4PE4A 1TIZA 2Q91A 1TNXA 2MAZA 4GUKA 4A4BA 1ZACA 1ZMZA 5HYDA 3BUNB 3SIAA 2L50A 2LVKA 3BYAA 3I5GB 4YGEB 3HCMA 2EGDA 2ZFDA 3AKAA 2MLFC 1KK7Y 2ZRTA 2K7OA 1CDPA 2JXCA 1M46A 3DVMA 1B7TY 4MZKA 2BCAA 2E30A 1NX3A 3FWBA 1KSMA 1N0YA 2D8NA 1SRAA 2GGMA 2L2EA 3CTNA 1KWOB 2JWWA 2LUXA 2BCBA 1FF1A 1Q80A 1M63B 1QLKA 2LLUA 1YURA 1IRJA 2LV7A 1QIWA 2MJWB 2QACA 3K21A 2ISDA 1AHRA 1CDMA 4WRIA 2I18A 4C0KA 2BKHB 3CZTX 2A4JA 1XFYO 2LVIA 2VRGA 2JT3A 1W7JB 1K2HA 2SASA 1MWNA 2JULA 2JTTA 1UP5A 3I5IB 3TS5B 2PVBA 1UHKA 2EHBA 3PATA 3AAKA 3JVTC 1EXRA 2H61A 3I5GC 3NSOA 1JF2A 2M3WA 3BUWB 1Y6WA 5FYXA 2NZ0A 3CS1A 4PHKA 1PRWA 3QRXA 1JFKA 2LP2A 3EK4A 1FBVA 4MLWA 4M2OA 4CFRA 1G4YR 3TDUA 1C7WA 1UWOA 1K9KA 1XFVO 1V1GA 2LLSA 5CSJA 2L0PA 1MXEA 1S6JA 1DJHA 3VGOA 1SR6C 2M7NA 1LVCD 3FIAA 3I5FB 1H8BA 4NQGA 1KWOC 5CSNA 1ALVA 2OS8B 3TDZA 4R1EA 4DCKA 2LP3A 1IQ3A 4C0JA 2H61C 4JQ0D 2WOSA 3OB2B 1QTXA 4BY5A 5DKQA 1LINA 1OZOA 2FCDA 1F8HA 1LXFC 1DJWA 1HQVA 1QIVA 2PSRA 3OX5A 3I5HB 1Y1UA 3DVEA 4YGCB 2K7BA 4DRWA 1B8CA 1BJFA 3I5IC 3TS5C 1FI6A 1H4BA 2NCPA 2BBMA 2LMUA 2K8MB 1KFXS 1YUSA 4GGFA 5I2LA 1WDCB 2KHNA 1OZSA 2KBIA 1K96A 3KO0A 1DJZA 3CR2A 4QJ4B 1SL8A 1NX2A 1S6CA 1W7IB 1DMOA 1SL7A 3PLFB 2KGRA 1CFCA 3EKHA 3I5FC 1PVAA 3IF7A 2F2OA 3RLZA 2PALA 3VRNA 5BPJA 2KYFA 2M7LA 2JNXA 2KI6C 1ALWA 1CM1A 2H2KA 2KFHA 5IBWA 3IQQA 1IJ5A 2RGIA 4HRHA 5D7FA 1WRKA 1B47A 1KFXL 4FQOA 2PMYA 1XFZO 2ZRSA 2G2BA 2I94A 2M29A 4DIRA 1B4CA 2P6BB 1WLZA 3DVJA 1A03A 2KSPA 2TN4A 3SG6A 1A4PA 1J7RA 1N2DA 1R6PA 2NXQA 2LHIA 5HKZA 3JTDB 1SW8A 5AANA 1J1EA 2L4IA 1WDCC 3TUYB 1FI5A 1X02A 3MSEB 1BU3A 4CFQA 1XFWO 2IS9A 4NDCA 4C0LA 2PRUA 5I2OA 1EG3A 4OKHA 1PULA 3CR4X 3LCPC 2KQYA 1GQMA 4YGBB 1CTRA 2NLNA 1PK0D 1TNQA 1LKJA 3PM8A 2AUCA 2K2AA 2M9GA 5GQQC 1WRLA 1RWYA 5KU1A 3GK4X 1YVLA 2JT8A 1K9UA 2MA2A 1UUSA 1DJXA 3CWGA 2OPOA 3LLEA 4YI9A 3GOFA 1RJVA 1ODBA 1VRKA 3JVTB 1BG1A 4OVNF 4L9MA 3ZWHA 1CNPA 3EVRA 1F4QA 1SNLA 3DD4A 1RFJA 3D0YA 1JWDA 2JZIA 4PE1A 1DF0A 1RROA 2KDHA 3BQ3A 3JTDC 4HSZA 2KAYA 1QX7A 3TUYC 2KAXA 2E6WA 1BF5A 4MN0A 2EC6C 3EK8A 1YTZC 1SR6B 2Y1NA 3FS7A 5ER4X 5AERA 2JT0A 2LC5A 4PHNA 2WCEA 1CFPA 2JNFA 1NCZA 2HF5A 1SY9A 2LAPA 2WC8A 5DKRA 1AP4A 1TTXA 5AFPA 1UHHA 1B1GA 4MVFA 2CBLA 2B1UA 4WQ3A 5HKWA 1S5GZ 3SG7A 2KQ6A 4E68A 1CB1A 2M1KB 2HETA 1GGWA 1B8LA 1YVHA 2Y5IA 1QV0A 1F55A 1A2XA 2BE6A 2R2IA 3OB1B 3PN7C 3EKJA 3OX6A 4ZCVA 1OOJA 1F54A 4OCIA 2CTNA 2WCBA 2HPSA 1NSHA 1E8AA 1IG5A 2ZNEA 4PALA 3A4UB 2F8PA 1NYAA 1ZFSA 1KQVA 3KEVA 1A29A 1NX1A 1OQPA 1XVJA 2K0JA 1CKKA 2JC2A 2LE9B 4ORBB 5CSIA 3WNXB 2BCXA 3DF0B 2FOTA 1N65A 1YRUB 1DJYA 1RK9A 1KFUS 1A75B 3O6BA 3A8RA 4GFTA 2JRFA 3VROA 4PDZA 4ZCUA 5K89A 3NSLA 1TRFA 2QPTA 4HREE 1CFFA 3C1VA 1YX8A 2AAOA 4M2QA 1XFXO 1TCOB 4QJ5B 5J3XA 2HQ8A 1QLSA 1SMGA 1XFUO 4PE7A 3DF0A 5TNCA 1BR1B 3OP0A 4OR9B 3SJSA 1XK4C 1CFDA 1A75A 1UHNA 2KOTA 1UHIA 1AJ5A 3GK2A 2L5XB 2OTGB 1FPWA 3KF9A 2ZKMX 5JOLA 1QATA 1IQ5A 2KFFA 3NSIA 2I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX0 A;  3VRR A;  4U8D A;  1TNW A;  1KSO A;  5AXI A;  3SG5 A;  1EL4 A;  4PHM A;  2JU0 A;  4GBA A;  3CLN A;  2JTZ A;  4YGD B;  1IKU A;  2L51 A;  4JWQ A;  4GNK B;  3LK1 A;  2JXL A;  1BR4 B;  1YRT B;  1F70 A;  2BBN A;  4YRU A;  1SCM B;  2L4H A;  1BOD A;  3O4Y A;  1CMF A;  1SL9 A;  2BE4 A;  2LUC A;  2LAN A;  5G08 A;  4AQI A;  1TN4 A;  5HLV A;  1MQ1 A;  2KFG A;  4CPV A;  2LNK A;  4DS7 A;  4F0Z B;  1PVB A;  5D69 A;  2O60 A;  1JFJ A;  5AEQ A;  1FW4 A;  4I5J A;  4P2Y B;  2F3Y A;  4MSP A;  1DGV A;  3SG3 A;  3TZ1 A;  2LLT A;  2HQW A;  4YBH B;  1CDN A;  4CLN A;  2ZN9 A;  2KNE A;  2OTG C;  1JC2 A;  1DVI A;  1XO5 A;  1B8R A;  1UUR A;  1YUU A;  3WHT B;  4ICB A;  2EC6 B;  3BOW B;  1UHJ A;  2NCO A;  1PSR A;  1R2U A;  2Q4U A;  1L2O B;  1QS7 A;  1J7Q A;  3RM1 A;  3OHM B;  2MRD A;  1DTL A;  3O78 A;  4I5N B;  1C7V A;  1XA5 A;  1OMR A;  4ORC B;  4GAO A;  1F71 A;  1Y1X A;  2CXJ A;  5CPV A;  1NIW A;  3H4S E;  1QVI Z;  2BL0 C;  3BXK A;  3IQO A;  4IL1 A;  4MRY A;  4UPG A;  1MHO A;  1SCM C;  1SKT A;  2LVV A;  2K7C A;  4PE0 A;  2M97 A;  5KTY A;  1PAL A;  2WND A;  1DJI A;  1U5I B;  4FTG A;  2LCP A;  4USL A;  4TNC A;  2KI4 B;  2M1U A;  1REC A;  3O2P A;  1KK7 Z;  4I5K A;  1B7T Z;  3PN7 B;  2ZND A;  1M31 A;  1Y0V H;  1BMO A;  1QX2 A;  3SIB A;  3VRP A;  1RTP 1;  5ER5 A;  3AKB A;  1G33 A;  1SCV A;  5HLO A;  3VRQ A;  4Q04 A;  2F2P A;  1JBA A;  2WCF A;  1BOC A;  2LMV A;  3PFV A;  1V1F A;  1AVS A;  1L2O C;  2LVJ A;  2SCP A;  4PHJ A;  1KQM B;  2WOR A;  1TNP A;  1M39 A;  3WXA A;  1YUT A;  1LA0 A;  3CR5 X;  1QXP A;  2JOJ A;  4NDD A;  2KI6 D;  1OSA A;  2M8U A;  2FCE A;  2GV5 A;  3ICB A;  4GPL B;  2MBX A;  3EVU A;  3SG4 A;  1QJT A;  2ZN8 A;  4AOM A;  1PSB A;  2LHL A;  1J7P A;  5CSF A;  1SYM A;  1EG4 A;  2KI4 C;  5I8N A;  1K93 D;  4BY4 A;  1CMG A;  4CID A;  1AJ4 A;  1OE9 B;  3PSR A;  1L7Z A;  1S26 D;  4N5X A;  2BKI B;  5PAL A;  1XK4 A;  1CLB A;  1DT7 B;  2DOQ A;  3FWC A;  2COL B;  2K7D A;  2M0R A;  1K8U A;  1SBJ A;  1SK6 D;  2M49 B;  4N1G A;  1KQM C;  1S5G Y;  2PAS A;  4I5L B;  4MBE A;  2Y1M A;  1GGZ A;  2K61 A;  4JPZ B;  4MRX A;  1MUX A;  3M0W A;  1JSA A;  2O5G A;  1S3P A;  2MLE C;  1F4O A;  4MEW A;  3LL8 B;  1LA3 A;  1NPQ A;  4ETO A;  3GK1 A;  1NCX A;  5JJG A;  2G9B A;  1S36 A;  2KYC A;  4HRG A;  4D1E A;  2BEC A;  4M2P A;  4GGN A;  1K90 D;  4AQJ A;  2MHH A;  4WQ2 A;  4QJ3 B;  1OMD A;  1CLL A;  1MF8 B;  1J7O A;  1IGV A;  3AAJ A;  1G8I A;  1YX7 A;  3WHU B;  2KBM A;  1MXL C;  3CGA A;  1XYD A;  3LK0 A;  1KFU L;  2LM5 A;  1K95 A;  1YR5 A;  2F33 A;  4A4C A;  2BL0 B;  3HX4 A;  3EVV A;  1C07 A;  1WLM A;  1JF0 A;  3EK7 A;  1K94 A;  4YI8 A;  3PAL A;  4DUQ A;  4YGA A;  1GJY A;  1D1O A;  1QX5 B;  1NUB A;  4NDB A;  2KGB C;  2JPT A;  1K9P A;  2AMI A;  2I2R E;  1KK8 B;  3SG2 A;  5KSZ A;  2F3Z A;  1DGU A;  1J55 A;  1B9A A;  4P5O E;  2OS8 C;  3E3R A;  1ZOT B;  2FJU B;  1AUI B;  1MR8 A;  1S1E A;  1WY9 A;  2Y4Q A;  2JQ6 A;  4XYN A;  3D10 A;  3DVK A;  1S6I A;  1EJ3 A;  2LMT A;  2K2F A;  4GGF C;  1OMV A;  1QAS A;  3KHE A;  1NCY A;  1SPY A;  3F45 A;  5DKN A;  3NXA A;  1CM4 A;  1NWD A;  3NSK A;  3BUX B;  5F6T A;  4N1F A;  2V53 A;  3I5H C;  2KAV A;  3BUO B;  1EH2 A;  3BOW A;  1QV1 A;  1IH0 A;  2GGZ A;  3TDI A;  3BUM B;  5B8I B;  4MZJ A;  1IWQ A;  5HKY A;  1KCY A;  2CT9 A;  4XJK B;  1NP8 A;  2CCM A;  1CLM A;  2CNP A;  1BLQ A;  1CDL A;  1TCF A;  1M45 A;  3KPX A;  1KK8 C;  1J1D A;  3ZNI A;  4OV2 A;  1Y1A A;  1BT6 A;  1WRZ A;  1IJ6 A;  1HT9 A;  2L98 A;  1TOP A;  1ZUZ A;  1JUO A;  1U5I A;  3D0Y B;  1QVI Y;  4MZL A;  1DF0 B;  4ORA B;  1AK8 A;  4XJK A;  5I2Q A;  4PCW A;  1DJG A;  4PE4 A;  1TIZ A;  2Q91 A;  1TNX A;  2MAZ A;  4GUK A;  4A4B A;  1ZAC A;  1ZMZ A;  5HYD A;  3BUN B;  3SIA A;  2L50 A;  2LVK A;  3BYA A;  3I5G B;  4YGE B;  3HCM A;  2EGD A;  2ZFD A;  3AKA A;  2MLF C;  1KK7 Y;  2ZRT A;  2K7O A;  1CDP A;  2JXC A;  1M46 A;  3DVM A;  1B7T Y;  4MZK A;  2BCA A;  2E30 A;  1NX3 A;  3FWB A;  1KSM A;  1N0Y A;  2D8N A;  1SRA A;  2GGM A;  2L2E A;  3CTN A;  1KWO B;  2JWW A;  2LUX A;  2BCB A;  1FF1 A;  1Q80 A;  1M63 B;  1QLK A;  2LLU A;  1YUR A;  1IRJ A;  2LV7 A;  1QIW A;  2MJW B;  2QAC A;  3K21 A;  2ISD A;  1AHR A;  1CDM A;  4WRI A;  2I18 A;  4C0K A;  2BKH B;  3CZT X;  2A4J A;  1XFY O;  2LVI A;  2VRG A;  2JT3 A;  1W7J B;  1K2H A;  2SAS A;  1MWN A;  2JUL A;  2JTT A;  1UP5 A;  3I5I B;  3TS5 B;  2PVB A;  1UHK A;  2EHB A;  3PAT A;  3AAK A;  3JVT C;  1EXR A;  2H61 A;  3I5G C;  3NSO A;  1JF2 A;  2M3W A;  3BUW B;  1Y6W A;  5FYX A;  2NZ0 A;  3CS1 A;  4PHK A;  1PRW A;  3QRX A;  1JFK A;  2LP2 A;  3EK4 A;  1FBV A;  4MLW A;  4M2O A;  4CFR A;  1G4Y R;  3TDU A;  1C7W A;  1UWO A;  1K9K A;  1XFV O;  1V1G A;  2LLS A;  5CSJ A;  2L0P A;  1MXE A;  1S6J A;  1DJH A;  3VGO A;  1SR6 C;  2M7N A;  1LVC D;  3FIA A;  3I5F B;  1H8B A;  4NQG A;  1KWO C;  5CSN A;  1ALV A;  2OS8 B;  3TDZ A;  4R1E A;  4DCK A;  2LP3 A;  1IQ3 A;  4C0J A;  2H61 C;  4JQ0 D;  2WOS A;  3OB2 B;  1QTX A;  4BY5 A;  5DKQ A;  1LIN A;  1OZO A;  2FCD A;  1F8H A;  1LXF C;  1DJW A;  1HQV A;  1QIV A;  2PSR A;  3OX5 A;  3I5H B;  1Y1U A;  3DVE A;  4YGC B;  2K7B A;  4DRW A;  1B8C A;  1BJF A;  3I5I C;  3TS5 C;  1FI6 A;  1H4B A;  2NCP A;  2BBM A;  2LMU A;  2K8M B;  1KFX S;  1YUS A;  4GGF A;  5I2L A;  1WDC B;  2KHN A;  1OZS A;  2KBI A;  1K96 A;  3KO0 A;  1DJZ A;  3CR2 A;  4QJ4 B;  1SL8 A;  1NX2 A;  1S6C A;  1W7I B;  1DMO A;  1SL7 A;  3PLF B;  2KGR A;  1CFC A;  3EKH A;  3I5F C;  1PVA A;  3IF7 A;  2F2O A;  3RLZ A;  2PAL A;  3VRN A;  5BPJ A;  2KYF A;  2M7L A;  2JNX A;  2KI6 C;  1ALW A;  1CM1 A;  2H2K A;  2KFH A;  5IBW A;  3IQQ A;  1IJ5 A;  2RGI A;  4HRH A;  5D7F A;  1WRK A;  1B47 A;  1KFX L;  4FQO A;  2PMY A;  1XFZ O;  2ZRS A;  2G2B A;  2I94 A;  2M29 A;  4DIR A;  1B4C A;  2P6B B;  1WLZ A;  3DVJ A;  1A03 A;  2KSP A;  2TN4 A;  3SG6 A;  1A4P A;  1J7R A;  1N2D A;  1R6P A;  2NXQ A;  2LHI A;  5HKZ A;  3JTD B;  1SW8 A;  5AAN A;  1J1E A;  2L4I A;  1WDC C;  3TUY B;  1FI5 A;  1X02 A;  3MSE B;  1BU3 A;  4CFQ A;  1XFW O;  2IS9 A;  4NDC A;  4C0L A;  2PRU A;  5I2O A;  1EG3 A;  4OKH A;  1PUL A;  3CR4 X;  3LCP C;  2KQY A;  1GQM A;  4YGB B;  1CTR A;  2NLN A;  1PK0 D;  1TNQ A;  1LKJ A;  3PM8 A;  2AUC A;  2K2A A;  2M9G A;  5GQQ C;  1WRL A;  1RWY A;  5KU1 A;  3GK4 X;  1YVL A;  2JT8 A;  1K9U A;  2MA2 A;  1UUS A;  1DJX A;  3CWG A;  2OPO A;  3LLE A;  4YI9 A;  3GOF A;  1RJV A;  1ODB A;  1VRK A;  3JVT B;  1BG1 A;  4OVN F;  4L9M A;  3ZWH A;  1CNP A;  3EVR A;  1F4Q A;  1SNL A;  3DD4 A;  1RFJ A;  3D0Y A;  1JWD A;  2JZI A;  4PE1 A;  1DF0 A;  1RRO A;  2KDH A;  3BQ3 A;  3JTD C;  4HSZ A;  2KAY A;  1QX7 A;  3TUY C;  2KAX A;  2E6W A;  1BF5 A;  4MN0 A;  2EC6 C;  3EK8 A;  1YTZ C;  1SR6 B;  2Y1N A;  3FS7 A;  5ER4 X;  5AER A;  2JT0 A;  2LC5 A;  4PHN A;  2WCE A;  1CFP A;  2JNF A;  1NCZ A;  2HF5 A;  1SY9 A;  2LAP A;  2WC8 A;  5DKR A;  1AP4 A;  1TTX A;  5AFP A;  1UHH A;  1B1G A;  4MVF A;  2CBL A;  2B1U A;  4WQ3 A;  5HKW A;  1S5G Z;  3SG7 A;  2KQ6 A;  4E68 A;  1CB1 A;  2M1K B;  2HET A;  1GGW A;  1B8L A;  1YVH A;  2Y5I A;  1QV0 A;  1F55 A;  1A2X A;  2BE6 A;  2R2I A;  3OB1 B;  3PN7 C;  3EKJ A;  3OX6 A;  4ZCV A;  1OOJ A;  1F54 A;  4OCI A;  2CTN A;  2WCB A;  2HPS A;  1NSH A;  1E8A A;  1IG5 A;  2ZNE A;  4PAL A;  3A4U B;  2F8P A;  1NYA A;  1ZFS A;  1KQV A;  3KEV A;  1A29 A;  1NX1 A;  1OQP A;  1XVJ A;  2K0J A;  1CKK A;  2JC2 A;  2LE9 B;  4ORB B;  5CSI A;  3WNX B;  2BCX A;  3DF0 B;  2FOT A;  1N65 A;  1YRU B;  1DJY A;  1RK9 A;  1KFU S;  1A75 B;  3O6B A;  3A8R A;  4GFT A;  2JRF A;  3VRO A;  4PDZ A;  4ZCU A;  5K89 A;  3NSL A;  1TRF A;  2QPT A;  4HRE E;  1CFF A;  3C1V A;  1YX8 A;  2AAO A;  4M2Q A;  1XFX O;  1TCO B;  4QJ5 B;  5J3X A;  2HQ8 A;  1QLS A;  1SMG A;  1XFU O;  4PE7 A;  3DF0 A;  5TNC A;  1BR1 B;  3OP0 A;  4OR9 B;  3SJS A;  1XK4 C;  1CFD A;  1A75 A;  1UHN A;  2KOT A;  1UHI A;  1AJ5 A;  3GK2 A;  2L5X B;  2OTG B;  1FPW A;  3KF9 A;  2ZKM X;  5JOL A;  1QAT A;  1IQ5 A;  2KFF A;  3NSI A;  2I7A A; 
#chains in the Genus database with same CATH topology
 1NX0 A;  3VRR A;  4U8D A;  1TNW A;  3FE9 A;  1KSO A;  5AXI A;  3SG5 A;  1EL4 A;  4PHM A;  2JU0 A;  2KLE A;  4GBA A;  3CLN A;  2JTZ A;  4YGD B;  1IKU A;  2L51 A;  4JWQ A;  4GNK B;  3LK1 A;  2JXL A;  3BJH A;  1BR4 B;  1YRT B;  1F70 A;  2BBN A;  5FI6 A;  4YRU A;  1SCM B;  2L4H A;  1BOD A;  3O4Y A;  3CYZ A;  1SL9 A;  2BE4 A;  2LUC A;  1CMF A;  2LAN A;  5G08 A;  4AQI A;  1TN4 A;  5HLV A;  1MQ1 A;  2KFG A;  4CPV A;  2LNK A;  4DS7 A;  4F0Z B;  1PVB A;  3S0E A;  5D69 A;  2O60 A;  1JFJ A;  5AEQ A;  1FW4 A;  4I5J A;  4P2Y B;  2F3Y A;  4MSP A;  1DGV A;  3SG3 A;  3TZ1 A;  2LLT A;  2HQW A;  4YBH B;  1CDN A;  4CLN A;  2ZN9 A;  2KNE A;  2OTG C;  1JC2 A;  1DVI A;  1XO5 A;  1B8R A;  1UUR A;  1YUU A;  3WHT B;  4ICB A;  2EC6 B;  4KYN A;  3BOW B;  1UHJ A;  2NCO A;  1PSR A;  2P70 A;  3B88 A;  1R2U A;  2Q4U A;  1DC1 A;  1L2O B;  1QS7 A;  1J7Q A;  3RM1 A;  3OHM B;  2MRD A;  1DTL A;  3O78 A;  4I5N B;  1C7V A;  1XA5 A;  1OMR A;  4ORC B;  3L4L A;  4GAO A;  1F71 A;  1Y1X A;  2CXJ A;  5CPV A;  1NIW A;  3H4S E;  1QVI Z;  2BL0 C;  2BNX A;  3BXK A;  3DYE A;  3IQO A;  4IL1 A;  4MRY A;  4UPG A;  1MHO A;  1SCM C;  1SKT A;  2LVV A;  2K7C A;  4PE0 A;  2M97 A;  3V2L A;  1OOH A;  5KTY A;  1PAL A;  2WND A;  1DJI A;  1U5I B;  5D3O A;  1GM0 A;  2JPO A;  4FTG A;  2LCP A;  4USL A;  4TNC A;  3Q8I A;  2KI4 B;  2M1U A;  1REC A;  3O2P A;  1KK7 Z;  4I5K A;  1Z4H A;  1B7T Z;  3PN7 B;  2YGU A;  2ZND A;  1M31 A;  1Y0V H;  1BMO A;  1QX2 A;  3SIB A;  3VRP A;  1RTP 1;  5ER5 A;  2KLD A;  1G33 A;  1SCV A;  3AKB A;  3OBV A;  4Q04 A;  5HLO A;  3VRQ A;  2F2P A;  1JBA A;  2WCF A;  1BOC A;  2LMV A;  3PFV A;  1V1F A;  1AVS A;  2L5Y A;  1L2O C;  2LVJ A;  2SCP A;  4PHJ A;  3S0D A;  1KQM B;  2WOR A;  1TNP A;  1M39 A;  4INW A;  3WXA A;  1YUT A;  1LA0 A;  3CR5 X;  1QXP A;  2JOJ A;  4NDD A;  2KI6 D;  1OSA A;  2M8U A;  2FCE A;  2GV5 A;  3ICB A;  4GPL B;  2MBX A;  3EVU A;  3SG4 A;  1QJT A;  2ZN8 A;  4AOM A;  1PSB A;  2LHL A;  1J7P A;  3D74 A;  5CSF A;  1SYM A;  1EG4 A;  2KI4 C;  5I8N A;  3CZ0 A;  3PM2 A;  3B6X A;  2PQL A;  1K93 D;  4BY4 A;  1CMG A;  4CID A;  1AJ4 A;  1OE9 B;  3PSR A;  1TUJ A;  1L7Z A;  1S26 D;  4N5X A;  2BKI B;  5PAL A;  1XK4 A;  1CLB A;  1DT7 B;  2DOQ A;  3FWC A;  2COL B;  2K7D A;  1OOF A;  2M0R A;  1K8U A;  1SBJ A;  1SK6 D;  2M49 B;  4N1G A;  1KQM C;  1S5G Y;  2PAS A;  3SS4 A;  4I5L B;  4MBE A;  2PYQ A;  2Y1M A;  3SS3 A;  1GGZ A;  2K61 A;  2WCL A;  4JPZ B;  4MRX A;  1MUX A;  3M0W A;  1JSA A;  2O5G A;  2H8V A;  1S3P A;  2MLE C;  1F4O A;  4MEW A;  3LL8 B;  1LA3 A;  1NPQ A;  4ETO A;  1LS8 A;  3GK1 A;  3CZ1 A;  1NCX A;  5JJG A;  2G9B A;  1S36 A;  1DEL A;  2KYC A;  4HRG A;  3D73 A;  3D78 A;  3R72 A;  4D1E A;  2BEC A;  4M2P A;  4GGN A;  1K90 D;  4AQJ A;  2MHH A;  4WQ2 A;  4QJ3 B;  1OMD A;  1Z2C B;  1CLL A;  1MF8 B;  2ERB A;  1J7O A;  1IGV A;  3AAJ A;  1G8I A;  1YX7 A;  3WHU B;  2KBM A;  2P71 A;  1MXL C;  3S0A A;  3CGA A;  1XYD A;  2FJY A;  3LK0 A;  1KFU L;  2LM5 A;  1K95 A;  1YR5 A;  2F33 A;  4A4C A;  2BL0 B;  1ORG A;  3HX4 A;  3EVV A;  1C07 A;  1WLM A;  3CZ2 A;  1JF0 A;  3EK7 A;  1K94 A;  4YI8 A;  3PAL A;  4DUQ A;  3D75 A;  4YGA A;  1GJY A;  1C3Z A;  3S0G A;  1D1O A;  1QX5 B;  1NUB A;  3OGN A;  4NDB A;  2KGB C;  2JPT A;  4F7F A;  1K9P A;  2AMI A;  2I2R E;  1KK8 B;  3SG2 A;  5KSZ A;  2F3Z A;  1DGU A;  1J55 A;  1B9A A;  4P5O E;  2OS8 C;  3E3R A;  1ZOT B;  2FJU B;  1AUI B;  1MR8 A;  1S1E A;  1WY9 A;  2Y4Q A;  2JQ6 A;  1TUZ A;  4IJ7 A;  4XYN A;  5DIC A;  3D10 A;  3DVK A;  1S6I A;  1EJ3 A;  2LMT A;  2K2F A;  4GGF C;  1OMV A;  1QAS A;  3KHE A;  1NCY A;  3CDN A;  1SPY A;  3F45 A;  5DKN A;  3NXA A;  1CM4 A;  1NWD A;  3NSK A;  3BUX B;  2BAP A;  5EL2 A;  5F6T A;  4N1F A;  2V53 A;  3I5H C;  3NHT A;  4PT1 A;  2KAV A;  3BUO B;  1EH2 A;  3BFB A;  3RZS A;  3BOW A;  1QV1 A;  1OOG A;  2QEH A;  1B4C A;  1IH0 A;  2GGZ A;  3TDI A;  3BUM B;  5B8I B;  4MZJ A;  1IWQ A;  5HKY A;  1KCY A;  2CT9 A;  4XJK B;  1NP8 A;  2CCM A;  1CLM A;  2CNP A;  3K1E A;  1BLQ A;  1CDL A;  1TCF A;  1M45 A;  3KPX A;  1KK8 C;  4JKT A;  1J1D A;  3ZNI A;  4OV2 A;  1Y1A A;  1BT6 A;  1WRZ A;  1IJ6 A;  1HT9 A;  2L98 A;  1TOP A;  1ZUZ A;  1JUO A;  1U5I A;  3D0Y B;  1QVI Y;  3DY9 A;  4MZL A;  1DF0 B;  1IIO A;  4ORA B;  5I94 A;  1AK8 A;  4XJK A;  5I2Q A;  4PCW A;  1DJG A;  4PE4 A;  1TIZ A;  2Q91 A;  1TNX A;  2MAZ A;  4GUK A;  4A4B A;  1ZAC A;  1ZMZ A;  3BFH A;  3BUN B;  5HYD A;  4FQT A;  3SIA A;  2L50 A;  2LVK A;  3BYA A;  3I5G B;  4YGE B;  3HCM A;  2EGD A;  2ZFD A;  3AKA A;  2MLF C;  1KK7 Y;  2ZRT A;  2K7O A;  1CDP A;  2JXC A;  3BFA A;  3R1O A;  1M46 A;  3DVM A;  1B7T Y;  4MZK A;  2BCA A;  2E30 A;  1NX3 A;  3FWB A;  1KSM A;  1N0Y A;  2D8N A;  1SRA A;  2GGM A;  2L2E A;  3CTN A;  1KWO B;  2JWW A;  2LUX A;  2BCB A;  1FF1 A;  1Q80 A;  1M63 B;  1QLK A;  2LLU A;  1YUR A;  1IRJ A;  2LV7 A;  1QIW A;  2MJW B;  2QAC A;  3K21 A;  2ISD A;  1AHR A;  1CDM A;  1C3Y A;  4WRI A;  2I18 A;  4C0K A;  2BKH B;  3CZT X;  2A4J A;  1XFY O;  2LVI A;  2VRG A;  2JT3 A;  1W7J B;  4OZD A;  1K2H A;  2SAS A;  1MWN A;  2JUL A;  2JTT A;  1UP5 A;  3UNW A;  3I5I B;  3TS5 B;  2PVB A;  1UHK A;  2EHB A;  3PAT A;  3AAK A;  3JVT C;  1EXR A;  2H61 A;  3I5G C;  3NSO A;  1JF2 A;  2M3W A;  3BUW B;  1Y6W A;  3B87 A;  5FYX A;  2NZ0 A;  3CS1 A;  4PHK A;  1PRW A;  3QRX A;  1JFK A;  2LP2 A;  3EK4 A;  1FBV A;  4MLW A;  4M2O A;  3UO9 A;  1G4Y R;  5FI7 A;  1C7W A;  1UWO A;  1K9K A;  1XFV O;  1V1G A;  3TDU A;  2LLS A;  3S0F A;  5CSJ A;  2L0P A;  1MXE A;  1S6J A;  4CFR A;  1DJH A;  3VGO A;  1XFR A;  1SR6 C;  2M7N A;  1LVC D;  3FIA A;  3I5F B;  1H8B A;  4NQG A;  1KWO C;  5CSN A;  1ALV A;  2OS8 B;  3TDZ A;  4R1E A;  4DCK A;  2LP3 A;  1IQ3 A;  4C0J A;  2H61 C;  4JQ0 D;  2WOS A;  3OB2 B;  1QTX A;  3D77 A;  4BY5 A;  5DKQ A;  1TWO A;  1LIN A;  1OZO A;  2FCD A;  1F8H A;  1LXF C;  1DJW A;  1HQV A;  1QIV A;  2PSR A;  3OX5 A;  3I5H B;  1Y1U A;  1OW4 A;  3DVE A;  2K7B A;  4YGC B;  3VB1 A;  4DRW A;  1B8C A;  1BJF A;  3I5I C;  2KPH A;  3TS5 C;  1FI6 A;  1H4B A;  2WCM A;  2NCP A;  2BBM A;  2LMU A;  1SSE B;  1KFX S;  2K8M B;  2QEO A;  1YUS A;  3NGV A;  4GGF A;  5I2L A;  1WDC B;  2KHN A;  1OZS A;  2KBI A;  1K96 A;  2K60 A;  3KO0 A;  1DJZ A;  3CR2 A;  4QJ4 B;  1SL8 A;  1NX2 A;  1S6C A;  1W7I B;  1DMO A;  3QME A;  1SL7 A;  3PLF B;  2KGR A;  1CFC A;  3EKH A;  3FE6 A;  3I5F C;  1PVA A;  3IF7 A;  2F2O A;  3RLZ A;  2PAL A;  3VRN A;  5FI2 A;  5BPJ A;  3B7A A;  1OOI X;  2KYF A;  2M7L A;  2JNX A;  2KI6 C;  1ALW A;  1CM1 A;  2H2K A;  2KFH A;  5IBW A;  3IQQ A;  1IJ5 A;  2RGI A;  4HRH A;  5D7F A;  1WRK A;  1B47 A;  1KFX L;  4FQO A;  2PMY A;  1XFZ O;  2ZRS A;  2G2B A;  2GTE A;  2I94 A;  2M29 A;  4DIR A;  2P6B B;  1WLZ A;  3DVJ A;  4JD9 A;  1A03 A;  2KSP A;  2TN4 A;  3SG6 A;  1A4P A;  1J7R A;  1N2D A;  1R6P A;  2NXQ A;  2LHI A;  5HKZ A;  3DZT A;  3R1V A;  3JTD B;  1SW8 A;  5AAN A;  1J1E A;  4INX A;  2L4I A;  1WDC C;  3TUY B;  1FI5 A;  1X02 A;  2WCH A;  3MSE B;  1BU3 A;  4CFQ A;  1DQE A;  3R1P A;  3PJI A;  1DEK A;  3SS5 A;  1XFW O;  2IS9 A;  4NDC A;  4C0L A;  2PRU A;  5I2O A;  3CAB A;  1EG3 A;  4OKH A;  1PUL A;  3CR4 X;  3LCP C;  2KQY A;  1GQM A;  1T14 A;  4YGB B;  1CTR A;  2NLN A;  5HL1 A;  1PK0 D;  1TNQ A;  1LKJ A;  3PM8 A;  2AUC A;  2K2A A;  2M9G A;  2QEV A;  1WRL A;  5GQQ C;  1RWY A;  5KU1 A;  3GK4 X;  1YVL A;  2JT8 A;  1K9U A;  2MA2 A;  1UUS A;  1DJX A;  3EG5 B;  3CWG A;  2OPO A;  3LLE A;  4YI9 A;  3NHI A;  3GOF A;  1RJV A;  1ODB A;  1VRK A;  3JVT B;  1BG1 A;  4OVN F;  4L9M A;  3ZWH A;  1CNP A;  3EVR A;  1F4Q A;  1SNL A;  3DD4 A;  1RFJ A;  3D0Y A;  1JWD A;  2JZI A;  4PE1 A;  1DF0 A;  1RRO A;  2KDH A;  3BQ3 A;  3JTD C;  4HSZ A;  2KAY A;  1QX7 A;  3TUY C;  2KAX A;  2E6W A;  3L4A A;  2QEB A;  1BF5 A;  4MN0 A;  2EC6 C;  3EK8 A;  1YTZ C;  1SR6 B;  3O4X A;  2Y1N A;  3FS7 A;  5ER4 X;  5AER A;  2JT0 A;  2LC5 A;  4PHN A;  2WCE A;  1CFP A;  2JNF A;  1NCZ A;  2HF5 A;  1SY9 A;  2LAP A;  2WC8 A;  3DXL A;  5DKR A;  1AP4 A;  2WCJ A;  1TTX A;  2WC5 A;  5AFP A;  1UHH A;  1W9Z A;  3B86 A;  4MVF A;  2CBL A;  2B1U A;  1B1G A;  4WQ3 A;  5HKW A;  1S5G Z;  1QWV A;  3SG7 A;  2KQ6 A;  4E68 A;  1CB1 A;  2M1K B;  2HET A;  3N7H A;  1GGW A;  1B8L A;  1YVH A;  2Y5I A;  1QV0 A;  1F55 A;  1A2X A;  2BE6 A;  2R2I A;  3OB1 B;  3PN7 C;  3EKJ A;  3OX6 A;  2WC6 A;  1OOJ A;  4ZCV A;  4OCI A;  1F54 A;  2CTN A;  2WCB A;  2HPS A;  1NSH A;  1E8A A;  1IG5 A;  2ZNE A;  4PAL A;  3A4U B;  2F8P A;  1NYA A;  1ZFS A;  1KQV A;  3KEV A;  1A29 A;  1NX1 A;  1OQP A;  1XVJ A;  2K0J A;  1CKK A;  2JC2 A;  2LE9 B;  4ORB B;  5CSI A;  3WNX B;  2BCX A;  3DF0 B;  2FOT A;  1N65 A;  1YRU B;  1DJY A;  1RK9 A;  1KFU S;  1A75 B;  3IVT A;  3A8R A;  3O6B A;  2JRF A;  4GFT A;  3VRO A;  4PDZ A;  4ZCU A;  5K89 A;  3NSL A;  1TRF A;  2QPT A;  4HRE E;  1CFF A;  3C1V A;  3FE8 A;  1YX8 A;  2AAO A;  4M2Q A;  1XFX O;  1TCO B;  4QJ5 B;  5J3X A;  2HQ8 A;  2L2C A;  3S0B A;  1QLS A;  1SMG A;  1XFU O;  3D76 A;  3DF0 A;  4PE7 A;  1BR1 B;  3OP0 A;  4OR9 B;  5TNC A;  3SJS A;  1XK4 C;  1CFD A;  3L47 A;  1A75 A;  2WCK A;  1UHN A;  2KOT A;  1P28 A;  1UHI A;  1AJ5 A;  3GK2 A;  2L5X B;  2OTG B;  1FPW A;  3KF9 A;  2ZKM X;  5JOL A;  2QDI A;  1QAT A;  1IQ5 A;  2KFF A;  3NSI A;  2I7A A; 
#chains in the Genus database with same CATH homology
 1NX0 A;  3VRR A;  4U8D A;  1TNW A;  1KSO A;  5AXI A;  3SG5 A;  1EL4 A;  4PHM A;  2JU0 A;  4GBA A;  3CLN A;  2JTZ A;  4YGD B;  1IKU A;  2L51 A;  4JWQ A;  4GNK B;  3LK1 A;  2JXL A;  1BR4 B;  1YRT B;  1F70 A;  2BBN A;  4YRU A;  1SCM B;  2L4H A;  1BOD A;  3O4Y A;  1CMF A;  1SL9 A;  2BE4 A;  2LUC A;  2LAN A;  5G08 A;  4AQI A;  1TN4 A;  5HLV A;  1MQ1 A;  2KFG A;  4CPV A;  2LNK A;  4DS7 A;  4F0Z B;  1PVB A;  5D69 A;  2O60 A;  1JFJ A;  5AEQ A;  1FW4 A;  4I5J A;  4P2Y B;  2F3Y A;  4MSP A;  1DGV A;  3SG3 A;  3TZ1 A;  2LLT A;  2HQW A;  4YBH B;  1CDN A;  4CLN A;  2ZN9 A;  2KNE A;  2OTG C;  1JC2 A;  1DVI A;  1XO5 A;  1B8R A;  1UUR A;  1YUU A;  3WHT B;  4ICB A;  2EC6 B;  3BOW B;  1UHJ A;  2NCO A;  1PSR A;  1R2U A;  2Q4U A;  1L2O B;  1QS7 A;  1J7Q A;  3RM1 A;  3OHM B;  2MRD A;  1DTL A;  3O78 A;  4I5N B;  1C7V A;  1XA5 A;  1OMR A;  4ORC B;  4GAO A;  1F71 A;  1Y1X A;  2CXJ A;  5CPV A;  1NIW A;  3H4S E;  1QVI Z;  2BL0 C;  3BXK A;  3IQO A;  4IL1 A;  4MRY A;  4UPG A;  1MHO A;  1SCM C;  1SKT A;  2LVV A;  2K7C A;  4PE0 A;  2M97 A;  5KTY A;  1PAL A;  2WND A;  1DJI A;  1U5I B;  4FTG A;  2LCP A;  4USL A;  4TNC A;  2KI4 B;  2M1U A;  1REC A;  3O2P A;  1KK7 Z;  4I5K A;  1B7T Z;  3PN7 B;  2ZND A;  1M31 A;  1Y0V H;  1BMO A;  1QX2 A;  3SIB A;  3VRP A;  1RTP 1;  5ER5 A;  3AKB A;  1G33 A;  1SCV A;  5HLO A;  3VRQ A;  4Q04 A;  2F2P A;  1JBA A;  2WCF A;  1BOC A;  2LMV A;  3PFV A;  1V1F A;  1AVS A;  1L2O C;  2LVJ A;  2SCP A;  4PHJ A;  1KQM B;  2WOR A;  1TNP A;  1M39 A;  3WXA A;  1YUT A;  1LA0 A;  3CR5 X;  1QXP A;  2JOJ A;  4NDD A;  2KI6 D;  1OSA A;  2M8U A;  2FCE A;  2GV5 A;  3ICB A;  4GPL B;  2MBX A;  3EVU A;  3SG4 A;  1QJT A;  2ZN8 A;  4AOM A;  1PSB A;  2LHL A;  1J7P A;  5CSF A;  1SYM A;  1EG4 A;  2KI4 C;  5I8N A;  1K93 D;  4BY4 A;  1CMG A;  4CID A;  1AJ4 A;  1OE9 B;  3PSR A;  1L7Z A;  1S26 D;  4N5X A;  2BKI B;  5PAL A;  1XK4 A;  1CLB A;  1DT7 B;  2DOQ A;  3FWC A;  2COL B;  2K7D A;  2M0R A;  1K8U A;  1SBJ A;  1SK6 D;  2M49 B;  4N1G A;  1KQM C;  1S5G Y;  2PAS A;  4I5L B;  4MBE A;  2Y1M A;  1GGZ A;  2K61 A;  4JPZ B;  4MRX A;  1MUX A;  3M0W A;  1JSA A;  2O5G A;  1S3P A;  2MLE C;  1F4O A;  4MEW A;  3LL8 B;  1LA3 A;  1NPQ A;  4ETO A;  3GK1 A;  1NCX A;  5JJG A;  2G9B A;  1S36 A;  2KYC A;  4HRG A;  4D1E A;  2BEC A;  4M2P A;  4GGN A;  1K90 D;  4AQJ A;  2MHH A;  4WQ2 A;  4QJ3 B;  1OMD A;  1CLL A;  1MF8 B;  1J7O A;  1IGV A;  3AAJ A;  1G8I A;  1YX7 A;  3WHU B;  2KBM A;  1MXL C;  3CGA A;  1XYD A;  3LK0 A;  1KFU L;  2LM5 A;  1K95 A;  1YR5 A;  2F33 A;  4A4C A;  2BL0 B;  3HX4 A;  3EVV A;  1C07 A;  1WLM A;  1JF0 A;  3EK7 A;  1K94 A;  4YI8 A;  3PAL A;  4DUQ A;  4YGA A;  1GJY A;  1D1O A;  1QX5 B;  1NUB A;  4NDB A;  2KGB C;  2JPT A;  1K9P A;  2AMI A;  2I2R E;  1KK8 B;  3SG2 A;  5KSZ A;  2F3Z A;  1DGU A;  1J55 A;  1B9A A;  4P5O E;  2OS8 C;  3E3R A;  1ZOT B;  2FJU B;  1AUI B;  1MR8 A;  1S1E A;  1WY9 A;  2Y4Q A;  2JQ6 A;  4XYN A;  3D10 A;  3DVK A;  1S6I A;  1EJ3 A;  2LMT A;  2K2F A;  4GGF C;  1OMV A;  1QAS A;  3KHE A;  1NCY A;  1SPY A;  3F45 A;  5DKN A;  3NXA A;  1CM4 A;  1NWD A;  3NSK A;  3BUX B;  5F6T A;  4N1F A;  2V53 A;  3I5H C;  2KAV A;  3BUO B;  1EH2 A;  3BOW A;  1QV1 A;  1IH0 A;  2GGZ A;  3TDI A;  3BUM B;  5B8I B;  4MZJ A;  1IWQ A;  5HKY A;  1KCY A;  2CT9 A;  4XJK B;  1NP8 A;  2CCM A;  1CLM A;  2CNP A;  1BLQ A;  1CDL A;  1TCF A;  1M45 A;  3KPX A;  1KK8 C;  1J1D A;  3ZNI A;  4OV2 A;  1Y1A A;  1BT6 A;  1WRZ A;  1IJ6 A;  1HT9 A;  2L98 A;  1TOP A;  1ZUZ A;  1JUO A;  1U5I A;  3D0Y B;  1QVI Y;  4MZL A;  1DF0 B;  4ORA B;  1AK8 A;  4XJK A;  5I2Q A;  4PCW A;  1DJG A;  4PE4 A;  1TIZ A;  2Q91 A;  1TNX A;  2MAZ A;  4GUK A;  4A4B A;  1ZAC A;  1ZMZ A;  5HYD A;  3BUN B;  3SIA A;  2L50 A;  2LVK A;  3BYA A;  3I5G B;  4YGE B;  3HCM A;  2EGD A;  2ZFD A;  3AKA A;  2MLF C;  1KK7 Y;  2ZRT A;  2K7O A;  1CDP A;  2JXC A;  1M46 A;  3DVM A;  1B7T Y;  4MZK A;  2BCA A;  2E30 A;  1NX3 A;  3FWB A;  1KSM A;  1N0Y A;  2D8N A;  1SRA A;  2GGM A;  2L2E A;  3CTN A;  1KWO B;  2JWW A;  2LUX A;  2BCB A;  1FF1 A;  1Q80 A;  1M63 B;  1QLK A;  2LLU A;  1YUR A;  1IRJ A;  2LV7 A;  1QIW A;  2MJW B;  2QAC A;  3K21 A;  2ISD A;  1AHR A;  1CDM A;  4WRI A;  2I18 A;  4C0K A;  2BKH B;  3CZT X;  2A4J A;  1XFY O;  2LVI A;  2VRG A;  2JT3 A;  1W7J B;  1K2H A;  2SAS A;  1MWN A;  2JUL A;  2JTT A;  1UP5 A;  3I5I B;  3TS5 B;  2PVB A;  1UHK A;  2EHB A;  3PAT A;  3AAK A;  3JVT C;  1EXR A;  2H61 A;  3I5G C;  3NSO A;  1JF2 A;  2M3W A;  3BUW B;  1Y6W A;  5FYX A;  2NZ0 A;  3CS1 A;  4PHK A;  1PRW A;  3QRX A;  1JFK A;  2LP2 A;  3EK4 A;  1FBV A;  4MLW A;  4M2O A;  4CFR A;  1G4Y R;  3TDU A;  1C7W A;  1UWO A;  1K9K A;  1XFV O;  1V1G A;  2LLS A;  5CSJ A;  2L0P A;  1MXE A;  1S6J A;  1DJH A;  3VGO A;  1SR6 C;  2M7N A;  1LVC D;  3FIA A;  3I5F B;  1H8B A;  4NQG A;  1KWO C;  5CSN A;  1ALV A;  2OS8 B;  3TDZ A;  4R1E A;  4DCK A;  2LP3 A;  1IQ3 A;  4C0J A;  2H61 C;  4JQ0 D;  2WOS A;  3OB2 B;  1QTX A;  4BY5 A;  5DKQ A;  1LIN A;  1OZO A;  2FCD A;  1F8H A;  1LXF C;  1DJW A;  1HQV A;  1QIV A;  2PSR A;  3OX5 A;  3I5H B;  1Y1U A;  3DVE A;  4YGC B;  2K7B A;  4DRW A;  1B8C A;  1BJF A;  3I5I C;  3TS5 C;  1FI6 A;  1H4B A;  2NCP A;  2BBM A;  2LMU A;  2K8M B;  1KFX S;  1YUS A;  4GGF A;  5I2L A;  1WDC B;  2KHN A;  1OZS A;  2KBI A;  1K96 A;  3KO0 A;  1DJZ A;  3CR2 A;  4QJ4 B;  1SL8 A;  1NX2 A;  1S6C A;  1W7I B;  1DMO A;  1SL7 A;  3PLF B;  2KGR A;  1CFC A;  3EKH A;  3I5F C;  1PVA A;  3IF7 A;  2F2O A;  3RLZ A;  2PAL A;  3VRN A;  5BPJ A;  2KYF A;  2M7L A;  2JNX A;  2KI6 C;  1ALW A;  1CM1 A;  2H2K A;  2KFH A;  5IBW A;  3IQQ A;  1IJ5 A;  2RGI A;  4HRH A;  5D7F A;  1WRK A;  1B47 A;  1KFX L;  4FQO A;  2PMY A;  1XFZ O;  2ZRS A;  2G2B A;  2I94 A;  2M29 A;  4DIR A;  1B4C A;  2P6B B;  1WLZ A;  3DVJ A;  1A03 A;  2KSP A;  2TN4 A;  3SG6 A;  1A4P A;  1J7R A;  1N2D A;  1R6P A;  2NXQ A;  2LHI A;  5HKZ A;  3JTD B;  1SW8 A;  5AAN A;  1J1E A;  2L4I A;  1WDC C;  3TUY B;  1FI5 A;  1X02 A;  3MSE B;  1BU3 A;  4CFQ A;  1XFW O;  2IS9 A;  4NDC A;  4C0L A;  2PRU A;  5I2O A;  1EG3 A;  4OKH A;  1PUL A;  3CR4 X;  3LCP C;  2KQY A;  1GQM A;  4YGB B;  1CTR A;  2NLN A;  1PK0 D;  1TNQ A;  1LKJ A;  3PM8 A;  2AUC A;  2K2A A;  2M9G A;  5GQQ C;  1WRL A;  1RWY A;  5KU1 A;  3GK4 X;  1YVL A;  2JT8 A;  1K9U A;  2MA2 A;  1UUS A;  1DJX A;  3CWG A;  2OPO A;  3LLE A;  4YI9 A;  3GOF A;  1RJV A;  1ODB A;  1VRK A;  3JVT B;  1BG1 A;  4OVN F;  4L9M A;  3ZWH A;  1CNP A;  3EVR A;  1F4Q A;  1SNL A;  3DD4 A;  1RFJ A;  3D0Y A;  1JWD A;  2JZI A;  4PE1 A;  1DF0 A;  1RRO A;  2KDH A;  3BQ3 A;  3JTD C;  4HSZ A;  2KAY A;  1QX7 A;  3TUY C;  2KAX A;  2E6W A;  1BF5 A;  4MN0 A;  2EC6 C;  3EK8 A;  1YTZ C;  1SR6 B;  2Y1N A;  3FS7 A;  5ER4 X;  5AER A;  2JT0 A;  2LC5 A;  4PHN A;  2WCE A;  1CFP A;  2JNF A;  1NCZ A;  2HF5 A;  1SY9 A;  2LAP A;  2WC8 A;  5DKR A;  1AP4 A;  1TTX A;  5AFP A;  1UHH A;  1B1G A;  4MVF A;  2CBL A;  2B1U A;  4WQ3 A;  5HKW A;  1S5G Z;  3SG7 A;  2KQ6 A;  4E68 A;  1CB1 A;  2M1K B;  2HET A;  1GGW A;  1B8L A;  1YVH A;  2Y5I A;  1QV0 A;  1F55 A;  1A2X A;  2BE6 A;  2R2I A;  3OB1 B;  3PN7 C;  3EKJ A;  3OX6 A;  4ZCV A;  1OOJ A;  1F54 A;  4OCI A;  2CTN A;  2WCB A;  2HPS A;  1NSH A;  1E8A A;  1IG5 A;  2ZNE A;  4PAL A;  3A4U B;  2F8P A;  1NYA A;  1ZFS A;  1KQV A;  3KEV A;  1A29 A;  1NX1 A;  1OQP A;  1XVJ A;  2K0J A;  1CKK A;  2JC2 A;  2LE9 B;  4ORB B;  5CSI A;  3WNX B;  2BCX A;  3DF0 B;  2FOT A;  1N65 A;  1YRU B;  1DJY A;  1RK9 A;  1KFU S;  1A75 B;  3O6B A;  3A8R A;  4GFT A;  2JRF A;  3VRO A;  4PDZ A;  4ZCU A;  5K89 A;  3NSL A;  1TRF A;  2QPT A;  4HRE E;  1CFF A;  3C1V A;  1YX8 A;  2AAO A;  4M2Q A;  1XFX O;  1TCO B;  4QJ5 B;  5J3X A;  2HQ8 A;  1QLS A;  1SMG A;  1XFU O;  4PE7 A;  3DF0 A;  5TNC A;  1BR1 B;  3OP0 A;  4OR9 B;  3SJS A;  1XK4 C;  1CFD A;  1A75 A;  1UHN A;  2KOT A;  1UHI A;  1AJ5 A;  3GK2 A;  2L5X B;  2OTG B;  1FPW A;  3KF9 A;  2ZKM X;  5JOL A;  1QAT A;  1IQ5 A;  2KFF A;  3NSI A;  2I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...