4ICBA

Proline cis-trans isomers in calbindin d9k observed by x-ray crystallography
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
MKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Proline cis-trans isomers in calbindin D9k observed by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1991-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4icbA00
3PN7B 3RLZA 1JF2A 4JWQA 1RWYA 1YRUB 4N1FA 2M8UA 2H61A 4GUKA 2EC6C 4F0ZB 2VRGA 3SJSA 1QVIY 5I2OA 1Y6WA 1B8RA 4MRYA 3F45A 2BL0C 2E6WA 5F6TA 1CFFA 3I5FB 1Y1AA 2K2AA 2OS8C 2GGMA 2PMYA 1SK6D 3BUXB 1IKUA 1MWNA 2KHNA 2K61A 1OOJA 2JOJA 1SPYA 1TNQA 1ZUZA 2HF5A 2LVJA 3JTDB 2BBMA 4YGEB 3I5HB 2KBIA 2HQ8A 4UPGA 4AQJA 1IRJA 2B1UA 2LV7A 1AVSA 1NPQA 3PM8A 4CIDA 1U5IA 2KQYA 1M45A 1Y1XA 2ZKMX 4GGNA 1W7IB 3TZ1A 1L2OC 1EG4A 1B4CA 4I5KA 1BR1B 3TDUA 3EVVA 4IL1A 1YUUA 1DJYA 1JFKA 1XFUO 1RJVA 1IQ5A 1R6PA 3O78A 3CLNA 1LA3A 4R1EA 4QJ3B 1C07A 1C7VA 2KGRA 2L2EA 1U5IB 2Y5IA 1B1GA 1L7ZA 1UHNA 3CS1A 3DVJA 4JPZB 4ORCB 4PCWA 2QACA 1HQVA 1A75A 1QIWA 2F33A 2G2BA 2KOTA 3OP0A 4PDZA 1NX1A 4YBHB 3EK7A 3O2PA 3SIAA 2BBNA 1FI6A 1CM1A 2KNEA 3ICBA 4I5LB 1HT9A 4YGBB 4CFRA 1SRAA 4QJ5B 3CGAA 4HSZA 1PSBA 4L9MA 2M7NA 1YRTB 1NX2A 2KFFA 3DD4A 3M0WA 4M2QA 1DMOA 2D8NA 1JSAA 1X02A 1IWQA 1M63B 1A75B 1DF0A 1SL9A 4YGAA 4DRWA 1S5GZ 2JPTA 4OKHA 3GK4X 1F54A 1WDCC 2EC6B 3PLFB 4USLA 2JULA 2K2FA 3BUMB 2BL0B 4PHKA 3I5FC 3O6BA 2OS8B 1JBAA 1K93D 1FW4A 2P6BB 5CSNA 2WOSA 1N2DA 4GFTA 3JTDC 1J7PA 2ISDA 1B47A 1DF0B 2K8MB 2K7CA 2PVBA 1BR4B 2FCDA 4GAOA 1TNXA 1K2HA 1TCOB 1NCXA 1ZMZA 2K7OA 2HQWA 5D69A 2M97A 2ZNDA 1W7JB 2L4IA 1NX0A 1XFVO 2JXCA 2LMTA 4PHMA 4NDCA 4PALA 1XFWO 1OMDA 1LINA 2LLUA 3GK2A 1L2OB 2KI6C 4BY4A 4A4BA 1S1EA 5ER5A 1YURA 4NDBA 2M0RA 1WRKA 1NP8A 2WC8A 1K94A 4OVNF 5I2QA 3OB2B 4PHJA 2LMUA 3D10A 4FTGA 4DCKA 1NSHA 1ZACA 2DOQA 2PALA 1BMOA 1C7WA 1FBVA 2KAXA 2SCPA 5K89A 1TRFA 1CLBA 4MVFA 1UHKA 2WORA 3JVTB 1NCYA 3EK4A 2F2OA 1BOCA 2A4JA 2LMVA 2NZ0A 1ALVA 2JXLA 3PSRA 2Y1MA 3VRNA 1DT7B 4PE4A 1B8CA 1DJZA 1UP5A 3EKHA 1YUSA 4MZJA 5JJGA 1DVIA 3VRRA 3FIAA 1DJHA 1SKTA 1NX3A 1SL8A 2SASA 2TN4A 4ETOA 1N0YA 2CNPA 2JWWA 1SL7A 1XFXO 2BKIB 5AXIA 1NUBA 1TIZA 1SY9A 1QASA 4WQ3A 1DGVA 2CBLA 2L51A 4M2OA 4MLWA 1OE9B 1QV1A 1B9AA 1KCYA 3SG4A 1MUXA 1WDCB 2NCPA 5HKWA 5ER4X 1TNPA 3I5GB 3AKBA 2BKHB 1RFJA 4QJ4B 1KFUS 2RGIA 1EH2A 1Y1UA 3VGOA 2M7LA 1KSOA 1QLKA 5IBWA 1BODA 3BOWA 4XJKA 1PALA 1GJYA 1KWOC 2ZN8A 3HX4A 2M1UA 1UUSA 2KAVA 3DF0A 2F8PA 1S6JA 4DS7A 3SIBA 4HRGA 2BE4A 2EGDA 4XYNA 1NCZA 1KFXL 3A8RA 4GPLB 5D7FA 2L5XB 2ZFDA 5CSFA 2FOTA 3BOWB 4XJKB 5G08A 4D1EA 3IQOA 3BUOB 1JC2A 1RECA 5BPJA 1CLMA 3DF0B 5I2LA 1B8LA 1EG3A 4OV2A 1QS7A 3CTNA 1A4PA 1F8HA 1WLZA 1NIWA 1XA5A 1TCFA 3K21A 2LANA 3TDIA 4DIRA 3OHMB 3KHEA 5JOLA 4YGDB 5B8IB 1DJWA 2FCEA 2V53A 4C0JA 1QV0A 2ZRSA 1XYDA 1F4OA 2H2KA 3JVTC 1CKKA 5CSIA 1KK8C 2MHHA 1J1EA 1KQMB 5DKRA 1B7TY 2F3YA 4A4CA 4YI9A 2NLNA 2KDHA 3VRPA 1CLLA 1K90D 2WCEA 1XO5A 2KGBC 3BUNB 4MEWA 4ICBA 2M3WA 1S6CA 2KQ6A 2WNDA 1KK7Y 3D0YA 3SG3A 2GV5A 3CR2A 1XFYO 4MN0A 1KSMA 4BY5A 2ZRTA 1OSAA 1QX5B 2LLTA 1H4BA 1QX2A 2CTNA 4WQ2A 1NYAA 4C0KA 1F70A 4HRHA 2MLFC 4WRIA 4PHNA 1LXFC 1SR6C 1TN4A 2F3ZA 1QVIZ 2JQ6A 2L50A 2M29A 2BE6A 1BU3A 2MRDA 2LHLA 3CR5X 3I5GC 4DUQA 1UHHA 4P5OE 4U8DA 1S26D 3GK1A 2JZIA 2KBMA 2L0PA 2LHIA 3NSIA 1PULA 2BECA 3D0YB 1GGWA 1J1DA 2CT9A 2LCPA 2JTTA 1KWOB 1IGVA 1QLSA 1V1FA 2CCMA 4CLNA 1F55A 2JT8A 4YRUA 1OQPA 1QXPA 3WHUB 1S3PA 1SBJA 3QRXA 1FPWA 1DJIA 2MBXA 1G4YR 1K9PA 1S36A 3LLEA 4YGCB 1DGUA 3BYAA 1WRZA 2KAYA 3LCPC 1G8IA 4I5NB 3KF9A 1CMGA 3ZNIA 1M39A 1QX7A 2Y4QA 4AQIA 1FI5A 1CDPA 3BQ3A 3A4UB 2LE9B 3OX6A 3NXAA 1V1GA 1CFCA 3AAJA 1A2XA 1CFDA 4YI8A 2AUCA 3GOFA 2I7AA 1CDLA 1F4QA 5AFPA 2IS9A 3SG5A 3DVKA 1PK0D 1XVJA 2LLSA 1CMFA 5KU1A 4GNKB 1A03A 1CNPA 1Q80A 4N1GA 1J7RA 3H4SE 1OZSA 3BUWB 1KK8B 4ZCVA 3WNXB 3NSKA 1KQMC 1LKJA 5GQQC 4E68A 1J7QA 2I2RE 2HETA 1EXRA 3TUYC 5DKNA 1TNWA 3CWGA 2Y1NA 1QJTA 1AP4A 2FJUB 3SG7A 1YUTA 1KK7Z 1PRWA 3RM1A 3MSEB 2JT0A 4AOMA 1YX8A 2PSRA 3O4YA 4FQOA 1CDMA 2MA2A 4OR9B 1WRLA 2K7DA 1BG1A 1GQMA 2CXJA 2LUXA 3FWBA 1SR6B 3CZTX 4ORAB 2LP2A 3EK8A 5FYXA 4OCIA 1QIVA 3FWCA 1JUOA 4HREE 2LM5A 2LC5A 3SG2A 4CFQA 3WXAA 2Q4UA 2ZNEA 1RTP1 1DTLA 1D1OA 4PE1A 5AANA 2LAPA 2KI4C 2LUCA 4GGFC 5DKQA 1MHOA 2JU0A 2M49B 3SG6A 3TS5B 1AJ4A 3ZWHA 2AMIA 1S5GY 3KO0A 3KEVA 2KFHA 2JT3A 5CSJA 1MXEA 1XK4C 2AAOA 1K96A 1ZFSA 1AK8A 5TNCA 1KQVA 1AHRA 1M31A 4ZCUA 1IJ5A 2LVKA 3PFVA 5CPVA 2LP3A 5KTYA 1J7OA 1PVBA 1M46A 5HKZA 3FS7A 3HCMA 2BCBA 4MZLA 5AERA 4Q04A 4TNCA 1VRKA 1MF8B 3I5IC 3IQQA 1YVHA 2LVVA 1WY9A 3TDZA 2K0JA 2KYFA 1N65A 3DVMA 3IF7A 2OTGC 1JWDA 1YX7A 3TUYB 1RK9A 1WLMA 2M1KB 5HYDA 1Y0VH 2LNKA 1BF5A 1R2UA 3LK1A 2KYCA 2I18A 1LA0A 2JRFA 1IJ6A 5J3XA 1UHIA 1UWOA 3OX5A 1E8AA 1QTXA 1MQ1A 5HKYA 4GGFA 2KI6D 1MR8A 1KFXS 1IH0A 1H8BA 1DJGA 1CTRA 1UURA 4GBAA 1GGZA 2O5GA 4P2YB 1K95A 2O60A 3OB1B 5PALA 2NXQA 4M2PA 2BCXA 1XK4A 2ZN9A 1ODBA 2MJWB 3LK0A 2KI4B 4MRXA 3KPXA 5KSZA 1DJXA 1QATA 3NSLA 1SCMC 3WHTB 1SW8A 2MAZA 3TS5C 1IQ3A 1OMRA 3PN7C 1UHJA 4ORBB 2KFGA 5AEQA 2BCAA 1YR5A 2COLB 2R2IA 1J55A 1OZOA 1SMGA 2PASA 1BJFA 3VROA 1OMVA 4N5XA 1CDNA 1AJ5A 4MBEA 1FF1A 3VRQA 2JNXA 1SYMA 1A29A 2E30A 3NSOA 3PALA 1YTZC 2L4HA 3EVUA 2HPSA 2L98A 2KSPA 4MZKA 2Q91A 3I5HC 3PATA 4CPVA 2MLEC 1TOPA 2QPTA 3BXKA 2H61C 1EJ3A 1PSRA 1K9KA 1S6IA 1JF0A 1CM4A 3I5IB 1BLQA 1ZOTB 3E3RA 1ALWA 2PRUA 1AUIB 2GGZA 1KFUL 4JQ0D 1NWDA 1B7TZ 1F71A 2JNFA 5I8NA 2K7BA 2OTGB 4NDDA 1EL4A 2NCOA 1K9UA 1CB1A 1SNLA 4NQGA 1RROA 1TTXA 3EKJA 2G9BA 3AKAA 2F2PA 1MXLC 3DVEA 3LL8B 4MSPA 1K8UA 2WCBA 3C1VA 4I5JA 1G33A 2LVIA 3CR4X 4C0LA 1CFPA 1JFJA 5HLVA 2JC2A 1IG5A 1BT6A 1YVLA 1LVCD 1PVAA 1SCVA 4PE7A 2OPOA 3EVRA 1XFZO 4PE0A 2JTZA 3AAKA 5HLOA 2WCFA 2M9GA 2I94A 1SCMB 2EHBA
chains in the Genus database with same CATH superfamily
5FI6A 3L47A 3PN7B 3RLZA 1JF2A 3SS3A 3B87A 4JWQA 1RWYA 1YRUB 4N1FA 2M8UA 2H61A 3D77A 2EC6C 4GUKA 4F0ZB 2VRGA 3SJSA 1QVIY 5I2OA 1Y6WA 1B8RA 4MRYA 1C3YA 3F45A 2BL0C 2E6WA 5F6TA 1CFFA 3I5FB 1Y1AA 2K2AA 2OS8C 2GGMA 2PMYA 1SK6D 3BUXB 3NGVA 1IKUA 4INXA 2QEHA 1MWNA 2KHNA 2H8VA 2K61A 1OOJA 2JOJA 1SPYA 1TNQA 1ZUZA 3N7HA 2HF5A 1FI6A 2LVJA 3L4AA 3JTDB 2BBMA 4YGEB 3I5HB 1OW4A 2KBIA 2HQ8A 4UPGA 4AQJA 1IRJA 2B1UA 2LV7A 1AVSA 1NPQA 3FE8A 3PM8A 4CIDA 3L4LA 1U5IA 2KQYA 1M45A 1Y1XA 2ZKMX 4GGNA 1W7IB 3TZ1A 1L2OC 1EG4A 1B4CA 3DYEA 1BR1B 4I5KA 3TDUA 3EVVA 1IIOA 4JKTA 3R1PA 4IL1A 1YUUA 1DJYA 1JFKA 1XFUO 1RJVA 1IQ5A 2QDIA 1R6PA 3O78A 3CLNA 4IJ7A 1LA3A 4R1EA 4QJ3B 1C07A 1C7VA 2KGRA 2L2EA 1U5IB 2Y5IA 1B1GA 1L7ZA 1UHNA 3CS1A 3DVJA 4JPZB 4ORCB 4PCWA 2QACA 1HQVA 1A75A 1QIWA 2F33A 2G2BA 2KOTA 3OP0A 4PDZA 1NX1A 4YBHB 3EK7A 3O2PA 3SIAA 2BBNA 3D76A 1CM1A 2KNEA 1TUZA 3CABA 1HT9A 2KPHA 3DZTA 3ICBA 4I5LB 1SRAA 4YGBB 3CGAA 4QJ5B 4HSZA 1PSBA 3CZ2A 4L9MA 2M7NA 1YRTB 1NX2A 2KFFA 3DD4A 3M0WA 4M2QA 4PT1A 1DMOA 2D8NA 1JSAA 1X02A 1IWQA 1M63B 1A75B 1DF0A 1DQEA 1SL9A 4YGAA 1W9ZA 4DRWA 1S5GZ 2JPTA 3O4XA 3GK4X 4OKHA 1WDCC 1F54A 2EC6B 3PLFB 4USLA 2KLEA 3B88A 2JULA 2K2FA 3BUMB 2BL0B 4PHKA 3I5FC 3O6BA 2OS8B 1JBAA 1K93D 3B86A 1FW4A 2P6BB 5CSNA 3RZSA 5D3OA 3S0EA 2WOSA 1N2DA 4GFTA 3JTDC 1J7PA 3DY9A 2ISDA 1B47A 1DF0B 2K8MB 2K7CA 2PVBA 1BR4B 2FCDA 3PJIA 4GAOA 1TNXA 1K2HA 1TCOB 4KYNA 1NCXA 1ZMZA 2K7OA 2HQWA 5D69A 2M97A 2ZNDA 1W7JB 2L4IA 1NX0A 1XFVO 2JXCA 2LMTA 4PHMA 4NDCA 3NHTA 4PALA 1XFWO 1OMDA 1LINA 1T14A 2LLUA 3D75A 3GK2A 1L2OB 2KI6C 4BY4A 4A4BA 1ORGA 1S1EA 5ER5A 1YURA 4NDBA 2M0RA 1WRKA 1NP8A 2WC8A 1K94A 2WCHA 4OVNF 5I2QA 3OB2B 4PHJA 2LMUA 5EL2A 1Z2CB 3D10A 3DXLA 4FTGA 1NSHA 1ZACA 4DCKA 2DOQA 2PALA 1BMOA 1C7WA 1FBVA 2KAXA 2SCPA 3BFBA 1TRFA 5K89A 4MVFA 1CLBA 1UHKA 1SSEB 2WORA 3JVTB 1NCYA 3EK4A 2F2OA 1BOCA 2A4JA 2LMVA 2NZ0A 1ALVA 2JXLA 3PSRA 2Y1MA 3VRNA 1DT7B 4PE4A 1B8CA 1DJZA 1UP5A 2JPOA 1YUSA 3EKHA 4MZJA 1DVIA 3VRRA 5JJGA 3FIAA 1DJHA 1SKTA 1NX3A 1SL8A 2SASA 2TN4A 3EG5B 4ETOA 1N0YA 2CNPA 2JWWA 1SL7A 3FE9A 3SS4A 1XFXO 2BKIB 5AXIA 1NUBA 1TIZA 1SY9A 1QASA 3D73A 1DGVA 2CBLA 2L51A 4M2OA 4WQ3A 4MLWA 1OE9B 3S0BA 1QV1A 1B9AA 1KCYA 1C3ZA 3SG4A 1MUXA 1WDCB 2NCPA 5HKWA 5ER4X 1TNPA 3I5GB 3AKBA 2BKHB 1RFJA 4QJ4B 1KFUS 2RGIA 1EH2A 1Y1UA 3VGOA 2M7LA 1KSOA 1QLKA 5IBWA 1BODA 3BOWA 4XJKA 1PALA 2WCJA 1GJYA 3PM2A 1KWOC 2ZN8A 3HX4A 2M1UA 1UUSA 2KAVA 3DF0A 2F8PA 1S6JA 4DS7A 3SIBA 4HRGA 2BE4A 2EGDA 4XYNA 1NCZA 1KFXL 3A8RA 4GPLB 5D7FA 2L5XB 2ZFDA 5CSFA 3B6XA 5FI2A 2FOTA 2QEBA 3BOWB 2WCMA 4XJKB 5G08A 4D1EA 3IQOA 2L2CA 2WCKA 3BUOB 1JC2A 1RECA 5BPJA 1CLMA 3DF0B 5I2LA 1B8LA 1EG3A 4OV2A 5HL1A 1QS7A 3CTNA 1A4PA 1F8HA 1WLZA 1NIWA 1XA5A 1TCFA 3K21A 2LANA 3NHIA 3TDIA 4DIRA 3OHMB 3KHEA 5JOLA 4YGDB 5B8IB 1DJWA 2FCEA 2V53A 4C0JA 3R1OA 1QV0A 2ZRSA 1XYDA 1F4OA 2H2KA 3JVTC 1CKKA 5CSIA 1OOIX 1KK8C 2MHHA 1J1EA 1KQMB 5DKRA 4F7FA 1B7TY 2F3YA 4A4CA 4YI9A 4CFRA 2NLNA 2KDHA 3VRPA 1CLLA 1K90D 2WCEA 1XO5A 2KGBC 3BUNB 2PQLA 4MEWA 4ICBA 2M3WA 1S6CA 2KQ6A 2WNDA 1KK7Y 3D0YA 2K60A 3FE6A 3SG3A 2GV5A 3CR2A 1XFYO 4MN0A 1KSMA 4BY5A 3UNWA 2ZRTA 1OSAA 1QX5B 2LLTA 1H4BA 1QX2A 2CTNA 4WQ2A 1NYAA 4C0KA 1F70A 4HRHA 2MLFC 4WRIA 4PHNA 1LXFC 1SR6C 1TN4A 2F3ZA 1QVIZ 2JQ6A 2L50A 2M29A 2BE6A 1BU3A 2MRDA 2LHLA 2L5YA 3CR5X 3I5GC 1UHHA 4P5OE 4U8DA 1S26D 3GK1A 2QEVA 3BFHA 2JZIA 2KBMA 2L0PA 2LHIA 3NSIA 1PULA 2BECA 3D0YB 1GGWA 1J1DA 2CT9A 2LCPA 2JTTA 1KWOB 1IGVA 1QLSA 1V1FA 2CCMA 2WC6A 4CLNA 1F55A 2JT8A 4YRUA 1OQPA 1OOFA 1TWOA 1QXPA 2KLDA 1S3PA 3WHUB 3OGNA 2BNXA 1SBJA 3QRXA 1FPWA 1DJIA 2MBXA 1G4YR 1K9PA 1S36A 3LLEA 4YGCB 1DGUA 3BYAA 1WRZA 2KAYA 3LCPC 1G8IA 4I5NB 3KF9A 1CMGA 3ZNIA 1M39A 1QX7A 2Y4QA 4AQIA 1FI5A 1CDPA 3BQ3A 3A4UB 2LE9B 3OX6A 3NXAA 1V1GA 3CZ1A 1CFCA 3AAJA 1A2XA 3V2LA 1CFDA 2WCLA 4YI8A 2AUCA 3GOFA 2I7AA 1CDLA 1F4QA 5AFPA 2IS9A 3SG5A 3DVKA 1PK0D 1XVJA 2LLSA 1CMFA 5KU1A 4GNKB 1A03A 1CNPA 1Q80A 4N1GA 1J7RA 3H4SE 1OZSA 3BUWB 1KK8B 4ZCVA 3WNXB 3NSKA 1KQMC 1LKJA 5GQQC 4E68A 1J7QA 1OOGA 2I2RE 2HETA 1EXRA 3TUYC 3IVTA 4JD9A 1Z4HA 1TNWA 5DKNA 3CWGA 2Y1NA 1QJTA 1P28A 1AP4A 2FJUB 3SG7A 1YUTA 1KK7Z 1PRWA 3RM1A 3MSEB 2JT0A 4AOMA 1YX8A 2PSRA 3O4YA 4FQOA 1CDMA 2MA2A 4OR9B 1WRLA 2K7DA 1BG1A 1GQMA 2CXJA 2LUXA 3FWBA 1SR6B 2PYQA 3CZTX 4ORAB 2LP2A 3EK8A 5FYXA 2FJYA 1XFRA 4OCIA 1QIVA 3FWCA 1JUOA 4HREE 2LM5A 1DEKA 2LC5A 3D74A 3SG2A 3UO9A 2Q4UA 2ZNEA 3WXAA 4CFQA 1RTP1 1DTLA 1D1OA 4PE1A 5AANA 2LAPA 2KI4C 2LUCA 4GGFC 5DKQA 1MHOA 2JU0A 2M49B 3SG6A 3TS5B 1AJ4A 2WC5A 3ZWHA 2AMIA 3QMEA 1S5GY 3KO0A 3KEVA 1DC1A 2KFHA 2JT3A 4OZDA 5CSJA 1MXEA 1XK4C 2AAOA 1K96A 1ZFSA 1AK8A 2BAPA 5TNCA 1KQVA 1AHRA 1M31A 4ZCUA 1IJ5A 2LVKA 3PFVA 5CPVA 2LP3A 5KTYA 1J7OA 1PVBA 1M46A 5HKZA 3FS7A 3HCMA 2BCBA 4MZLA 5AERA 4Q04A 4TNCA 1VRKA 1MF8B 3I5IC 3BJHA 3IQQA 1YVHA 2LVVA 1WY9A 3TDZA 2K0JA 2KYFA 3S0DA 1N65A 3DVMA 3IF7A 2OTGC 1JWDA 1YX7A 3TUYB 1LS8A 1RK9A 1WLMA 2M1KB 3Q8IA 5HYDA 1Y0VH 2GTEA 2LNKA 1BF5A 1R2UA 3S0AA 4INWA 3LK1A 2KYCA 2QEOA 2I18A 1LA0A 2JRFA 3BFAA 1IJ6A 5J3XA 1UHIA 1UWOA 3OX5A 1E8AA 3K1EA 5I94A 1QTXA 3SS5A 1MQ1A 3R1VA 5HKYA 4GGFA 2KI6D 1MR8A 1KFXS 1IH0A 1H8BA 1OOHA 1DJGA 2YGUA 2P70A 1CTRA 1UURA 4GBAA 1GGZA 2O5GA 4P2YB 1K95A 2O60A 3OB1B 5PALA 2NXQA 4M2PA 2BCXA 1XK4A 2ZN9A 1ODBA 5DICA 3S0FA 2MJWB 3LK0A 2KI4B 4MRXA 3KPXA 5KSZA 1DJXA 1QATA 3NSLA 1SCMC 3WHTB 1SW8A 2MAZA 3TS5C 1IQ3A 1OMRA 3PN7C 1UHJA 4ORBB 2KFGA 5AEQA 2BCAA 1YR5A 2COLB 2R2IA 1J55A 1OZOA 1SMGA 2PASA 1BJFA 3VROA 1OMVA 3CZ0A 4N5XA 1CDNA 1AJ5A 4MBEA 1FF1A 3VRQA 4DUQA 2JNXA 1SYMA 1A29A 2E30A 3NSOA 3PALA 3S0GA 1YTZC 2L4HA 3EVUA 2HPSA 5FI7A 2L98A 1DELA 2KSPA 4MZKA 2Q91A 3I5HC 3PATA 4CPVA 2MLEC 1TOPA 2ERBA 2QPTA 3BXKA 2P71A 2H61C 1EJ3A 1PSRA 1K9KA 1S6IA 1QWVA 1GM0A 1JF0A 1CM4A 3I5IB 1BLQA 1ZOTB 3E3RA 1ALWA 2PRUA 3B7AA 1AUIB 2GGZA 1KFUL 4JQ0D 1NWDA 1B7TZ 1F71A 2JNFA 5I8NA 2K7BA 2OTGB 4NDDA 1EL4A 2NCOA 3OBVA 1K9UA 1CB1A 1SNLA 4NQGA 1RROA 1TTXA 3EKJA 2G9BA 3AKAA 2F2PA 1MXLC 3DVEA 3LL8B 4MSPA 1K8UA 2WCBA 3C1VA 4I5JA 1G33A 2LVIA 3CR4X 4C0LA 1CFPA 1JFJA 5HLVA 2JC2A 1IG5A 1BT6A 1YVLA 1LVCD 3CYZA 3R72A 1PVAA 1SCVA 3D78A 4PE7A 2OPOA 3EVRA 1XFZO 4PE0A 2JTZA 3AAKA 5HLOA 2WCFA 2M9GA 2I94A 1SCMB 1TUJA 2EHBA 4FQTA 3CDNA 3VB1A
chains in the Genus database with same CATH topology
3PN7B 3RLZA 1JF2A 4JWQA 1RWYA 1YRUB 4N1FA 2M8UA 2H61A 4GUKA 2EC6C 4F0ZB 2VRGA 3SJSA 1QVIY 5I2OA 1Y6WA 1B8RA 4MRYA 3F45A 2BL0C 2E6WA 5F6TA 1CFFA 3I5FB 1Y1AA 2K2AA 2OS8C 2GGMA 2PMYA 1SK6D 3BUXB 1IKUA 1MWNA 2KHNA 2K61A 1OOJA 2JOJA 1SPYA 1TNQA 1ZUZA 2HF5A 2LVJA 3JTDB 2BBMA 4YGEB 3I5HB 2KBIA 2HQ8A 4UPGA 4AQJA 1IRJA 2B1UA 2LV7A 1AVSA 1NPQA 3PM8A 4CIDA 1U5IA 2KQYA 1M45A 1Y1XA 2ZKMX 4GGNA 1W7IB 3TZ1A 1L2OC 1EG4A 1B4CA 4I5KA 1BR1B 3TDUA 3EVVA 4IL1A 1YUUA 1DJYA 1JFKA 1XFUO 1RJVA 1IQ5A 1R6PA 3O78A 3CLNA 1LA3A 4R1EA 4QJ3B 1C07A 1C7VA 2KGRA 2L2EA 1U5IB 2Y5IA 1B1GA 1L7ZA 1UHNA 3CS1A 3DVJA 4JPZB 4ORCB 4PCWA 2QACA 1HQVA 1A75A 1QIWA 2F33A 2G2BA 2KOTA 3OP0A 4PDZA 1NX1A 4YBHB 3EK7A 3O2PA 3SIAA 2BBNA 1FI6A 1CM1A 2KNEA 3ICBA 4I5LB 1HT9A 4YGBB 4CFRA 1SRAA 4QJ5B 3CGAA 4HSZA 1PSBA 4L9MA 2M7NA 1YRTB 1NX2A 2KFFA 3DD4A 3M0WA 4M2QA 1DMOA 2D8NA 1JSAA 1X02A 1IWQA 1M63B 1A75B 1DF0A 1SL9A 4YGAA 4DRWA 1S5GZ 2JPTA 4OKHA 3GK4X 1F54A 1WDCC 2EC6B 3PLFB 4USLA 2JULA 2K2FA 3BUMB 2BL0B 4PHKA 3I5FC 3O6BA 2OS8B 1JBAA 1K93D 1FW4A 2P6BB 5CSNA 2WOSA 1N2DA 4GFTA 3JTDC 1J7PA 2ISDA 1B47A 1DF0B 2K8MB 2K7CA 2PVBA 1BR4B 2FCDA 4GAOA 1TNXA 1K2HA 1TCOB 1NCXA 1ZMZA 2K7OA 2HQWA 5D69A 2M97A 2ZNDA 1W7JB 2L4IA 1NX0A 1XFVO 2JXCA 2LMTA 4PHMA 4NDCA 4PALA 1XFWO 1OMDA 1LINA 2LLUA 3GK2A 1L2OB 2KI6C 4BY4A 4A4BA 1S1EA 5ER5A 1YURA 4NDBA 2M0RA 1WRKA 1NP8A 2WC8A 1K94A 4OVNF 5I2QA 3OB2B 4PHJA 2LMUA 3D10A 4FTGA 4DCKA 1NSHA 1ZACA 2DOQA 2PALA 1BMOA 1C7WA 1FBVA 2KAXA 2SCPA 5K89A 1TRFA 1CLBA 4MVFA 1UHKA 2WORA 3JVTB 1NCYA 3EK4A 2F2OA 1BOCA 2A4JA 2LMVA 2NZ0A 1ALVA 2JXLA 3PSRA 2Y1MA 3VRNA 1DT7B 4PE4A 1B8CA 1DJZA 1UP5A 3EKHA 1YUSA 4MZJA 5JJGA 1DVIA 3VRRA 3FIAA 1DJHA 1SKTA 1NX3A 1SL8A 2SASA 2TN4A 4ETOA 1N0YA 2CNPA 2JWWA 1SL7A 1XFXO 2BKIB 5AXIA 1NUBA 1TIZA 1SY9A 1QASA 4WQ3A 1DGVA 2CBLA 2L51A 4M2OA 4MLWA 1OE9B 1QV1A 1B9AA 1KCYA 3SG4A 1MUXA 1WDCB 2NCPA 5HKWA 5ER4X 1TNPA 3I5GB 3AKBA 2BKHB 1RFJA 4QJ4B 1KFUS 2RGIA 1EH2A 1Y1UA 3VGOA 2M7LA 1KSOA 1QLKA 5IBWA 1BODA 3BOWA 4XJKA 1PALA 1GJYA 1KWOC 2ZN8A 3HX4A 2M1UA 1UUSA 2KAVA 3DF0A 2F8PA 1S6JA 4DS7A 3SIBA 4HRGA 2BE4A 2EGDA 4XYNA 1NCZA 1KFXL 3A8RA 4GPLB 5D7FA 2L5XB 2ZFDA 5CSFA 2FOTA 3BOWB 4XJKB 5G08A 4D1EA 3IQOA 3BUOB 1JC2A 1RECA 5BPJA 1CLMA 3DF0B 5I2LA 1B8LA 1EG3A 4OV2A 1QS7A 3CTNA 1A4PA 1F8HA 1WLZA 1NIWA 1XA5A 1TCFA 3K21A 2LANA 3TDIA 4DIRA 3OHMB 3KHEA 5JOLA 4YGDB 5B8IB 1DJWA 2FCEA 2V53A 4C0JA 1QV0A 2ZRSA 1XYDA 1F4OA 2H2KA 3JVTC 1CKKA 5CSIA 1KK8C 2MHHA 1J1EA 1KQMB 5DKRA 1B7TY 2F3YA 4A4CA 4YI9A 2NLNA 2KDHA 3VRPA 1CLLA 1K90D 2WCEA 1XO5A 2KGBC 3BUNB 4MEWA 4ICBA 2M3WA 1S6CA 2KQ6A 2WNDA 1KK7Y 3D0YA 3SG3A 2GV5A 3CR2A 1XFYO 4MN0A 1KSMA 4BY5A 2ZRTA 1OSAA 1QX5B 2LLTA 1H4BA 1QX2A 2CTNA 4WQ2A 1NYAA 4C0KA 1F70A 4HRHA 2MLFC 4WRIA 4PHNA 1LXFC 1SR6C 1TN4A 2F3ZA 1QVIZ 2JQ6A 2L50A 2M29A 2BE6A 1BU3A 2MRDA 2LHLA 3CR5X 3I5GC 4DUQA 1UHHA 4P5OE 4U8DA 1S26D 3GK1A 2JZIA 2KBMA 2L0PA 2LHIA 3NSIA 1PULA 2BECA 3D0YB 1GGWA 1J1DA 2CT9A 2LCPA 2JTTA 1KWOB 1IGVA 1QLSA 1V1FA 2CCMA 4CLNA 1F55A 2JT8A 4YRUA 1OQPA 1QXPA 3WHUB 1S3PA 1SBJA 3QRXA 1FPWA 1DJIA 2MBXA 1G4YR 1K9PA 1S36A 3LLEA 4YGCB 1DGUA 3BYAA 1WRZA 2KAYA 3LCPC 1G8IA 4I5NB 3KF9A 1CMGA 3ZNIA 1M39A 1QX7A 2Y4QA 4AQIA 1FI5A 1CDPA 3BQ3A 3A4UB 2LE9B 3OX6A 3NXAA 1V1GA 1CFCA 3AAJA 1A2XA 1CFDA 4YI8A 2AUCA 3GOFA 2I7AA 1CDLA 1F4QA 5AFPA 2IS9A 3SG5A 3DVKA 1PK0D 1XVJA 2LLSA 1CMFA 5KU1A 4GNKB 1A03A 1CNPA 1Q80A 4N1GA 1J7RA 3H4SE 1OZSA 3BUWB 1KK8B 4ZCVA 3WNXB 3NSKA 1KQMC 1LKJA 5GQQC 4E68A 1J7QA 2I2RE 2HETA 1EXRA 3TUYC 5DKNA 1TNWA 3CWGA 2Y1NA 1QJTA 1AP4A 2FJUB 3SG7A 1YUTA 1KK7Z 1PRWA 3RM1A 3MSEB 2JT0A 4AOMA 1YX8A 2PSRA 3O4YA 4FQOA 1CDMA 2MA2A 4OR9B 1WRLA 2K7DA 1BG1A 1GQMA 2CXJA 2LUXA 3FWBA 1SR6B 3CZTX 4ORAB 2LP2A 3EK8A 5FYXA 4OCIA 1QIVA 3FWCA 1JUOA 4HREE 2LM5A 2LC5A 3SG2A 4CFQA 3WXAA 2Q4UA 2ZNEA 1RTP1 1DTLA 1D1OA 4PE1A 5AANA 2LAPA 2KI4C 2LUCA 4GGFC 5DKQA 1MHOA 2JU0A 2M49B 3SG6A 3TS5B 1AJ4A 3ZWHA 2AMIA 1S5GY 3KO0A 3KEVA 2KFHA 2JT3A 5CSJA 1MXEA 1XK4C 2AAOA 1K96A 1ZFSA 1AK8A 5TNCA 1KQVA 1AHRA 1M31A 4ZCUA 1IJ5A 2LVKA 3PFVA 5CPVA 2LP3A 5KTYA 1J7OA 1PVBA 1M46A 5HKZA 3FS7A 3HCMA 2BCBA 4MZLA 5AERA 4Q04A 4TNCA 1VRKA 1MF8B 3I5IC 3IQQA 1YVHA 2LVVA 1WY9A 3TDZA 2K0JA 2KYFA 1N65A 3DVMA 3IF7A 2OTGC 1JWDA 1YX7A 3TUYB 1RK9A 1WLMA 2M1KB 5HYDA 1Y0VH 2LNKA 1BF5A 1R2UA 3LK1A 2KYCA 2I18A 1LA0A 2JRFA 1IJ6A 5J3XA 1UHIA 1UWOA 3OX5A 1E8AA 1QTXA 1MQ1A 5HKYA 4GGFA 2KI6D 1MR8A 1KFXS 1IH0A 1H8BA 1DJGA 1CTRA 1UURA 4GBAA 1GGZA 2O5GA 4P2YB 1K95A 2O60A 3OB1B 5PALA 2NXQA 4M2PA 2BCXA 1XK4A 2ZN9A 1ODBA 2MJWB 3LK0A 2KI4B 4MRXA 3KPXA 5KSZA 1DJXA 1QATA 3NSLA 1SCMC 3WHTB 1SW8A 2MAZA 3TS5C 1IQ3A 1OMRA 3PN7C 1UHJA 4ORBB 2KFGA 5AEQA 2BCAA 1YR5A 2COLB 2R2IA 1J55A 1OZOA 1SMGA 2PASA 1BJFA 3VROA 1OMVA 4N5XA 1CDNA 1AJ5A 4MBEA 1FF1A 3VRQA 2JNXA 1SYMA 1A29A 2E30A 3NSOA 3PALA 1YTZC 2L4HA 3EVUA 2HPSA 2L98A 2KSPA 4MZKA 2Q91A 3I5HC 3PATA 4CPVA 2MLEC 1TOPA 2QPTA 3BXKA 2H61C 1EJ3A 1PSRA 1K9KA 1S6IA 1JF0A 1CM4A 3I5IB 1BLQA 1ZOTB 3E3RA 1ALWA 2PRUA 1AUIB 2GGZA 1KFUL 4JQ0D 1NWDA 1B7TZ 1F71A 2JNFA 5I8NA 2K7BA 2OTGB 4NDDA 1EL4A 2NCOA 1K9UA 1CB1A 1SNLA 4NQGA 1RROA 1TTXA 3EKJA 2G9BA 3AKAA 2F2PA 1MXLC 3DVEA 3LL8B 4MSPA 1K8UA 2WCBA 3C1VA 4I5JA 1G33A 2LVIA 3CR4X 4C0LA 1CFPA 1JFJA 5HLVA 2JC2A 1IG5A 1BT6A 1YVLA 1LVCD 1PVAA 1SCVA 4PE7A 2OPOA 3EVRA 1XFZO 4PE0A 2JTZA 3AAKA 5HLOA 2WCFA 2M9GA 2I94A 1SCMB 2EHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 B;  3RLZ A;  1JF2 A;  4JWQ A;  1RWY A;  1YRU B;  4N1F A;  2M8U A;  2H61 A;  4GUK A;  2EC6 C;  4F0Z B;  2VRG A;  3SJS A;  1QVI Y;  5I2O A;  1Y6W A;  1B8R A;  4MRY A;  3F45 A;  2BL0 C;  2E6W A;  5F6T A;  1CFF A;  3I5F B;  1Y1A A;  2K2A A;  2OS8 C;  2GGM A;  2PMY A;  1SK6 D;  3BUX B;  1IKU A;  1MWN A;  2KHN A;  2K61 A;  1OOJ A;  2JOJ A;  1SPY A;  1TNQ A;  1ZUZ A;  2HF5 A;  2LVJ A;  3JTD B;  2BBM A;  4YGE B;  3I5H B;  2KBI A;  2HQ8 A;  4UPG A;  4AQJ A;  1IRJ A;  2B1U A;  2LV7 A;  1AVS A;  1NPQ A;  3PM8 A;  4CID A;  1U5I A;  2KQY A;  1M45 A;  1Y1X A;  2ZKM X;  4GGN A;  1W7I B;  3TZ1 A;  1L2O C;  1EG4 A;  1B4C A;  4I5K A;  1BR1 B;  3TDU A;  3EVV A;  4IL1 A;  1YUU A;  1DJY A;  1JFK A;  1XFU O;  1RJV A;  1IQ5 A;  1R6P A;  3O78 A;  3CLN A;  1LA3 A;  4R1E A;  4QJ3 B;  1C07 A;  1C7V A;  2KGR A;  2L2E A;  1U5I B;  2Y5I A;  1B1G A;  1L7Z A;  1UHN A;  3CS1 A;  3DVJ A;  4JPZ B;  4ORC B;  4PCW A;  2QAC A;  1HQV A;  1A75 A;  1QIW A;  2F33 A;  2G2B A;  2KOT A;  3OP0 A;  4PDZ A;  1NX1 A;  4YBH B;  3EK7 A;  3O2P A;  3SIA A;  2BBN A;  1FI6 A;  1CM1 A;  2KNE A;  3ICB A;  4I5L B;  1HT9 A;  4YGB B;  4CFR A;  1SRA A;  4QJ5 B;  3CGA A;  4HSZ A;  1PSB A;  4L9M A;  2M7N A;  1YRT B;  1NX2 A;  2KFF A;  3DD4 A;  3M0W A;  4M2Q A;  1DMO A;  2D8N A;  1JSA A;  1X02 A;  1IWQ A;  1M63 B;  1A75 B;  1DF0 A;  1SL9 A;  4YGA A;  4DRW A;  1S5G Z;  2JPT A;  4OKH A;  3GK4 X;  1F54 A;  1WDC C;  2EC6 B;  3PLF B;  4USL A;  2JUL A;  2K2F A;  3BUM B;  2BL0 B;  4PHK A;  3I5F C;  3O6B A;  2OS8 B;  1JBA A;  1K93 D;  1FW4 A;  2P6B B;  5CSN A;  2WOS A;  1N2D A;  4GFT A;  3JTD C;  1J7P A;  2ISD A;  1B47 A;  1DF0 B;  2K8M B;  2K7C A;  2PVB A;  1BR4 B;  2FCD A;  4GAO A;  1TNX A;  1K2H A;  1TCO B;  1NCX A;  1ZMZ A;  2K7O A;  2HQW A;  5D69 A;  2M97 A;  2ZND A;  1W7J B;  2L4I A;  1NX0 A;  1XFV O;  2JXC A;  2LMT A;  4PHM A;  4NDC A;  4PAL A;  1XFW O;  1OMD A;  1LIN A;  2LLU A;  3GK2 A;  1L2O B;  2KI6 C;  4BY4 A;  4A4B A;  1S1E A;  5ER5 A;  1YUR A;  4NDB A;  2M0R A;  1WRK A;  1NP8 A;  2WC8 A;  1K94 A;  4OVN F;  5I2Q A;  3OB2 B;  4PHJ A;  2LMU A;  3D10 A;  4FTG A;  4DCK A;  1NSH A;  1ZAC A;  2DOQ A;  2PAL A;  1BMO A;  1C7W A;  1FBV A;  2KAX A;  2SCP A;  5K89 A;  1TRF A;  1CLB A;  4MVF A;  1UHK A;  2WOR A;  3JVT B;  1NCY A;  3EK4 A;  2F2O A;  1BOC A;  2A4J A;  2LMV A;  2NZ0 A;  1ALV A;  2JXL A;  3PSR A;  2Y1M A;  3VRN A;  1DT7 B;  4PE4 A;  1B8C A;  1DJZ A;  1UP5 A;  3EKH A;  1YUS A;  4MZJ A;  5JJG A;  1DVI A;  3VRR A;  3FIA A;  1DJH A;  1SKT A;  1NX3 A;  1SL8 A;  2SAS A;  2TN4 A;  4ETO A;  1N0Y A;  2CNP A;  2JWW A;  1SL7 A;  1XFX O;  2BKI B;  5AXI A;  1NUB A;  1TIZ A;  1SY9 A;  1QAS A;  4WQ3 A;  1DGV A;  2CBL A;  2L51 A;  4M2O A;  4MLW A;  1OE9 B;  1QV1 A;  1B9A A;  1KCY A;  3SG4 A;  1MUX A;  1WDC B;  2NCP A;  5HKW A;  5ER4 X;  1TNP A;  3I5G B;  3AKB A;  2BKH B;  1RFJ A;  4QJ4 B;  1KFU S;  2RGI A;  1EH2 A;  1Y1U A;  3VGO A;  2M7L A;  1KSO A;  1QLK A;  5IBW A;  1BOD A;  3BOW A;  4XJK A;  1PAL A;  1GJY A;  1KWO C;  2ZN8 A;  3HX4 A;  2M1U A;  1UUS A;  2KAV A;  3DF0 A;  2F8P A;  1S6J A;  4DS7 A;  3SIB A;  4HRG A;  2BE4 A;  2EGD A;  4XYN A;  1NCZ A;  1KFX L;  3A8R A;  4GPL B;  5D7F A;  2L5X B;  2ZFD A;  5CSF A;  2FOT A;  3BOW B;  4XJK B;  5G08 A;  4D1E A;  3IQO A;  3BUO B;  1JC2 A;  1REC A;  5BPJ A;  1CLM A;  3DF0 B;  5I2L A;  1B8L A;  1EG3 A;  4OV2 A;  1QS7 A;  3CTN A;  1A4P A;  1F8H A;  1WLZ A;  1NIW A;  1XA5 A;  1TCF A;  3K21 A;  2LAN A;  3TDI A;  4DIR A;  3OHM B;  3KHE A;  5JOL A;  4YGD B;  5B8I B;  1DJW A;  2FCE A;  2V53 A;  4C0J A;  1QV0 A;  2ZRS A;  1XYD A;  1F4O A;  2H2K A;  3JVT C;  1CKK A;  5CSI A;  1KK8 C;  2MHH A;  1J1E A;  1KQM B;  5DKR A;  1B7T Y;  2F3Y A;  4A4C A;  4YI9 A;  2NLN A;  2KDH A;  3VRP A;  1CLL A;  1K90 D;  2WCE A;  1XO5 A;  2KGB C;  3BUN B;  4MEW A;  4ICB A;  2M3W A;  1S6C A;  2KQ6 A;  2WND A;  1KK7 Y;  3D0Y A;  3SG3 A;  2GV5 A;  3CR2 A;  1XFY O;  4MN0 A;  1KSM A;  4BY5 A;  2ZRT A;  1OSA A;  1QX5 B;  2LLT A;  1H4B A;  1QX2 A;  2CTN A;  4WQ2 A;  1NYA A;  4C0K A;  1F70 A;  4HRH A;  2MLF C;  4WRI A;  4PHN A;  1LXF C;  1SR6 C;  1TN4 A;  2F3Z A;  1QVI Z;  2JQ6 A;  2L50 A;  2M29 A;  2BE6 A;  1BU3 A;  2MRD A;  2LHL A;  3CR5 X;  3I5G C;  4DUQ A;  1UHH A;  4P5O E;  4U8D A;  1S26 D;  3GK1 A;  2JZI A;  2KBM A;  2L0P A;  2LHI A;  3NSI A;  1PUL A;  2BEC A;  3D0Y B;  1GGW A;  1J1D A;  2CT9 A;  2LCP A;  2JTT A;  1KWO B;  1IGV A;  1QLS A;  1V1F A;  2CCM A;  4CLN A;  1F55 A;  2JT8 A;  4YRU A;  1OQP A;  1QXP A;  3WHU B;  1S3P A;  1SBJ A;  3QRX A;  1FPW A;  1DJI A;  2MBX A;  1G4Y R;  1K9P A;  1S36 A;  3LLE A;  4YGC B;  1DGU A;  3BYA A;  1WRZ A;  2KAY A;  3LCP C;  1G8I A;  4I5N B;  3KF9 A;  1CMG A;  3ZNI A;  1M39 A;  1QX7 A;  2Y4Q A;  4AQI A;  1FI5 A;  1CDP A;  3BQ3 A;  3A4U B;  2LE9 B;  3OX6 A;  3NXA A;  1V1G A;  1CFC A;  3AAJ A;  1A2X A;  1CFD A;  4YI8 A;  2AUC A;  3GOF A;  2I7A A;  1CDL A;  1F4Q A;  5AFP A;  2IS9 A;  3SG5 A;  3DVK A;  1PK0 D;  1XVJ A;  2LLS A;  1CMF A;  5KU1 A;  4GNK B;  1A03 A;  1CNP A;  1Q80 A;  4N1G A;  1J7R A;  3H4S E;  1OZS A;  3BUW B;  1KK8 B;  4ZCV A;  3WNX B;  3NSK A;  1KQM C;  1LKJ A;  5GQQ C;  4E68 A;  1J7Q A;  2I2R E;  2HET A;  1EXR A;  3TUY C;  5DKN A;  1TNW A;  3CWG A;  2Y1N A;  1QJT A;  1AP4 A;  2FJU B;  3SG7 A;  1YUT A;  1KK7 Z;  1PRW A;  3RM1 A;  3MSE B;  2JT0 A;  4AOM A;  1YX8 A;  2PSR A;  3O4Y A;  4FQO A;  1CDM A;  2MA2 A;  4OR9 B;  1WRL A;  2K7D A;  1BG1 A;  1GQM A;  2CXJ A;  2LUX A;  3FWB A;  1SR6 B;  3CZT X;  4ORA B;  2LP2 A;  3EK8 A;  5FYX A;  4OCI A;  1QIV A;  3FWC A;  1JUO A;  4HRE E;  2LM5 A;  2LC5 A;  3SG2 A;  4CFQ A;  3WXA A;  2Q4U A;  2ZNE A;  1RTP 1;  1DTL A;  1D1O A;  4PE1 A;  5AAN A;  2LAP A;  2KI4 C;  2LUC A;  4GGF C;  5DKQ A;  1MHO A;  2JU0 A;  2M49 B;  3SG6 A;  3TS5 B;  1AJ4 A;  3ZWH A;  2AMI A;  1S5G Y;  3KO0 A;  3KEV A;  2KFH A;  2JT3 A;  5CSJ A;  1MXE A;  1XK4 C;  2AAO A;  1K96 A;  1ZFS A;  1AK8 A;  5TNC A;  1KQV A;  1AHR A;  1M31 A;  4ZCU A;  1IJ5 A;  2LVK A;  3PFV A;  5CPV A;  2LP3 A;  5KTY A;  1J7O A;  1PVB A;  1M46 A;  5HKZ A;  3FS7 A;  3HCM A;  2BCB A;  4MZL A;  5AER A;  4Q04 A;  4TNC A;  1VRK A;  1MF8 B;  3I5I C;  3IQQ A;  1YVH A;  2LVV A;  1WY9 A;  3TDZ A;  2K0J A;  2KYF A;  1N65 A;  3DVM A;  3IF7 A;  2OTG C;  1JWD A;  1YX7 A;  3TUY B;  1RK9 A;  1WLM A;  2M1K B;  5HYD A;  1Y0V H;  2LNK A;  1BF5 A;  1R2U A;  3LK1 A;  2KYC A;  2I18 A;  1LA0 A;  2JRF A;  1IJ6 A;  5J3X A;  1UHI A;  1UWO A;  3OX5 A;  1E8A A;  1QTX A;  1MQ1 A;  5HKY A;  4GGF A;  2KI6 D;  1MR8 A;  1KFX S;  1IH0 A;  1H8B A;  1DJG A;  1CTR A;  1UUR A;  4GBA A;  1GGZ A;  2O5G A;  4P2Y B;  1K95 A;  2O60 A;  3OB1 B;  5PAL A;  2NXQ A;  4M2P A;  2BCX A;  1XK4 A;  2ZN9 A;  1ODB A;  2MJW B;  3LK0 A;  2KI4 B;  4MRX A;  3KPX A;  5KSZ A;  1DJX A;  1QAT A;  3NSL A;  1SCM C;  3WHT B;  1SW8 A;  2MAZ A;  3TS5 C;  1IQ3 A;  1OMR A;  3PN7 C;  1UHJ A;  4ORB B;  2KFG A;  5AEQ A;  2BCA A;  1YR5 A;  2COL B;  2R2I A;  1J55 A;  1OZO A;  1SMG A;  2PAS A;  1BJF A;  3VRO A;  1OMV A;  4N5X A;  1CDN A;  1AJ5 A;  4MBE A;  1FF1 A;  3VRQ A;  2JNX A;  1SYM A;  1A29 A;  2E30 A;  3NSO A;  3PAL A;  1YTZ C;  2L4H A;  3EVU A;  2HPS A;  2L98 A;  2KSP A;  4MZK A;  2Q91 A;  3I5H C;  3PAT A;  4CPV A;  2MLE C;  1TOP A;  2QPT A;  3BXK A;  2H61 C;  1EJ3 A;  1PSR A;  1K9K A;  1S6I A;  1JF0 A;  1CM4 A;  3I5I B;  1BLQ A;  1ZOT B;  3E3R A;  1ALW A;  2PRU A;  1AUI B;  2GGZ A;  1KFU L;  4JQ0 D;  1NWD A;  1B7T Z;  1F71 A;  2JNF A;  5I8N A;  2K7B A;  2OTG B;  4NDD A;  1EL4 A;  2NCO A;  1K9U A;  1CB1 A;  1SNL A;  4NQG A;  1RRO A;  1TTX A;  3EKJ A;  2G9B A;  3AKA A;  2F2P A;  1MXL C;  3DVE A;  3LL8 B;  4MSP A;  1K8U A;  2WCB A;  3C1V A;  4I5J A;  1G33 A;  2LVI A;  3CR4 X;  4C0L A;  1CFP A;  1JFJ A;  5HLV A;  2JC2 A;  1IG5 A;  1BT6 A;  1YVL A;  1LVC D;  1PVA A;  1SCV A;  4PE7 A;  2OPO A;  3EVR A;  1XFZ O;  4PE0 A;  2JTZ A;  3AAK A;  5HLO A;  2WCF A;  2M9G A;  2I94 A;  1SCM B;  2EHB A; 
#chains in the Genus database with same CATH topology
 5FI6 A;  3L47 A;  3PN7 B;  3RLZ A;  1JF2 A;  3SS3 A;  3B87 A;  4JWQ A;  1RWY A;  1YRU B;  4N1F A;  2M8U A;  2H61 A;  3D77 A;  2EC6 C;  4GUK A;  4F0Z B;  2VRG A;  3SJS A;  1QVI Y;  5I2O A;  1Y6W A;  1B8R A;  4MRY A;  1C3Y A;  3F45 A;  2BL0 C;  2E6W A;  5F6T A;  1CFF A;  3I5F B;  1Y1A A;  2K2A A;  2OS8 C;  2GGM A;  2PMY A;  1SK6 D;  3BUX B;  3NGV A;  1IKU A;  4INX A;  2QEH A;  1MWN A;  2KHN A;  2H8V A;  2K61 A;  1OOJ A;  2JOJ A;  1SPY A;  1TNQ A;  1ZUZ A;  3N7H A;  2HF5 A;  1FI6 A;  2LVJ A;  3L4A A;  3JTD B;  2BBM A;  4YGE B;  3I5H B;  1OW4 A;  2KBI A;  2HQ8 A;  4UPG A;  4AQJ A;  1IRJ A;  2B1U A;  2LV7 A;  1AVS A;  1NPQ A;  3FE8 A;  3PM8 A;  4CID A;  3L4L A;  1U5I A;  2KQY A;  1M45 A;  1Y1X A;  2ZKM X;  4GGN A;  1W7I B;  3TZ1 A;  1L2O C;  1EG4 A;  1B4C A;  3DYE A;  1BR1 B;  4I5K A;  3TDU A;  3EVV A;  1IIO A;  4JKT A;  3R1P A;  4IL1 A;  1YUU A;  1DJY A;  1JFK A;  1XFU O;  1RJV A;  1IQ5 A;  2QDI A;  1R6P A;  3O78 A;  3CLN A;  4IJ7 A;  1LA3 A;  4R1E A;  4QJ3 B;  1C07 A;  1C7V A;  2KGR A;  2L2E A;  1U5I B;  2Y5I A;  1B1G A;  1L7Z A;  1UHN A;  3CS1 A;  3DVJ A;  4JPZ B;  4ORC B;  4PCW A;  2QAC A;  1HQV A;  1A75 A;  1QIW A;  2F33 A;  2G2B A;  2KOT A;  3OP0 A;  4PDZ A;  1NX1 A;  4YBH B;  3EK7 A;  3O2P A;  3SIA A;  2BBN A;  3D76 A;  1CM1 A;  2KNE A;  1TUZ A;  3CAB A;  1HT9 A;  2KPH A;  3DZT A;  3ICB A;  4I5L B;  1SRA A;  4YGB B;  3CGA A;  4QJ5 B;  4HSZ A;  1PSB A;  3CZ2 A;  4L9M A;  2M7N A;  1YRT B;  1NX2 A;  2KFF A;  3DD4 A;  3M0W A;  4M2Q A;  4PT1 A;  1DMO A;  2D8N A;  1JSA A;  1X02 A;  1IWQ A;  1M63 B;  1A75 B;  1DF0 A;  1DQE A;  1SL9 A;  4YGA A;  1W9Z A;  4DRW A;  1S5G Z;  2JPT A;  3O4X A;  3GK4 X;  4OKH A;  1WDC C;  1F54 A;  2EC6 B;  3PLF B;  4USL A;  2KLE A;  3B88 A;  2JUL A;  2K2F A;  3BUM B;  2BL0 B;  4PHK A;  3I5F C;  3O6B A;  2OS8 B;  1JBA A;  1K93 D;  3B86 A;  1FW4 A;  2P6B B;  5CSN A;  3RZS A;  5D3O A;  3S0E A;  2WOS A;  1N2D A;  4GFT A;  3JTD C;  1J7P A;  3DY9 A;  2ISD A;  1B47 A;  1DF0 B;  2K8M B;  2K7C A;  2PVB A;  1BR4 B;  2FCD A;  3PJI A;  4GAO A;  1TNX A;  1K2H A;  1TCO B;  4KYN A;  1NCX A;  1ZMZ A;  2K7O A;  2HQW A;  5D69 A;  2M97 A;  2ZND A;  1W7J B;  2L4I A;  1NX0 A;  1XFV O;  2JXC A;  2LMT A;  4PHM A;  4NDC A;  3NHT A;  4PAL A;  1XFW O;  1OMD A;  1LIN A;  1T14 A;  2LLU A;  3D75 A;  3GK2 A;  1L2O B;  2KI6 C;  4BY4 A;  4A4B A;  1ORG A;  1S1E A;  5ER5 A;  1YUR A;  4NDB A;  2M0R A;  1WRK A;  1NP8 A;  2WC8 A;  1K94 A;  2WCH A;  4OVN F;  5I2Q A;  3OB2 B;  4PHJ A;  2LMU A;  5EL2 A;  1Z2C B;  3D10 A;  3DXL A;  4FTG A;  1NSH A;  1ZAC A;  4DCK A;  2DOQ A;  2PAL A;  1BMO A;  1C7W A;  1FBV A;  2KAX A;  2SCP A;  3BFB A;  1TRF A;  5K89 A;  4MVF A;  1CLB A;  1UHK A;  1SSE B;  2WOR A;  3JVT B;  1NCY A;  3EK4 A;  2F2O A;  1BOC A;  2A4J A;  2LMV A;  2NZ0 A;  1ALV A;  2JXL A;  3PSR A;  2Y1M A;  3VRN A;  1DT7 B;  4PE4 A;  1B8C A;  1DJZ A;  1UP5 A;  2JPO A;  1YUS A;  3EKH A;  4MZJ A;  1DVI A;  3VRR A;  5JJG A;  3FIA A;  1DJH A;  1SKT A;  1NX3 A;  1SL8 A;  2SAS A;  2TN4 A;  3EG5 B;  4ETO A;  1N0Y A;  2CNP A;  2JWW A;  1SL7 A;  3FE9 A;  3SS4 A;  1XFX O;  2BKI B;  5AXI A;  1NUB A;  1TIZ A;  1SY9 A;  1QAS A;  3D73 A;  1DGV A;  2CBL A;  2L51 A;  4M2O A;  4WQ3 A;  4MLW A;  1OE9 B;  3S0B A;  1QV1 A;  1B9A A;  1KCY A;  1C3Z A;  3SG4 A;  1MUX A;  1WDC B;  2NCP A;  5HKW A;  5ER4 X;  1TNP A;  3I5G B;  3AKB A;  2BKH B;  1RFJ A;  4QJ4 B;  1KFU S;  2RGI A;  1EH2 A;  1Y1U A;  3VGO A;  2M7L A;  1KSO A;  1QLK A;  5IBW A;  1BOD A;  3BOW A;  4XJK A;  1PAL A;  2WCJ A;  1GJY A;  3PM2 A;  1KWO C;  2ZN8 A;  3HX4 A;  2M1U A;  1UUS A;  2KAV A;  3DF0 A;  2F8P A;  1S6J A;  4DS7 A;  3SIB A;  4HRG A;  2BE4 A;  2EGD A;  4XYN A;  1NCZ A;  1KFX L;  3A8R A;  4GPL B;  5D7F A;  2L5X B;  2ZFD A;  5CSF A;  3B6X A;  5FI2 A;  2FOT A;  2QEB A;  3BOW B;  2WCM A;  4XJK B;  5G08 A;  4D1E A;  3IQO A;  2L2C A;  2WCK A;  3BUO B;  1JC2 A;  1REC A;  5BPJ A;  1CLM A;  3DF0 B;  5I2L A;  1B8L A;  1EG3 A;  4OV2 A;  5HL1 A;  1QS7 A;  3CTN A;  1A4P A;  1F8H A;  1WLZ A;  1NIW A;  1XA5 A;  1TCF A;  3K21 A;  2LAN A;  3NHI A;  3TDI A;  4DIR A;  3OHM B;  3KHE A;  5JOL A;  4YGD B;  5B8I B;  1DJW A;  2FCE A;  2V53 A;  4C0J A;  3R1O A;  1QV0 A;  2ZRS A;  1XYD A;  1F4O A;  2H2K A;  3JVT C;  1CKK A;  5CSI A;  1OOI X;  1KK8 C;  2MHH A;  1J1E A;  1KQM B;  5DKR A;  4F7F A;  1B7T Y;  2F3Y A;  4A4C A;  4YI9 A;  4CFR A;  2NLN A;  2KDH A;  3VRP A;  1CLL A;  1K90 D;  2WCE A;  1XO5 A;  2KGB C;  3BUN B;  2PQL A;  4MEW A;  4ICB A;  2M3W A;  1S6C A;  2KQ6 A;  2WND A;  1KK7 Y;  3D0Y A;  2K60 A;  3FE6 A;  3SG3 A;  2GV5 A;  3CR2 A;  1XFY O;  4MN0 A;  1KSM A;  4BY5 A;  3UNW A;  2ZRT A;  1OSA A;  1QX5 B;  2LLT A;  1H4B A;  1QX2 A;  2CTN A;  4WQ2 A;  1NYA A;  4C0K A;  1F70 A;  4HRH A;  2MLF C;  4WRI A;  4PHN A;  1LXF C;  1SR6 C;  1TN4 A;  2F3Z A;  1QVI Z;  2JQ6 A;  2L50 A;  2M29 A;  2BE6 A;  1BU3 A;  2MRD A;  2LHL A;  2L5Y A;  3CR5 X;  3I5G C;  1UHH A;  4P5O E;  4U8D A;  1S26 D;  3GK1 A;  2QEV A;  3BFH A;  2JZI A;  2KBM A;  2L0P A;  2LHI A;  3NSI A;  1PUL A;  2BEC A;  3D0Y B;  1GGW A;  1J1D A;  2CT9 A;  2LCP A;  2JTT A;  1KWO B;  1IGV A;  1QLS A;  1V1F A;  2CCM A;  2WC6 A;  4CLN A;  1F55 A;  2JT8 A;  4YRU A;  1OQP A;  1OOF A;  1TWO A;  1QXP A;  2KLD A;  1S3P A;  3WHU B;  3OGN A;  2BNX A;  1SBJ A;  3QRX A;  1FPW A;  1DJI A;  2MBX A;  1G4Y R;  1K9P A;  1S36 A;  3LLE A;  4YGC B;  1DGU A;  3BYA A;  1WRZ A;  2KAY A;  3LCP C;  1G8I A;  4I5N B;  3KF9 A;  1CMG A;  3ZNI A;  1M39 A;  1QX7 A;  2Y4Q A;  4AQI A;  1FI5 A;  1CDP A;  3BQ3 A;  3A4U B;  2LE9 B;  3OX6 A;  3NXA A;  1V1G A;  3CZ1 A;  1CFC A;  3AAJ A;  1A2X A;  3V2L A;  1CFD A;  2WCL A;  4YI8 A;  2AUC A;  3GOF A;  2I7A A;  1CDL A;  1F4Q A;  5AFP A;  2IS9 A;  3SG5 A;  3DVK A;  1PK0 D;  1XVJ A;  2LLS A;  1CMF A;  5KU1 A;  4GNK B;  1A03 A;  1CNP A;  1Q80 A;  4N1G A;  1J7R A;  3H4S E;  1OZS A;  3BUW B;  1KK8 B;  4ZCV A;  3WNX B;  3NSK A;  1KQM C;  1LKJ A;  5GQQ C;  4E68 A;  1J7Q A;  1OOG A;  2I2R E;  2HET A;  1EXR A;  3TUY C;  3IVT A;  4JD9 A;  1Z4H A;  1TNW A;  5DKN A;  3CWG A;  2Y1N A;  1QJT A;  1P28 A;  1AP4 A;  2FJU B;  3SG7 A;  1YUT A;  1KK7 Z;  1PRW A;  3RM1 A;  3MSE B;  2JT0 A;  4AOM A;  1YX8 A;  2PSR A;  3O4Y A;  4FQO A;  1CDM A;  2MA2 A;  4OR9 B;  1WRL A;  2K7D A;  1BG1 A;  1GQM A;  2CXJ A;  2LUX A;  3FWB A;  1SR6 B;  2PYQ A;  3CZT X;  4ORA B;  2LP2 A;  3EK8 A;  5FYX A;  2FJY A;  1XFR A;  4OCI A;  1QIV A;  3FWC A;  1JUO A;  4HRE E;  2LM5 A;  1DEK A;  2LC5 A;  3D74 A;  3SG2 A;  3UO9 A;  2Q4U A;  2ZNE A;  3WXA A;  4CFQ A;  1RTP 1;  1DTL A;  1D1O A;  4PE1 A;  5AAN A;  2LAP A;  2KI4 C;  2LUC A;  4GGF C;  5DKQ A;  1MHO A;  2JU0 A;  2M49 B;  3SG6 A;  3TS5 B;  1AJ4 A;  2WC5 A;  3ZWH A;  2AMI A;  3QME A;  1S5G Y;  3KO0 A;  3KEV A;  1DC1 A;  2KFH A;  2JT3 A;  4OZD A;  5CSJ A;  1MXE A;  1XK4 C;  2AAO A;  1K96 A;  1ZFS A;  1AK8 A;  2BAP A;  5TNC A;  1KQV A;  1AHR A;  1M31 A;  4ZCU A;  1IJ5 A;  2LVK A;  3PFV A;  5CPV A;  2LP3 A;  5KTY A;  1J7O A;  1PVB A;  1M46 A;  5HKZ A;  3FS7 A;  3HCM A;  2BCB A;  4MZL A;  5AER A;  4Q04 A;  4TNC A;  1VRK A;  1MF8 B;  3I5I C;  3BJH A;  3IQQ A;  1YVH A;  2LVV A;  1WY9 A;  3TDZ A;  2K0J A;  2KYF A;  3S0D A;  1N65 A;  3DVM A;  3IF7 A;  2OTG C;  1JWD A;  1YX7 A;  3TUY B;  1LS8 A;  1RK9 A;  1WLM A;  2M1K B;  3Q8I A;  5HYD A;  1Y0V H;  2GTE A;  2LNK A;  1BF5 A;  1R2U A;  3S0A A;  4INW A;  3LK1 A;  2KYC A;  2QEO A;  2I18 A;  1LA0 A;  2JRF A;  3BFA A;  1IJ6 A;  5J3X A;  1UHI A;  1UWO A;  3OX5 A;  1E8A A;  3K1E A;  5I94 A;  1QTX A;  3SS5 A;  1MQ1 A;  3R1V A;  5HKY A;  4GGF A;  2KI6 D;  1MR8 A;  1KFX S;  1IH0 A;  1H8B A;  1OOH A;  1DJG A;  2YGU A;  2P70 A;  1CTR A;  1UUR A;  4GBA A;  1GGZ A;  2O5G A;  4P2Y B;  1K95 A;  2O60 A;  3OB1 B;  5PAL A;  2NXQ A;  4M2P A;  2BCX A;  1XK4 A;  2ZN9 A;  1ODB A;  5DIC A;  3S0F A;  2MJW B;  3LK0 A;  2KI4 B;  4MRX A;  3KPX A;  5KSZ A;  1DJX A;  1QAT A;  3NSL A;  1SCM C;  3WHT B;  1SW8 A;  2MAZ A;  3TS5 C;  1IQ3 A;  1OMR A;  3PN7 C;  1UHJ A;  4ORB B;  2KFG A;  5AEQ A;  2BCA A;  1YR5 A;  2COL B;  2R2I A;  1J55 A;  1OZO A;  1SMG A;  2PAS A;  1BJF A;  3VRO A;  1OMV A;  3CZ0 A;  4N5X A;  1CDN A;  1AJ5 A;  4MBE A;  1FF1 A;  3VRQ A;  4DUQ A;  2JNX A;  1SYM A;  1A29 A;  2E30 A;  3NSO A;  3PAL A;  3S0G A;  1YTZ C;  2L4H A;  3EVU A;  2HPS A;  5FI7 A;  2L98 A;  1DEL A;  2KSP A;  4MZK A;  2Q91 A;  3I5H C;  3PAT A;  4CPV A;  2MLE C;  1TOP A;  2ERB A;  2QPT A;  3BXK A;  2P71 A;  2H61 C;  1EJ3 A;  1PSR A;  1K9K A;  1S6I A;  1QWV A;  1GM0 A;  1JF0 A;  1CM4 A;  3I5I B;  1BLQ A;  1ZOT B;  3E3R A;  1ALW A;  2PRU A;  3B7A A;  1AUI B;  2GGZ A;  1KFU L;  4JQ0 D;  1NWD A;  1B7T Z;  1F71 A;  2JNF A;  5I8N A;  2K7B A;  2OTG B;  4NDD A;  1EL4 A;  2NCO A;  3OBV A;  1K9U A;  1CB1 A;  1SNL A;  4NQG A;  1RRO A;  1TTX A;  3EKJ A;  2G9B A;  3AKA A;  2F2P A;  1MXL C;  3DVE A;  3LL8 B;  4MSP A;  1K8U A;  2WCB A;  3C1V A;  4I5J A;  1G33 A;  2LVI A;  3CR4 X;  4C0L A;  1CFP A;  1JFJ A;  5HLV A;  2JC2 A;  1IG5 A;  1BT6 A;  1YVL A;  1LVC D;  3CYZ A;  3R72 A;  1PVA A;  1SCV A;  3D78 A;  4PE7 A;  2OPO A;  3EVR A;  1XFZ O;  4PE0 A;  2JTZ A;  3AAK A;  5HLO A;  2WCF A;  2M9G A;  2I94 A;  1SCM B;  1TUJ A;  2EHB A;  4FQT A;  3CDN A;  3VB1 A; 
#chains in the Genus database with same CATH homology
 3PN7 B;  3RLZ A;  1JF2 A;  4JWQ A;  1RWY A;  1YRU B;  4N1F A;  2M8U A;  2H61 A;  4GUK A;  2EC6 C;  4F0Z B;  2VRG A;  3SJS A;  1QVI Y;  5I2O A;  1Y6W A;  1B8R A;  4MRY A;  3F45 A;  2BL0 C;  2E6W A;  5F6T A;  1CFF A;  3I5F B;  1Y1A A;  2K2A A;  2OS8 C;  2GGM A;  2PMY A;  1SK6 D;  3BUX B;  1IKU A;  1MWN A;  2KHN A;  2K61 A;  1OOJ A;  2JOJ A;  1SPY A;  1TNQ A;  1ZUZ A;  2HF5 A;  2LVJ A;  3JTD B;  2BBM A;  4YGE B;  3I5H B;  2KBI A;  2HQ8 A;  4UPG A;  4AQJ A;  1IRJ A;  2B1U A;  2LV7 A;  1AVS A;  1NPQ A;  3PM8 A;  4CID A;  1U5I A;  2KQY A;  1M45 A;  1Y1X A;  2ZKM X;  4GGN A;  1W7I B;  3TZ1 A;  1L2O C;  1EG4 A;  1B4C A;  4I5K A;  1BR1 B;  3TDU A;  3EVV A;  4IL1 A;  1YUU A;  1DJY A;  1JFK A;  1XFU O;  1RJV A;  1IQ5 A;  1R6P A;  3O78 A;  3CLN A;  1LA3 A;  4R1E A;  4QJ3 B;  1C07 A;  1C7V A;  2KGR A;  2L2E A;  1U5I B;  2Y5I A;  1B1G A;  1L7Z A;  1UHN A;  3CS1 A;  3DVJ A;  4JPZ B;  4ORC B;  4PCW A;  2QAC A;  1HQV A;  1A75 A;  1QIW A;  2F33 A;  2G2B A;  2KOT A;  3OP0 A;  4PDZ A;  1NX1 A;  4YBH B;  3EK7 A;  3O2P A;  3SIA A;  2BBN A;  1FI6 A;  1CM1 A;  2KNE A;  3ICB A;  4I5L B;  1HT9 A;  4YGB B;  4CFR A;  1SRA A;  4QJ5 B;  3CGA A;  4HSZ A;  1PSB A;  4L9M A;  2M7N A;  1YRT B;  1NX2 A;  2KFF A;  3DD4 A;  3M0W A;  4M2Q A;  1DMO A;  2D8N A;  1JSA A;  1X02 A;  1IWQ A;  1M63 B;  1A75 B;  1DF0 A;  1SL9 A;  4YGA A;  4DRW A;  1S5G Z;  2JPT A;  4OKH A;  3GK4 X;  1F54 A;  1WDC C;  2EC6 B;  3PLF B;  4USL A;  2JUL A;  2K2F A;  3BUM B;  2BL0 B;  4PHK A;  3I5F C;  3O6B A;  2OS8 B;  1JBA A;  1K93 D;  1FW4 A;  2P6B B;  5CSN A;  2WOS A;  1N2D A;  4GFT A;  3JTD C;  1J7P A;  2ISD A;  1B47 A;  1DF0 B;  2K8M B;  2K7C A;  2PVB A;  1BR4 B;  2FCD A;  4GAO A;  1TNX A;  1K2H A;  1TCO B;  1NCX A;  1ZMZ A;  2K7O A;  2HQW A;  5D69 A;  2M97 A;  2ZND A;  1W7J B;  2L4I A;  1NX0 A;  1XFV O;  2JXC A;  2LMT A;  4PHM A;  4NDC A;  4PAL A;  1XFW O;  1OMD A;  1LIN A;  2LLU A;  3GK2 A;  1L2O B;  2KI6 C;  4BY4 A;  4A4B A;  1S1E A;  5ER5 A;  1YUR A;  4NDB A;  2M0R A;  1WRK A;  1NP8 A;  2WC8 A;  1K94 A;  4OVN F;  5I2Q A;  3OB2 B;  4PHJ A;  2LMU A;  3D10 A;  4FTG A;  4DCK A;  1NSH A;  1ZAC A;  2DOQ A;  2PAL A;  1BMO A;  1C7W A;  1FBV A;  2KAX A;  2SCP A;  5K89 A;  1TRF A;  1CLB A;  4MVF A;  1UHK A;  2WOR A;  3JVT B;  1NCY A;  3EK4 A;  2F2O A;  1BOC A;  2A4J A;  2LMV A;  2NZ0 A;  1ALV A;  2JXL A;  3PSR A;  2Y1M A;  3VRN A;  1DT7 B;  4PE4 A;  1B8C A;  1DJZ A;  1UP5 A;  3EKH A;  1YUS A;  4MZJ A;  5JJG A;  1DVI A;  3VRR A;  3FIA A;  1DJH A;  1SKT A;  1NX3 A;  1SL8 A;  2SAS A;  2TN4 A;  4ETO A;  1N0Y A;  2CNP A;  2JWW A;  1SL7 A;  1XFX O;  2BKI B;  5AXI A;  1NUB A;  1TIZ A;  1SY9 A;  1QAS A;  4WQ3 A;  1DGV A;  2CBL A;  2L51 A;  4M2O A;  4MLW A;  1OE9 B;  1QV1 A;  1B9A A;  1KCY A;  3SG4 A;  1MUX A;  1WDC B;  2NCP A;  5HKW A;  5ER4 X;  1TNP A;  3I5G B;  3AKB A;  2BKH B;  1RFJ A;  4QJ4 B;  1KFU S;  2RGI A;  1EH2 A;  1Y1U A;  3VGO A;  2M7L A;  1KSO A;  1QLK A;  5IBW A;  1BOD A;  3BOW A;  4XJK A;  1PAL A;  1GJY A;  1KWO C;  2ZN8 A;  3HX4 A;  2M1U A;  1UUS A;  2KAV A;  3DF0 A;  2F8P A;  1S6J A;  4DS7 A;  3SIB A;  4HRG A;  2BE4 A;  2EGD A;  4XYN A;  1NCZ A;  1KFX L;  3A8R A;  4GPL B;  5D7F A;  2L5X B;  2ZFD A;  5CSF A;  2FOT A;  3BOW B;  4XJK B;  5G08 A;  4D1E A;  3IQO A;  3BUO B;  1JC2 A;  1REC A;  5BPJ A;  1CLM A;  3DF0 B;  5I2L A;  1B8L A;  1EG3 A;  4OV2 A;  1QS7 A;  3CTN A;  1A4P A;  1F8H A;  1WLZ A;  1NIW A;  1XA5 A;  1TCF A;  3K21 A;  2LAN A;  3TDI A;  4DIR A;  3OHM B;  3KHE A;  5JOL A;  4YGD B;  5B8I B;  1DJW A;  2FCE A;  2V53 A;  4C0J A;  1QV0 A;  2ZRS A;  1XYD A;  1F4O A;  2H2K A;  3JVT C;  1CKK A;  5CSI A;  1KK8 C;  2MHH A;  1J1E A;  1KQM B;  5DKR A;  1B7T Y;  2F3Y A;  4A4C A;  4YI9 A;  2NLN A;  2KDH A;  3VRP A;  1CLL A;  1K90 D;  2WCE A;  1XO5 A;  2KGB C;  3BUN B;  4MEW A;  4ICB A;  2M3W A;  1S6C A;  2KQ6 A;  2WND A;  1KK7 Y;  3D0Y A;  3SG3 A;  2GV5 A;  3CR2 A;  1XFY O;  4MN0 A;  1KSM A;  4BY5 A;  2ZRT A;  1OSA A;  1QX5 B;  2LLT A;  1H4B A;  1QX2 A;  2CTN A;  4WQ2 A;  1NYA A;  4C0K A;  1F70 A;  4HRH A;  2MLF C;  4WRI A;  4PHN A;  1LXF C;  1SR6 C;  1TN4 A;  2F3Z A;  1QVI Z;  2JQ6 A;  2L50 A;  2M29 A;  2BE6 A;  1BU3 A;  2MRD A;  2LHL A;  3CR5 X;  3I5G C;  4DUQ A;  1UHH A;  4P5O E;  4U8D A;  1S26 D;  3GK1 A;  2JZI A;  2KBM A;  2L0P A;  2LHI A;  3NSI A;  1PUL A;  2BEC A;  3D0Y B;  1GGW A;  1J1D A;  2CT9 A;  2LCP A;  2JTT A;  1KWO B;  1IGV A;  1QLS A;  1V1F A;  2CCM A;  4CLN A;  1F55 A;  2JT8 A;  4YRU A;  1OQP A;  1QXP A;  3WHU B;  1S3P A;  1SBJ A;  3QRX A;  1FPW A;  1DJI A;  2MBX A;  1G4Y R;  1K9P A;  1S36 A;  3LLE A;  4YGC B;  1DGU A;  3BYA A;  1WRZ A;  2KAY A;  3LCP C;  1G8I A;  4I5N B;  3KF9 A;  1CMG A;  3ZNI A;  1M39 A;  1QX7 A;  2Y4Q A;  4AQI A;  1FI5 A;  1CDP A;  3BQ3 A;  3A4U B;  2LE9 B;  3OX6 A;  3NXA A;  1V1G A;  1CFC A;  3AAJ A;  1A2X A;  1CFD A;  4YI8 A;  2AUC A;  3GOF A;  2I7A A;  1CDL A;  1F4Q A;  5AFP A;  2IS9 A;  3SG5 A;  3DVK A;  1PK0 D;  1XVJ A;  2LLS A;  1CMF A;  5KU1 A;  4GNK B;  1A03 A;  1CNP A;  1Q80 A;  4N1G A;  1J7R A;  3H4S E;  1OZS A;  3BUW B;  1KK8 B;  4ZCV A;  3WNX B;  3NSK A;  1KQM C;  1LKJ A;  5GQQ C;  4E68 A;  1J7Q A;  2I2R E;  2HET A;  1EXR A;  3TUY C;  5DKN A;  1TNW A;  3CWG A;  2Y1N A;  1QJT A;  1AP4 A;  2FJU B;  3SG7 A;  1YUT A;  1KK7 Z;  1PRW A;  3RM1 A;  3MSE B;  2JT0 A;  4AOM A;  1YX8 A;  2PSR A;  3O4Y A;  4FQO A;  1CDM A;  2MA2 A;  4OR9 B;  1WRL A;  2K7D A;  1BG1 A;  1GQM A;  2CXJ A;  2LUX A;  3FWB A;  1SR6 B;  3CZT X;  4ORA B;  2LP2 A;  3EK8 A;  5FYX A;  4OCI A;  1QIV A;  3FWC A;  1JUO A;  4HRE E;  2LM5 A;  2LC5 A;  3SG2 A;  4CFQ A;  3WXA A;  2Q4U A;  2ZNE A;  1RTP 1;  1DTL A;  1D1O A;  4PE1 A;  5AAN A;  2LAP A;  2KI4 C;  2LUC A;  4GGF C;  5DKQ A;  1MHO A;  2JU0 A;  2M49 B;  3SG6 A;  3TS5 B;  1AJ4 A;  3ZWH A;  2AMI A;  1S5G Y;  3KO0 A;  3KEV A;  2KFH A;  2JT3 A;  5CSJ A;  1MXE A;  1XK4 C;  2AAO A;  1K96 A;  1ZFS A;  1AK8 A;  5TNC A;  1KQV A;  1AHR A;  1M31 A;  4ZCU A;  1IJ5 A;  2LVK A;  3PFV A;  5CPV A;  2LP3 A;  5KTY A;  1J7O A;  1PVB A;  1M46 A;  5HKZ A;  3FS7 A;  3HCM A;  2BCB A;  4MZL A;  5AER A;  4Q04 A;  4TNC A;  1VRK A;  1MF8 B;  3I5I C;  3IQQ A;  1YVH A;  2LVV A;  1WY9 A;  3TDZ A;  2K0J A;  2KYF A;  1N65 A;  3DVM A;  3IF7 A;  2OTG C;  1JWD A;  1YX7 A;  3TUY B;  1RK9 A;  1WLM A;  2M1K B;  5HYD A;  1Y0V H;  2LNK A;  1BF5 A;  1R2U A;  3LK1 A;  2KYC A;  2I18 A;  1LA0 A;  2JRF A;  1IJ6 A;  5J3X A;  1UHI A;  1UWO A;  3OX5 A;  1E8A A;  1QTX A;  1MQ1 A;  5HKY A;  4GGF A;  2KI6 D;  1MR8 A;  1KFX S;  1IH0 A;  1H8B A;  1DJG A;  1CTR A;  1UUR A;  4GBA A;  1GGZ A;  2O5G A;  4P2Y B;  1K95 A;  2O60 A;  3OB1 B;  5PAL A;  2NXQ A;  4M2P A;  2BCX A;  1XK4 A;  2ZN9 A;  1ODB A;  2MJW B;  3LK0 A;  2KI4 B;  4MRX A;  3KPX A;  5KSZ A;  1DJX A;  1QAT A;  3NSL A;  1SCM C;  3WHT B;  1SW8 A;  2MAZ A;  3TS5 C;  1IQ3 A;  1OMR A;  3PN7 C;  1UHJ A;  4ORB B;  2KFG A;  5AEQ A;  2BCA A;  1YR5 A;  2COL B;  2R2I A;  1J55 A;  1OZO A;  1SMG A;  2PAS A;  1BJF A;  3VRO A;  1OMV A;  4N5X A;  1CDN A;  1AJ5 A;  4MBE A;  1FF1 A;  3VRQ A;  2JNX A;  1SYM A;  1A29 A;  2E30 A;  3NSO A;  3PAL A;  1YTZ C;  2L4H A;  3EVU A;  2HPS A;  2L98 A;  2KSP A;  4MZK A;  2Q91 A;  3I5H C;  3PAT A;  4CPV A;  2MLE C;  1TOP A;  2QPT A;  3BXK A;  2H61 C;  1EJ3 A;  1PSR A;  1K9K A;  1S6I A;  1JF0 A;  1CM4 A;  3I5I B;  1BLQ A;  1ZOT B;  3E3R A;  1ALW A;  2PRU A;  1AUI B;  2GGZ A;  1KFU L;  4JQ0 D;  1NWD A;  1B7T Z;  1F71 A;  2JNF A;  5I8N A;  2K7B A;  2OTG B;  4NDD A;  1EL4 A;  2NCO A;  1K9U A;  1CB1 A;  1SNL A;  4NQG A;  1RRO A;  1TTX A;  3EKJ A;  2G9B A;  3AKA A;  2F2P A;  1MXL C;  3DVE A;  3LL8 B;  4MSP A;  1K8U A;  2WCB A;  3C1V A;  4I5J A;  1G33 A;  2LVI A;  3CR4 X;  4C0L A;  1CFP A;  1JFJ A;  5HLV A;  2JC2 A;  1IG5 A;  1BT6 A;  1YVL A;  1LVC D;  1PVA A;  1SCV A;  4PE7 A;  2OPO A;  3EVR A;  1XFZ O;  4PE0 A;  2JTZ A;  3AAK A;  5HLO A;  2WCF A;  2M9G A;  2I94 A;  1SCM B;  2EHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...