3DVEA

Crystal structure of ca2+/cam-cav2.2 iq domain complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dveA00
1XFXO 3NSOA 2LUCA 2BBMA 1S26D 4IL1A 2HPSA 2Y5IA 2L0PA 3D10A 3EVRA 4ORBB 1XK4C 2LMTA 2MAZA 4PHKA 1EG3A 1KCYA 1TCOB 4ICBA 1ZOTB 1IJ6A 1QX7A 5B8IB 1LVCD 1CLMA 1XYDA 2LHLA 2QACA 3WXAA 1WDCC 2K2FA 1F8HA 3KF9A 1MUXA 5I2QA 1S36A 1RK9A 2JRFA 1ODBA 2LMUA 4BY4A 1RROA 4PDZA 1SCMB 2LLUA 1KQVA 2KQ6A 1CLBA 2WCBA 5AXIA 1OOJA 4CFRA 1A29A 1B8RA 5HKYA 1TTXA 2K7BA 4OR9B 1EL4A 1M63B 1KK7Z 5ER5A 2BL0C 1SR6B 2PSRA 2KGBC 2ZRSA 1CFFA 1U5IB 1TN4A 1UHHA 2CNPA 2K7CA 1LA3A 2NXQA 3TUYB 1GQMA 2MA2A 2WNDA 3SG7A 2JTZA 1UURA 2PRUA 1FI6A 1KK8B 4YGCB 1OE9B 1ZUZA 1L2OC 4PE4A 1K90D 2K2AA 1SL9A 3TDZA 2L98A 1M31A 1IH0A 2JOJA 3CR5X 1Y1XA 2JXCA 3JTDB 3O78A 1CM1A 3CTNA 3VRPA 4ZCVA 1MWNA 1SCVA 3FIAA 1J1DA 4WQ2A 2WORA 3CLNA 1NP8A 1QX2A 1WY9A 2HQ8A 2B1UA 1F4OA 1GGZA 1K9UA 2OS8C 3LCPC 4ZCUA 1KWOC 1DGUA 1W7IB 1IGVA 2EC6B 2LHIA 3BUOB 4M2OA 4DCKA 1N65A 4JWQA 1WLZA 2JQ6A 4MVFA 2NCOA 4MZJA 4XYNA 2H61A 3SG2A 1DJZA 4GGFA 1Q80A 4MEWA 3O2PA 2KQYA 1K93D 1BU3A 2JU0A 1KQMC 2QPTA 4GPLB 4A4CA 1IKUA 1B4CA 1CFCA 1OZOA 1OSAA 1F4QA 1ZACA 2WCFA 1M45A 5IBWA 3D0YB 1V1GA 3E3RA 1PVBA 3K21A 4CIDA 2TN4A 1LXFC 1PSBA 1EG4A 2Y1MA 3FS7A 2KYFA 1BJFA 3EK4A 1CFDA 1S5GZ 2I7AA 4AQJA 1J7PA 2LLSA 3A4UB 4C0JA 2BKIB 1UHNA 2LAPA 1TNPA 1EXRA 4XJKB 1DJIA 2JULA 3BUXB 1YURA 3VROA 4YGAA 2ZRTA 1WDCB 3KPXA 3GOFA 2LVJA 1OZSA 1AHRA 1LINA 3IQOA 3PM8A 2PALA 4BY5A 5AERA 3NSIA 4I5JA 1U5IA 1ZFSA 4M2QA 3TZ1A 3SG6A 2M1UA 1DF0B 2WOSA 2K61A 4YGEB 1MR8A 2I18A 4U8DA 1DMOA 1KFXL 4MRXA 4OCIA 3BXKA 1RECA 2A4JA 4UPGA 1BOCA 3PLFB 1NX1A 2KFHA 2BL0B 1C7WA 1QTXA 4AQIA 1TCFA 4N5XA 5AEQA 1R2UA 3BUNB 3OX6A 2FCEA 2LVKA 1XFVO 2L2EA 2BBNA 3CR4X 2CT9A 4C0LA 4PE0A 2KBIA 1UWOA 1OMRA 1SKTA 1Y1AA 2MRDA 3PATA 1K2HA 4ORAB 1S5GY 1L2OB 1YUTA 1QLKA 2SASA 1GGWA 1JSAA 3RM1A 3QRXA 1IWQA 2KDHA 1XFWO 3EVUA 4MZLA 2H2KA 2CXJA 4CFQA 1S1EA 3VRQA 3A8RA 1K9PA 1QJTA 3TDUA 2MHHA 1WRKA 2LV7A 2KYCA 1AVSA 1F70A 1V1FA 4FTGA 1Y1UA 2LCPA 4PHNA 1RJVA 2OS8B 2D8NA 1MF8B 1RWYA 3VGOA 4PCWA 1KWOB 1DJHA 2F3ZA 3AAKA 4WQ3A 2KAXA 3D0YA 2JNXA 2JPTA 3GK2A 4F0ZB 1DJGA 1G8IA 3I5HC 1AJ4A 1IRJA 2IS9A 2LNKA 5D7FA 1KFUS 1XK4A 1N0YA 4MLWA 1KQMB 4XJKA 4GGNA 4E68A 4GUKA 1QATA 3OB2B 1CMFA 2BE6A 2WC8A 2F2OA 4DS7A 1LA0A 3I5FC 1JC2A 1QASA 2G9BA 2M97A 2JTTA 5DKQA 2HQWA 1UHKA 3TDIA 2G2BA 1MXLC 2L4IA 1PALA 1TNXA 2GGMA 1PVAA 4HRHA 1DF0A 1BF5A 1KSOA 3FWCA 1FW4A 3CR2A 4NDDA 1NYAA 1DJYA 1IQ5A 2M9GA 3SIBA 2LP2A 4HREE 3DVJA 1TIZA 1WLMA 4NDCA 1W7JB 4PE1A 1B8CA 3EKHA 1EJ3A 3RLZA 2O5GA 1SY9A 1YR5A 1MHOA 3PSRA 1AK8A 4AOMA 2ISDA 3I5GC 1UP5A 2F3YA 1G4YR 2WCEA 1LKJA 1HT9A 2BE4A 1QLSA 1NX3A 1DJWA 1AUIB 5DKNA 1L7ZA 1BT6A 2KBMA 1CDPA 4TNCA 1KSMA 1J1EA 1D1OA 3HCMA 2MLEC 1ALWA 2ZNEA 3SG4A 3JVTC 1QV0A 2AMIA 4YGDB 2M1KB 3DF0B 1B7TZ 2L5XB 1OMVA 2M7NA 1A2XA 5BPJA 1CB1A 1YUUA 1JFJA 2LLTA 2LC5A 1NSHA 4MRYA 1CM4A 2MJWB 3GK4X 4MSPA 3CGAA 3DVEA 1PULA 4GAOA 5I2LA 4CLNA 1IQ3A 1F71A 1CLLA 3DD4A 4HSZA 4R1EA 4USLA 1RFJA 3O4YA 1YRTB 1CDLA 3SJSA 4PALA 4I5LB 1XVJA 3ZWHA 1WRLA 2GV5A 2I94A 2M3WA 2BECA 3VRNA 1JWDA 4QJ3B 2FCDA 3HX4A 3WNXB 1UHJA 2JXLA 3I5HB 2LMVA 4JQ0D 1G33A 4L9MA 3WHUB 2EHBA 4GBAA 5CSJA 1CKKA 1QXPA 1AP4A 2LUXA 1IJ5A 1A4PA 1K9KA 2LVIA 4JPZB 3M0WA 1CMGA 2CCMA 2EGDA 5AFPA 1QS7A 2Y1NA 1OQPA 1B7TY 1MQ1A 3C1VA 3EKJA 3OP0A 1SMGA 5CSFA 3ICBA 2K7DA 2LP3A 3I5FB 3SG5A 3EK8A 5K89A 1B9AA 3OB1B 4PE7A 1SW8A 2AUCA 4C0KA 5KU1A 1BG1A 2KI6D 4DRWA 2Q91A 1CDMA 1GJYA 3KO0A 1K95A 2HETA 1QV1A 1C07A 5HYDA 2KNEA 2VRGA 1XFYO 3IF7A 5CSIA 1YRUB 5ER4X 1TOPA 3EK7A 1F55A 1XFUO 1FBVA 3I5IC 4N1GA 5I8NA 3NSKA 4YI9A 3CZTX 1NX0A 4QJ4B 2I2RE 2F33A 1Y6WA 2ZKMX 2M49B 1IG5A 1ZMZA 1DJXA 3I5GB 3PN7C 4Q04A 3TS5C 1NX2A 1X02A 3DF0A 1TRFA 5J3XA 4DIRA 4ETOA 1C7VA 2BCXA 1XA5A 2KI4C 1DGVA 4PHJA 3CS1A 1A03A 1VRKA 1B1GA 1EH2A 2SCPA 3JVTB 1NWDA 4P2YB 2L4HA 3O6BA 1N2DA 1BR1B 2KFGA 4OVNF 3OX5A 5I2OA 1NUBA 1QVIZ 2ZN9A 3NSLA 1MXEA 2HF5A 1JFKA 1SNLA 2ZFDA 3GK1A 2JT0A 2PVBA 4ORCB 3ZNIA 3SIAA 4OV2A 2MBXA 1AJ5A 1JF0A 4PHMA 2PMYA 1KFUL 2DOQA 3AKAA 1K94A 1BR4B 5HKZA 2F8PA 2L51A 1SBJA 2Q4UA 3KEVA 1NCYA 4MN0A 3OHMB 1TNQA 2GGZA 4M2PA 2R2IA 1JUOA 5JOLA 1SRAA 1SL7A 2JC2A 2KAVA 1A75B 5KTYA 1CNPA 2NLNA 3FWBA 2CTNA 2FJUB 1FF1A 5TNCA 1YVHA 3BUWB 1NCXA 5D69A 1FPWA 2KSPA 2OTGC 1E8AA 1YUSA 1NCZA 2O60A 3DVMA 1CTRA 1R6PA 5G08A 5GQQC 3CWGA 3KHEA 1NIWA 3BOWB 3WHTB 4OKHA 2BKHB 5F6TA 5AANA 3LL8B 1S3PA 1BMOA 1QVIY 2H61C 1S6JA 2LE9B 2K0JA 4GGFC 1TNWA 1YTZC 4GFTA 1J7QA 4D1EA 4NQGA 3LLEA 1OMDA 4N1FA 4YBHB 4NDBA 2JZIA 1SK6D 4GNKB 3LK0A 1QIVA 2COLB 1S6IA 5HLVA 1PRWA 1YX8A 4MBEA 4QJ5B 1DVIA 2JT3A 1BODA 3AKBA 1XO5A 1Y0VH 2ZN8A 4I5KA 4WRIA 2KHNA 1KK7Y 3VRRA 1F54A 1SCMC 3I5IB 1UHIA 1K96A 5FYXA 3MSEB 4MZKA 2M7LA 2M0RA 2OPOA 2JNFA 3DVKA 3PFVA 3BYAA 3PN7B 2KOTA 4A4BA 1B8LA 3NXAA 3TS5B 1M39A 4YI8A 3LK1A 1SR6C 2NCPA 2PASA 3PALA 1DT7B 5JJGA 3TUYC 2KI4B 1K8UA 2JT8A 1DTLA 2KAYA 2CBLA 2ZNDA 2KGRA 1KK8C 2M8UA 1UUSA 5KSZA 4DUQA 3H4SE 1H4BA 2FOTA 1J7RA 4YRUA 3BUMB 1KFXS 2L50A 3AAJA 3JTDC 1JF2A 1QX5B 4CPVA 2E6WA 1A75A 1HQVA 2MLFC 2E30A 2LANA 4HRGA 1FI5A 1PSRA 1SPYA 4FQOA 1YVLA 2K7OA 1XFZO 2P6BB 3BQ3A 1M46A 2BCAA 2KI6C 4I5NB 1NPQA 1PK0D 2K8MB 5CPVA 1CFPA 2M29A 4P5OE 1H8BA 2NZ0A 2JWWA 1SL8A 3SG3A 2Y4QA 2KFFA 1BLQA 3EVVA 5DKRA 1RTP1 2EC6C 1S6CA 1SYMA 2BCBA 1J55A 1QIWA 2LM5A 3BOWA 3IQQA 5HLOA 5CSNA 1J7OA 2LVVA 2RGIA 1WRZA 5HKWA 3F45A 2F2PA 1JBAA 1ALVA 1CDNA 2V53A 2OTGB 4YGBB 5PALA 1YX7A 1B47A 2AAOA
chains in the Genus database with same CATH superfamily
3CZ1A 1XFRA 1XFXO 3NHTA 3NSOA 2LUCA 2BBMA 2KLDA 1S26D 4IL1A 2HPSA 2Y5IA 2L0PA 3D10A 3EVRA 4ORBB 1OOGA 1XK4C 2LMTA 2MAZA 3BFBA 1EG3A 4PHKA 1KCYA 1C3ZA 1TCOB 4ICBA 1ZOTB 1IJ6A 2P71A 2K60A 1QX7A 5B8IB 1LVCD 1CLMA 1XYDA 2LHLA 2QACA 3WXAA 3FE6A 5I94A 1WDCC 2K2FA 1F8HA 3KF9A 1MUXA 5I2QA 1S36A 1RK9A 2JRFA 1ODBA 2LMUA 4BY4A 1RROA 4PDZA 1SCMB 2LLUA 1KQVA 2KQ6A 1CLBA 2WCBA 5AXIA 1OOJA 3S0GA 1A29A 4CFRA 1B8RA 5HKYA 1TTXA 2K7BA 3QMEA 4OR9B 1EL4A 1M63B 1KK7Z 5ER5A 2BL0C 1Z2CB 1SR6B 3L47A 2PSRA 2KGBC 2ZRSA 1CFFA 1U5IB 1TN4A 1UHHA 2CNPA 2K7CA 1LA3A 2NXQA 3CZ0A 1GQMA 2MA2A 3TUYB 2WNDA 3SG7A 4F7FA 2JTZA 1UURA 2PRUA 3UNWA 1KK8B 1FI6A 4INWA 4YGCB 1OE9B 1ZUZA 4KYNA 1L2OC 4PE4A 1K90D 2K2AA 1SL9A 3TDZA 2L98A 1M31A 1IH0A 2JOJA 3CR5X 1Y1XA 2JXCA 3JTDB 3O78A 1CM1A 3CTNA 3VRPA 4ZCVA 1MWNA 1SCVA 3S0FA 3FIAA 1J1DA 4WQ2A 3R1PA 2WORA 1TUJA 3CLNA 1T14A 1NP8A 1QX2A 1WY9A 2HQ8A 2B1UA 1F4OA 1GGZA 3BFHA 1K9UA 2OS8C 3LCPC 3L4LA 4ZCUA 1KWOC 3NGVA 1DGUA 1W7IB 1IGVA 2EC6B 2LHIA 3BUOB 4M2OA 4DCKA 1N65A 4JWQA 1WLZA 3CZ2A 2JQ6A 3D78A 4MVFA 2NCOA 4MZJA 4XYNA 1QWVA 2H61A 1DJZA 4GGFA 3SG2A 1Q80A 4MEWA 3O2PA 2KQYA 1K93D 1BU3A 2JU0A 1KQMC 2QPTA 4GPLB 4A4CA 3NHIA 1IKUA 1B4CA 3OBVA 1OZOA 1OSAA 1F4QA 1ZACA 2WCFA 1CFCA 1J7OA 1M45A 5IBWA 3D0YB 1V1GA 3E3RA 1PVBA 3K21A 4CIDA 2TN4A 3OGNA 1LXFC 1PSBA 1OOFA 1EG4A 2Y1MA 3B6XA 1DC1A 3FS7A 2KYFA 1BJFA 3EK4A 1CFDA 1S5GZ 2I7AA 4AQJA 1TWOA 1J7PA 2LLSA 3A4UB 4C0JA 2BKIB 1UHNA 2LAPA 1TNPA 1EXRA 4XJKB 1DJIA 2JULA 3BUXB 1YURA 1C3YA 3VROA 4YGAA 2ZRTA 1WDCB 3KPXA 3GOFA 2LVJA 1OZSA 1AHRA 1LINA 3IQOA 3PM8A 2P70A 2PALA 4BY5A 5AERA 3NSIA 4I5JA 1U5IA 1ZFSA 4M2QA 3TZ1A 3SG6A 2M1UA 1DF0B 2WOSA 2K61A 4YGEB 1MR8A 2I18A 4U8DA 1DMOA 1KFXL 4MRXA 4OCIA 3BXKA 1RECA 2A4JA 4UPGA 1BOCA 3PLFB 3VB1A 1NX1A 2KFHA 2BL0B 1C7WA 1QTXA 3B86A 2KPHA 4AQIA 1TCFA 3PM2A 4N5XA 5AEQA 1R2UA 3BUNB 3OX6A 2FCEA 2LVKA 1XFVO 2L2EA 2BBNA 3CR4X 2CT9A 4C0LA 4PE0A 2KBIA 3R1OA 1UWOA 1OMRA 1SKTA 1Y1AA 2MRDA 3PATA 1K2HA 4ORAB 1S5GY 1L2OB 1DEKA 1YUTA 1QLKA 2SASA 1GGWA 1FI5A 1JSAA 4INXA 3RM1A 3O4XA 3QRXA 1IWQA 2KDHA 1XFWO 3EVUA 4MZLA 2H2KA 2CXJA 4CFQA 1S1EA 3VRQA 3A8RA 1K9PA 1QJTA 3TDUA 2MHHA 2QEHA 1WRKA 2LV7A 2KYCA 1AVSA 1DQEA 1F70A 3CABA 1V1FA 4FTGA 1Y1UA 2L5YA 2LCPA 4PHNA 1RJVA 2OS8B 2D8NA 1MF8B 1RWYA 3VGOA 4PCWA 1KWOB 1DJHA 2F3ZA 3AAKA 4WQ3A 2QDIA 2KAXA 3D0YA 2JNXA 2JPTA 3GK2A 4F0ZB 1DJGA 1G8IA 3I5HC 1AJ4A 1IRJA 2IS9A 2LNKA 5D7FA 1KFUS 1XK4A 1N0YA 1SSEB 4MLWA 1KQMB 4XJKA 4GGNA 4E68A 4GUKA 1QATA 3OB2B 3DZTA 1CMFA 2BE6A 2WC8A 2F2OA 4DS7A 1LA0A 3I5FC 1JC2A 1QASA 2G9BA 2M97A 2JTTA 3N7HA 5DKQA 2HQWA 1UHKA 3TDIA 2G2BA 1MXLC 2L4IA 1PALA 1TNXA 2GGMA 2WC6A 1PVAA 4HRHA 1DF0A 1BF5A 1KSOA 3FWCA 1FW4A 3CR2A 4NDDA 1NYAA 1DJYA 1IQ5A 2M9GA 3SIBA 2LP2A 4HREE 3DVJA 1TIZA 1WLMA 4NDCA 1W7JB 1OW4A 4PE1A 1B8CA 3EKHA 1EJ3A 3RLZA 2O5GA 1SY9A 1YR5A 1MHOA 3PSRA 1AK8A 4AOMA 3Q8IA 2ISDA 1IIOA 3I5GC 1UP5A 3SS3A 2F3YA 1G4YR 3S0EA 2WCEA 1LKJA 1HT9A 2BE4A 3CYZA 1QLSA 1NX3A 1DJWA 3B7AA 1AUIB 5DKNA 2WCKA 1L7ZA 1BT6A 2KBMA 1CDPA 4TNCA 1KSMA 1J1EA 1D1OA 3HCMA 2MLEC 1ALWA 2QEBA 2ZNEA 3JVTC 3SG4A 1QV0A 2AMIA 4YGDB 2M1KB 3DF0B 1B7TZ 2H8VA 2L5XB 1OMVA 2M7NA 1A2XA 5BPJA 1CB1A 1YUUA 1TUZA 1JFJA 2LLTA 2LC5A 1NSHA 4MRYA 1CM4A 2MJWB 3GK4X 4MSPA 3CGAA 3DVEA 1PULA 4GAOA 5I2LA 4CLNA 1IQ3A 1F71A 1CLLA 3DD4A 4HSZA 4R1EA 4USLA 1RFJA 2YGUA 2WCLA 3O4YA 1YRTB 1CDLA 3SJSA 2JPOA 4PALA 4I5LB 1XVJA 3S0DA 3ZWHA 1WRLA 2GV5A 2I94A 2M3WA 2BECA 3VRNA 1JWDA 4QJ3B 2FCDA 3HX4A 3WNXB 1UHJA 2JXLA 3I5HB 2LMVA 4JQ0D 1G33A 4L9MA 3WHUB 2EHBA 4GBAA 1OOHA 5CSJA 5FI6A 1CKKA 1QXPA 1AP4A 2LUXA 1IJ5A 1A4PA 1K9KA 2LVIA 3EG5B 3M0WA 4JPZB 1CMGA 2CCMA 2EGDA 5AFPA 1QS7A 4FQTA 2BAPA 1OQPA 2Y1NA 1B7TY 1MQ1A 3C1VA 3EKJA 3OP0A 1SMGA 5CSFA 3ICBA 2K7DA 3SS4A 2LP3A 3I5FB 3SG5A 3EK8A 5K89A 1B9AA 3OB1B 4PE7A 1SW8A 2AUCA 5HL1A 4C0KA 5KU1A 1BG1A 2KI6D 4DRWA 2Q91A 1CDMA 1GJYA 3KO0A 1K95A 2HETA 2WCHA 1QV1A 1C07A 5HYDA 2KNEA 2VRGA 1XFYO 3IF7A 1W9ZA 5CSIA 3UO9A 1YRUB 5ER4X 1TOPA 3EK7A 1F55A 1XFUO 1FBVA 3I5IC 4N1GA 1Z4HA 3NSKA 4YI9A 3CZTX 1NX0A 4QJ4B 5I8NA 3K1EA 2I2RE 2F33A 1Y6WA 3S0BA 2ZKMX 2M49B 1IG5A 1ZMZA 1DJXA 3I5GB 3PN7C 4Q04A 3D74A 4OZDA 3TS5C 1NX2A 1X02A 3V2LA 3DF0A 1TRFA 5J3XA 1ORGA 4DIRA 4ETOA 1C7VA 2PYQA 3D77A 2BCXA 2KLEA 1XA5A 2KI4C 1DGVA 4PHJA 1OOIX 3CS1A 1A03A 1VRKA 3PJIA 5FI7A 1P28A 2SCPA 3JVTB 1B1GA 1EH2A 1NWDA 3R72A 2L4HA 4P2YB 3O6BA 1N2DA 1BR1B 2KFGA 4OVNF 3OX5A 5I2OA 1NUBA 1QVIZ 2ZN9A 1GM0A 3NSLA 1MXEA 2HF5A 1JFKA 1SNLA 2ZFDA 3GK1A 2JT0A 2PVBA 4ORCB 3ZNIA 3SIAA 4OV2A 2MBXA 1AJ5A 1JF0A 3D76A 2PMYA 4PHMA 1KFUL 2L2CA 2DOQA 3AKAA 1K94A 1BR4B 5HKZA 2F8PA 2L51A 1SBJA 2Q4UA 3KEVA 1NCYA 4MN0A 3OHMB 1TNQA 2GGZA 4M2PA 2R2IA 3FE9A 1JUOA 5JOLA 1SRAA 1SL7A 2JC2A 2KAVA 1A75B 5KTYA 3RZSA 1CNPA 2NLNA 3FWBA 2CTNA 2FJUB 1FF1A 5TNCA 1YVHA 3BUWB 1NCXA 5D69A 1FPWA 2KSPA 2OTGC 3BFAA 1E8AA 3B87A 1YUSA 1NCZA 2O60A 3DVMA 1CTRA 1R6PA 5G08A 5GQQC 3CWGA 3KHEA 3D73A 1NIWA 3BOWB 3WHTB 4OKHA 2BKHB 5F6TA 5AANA 3LL8B 1S3PA 1BMOA 1QVIY 2H61C 1S6JA 2LE9B 2K0JA 4GGFC 1TNWA 1YTZC 2WCJA 4GFTA 4PT1A 1J7QA 4D1EA 4NQGA 3LLEA 1OMDA 4N1FA 4YBHB 4NDBA 4JD9A 2JZIA 1SK6D 4GNKB 3LK0A 1QIVA 2COLB 1S6IA 3S0AA 5HLVA 1PRWA 1YX8A 4MBEA 4QJ5B 1DVIA 2JT3A 3FE8A 1BODA 3AKBA 1XO5A 1Y0VH 2ZN8A 4I5KA 4WRIA 2KHNA 3SS5A 1KK7Y 3VRRA 1F54A 1SCMC 3I5IB 1UHIA 1DELA 1K96A 5FYXA 2WC5A 3MSEB 4MZKA 5FI2A 2M7LA 2M0RA 2OPOA 2JNFA 4IJ7A 3DVKA 3PFVA 3BYAA 3PN7B 2KOTA 4A4BA 1B8LA 3NXAA 3TS5B 1M39A 2ERBA 4YI8A 3LK1A 1SR6C 2NCPA 2PASA 3PALA 2FJYA 1DT7B 5JJGA 3IVTA 3TUYC 2KI4B 2WCMA 5EL2A 1K8UA 2JT8A 1DTLA 2KAYA 3BJHA 2CBLA 2ZNDA 2KGRA 2GTEA 3DY9A 1KK8C 2M8UA 1UUSA 5KSZA 4DUQA 2BNXA 3H4SE 2QEVA 1H4BA 2FOTA 1J7RA 4YRUA 3BUMB 1KFXS 2L50A 3AAJA 3DYEA 3JTDC 1JF2A 1QX5B 3R1VA 2E6WA 1A75A 1HQVA 4CPVA 2MLFC 2E30A 2LANA 4HRGA 2PQLA 1PSRA 1SPYA 4FQOA 4JKTA 1YVLA 2K7OA 3D75A 1XFZO 2P6BB 3L4AA 3BQ3A 1M46A 2BCAA 2KI6C 4I5NB 1NPQA 1PK0D 2K8MB 5CPVA 1CFPA 2M29A 4P5OE 3DXLA 1H8BA 2NZ0A 2JWWA 1SL8A 3SG3A 2Y4QA 2KFFA 1BLQA 3EVVA 5DKRA 1RTP1 2EC6C 3B88A 1S6CA 1SYMA 2BCBA 1J55A 1QIWA 2LM5A 2QEOA 3BOWA 3IQQA 5CSNA 5HLOA 2LVVA 2RGIA 1WRZA 5HKWA 3F45A 5D3OA 2F2PA 3CDNA 1JBAA 1ALVA 1CDNA 2V53A 2OTGB 4YGBB 5DICA 5PALA 1LS8A 1YX7A 1B47A 2AAOA
chains in the Genus database with same CATH topology
1XFXO 3NSOA 2LUCA 2BBMA 1S26D 4IL1A 2HPSA 2Y5IA 2L0PA 3D10A 3EVRA 4ORBB 1XK4C 2LMTA 2MAZA 4PHKA 1EG3A 1KCYA 1TCOB 4ICBA 1ZOTB 1IJ6A 1QX7A 5B8IB 1LVCD 1CLMA 1XYDA 2LHLA 2QACA 3WXAA 1WDCC 2K2FA 1F8HA 3KF9A 1MUXA 5I2QA 1S36A 1RK9A 2JRFA 1ODBA 2LMUA 4BY4A 1RROA 4PDZA 1SCMB 2LLUA 1KQVA 2KQ6A 1CLBA 2WCBA 5AXIA 1OOJA 4CFRA 1A29A 1B8RA 5HKYA 1TTXA 2K7BA 4OR9B 1EL4A 1M63B 1KK7Z 5ER5A 2BL0C 1SR6B 2PSRA 2KGBC 2ZRSA 1CFFA 1U5IB 1TN4A 1UHHA 2CNPA 2K7CA 1LA3A 2NXQA 3TUYB 1GQMA 2MA2A 2WNDA 3SG7A 2JTZA 1UURA 2PRUA 1FI6A 1KK8B 4YGCB 1OE9B 1ZUZA 1L2OC 4PE4A 1K90D 2K2AA 1SL9A 3TDZA 2L98A 1M31A 1IH0A 2JOJA 3CR5X 1Y1XA 2JXCA 3JTDB 3O78A 1CM1A 3CTNA 3VRPA 4ZCVA 1MWNA 1SCVA 3FIAA 1J1DA 4WQ2A 2WORA 3CLNA 1NP8A 1QX2A 1WY9A 2HQ8A 2B1UA 1F4OA 1GGZA 1K9UA 2OS8C 3LCPC 4ZCUA 1KWOC 1DGUA 1W7IB 1IGVA 2EC6B 2LHIA 3BUOB 4M2OA 4DCKA 1N65A 4JWQA 1WLZA 2JQ6A 4MVFA 2NCOA 4MZJA 4XYNA 2H61A 3SG2A 1DJZA 4GGFA 1Q80A 4MEWA 3O2PA 2KQYA 1K93D 1BU3A 2JU0A 1KQMC 2QPTA 4GPLB 4A4CA 1IKUA 1B4CA 1CFCA 1OZOA 1OSAA 1F4QA 1ZACA 2WCFA 1M45A 5IBWA 3D0YB 1V1GA 3E3RA 1PVBA 3K21A 4CIDA 2TN4A 1LXFC 1PSBA 1EG4A 2Y1MA 3FS7A 2KYFA 1BJFA 3EK4A 1CFDA 1S5GZ 2I7AA 4AQJA 1J7PA 2LLSA 3A4UB 4C0JA 2BKIB 1UHNA 2LAPA 1TNPA 1EXRA 4XJKB 1DJIA 2JULA 3BUXB 1YURA 3VROA 4YGAA 2ZRTA 1WDCB 3KPXA 3GOFA 2LVJA 1OZSA 1AHRA 1LINA 3IQOA 3PM8A 2PALA 4BY5A 5AERA 3NSIA 4I5JA 1U5IA 1ZFSA 4M2QA 3TZ1A 3SG6A 2M1UA 1DF0B 2WOSA 2K61A 4YGEB 1MR8A 2I18A 4U8DA 1DMOA 1KFXL 4MRXA 4OCIA 3BXKA 1RECA 2A4JA 4UPGA 1BOCA 3PLFB 1NX1A 2KFHA 2BL0B 1C7WA 1QTXA 4AQIA 1TCFA 4N5XA 5AEQA 1R2UA 3BUNB 3OX6A 2FCEA 2LVKA 1XFVO 2L2EA 2BBNA 3CR4X 2CT9A 4C0LA 4PE0A 2KBIA 1UWOA 1OMRA 1SKTA 1Y1AA 2MRDA 3PATA 1K2HA 4ORAB 1S5GY 1L2OB 1YUTA 1QLKA 2SASA 1GGWA 1JSAA 3RM1A 3QRXA 1IWQA 2KDHA 1XFWO 3EVUA 4MZLA 2H2KA 2CXJA 4CFQA 1S1EA 3VRQA 3A8RA 1K9PA 1QJTA 3TDUA 2MHHA 1WRKA 2LV7A 2KYCA 1AVSA 1F70A 1V1FA 4FTGA 1Y1UA 2LCPA 4PHNA 1RJVA 2OS8B 2D8NA 1MF8B 1RWYA 3VGOA 4PCWA 1KWOB 1DJHA 2F3ZA 3AAKA 4WQ3A 2KAXA 3D0YA 2JNXA 2JPTA 3GK2A 4F0ZB 1DJGA 1G8IA 3I5HC 1AJ4A 1IRJA 2IS9A 2LNKA 5D7FA 1KFUS 1XK4A 1N0YA 4MLWA 1KQMB 4XJKA 4GGNA 4E68A 4GUKA 1QATA 3OB2B 1CMFA 2BE6A 2WC8A 2F2OA 4DS7A 1LA0A 3I5FC 1JC2A 1QASA 2G9BA 2M97A 2JTTA 5DKQA 2HQWA 1UHKA 3TDIA 2G2BA 1MXLC 2L4IA 1PALA 1TNXA 2GGMA 1PVAA 4HRHA 1DF0A 1BF5A 1KSOA 3FWCA 1FW4A 3CR2A 4NDDA 1NYAA 1DJYA 1IQ5A 2M9GA 3SIBA 2LP2A 4HREE 3DVJA 1TIZA 1WLMA 4NDCA 1W7JB 4PE1A 1B8CA 3EKHA 1EJ3A 3RLZA 2O5GA 1SY9A 1YR5A 1MHOA 3PSRA 1AK8A 4AOMA 2ISDA 3I5GC 1UP5A 2F3YA 1G4YR 2WCEA 1LKJA 1HT9A 2BE4A 1QLSA 1NX3A 1DJWA 1AUIB 5DKNA 1L7ZA 1BT6A 2KBMA 1CDPA 4TNCA 1KSMA 1J1EA 1D1OA 3HCMA 2MLEC 1ALWA 2ZNEA 3SG4A 3JVTC 1QV0A 2AMIA 4YGDB 2M1KB 3DF0B 1B7TZ 2L5XB 1OMVA 2M7NA 1A2XA 5BPJA 1CB1A 1YUUA 1JFJA 2LLTA 2LC5A 1NSHA 4MRYA 1CM4A 2MJWB 3GK4X 4MSPA 3CGAA 3DVEA 1PULA 4GAOA 5I2LA 4CLNA 1IQ3A 1F71A 1CLLA 3DD4A 4HSZA 4R1EA 4USLA 1RFJA 3O4YA 1YRTB 1CDLA 3SJSA 4PALA 4I5LB 1XVJA 3ZWHA 1WRLA 2GV5A 2I94A 2M3WA 2BECA 3VRNA 1JWDA 4QJ3B 2FCDA 3HX4A 3WNXB 1UHJA 2JXLA 3I5HB 2LMVA 4JQ0D 1G33A 4L9MA 3WHUB 2EHBA 4GBAA 5CSJA 1CKKA 1QXPA 1AP4A 2LUXA 1IJ5A 1A4PA 1K9KA 2LVIA 4JPZB 3M0WA 1CMGA 2CCMA 2EGDA 5AFPA 1QS7A 2Y1NA 1OQPA 1B7TY 1MQ1A 3C1VA 3EKJA 3OP0A 1SMGA 5CSFA 3ICBA 2K7DA 2LP3A 3I5FB 3SG5A 3EK8A 5K89A 1B9AA 3OB1B 4PE7A 1SW8A 2AUCA 4C0KA 5KU1A 1BG1A 2KI6D 4DRWA 2Q91A 1CDMA 1GJYA 3KO0A 1K95A 2HETA 1QV1A 1C07A 5HYDA 2KNEA 2VRGA 1XFYO 3IF7A 5CSIA 1YRUB 5ER4X 1TOPA 3EK7A 1F55A 1XFUO 1FBVA 3I5IC 4N1GA 5I8NA 3NSKA 4YI9A 3CZTX 1NX0A 4QJ4B 2I2RE 2F33A 1Y6WA 2ZKMX 2M49B 1IG5A 1ZMZA 1DJXA 3I5GB 3PN7C 4Q04A 3TS5C 1NX2A 1X02A 3DF0A 1TRFA 5J3XA 4DIRA 4ETOA 1C7VA 2BCXA 1XA5A 2KI4C 1DGVA 4PHJA 3CS1A 1A03A 1VRKA 1B1GA 1EH2A 2SCPA 3JVTB 1NWDA 4P2YB 2L4HA 3O6BA 1N2DA 1BR1B 2KFGA 4OVNF 3OX5A 5I2OA 1NUBA 1QVIZ 2ZN9A 3NSLA 1MXEA 2HF5A 1JFKA 1SNLA 2ZFDA 3GK1A 2JT0A 2PVBA 4ORCB 3ZNIA 3SIAA 4OV2A 2MBXA 1AJ5A 1JF0A 4PHMA 2PMYA 1KFUL 2DOQA 3AKAA 1K94A 1BR4B 5HKZA 2F8PA 2L51A 1SBJA 2Q4UA 3KEVA 1NCYA 4MN0A 3OHMB 1TNQA 2GGZA 4M2PA 2R2IA 1JUOA 5JOLA 1SRAA 1SL7A 2JC2A 2KAVA 1A75B 5KTYA 1CNPA 2NLNA 3FWBA 2CTNA 2FJUB 1FF1A 5TNCA 1YVHA 3BUWB 1NCXA 5D69A 1FPWA 2KSPA 2OTGC 1E8AA 1YUSA 1NCZA 2O60A 3DVMA 1CTRA 1R6PA 5G08A 5GQQC 3CWGA 3KHEA 1NIWA 3BOWB 3WHTB 4OKHA 2BKHB 5F6TA 5AANA 3LL8B 1S3PA 1BMOA 1QVIY 2H61C 1S6JA 2LE9B 2K0JA 4GGFC 1TNWA 1YTZC 4GFTA 1J7QA 4D1EA 4NQGA 3LLEA 1OMDA 4N1FA 4YBHB 4NDBA 2JZIA 1SK6D 4GNKB 3LK0A 1QIVA 2COLB 1S6IA 5HLVA 1PRWA 1YX8A 4MBEA 4QJ5B 1DVIA 2JT3A 1BODA 3AKBA 1XO5A 1Y0VH 2ZN8A 4I5KA 4WRIA 2KHNA 1KK7Y 3VRRA 1F54A 1SCMC 3I5IB 1UHIA 1K96A 5FYXA 3MSEB 4MZKA 2M7LA 2M0RA 2OPOA 2JNFA 3DVKA 3PFVA 3BYAA 3PN7B 2KOTA 4A4BA 1B8LA 3NXAA 3TS5B 1M39A 4YI8A 3LK1A 1SR6C 2NCPA 2PASA 3PALA 1DT7B 5JJGA 3TUYC 2KI4B 1K8UA 2JT8A 1DTLA 2KAYA 2CBLA 2ZNDA 2KGRA 1KK8C 2M8UA 1UUSA 5KSZA 4DUQA 3H4SE 1H4BA 2FOTA 1J7RA 4YRUA 3BUMB 1KFXS 2L50A 3AAJA 3JTDC 1JF2A 1QX5B 4CPVA 2E6WA 1A75A 1HQVA 2MLFC 2E30A 2LANA 4HRGA 1FI5A 1PSRA 1SPYA 4FQOA 1YVLA 2K7OA 1XFZO 2P6BB 3BQ3A 1M46A 2BCAA 2KI6C 4I5NB 1NPQA 1PK0D 2K8MB 5CPVA 1CFPA 2M29A 4P5OE 1H8BA 2NZ0A 2JWWA 1SL8A 3SG3A 2Y4QA 2KFFA 1BLQA 3EVVA 5DKRA 1RTP1 2EC6C 1S6CA 1SYMA 2BCBA 1J55A 1QIWA 2LM5A 3BOWA 3IQQA 5HLOA 5CSNA 1J7OA 2LVVA 2RGIA 1WRZA 5HKWA 3F45A 2F2PA 1JBAA 1ALVA 1CDNA 2V53A 2OTGB 4YGBB 5PALA 1YX7A 1B47A 2AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFX O;  3NSO A;  2LUC A;  2BBM A;  1S26 D;  4IL1 A;  2HPS A;  2Y5I A;  2L0P A;  3D10 A;  3EVR A;  4ORB B;  1XK4 C;  2LMT A;  2MAZ A;  4PHK A;  1EG3 A;  1KCY A;  1TCO B;  4ICB A;  1ZOT B;  1IJ6 A;  1QX7 A;  5B8I B;  1LVC D;  1CLM A;  1XYD A;  2LHL A;  2QAC A;  3WXA A;  1WDC C;  2K2F A;  1F8H A;  3KF9 A;  1MUX A;  5I2Q A;  1S36 A;  1RK9 A;  2JRF A;  1ODB A;  2LMU A;  4BY4 A;  1RRO A;  4PDZ A;  1SCM B;  2LLU A;  1KQV A;  2KQ6 A;  1CLB A;  2WCB A;  5AXI A;  1OOJ A;  4CFR A;  1A29 A;  1B8R A;  5HKY A;  1TTX A;  2K7B A;  4OR9 B;  1EL4 A;  1M63 B;  1KK7 Z;  5ER5 A;  2BL0 C;  1SR6 B;  2PSR A;  2KGB C;  2ZRS A;  1CFF A;  1U5I B;  1TN4 A;  1UHH A;  2CNP A;  2K7C A;  1LA3 A;  2NXQ A;  3TUY B;  1GQM A;  2MA2 A;  2WND A;  3SG7 A;  2JTZ A;  1UUR A;  2PRU A;  1FI6 A;  1KK8 B;  4YGC B;  1OE9 B;  1ZUZ A;  1L2O C;  4PE4 A;  1K90 D;  2K2A A;  1SL9 A;  3TDZ A;  2L98 A;  1M31 A;  1IH0 A;  2JOJ A;  3CR5 X;  1Y1X A;  2JXC A;  3JTD B;  3O78 A;  1CM1 A;  3CTN A;  3VRP A;  4ZCV A;  1MWN A;  1SCV A;  3FIA A;  1J1D A;  4WQ2 A;  2WOR A;  3CLN A;  1NP8 A;  1QX2 A;  1WY9 A;  2HQ8 A;  2B1U A;  1F4O A;  1GGZ A;  1K9U A;  2OS8 C;  3LCP C;  4ZCU A;  1KWO C;  1DGU A;  1W7I B;  1IGV A;  2EC6 B;  2LHI A;  3BUO B;  4M2O A;  4DCK A;  1N65 A;  4JWQ A;  1WLZ A;  2JQ6 A;  4MVF A;  2NCO A;  4MZJ A;  4XYN A;  2H61 A;  3SG2 A;  1DJZ A;  4GGF A;  1Q80 A;  4MEW A;  3O2P A;  2KQY A;  1K93 D;  1BU3 A;  2JU0 A;  1KQM C;  2QPT A;  4GPL B;  4A4C A;  1IKU A;  1B4C A;  1CFC A;  1OZO A;  1OSA A;  1F4Q A;  1ZAC A;  2WCF A;  1M45 A;  5IBW A;  3D0Y B;  1V1G A;  3E3R A;  1PVB A;  3K21 A;  4CID A;  2TN4 A;  1LXF C;  1PSB A;  1EG4 A;  2Y1M A;  3FS7 A;  2KYF A;  1BJF A;  3EK4 A;  1CFD A;  1S5G Z;  2I7A A;  4AQJ A;  1J7P A;  2LLS A;  3A4U B;  4C0J A;  2BKI B;  1UHN A;  2LAP A;  1TNP A;  1EXR A;  4XJK B;  1DJI A;  2JUL A;  3BUX B;  1YUR A;  3VRO A;  4YGA A;  2ZRT A;  1WDC B;  3KPX A;  3GOF A;  2LVJ A;  1OZS A;  1AHR A;  1LIN A;  3IQO A;  3PM8 A;  2PAL A;  4BY5 A;  5AER A;  3NSI A;  4I5J A;  1U5I A;  1ZFS A;  4M2Q A;  3TZ1 A;  3SG6 A;  2M1U A;  1DF0 B;  2WOS A;  2K61 A;  4YGE B;  1MR8 A;  2I18 A;  4U8D A;  1DMO A;  1KFX L;  4MRX A;  4OCI A;  3BXK A;  1REC A;  2A4J A;  4UPG A;  1BOC A;  3PLF B;  1NX1 A;  2KFH A;  2BL0 B;  1C7W A;  1QTX A;  4AQI A;  1TCF A;  4N5X A;  5AEQ A;  1R2U A;  3BUN B;  3OX6 A;  2FCE A;  2LVK A;  1XFV O;  2L2E A;  2BBN A;  3CR4 X;  2CT9 A;  4C0L A;  4PE0 A;  2KBI A;  1UWO A;  1OMR A;  1SKT A;  1Y1A A;  2MRD A;  3PAT A;  1K2H A;  4ORA B;  1S5G Y;  1L2O B;  1YUT A;  1QLK A;  2SAS A;  1GGW A;  1JSA A;  3RM1 A;  3QRX A;  1IWQ A;  2KDH A;  1XFW O;  3EVU A;  4MZL A;  2H2K A;  2CXJ A;  4CFQ A;  1S1E A;  3VRQ A;  3A8R A;  1K9P A;  1QJT A;  3TDU A;  2MHH A;  1WRK A;  2LV7 A;  2KYC A;  1AVS A;  1F70 A;  1V1F A;  4FTG A;  1Y1U A;  2LCP A;  4PHN A;  1RJV A;  2OS8 B;  2D8N A;  1MF8 B;  1RWY A;  3VGO A;  4PCW A;  1KWO B;  1DJH A;  2F3Z A;  3AAK A;  4WQ3 A;  2KAX A;  3D0Y A;  2JNX A;  2JPT A;  3GK2 A;  4F0Z B;  1DJG A;  1G8I A;  3I5H C;  1AJ4 A;  1IRJ A;  2IS9 A;  2LNK A;  5D7F A;  1KFU S;  1XK4 A;  1N0Y A;  4MLW A;  1KQM B;  4XJK A;  4GGN A;  4E68 A;  4GUK A;  1QAT A;  3OB2 B;  1CMF A;  2BE6 A;  2WC8 A;  2F2O A;  4DS7 A;  1LA0 A;  3I5F C;  1JC2 A;  1QAS A;  2G9B A;  2M97 A;  2JTT A;  5DKQ A;  2HQW A;  1UHK A;  3TDI A;  2G2B A;  1MXL C;  2L4I A;  1PAL A;  1TNX A;  2GGM A;  1PVA A;  4HRH A;  1DF0 A;  1BF5 A;  1KSO A;  3FWC A;  1FW4 A;  3CR2 A;  4NDD A;  1NYA A;  1DJY A;  1IQ5 A;  2M9G A;  3SIB A;  2LP2 A;  4HRE E;  3DVJ A;  1TIZ A;  1WLM A;  4NDC A;  1W7J B;  4PE1 A;  1B8C A;  3EKH A;  1EJ3 A;  3RLZ A;  2O5G A;  1SY9 A;  1YR5 A;  1MHO A;  3PSR A;  1AK8 A;  4AOM A;  2ISD A;  3I5G C;  1UP5 A;  2F3Y A;  1G4Y R;  2WCE A;  1LKJ A;  1HT9 A;  2BE4 A;  1QLS A;  1NX3 A;  1DJW A;  1AUI B;  5DKN A;  1L7Z A;  1BT6 A;  2KBM A;  1CDP A;  4TNC A;  1KSM A;  1J1E A;  1D1O A;  3HCM A;  2MLE C;  1ALW A;  2ZNE A;  3SG4 A;  3JVT C;  1QV0 A;  2AMI A;  4YGD B;  2M1K B;  3DF0 B;  1B7T Z;  2L5X B;  1OMV A;  2M7N A;  1A2X A;  5BPJ A;  1CB1 A;  1YUU A;  1JFJ A;  2LLT A;  2LC5 A;  1NSH A;  4MRY A;  1CM4 A;  2MJW B;  3GK4 X;  4MSP A;  3CGA A;  3DVE A;  1PUL A;  4GAO A;  5I2L A;  4CLN A;  1IQ3 A;  1F71 A;  1CLL A;  3DD4 A;  4HSZ A;  4R1E A;  4USL A;  1RFJ A;  3O4Y A;  1YRT B;  1CDL A;  3SJS A;  4PAL A;  4I5L B;  1XVJ A;  3ZWH A;  1WRL A;  2GV5 A;  2I94 A;  2M3W A;  2BEC A;  3VRN A;  1JWD A;  4QJ3 B;  2FCD A;  3HX4 A;  3WNX B;  1UHJ A;  2JXL A;  3I5H B;  2LMV A;  4JQ0 D;  1G33 A;  4L9M A;  3WHU B;  2EHB A;  4GBA A;  5CSJ A;  1CKK A;  1QXP A;  1AP4 A;  2LUX A;  1IJ5 A;  1A4P A;  1K9K A;  2LVI A;  4JPZ B;  3M0W A;  1CMG A;  2CCM A;  2EGD A;  5AFP A;  1QS7 A;  2Y1N A;  1OQP A;  1B7T Y;  1MQ1 A;  3C1V A;  3EKJ A;  3OP0 A;  1SMG A;  5CSF A;  3ICB A;  2K7D A;  2LP3 A;  3I5F B;  3SG5 A;  3EK8 A;  5K89 A;  1B9A A;  3OB1 B;  4PE7 A;  1SW8 A;  2AUC A;  4C0K A;  5KU1 A;  1BG1 A;  2KI6 D;  4DRW A;  2Q91 A;  1CDM A;  1GJY A;  3KO0 A;  1K95 A;  2HET A;  1QV1 A;  1C07 A;  5HYD A;  2KNE A;  2VRG A;  1XFY O;  3IF7 A;  5CSI A;  1YRU B;  5ER4 X;  1TOP A;  3EK7 A;  1F55 A;  1XFU O;  1FBV A;  3I5I C;  4N1G A;  5I8N A;  3NSK A;  4YI9 A;  3CZT X;  1NX0 A;  4QJ4 B;  2I2R E;  2F33 A;  1Y6W A;  2ZKM X;  2M49 B;  1IG5 A;  1ZMZ A;  1DJX A;  3I5G B;  3PN7 C;  4Q04 A;  3TS5 C;  1NX2 A;  1X02 A;  3DF0 A;  1TRF A;  5J3X A;  4DIR A;  4ETO A;  1C7V A;  2BCX A;  1XA5 A;  2KI4 C;  1DGV A;  4PHJ A;  3CS1 A;  1A03 A;  1VRK A;  1B1G A;  1EH2 A;  2SCP A;  3JVT B;  1NWD A;  4P2Y B;  2L4H A;  3O6B A;  1N2D A;  1BR1 B;  2KFG A;  4OVN F;  3OX5 A;  5I2O A;  1NUB A;  1QVI Z;  2ZN9 A;  3NSL A;  1MXE A;  2HF5 A;  1JFK A;  1SNL A;  2ZFD A;  3GK1 A;  2JT0 A;  2PVB A;  4ORC B;  3ZNI A;  3SIA A;  4OV2 A;  2MBX A;  1AJ5 A;  1JF0 A;  4PHM A;  2PMY A;  1KFU L;  2DOQ A;  3AKA A;  1K94 A;  1BR4 B;  5HKZ A;  2F8P A;  2L51 A;  1SBJ A;  2Q4U A;  3KEV A;  1NCY A;  4MN0 A;  3OHM B;  1TNQ A;  2GGZ A;  4M2P A;  2R2I A;  1JUO A;  5JOL A;  1SRA A;  1SL7 A;  2JC2 A;  2KAV A;  1A75 B;  5KTY A;  1CNP A;  2NLN A;  3FWB A;  2CTN A;  2FJU B;  1FF1 A;  5TNC A;  1YVH A;  3BUW B;  1NCX A;  5D69 A;  1FPW A;  2KSP A;  2OTG C;  1E8A A;  1YUS A;  1NCZ A;  2O60 A;  3DVM A;  1CTR A;  1R6P A;  5G08 A;  5GQQ C;  3CWG A;  3KHE A;  1NIW A;  3BOW B;  3WHT B;  4OKH A;  2BKH B;  5F6T A;  5AAN A;  3LL8 B;  1S3P A;  1BMO A;  1QVI Y;  2H61 C;  1S6J A;  2LE9 B;  2K0J A;  4GGF C;  1TNW A;  1YTZ C;  4GFT A;  1J7Q A;  4D1E A;  4NQG A;  3LLE A;  1OMD A;  4N1F A;  4YBH B;  4NDB A;  2JZI A;  1SK6 D;  4GNK B;  3LK0 A;  1QIV A;  2COL B;  1S6I A;  5HLV A;  1PRW A;  1YX8 A;  4MBE A;  4QJ5 B;  1DVI A;  2JT3 A;  1BOD A;  3AKB A;  1XO5 A;  1Y0V H;  2ZN8 A;  4I5K A;  4WRI A;  2KHN A;  1KK7 Y;  3VRR A;  1F54 A;  1SCM C;  3I5I B;  1UHI A;  1K96 A;  5FYX A;  3MSE B;  4MZK A;  2M7L A;  2M0R A;  2OPO A;  2JNF A;  3DVK A;  3PFV A;  3BYA A;  3PN7 B;  2KOT A;  4A4B A;  1B8L A;  3NXA A;  3TS5 B;  1M39 A;  4YI8 A;  3LK1 A;  1SR6 C;  2NCP A;  2PAS A;  3PAL A;  1DT7 B;  5JJG A;  3TUY C;  2KI4 B;  1K8U A;  2JT8 A;  1DTL A;  2KAY A;  2CBL A;  2ZND A;  2KGR A;  1KK8 C;  2M8U A;  1UUS A;  5KSZ A;  4DUQ A;  3H4S E;  1H4B A;  2FOT A;  1J7R A;  4YRU A;  3BUM B;  1KFX S;  2L50 A;  3AAJ A;  3JTD C;  1JF2 A;  1QX5 B;  4CPV A;  2E6W A;  1A75 A;  1HQV A;  2MLF C;  2E30 A;  2LAN A;  4HRG A;  1FI5 A;  1PSR A;  1SPY A;  4FQO A;  1YVL A;  2K7O A;  1XFZ O;  2P6B B;  3BQ3 A;  1M46 A;  2BCA A;  2KI6 C;  4I5N B;  1NPQ A;  1PK0 D;  2K8M B;  5CPV A;  1CFP A;  2M29 A;  4P5O E;  1H8B A;  2NZ0 A;  2JWW A;  1SL8 A;  3SG3 A;  2Y4Q A;  2KFF A;  1BLQ A;  3EVV A;  5DKR A;  1RTP 1;  2EC6 C;  1S6C A;  1SYM A;  2BCB A;  1J55 A;  1QIW A;  2LM5 A;  3BOW A;  3IQQ A;  5HLO A;  5CSN A;  1J7O A;  2LVV A;  2RGI A;  1WRZ A;  5HKW A;  3F45 A;  2F2P A;  1JBA A;  1ALV A;  1CDN A;  2V53 A;  2OTG B;  4YGB B;  5PAL A;  1YX7 A;  1B47 A;  2AAO A; 
#chains in the Genus database with same CATH topology
 3CZ1 A;  1XFR A;  1XFX O;  3NHT A;  3NSO A;  2LUC A;  2BBM A;  2KLD A;  1S26 D;  4IL1 A;  2HPS A;  2Y5I A;  2L0P A;  3D10 A;  3EVR A;  4ORB B;  1OOG A;  1XK4 C;  2LMT A;  2MAZ A;  3BFB A;  1EG3 A;  4PHK A;  1KCY A;  1C3Z A;  1TCO B;  4ICB A;  1ZOT B;  1IJ6 A;  2P71 A;  2K60 A;  1QX7 A;  5B8I B;  1LVC D;  1CLM A;  1XYD A;  2LHL A;  2QAC A;  3WXA A;  3FE6 A;  5I94 A;  1WDC C;  2K2F A;  1F8H A;  3KF9 A;  1MUX A;  5I2Q A;  1S36 A;  1RK9 A;  2JRF A;  1ODB A;  2LMU A;  4BY4 A;  1RRO A;  4PDZ A;  1SCM B;  2LLU A;  1KQV A;  2KQ6 A;  1CLB A;  2WCB A;  5AXI A;  1OOJ A;  3S0G A;  1A29 A;  4CFR A;  1B8R A;  5HKY A;  1TTX A;  2K7B A;  3QME A;  4OR9 B;  1EL4 A;  1M63 B;  1KK7 Z;  5ER5 A;  2BL0 C;  1Z2C B;  1SR6 B;  3L47 A;  2PSR A;  2KGB C;  2ZRS A;  1CFF A;  1U5I B;  1TN4 A;  1UHH A;  2CNP A;  2K7C A;  1LA3 A;  2NXQ A;  3CZ0 A;  1GQM A;  2MA2 A;  3TUY B;  2WND A;  3SG7 A;  4F7F A;  2JTZ A;  1UUR A;  2PRU A;  3UNW A;  1KK8 B;  1FI6 A;  4INW A;  4YGC B;  1OE9 B;  1ZUZ A;  4KYN A;  1L2O C;  4PE4 A;  1K90 D;  2K2A A;  1SL9 A;  3TDZ A;  2L98 A;  1M31 A;  1IH0 A;  2JOJ A;  3CR5 X;  1Y1X A;  2JXC A;  3JTD B;  3O78 A;  1CM1 A;  3CTN A;  3VRP A;  4ZCV A;  1MWN A;  1SCV A;  3S0F A;  3FIA A;  1J1D A;  4WQ2 A;  3R1P A;  2WOR A;  1TUJ A;  3CLN A;  1T14 A;  1NP8 A;  1QX2 A;  1WY9 A;  2HQ8 A;  2B1U A;  1F4O A;  1GGZ A;  3BFH A;  1K9U A;  2OS8 C;  3LCP C;  3L4L A;  4ZCU A;  1KWO C;  3NGV A;  1DGU A;  1W7I B;  1IGV A;  2EC6 B;  2LHI A;  3BUO B;  4M2O A;  4DCK A;  1N65 A;  4JWQ A;  1WLZ A;  3CZ2 A;  2JQ6 A;  3D78 A;  4MVF A;  2NCO A;  4MZJ A;  4XYN A;  1QWV A;  2H61 A;  1DJZ A;  4GGF A;  3SG2 A;  1Q80 A;  4MEW A;  3O2P A;  2KQY A;  1K93 D;  1BU3 A;  2JU0 A;  1KQM C;  2QPT A;  4GPL B;  4A4C A;  3NHI A;  1IKU A;  1B4C A;  3OBV A;  1OZO A;  1OSA A;  1F4Q A;  1ZAC A;  2WCF A;  1CFC A;  1J7O A;  1M45 A;  5IBW A;  3D0Y B;  1V1G A;  3E3R A;  1PVB A;  3K21 A;  4CID A;  2TN4 A;  3OGN A;  1LXF C;  1PSB A;  1OOF A;  1EG4 A;  2Y1M A;  3B6X A;  1DC1 A;  3FS7 A;  2KYF A;  1BJF A;  3EK4 A;  1CFD A;  1S5G Z;  2I7A A;  4AQJ A;  1TWO A;  1J7P A;  2LLS A;  3A4U B;  4C0J A;  2BKI B;  1UHN A;  2LAP A;  1TNP A;  1EXR A;  4XJK B;  1DJI A;  2JUL A;  3BUX B;  1YUR A;  1C3Y A;  3VRO A;  4YGA A;  2ZRT A;  1WDC B;  3KPX A;  3GOF A;  2LVJ A;  1OZS A;  1AHR A;  1LIN A;  3IQO A;  3PM8 A;  2P70 A;  2PAL A;  4BY5 A;  5AER A;  3NSI A;  4I5J A;  1U5I A;  1ZFS A;  4M2Q A;  3TZ1 A;  3SG6 A;  2M1U A;  1DF0 B;  2WOS A;  2K61 A;  4YGE B;  1MR8 A;  2I18 A;  4U8D A;  1DMO A;  1KFX L;  4MRX A;  4OCI A;  3BXK A;  1REC A;  2A4J A;  4UPG A;  1BOC A;  3PLF B;  3VB1 A;  1NX1 A;  2KFH A;  2BL0 B;  1C7W A;  1QTX A;  3B86 A;  2KPH A;  4AQI A;  1TCF A;  3PM2 A;  4N5X A;  5AEQ A;  1R2U A;  3BUN B;  3OX6 A;  2FCE A;  2LVK A;  1XFV O;  2L2E A;  2BBN A;  3CR4 X;  2CT9 A;  4C0L A;  4PE0 A;  2KBI A;  3R1O A;  1UWO A;  1OMR A;  1SKT A;  1Y1A A;  2MRD A;  3PAT A;  1K2H A;  4ORA B;  1S5G Y;  1L2O B;  1DEK A;  1YUT A;  1QLK A;  2SAS A;  1GGW A;  1FI5 A;  1JSA A;  4INX A;  3RM1 A;  3O4X A;  3QRX A;  1IWQ A;  2KDH A;  1XFW O;  3EVU A;  4MZL A;  2H2K A;  2CXJ A;  4CFQ A;  1S1E A;  3VRQ A;  3A8R A;  1K9P A;  1QJT A;  3TDU A;  2MHH A;  2QEH A;  1WRK A;  2LV7 A;  2KYC A;  1AVS A;  1DQE A;  1F70 A;  3CAB A;  1V1F A;  4FTG A;  1Y1U A;  2L5Y A;  2LCP A;  4PHN A;  1RJV A;  2OS8 B;  2D8N A;  1MF8 B;  1RWY A;  3VGO A;  4PCW A;  1KWO B;  1DJH A;  2F3Z A;  3AAK A;  4WQ3 A;  2QDI A;  2KAX A;  3D0Y A;  2JNX A;  2JPT A;  3GK2 A;  4F0Z B;  1DJG A;  1G8I A;  3I5H C;  1AJ4 A;  1IRJ A;  2IS9 A;  2LNK A;  5D7F A;  1KFU S;  1XK4 A;  1N0Y A;  1SSE B;  4MLW A;  1KQM B;  4XJK A;  4GGN A;  4E68 A;  4GUK A;  1QAT A;  3OB2 B;  3DZT A;  1CMF A;  2BE6 A;  2WC8 A;  2F2O A;  4DS7 A;  1LA0 A;  3I5F C;  1JC2 A;  1QAS A;  2G9B A;  2M97 A;  2JTT A;  3N7H A;  5DKQ A;  2HQW A;  1UHK A;  3TDI A;  2G2B A;  1MXL C;  2L4I A;  1PAL A;  1TNX A;  2GGM A;  2WC6 A;  1PVA A;  4HRH A;  1DF0 A;  1BF5 A;  1KSO A;  3FWC A;  1FW4 A;  3CR2 A;  4NDD A;  1NYA A;  1DJY A;  1IQ5 A;  2M9G A;  3SIB A;  2LP2 A;  4HRE E;  3DVJ A;  1TIZ A;  1WLM A;  4NDC A;  1W7J B;  1OW4 A;  4PE1 A;  1B8C A;  3EKH A;  1EJ3 A;  3RLZ A;  2O5G A;  1SY9 A;  1YR5 A;  1MHO A;  3PSR A;  1AK8 A;  4AOM A;  3Q8I A;  2ISD A;  1IIO A;  3I5G C;  1UP5 A;  3SS3 A;  2F3Y A;  1G4Y R;  3S0E A;  2WCE A;  1LKJ A;  1HT9 A;  2BE4 A;  3CYZ A;  1QLS A;  1NX3 A;  1DJW A;  3B7A A;  1AUI B;  5DKN A;  2WCK A;  1L7Z A;  1BT6 A;  2KBM A;  1CDP A;  4TNC A;  1KSM A;  1J1E A;  1D1O A;  3HCM A;  2MLE C;  1ALW A;  2QEB A;  2ZNE A;  3JVT C;  3SG4 A;  1QV0 A;  2AMI A;  4YGD B;  2M1K B;  3DF0 B;  1B7T Z;  2H8V A;  2L5X B;  1OMV A;  2M7N A;  1A2X A;  5BPJ A;  1CB1 A;  1YUU A;  1TUZ A;  1JFJ A;  2LLT A;  2LC5 A;  1NSH A;  4MRY A;  1CM4 A;  2MJW B;  3GK4 X;  4MSP A;  3CGA A;  3DVE A;  1PUL A;  4GAO A;  5I2L A;  4CLN A;  1IQ3 A;  1F71 A;  1CLL A;  3DD4 A;  4HSZ A;  4R1E A;  4USL A;  1RFJ A;  2YGU A;  2WCL A;  3O4Y A;  1YRT B;  1CDL A;  3SJS A;  2JPO A;  4PAL A;  4I5L B;  1XVJ A;  3S0D A;  3ZWH A;  1WRL A;  2GV5 A;  2I94 A;  2M3W A;  2BEC A;  3VRN A;  1JWD A;  4QJ3 B;  2FCD A;  3HX4 A;  3WNX B;  1UHJ A;  2JXL A;  3I5H B;  2LMV A;  4JQ0 D;  1G33 A;  4L9M A;  3WHU B;  2EHB A;  4GBA A;  1OOH A;  5CSJ A;  5FI6 A;  1CKK A;  1QXP A;  1AP4 A;  2LUX A;  1IJ5 A;  1A4P A;  1K9K A;  2LVI A;  3EG5 B;  3M0W A;  4JPZ B;  1CMG A;  2CCM A;  2EGD A;  5AFP A;  1QS7 A;  4FQT A;  2BAP A;  1OQP A;  2Y1N A;  1B7T Y;  1MQ1 A;  3C1V A;  3EKJ A;  3OP0 A;  1SMG A;  5CSF A;  3ICB A;  2K7D A;  3SS4 A;  2LP3 A;  3I5F B;  3SG5 A;  3EK8 A;  5K89 A;  1B9A A;  3OB1 B;  4PE7 A;  1SW8 A;  2AUC A;  5HL1 A;  4C0K A;  5KU1 A;  1BG1 A;  2KI6 D;  4DRW A;  2Q91 A;  1CDM A;  1GJY A;  3KO0 A;  1K95 A;  2HET A;  2WCH A;  1QV1 A;  1C07 A;  5HYD A;  2KNE A;  2VRG A;  1XFY O;  3IF7 A;  1W9Z A;  5CSI A;  3UO9 A;  1YRU B;  5ER4 X;  1TOP A;  3EK7 A;  1F55 A;  1XFU O;  1FBV A;  3I5I C;  4N1G A;  1Z4H A;  3NSK A;  4YI9 A;  3CZT X;  1NX0 A;  4QJ4 B;  5I8N A;  3K1E A;  2I2R E;  2F33 A;  1Y6W A;  3S0B A;  2ZKM X;  2M49 B;  1IG5 A;  1ZMZ A;  1DJX A;  3I5G B;  3PN7 C;  4Q04 A;  3D74 A;  4OZD A;  3TS5 C;  1NX2 A;  1X02 A;  3V2L A;  3DF0 A;  1TRF A;  5J3X A;  1ORG A;  4DIR A;  4ETO A;  1C7V A;  2PYQ A;  3D77 A;  2BCX A;  2KLE A;  1XA5 A;  2KI4 C;  1DGV A;  4PHJ A;  1OOI X;  3CS1 A;  1A03 A;  1VRK A;  3PJI A;  5FI7 A;  1P28 A;  2SCP A;  3JVT B;  1B1G A;  1EH2 A;  1NWD A;  3R72 A;  2L4H A;  4P2Y B;  3O6B A;  1N2D A;  1BR1 B;  2KFG A;  4OVN F;  3OX5 A;  5I2O A;  1NUB A;  1QVI Z;  2ZN9 A;  1GM0 A;  3NSL A;  1MXE A;  2HF5 A;  1JFK A;  1SNL A;  2ZFD A;  3GK1 A;  2JT0 A;  2PVB A;  4ORC B;  3ZNI A;  3SIA A;  4OV2 A;  2MBX A;  1AJ5 A;  1JF0 A;  3D76 A;  2PMY A;  4PHM A;  1KFU L;  2L2C A;  2DOQ A;  3AKA A;  1K94 A;  1BR4 B;  5HKZ A;  2F8P A;  2L51 A;  1SBJ A;  2Q4U A;  3KEV A;  1NCY A;  4MN0 A;  3OHM B;  1TNQ A;  2GGZ A;  4M2P A;  2R2I A;  3FE9 A;  1JUO A;  5JOL A;  1SRA A;  1SL7 A;  2JC2 A;  2KAV A;  1A75 B;  5KTY A;  3RZS A;  1CNP A;  2NLN A;  3FWB A;  2CTN A;  2FJU B;  1FF1 A;  5TNC A;  1YVH A;  3BUW B;  1NCX A;  5D69 A;  1FPW A;  2KSP A;  2OTG C;  3BFA A;  1E8A A;  3B87 A;  1YUS A;  1NCZ A;  2O60 A;  3DVM A;  1CTR A;  1R6P A;  5G08 A;  5GQQ C;  3CWG A;  3KHE A;  3D73 A;  1NIW A;  3BOW B;  3WHT B;  4OKH A;  2BKH B;  5F6T A;  5AAN A;  3LL8 B;  1S3P A;  1BMO A;  1QVI Y;  2H61 C;  1S6J A;  2LE9 B;  2K0J A;  4GGF C;  1TNW A;  1YTZ C;  2WCJ A;  4GFT A;  4PT1 A;  1J7Q A;  4D1E A;  4NQG A;  3LLE A;  1OMD A;  4N1F A;  4YBH B;  4NDB A;  4JD9 A;  2JZI A;  1SK6 D;  4GNK B;  3LK0 A;  1QIV A;  2COL B;  1S6I A;  3S0A A;  5HLV A;  1PRW A;  1YX8 A;  4MBE A;  4QJ5 B;  1DVI A;  2JT3 A;  3FE8 A;  1BOD A;  3AKB A;  1XO5 A;  1Y0V H;  2ZN8 A;  4I5K A;  4WRI A;  2KHN A;  3SS5 A;  1KK7 Y;  3VRR A;  1F54 A;  1SCM C;  3I5I B;  1UHI A;  1DEL A;  1K96 A;  5FYX A;  2WC5 A;  3MSE B;  4MZK A;  5FI2 A;  2M7L A;  2M0R A;  2OPO A;  2JNF A;  4IJ7 A;  3DVK A;  3PFV A;  3BYA A;  3PN7 B;  2KOT A;  4A4B A;  1B8L A;  3NXA A;  3TS5 B;  1M39 A;  2ERB A;  4YI8 A;  3LK1 A;  1SR6 C;  2NCP A;  2PAS A;  3PAL A;  2FJY A;  1DT7 B;  5JJG A;  3IVT A;  3TUY C;  2KI4 B;  2WCM A;  5EL2 A;  1K8U A;  2JT8 A;  1DTL A;  2KAY A;  3BJH A;  2CBL A;  2ZND A;  2KGR A;  2GTE A;  3DY9 A;  1KK8 C;  2M8U A;  1UUS A;  5KSZ A;  4DUQ A;  2BNX A;  3H4S E;  2QEV A;  1H4B A;  2FOT A;  1J7R A;  4YRU A;  3BUM B;  1KFX S;  2L50 A;  3AAJ A;  3DYE A;  3JTD C;  1JF2 A;  1QX5 B;  3R1V A;  2E6W A;  1A75 A;  1HQV A;  4CPV A;  2MLF C;  2E30 A;  2LAN A;  4HRG A;  2PQL A;  1PSR A;  1SPY A;  4FQO A;  4JKT A;  1YVL A;  2K7O A;  3D75 A;  1XFZ O;  2P6B B;  3L4A A;  3BQ3 A;  1M46 A;  2BCA A;  2KI6 C;  4I5N B;  1NPQ A;  1PK0 D;  2K8M B;  5CPV A;  1CFP A;  2M29 A;  4P5O E;  3DXL A;  1H8B A;  2NZ0 A;  2JWW A;  1SL8 A;  3SG3 A;  2Y4Q A;  2KFF A;  1BLQ A;  3EVV A;  5DKR A;  1RTP 1;  2EC6 C;  3B88 A;  1S6C A;  1SYM A;  2BCB A;  1J55 A;  1QIW A;  2LM5 A;  2QEO A;  3BOW A;  3IQQ A;  5CSN A;  5HLO A;  2LVV A;  2RGI A;  1WRZ A;  5HKW A;  3F45 A;  5D3O A;  2F2P A;  3CDN A;  1JBA A;  1ALV A;  1CDN A;  2V53 A;  2OTG B;  4YGB B;  5DIC A;  5PAL A;  1LS8 A;  1YX7 A;  1B47 A;  2AAO A; 
#chains in the Genus database with same CATH homology
 1XFX O;  3NSO A;  2LUC A;  2BBM A;  1S26 D;  4IL1 A;  2HPS A;  2Y5I A;  2L0P A;  3D10 A;  3EVR A;  4ORB B;  1XK4 C;  2LMT A;  2MAZ A;  4PHK A;  1EG3 A;  1KCY A;  1TCO B;  4ICB A;  1ZOT B;  1IJ6 A;  1QX7 A;  5B8I B;  1LVC D;  1CLM A;  1XYD A;  2LHL A;  2QAC A;  3WXA A;  1WDC C;  2K2F A;  1F8H A;  3KF9 A;  1MUX A;  5I2Q A;  1S36 A;  1RK9 A;  2JRF A;  1ODB A;  2LMU A;  4BY4 A;  1RRO A;  4PDZ A;  1SCM B;  2LLU A;  1KQV A;  2KQ6 A;  1CLB A;  2WCB A;  5AXI A;  1OOJ A;  4CFR A;  1A29 A;  1B8R A;  5HKY A;  1TTX A;  2K7B A;  4OR9 B;  1EL4 A;  1M63 B;  1KK7 Z;  5ER5 A;  2BL0 C;  1SR6 B;  2PSR A;  2KGB C;  2ZRS A;  1CFF A;  1U5I B;  1TN4 A;  1UHH A;  2CNP A;  2K7C A;  1LA3 A;  2NXQ A;  3TUY B;  1GQM A;  2MA2 A;  2WND A;  3SG7 A;  2JTZ A;  1UUR A;  2PRU A;  1FI6 A;  1KK8 B;  4YGC B;  1OE9 B;  1ZUZ A;  1L2O C;  4PE4 A;  1K90 D;  2K2A A;  1SL9 A;  3TDZ A;  2L98 A;  1M31 A;  1IH0 A;  2JOJ A;  3CR5 X;  1Y1X A;  2JXC A;  3JTD B;  3O78 A;  1CM1 A;  3CTN A;  3VRP A;  4ZCV A;  1MWN A;  1SCV A;  3FIA A;  1J1D A;  4WQ2 A;  2WOR A;  3CLN A;  1NP8 A;  1QX2 A;  1WY9 A;  2HQ8 A;  2B1U A;  1F4O A;  1GGZ A;  1K9U A;  2OS8 C;  3LCP C;  4ZCU A;  1KWO C;  1DGU A;  1W7I B;  1IGV A;  2EC6 B;  2LHI A;  3BUO B;  4M2O A;  4DCK A;  1N65 A;  4JWQ A;  1WLZ A;  2JQ6 A;  4MVF A;  2NCO A;  4MZJ A;  4XYN A;  2H61 A;  3SG2 A;  1DJZ A;  4GGF A;  1Q80 A;  4MEW A;  3O2P A;  2KQY A;  1K93 D;  1BU3 A;  2JU0 A;  1KQM C;  2QPT A;  4GPL B;  4A4C A;  1IKU A;  1B4C A;  1CFC A;  1OZO A;  1OSA A;  1F4Q A;  1ZAC A;  2WCF A;  1M45 A;  5IBW A;  3D0Y B;  1V1G A;  3E3R A;  1PVB A;  3K21 A;  4CID A;  2TN4 A;  1LXF C;  1PSB A;  1EG4 A;  2Y1M A;  3FS7 A;  2KYF A;  1BJF A;  3EK4 A;  1CFD A;  1S5G Z;  2I7A A;  4AQJ A;  1J7P A;  2LLS A;  3A4U B;  4C0J A;  2BKI B;  1UHN A;  2LAP A;  1TNP A;  1EXR A;  4XJK B;  1DJI A;  2JUL A;  3BUX B;  1YUR A;  3VRO A;  4YGA A;  2ZRT A;  1WDC B;  3KPX A;  3GOF A;  2LVJ A;  1OZS A;  1AHR A;  1LIN A;  3IQO A;  3PM8 A;  2PAL A;  4BY5 A;  5AER A;  3NSI A;  4I5J A;  1U5I A;  1ZFS A;  4M2Q A;  3TZ1 A;  3SG6 A;  2M1U A;  1DF0 B;  2WOS A;  2K61 A;  4YGE B;  1MR8 A;  2I18 A;  4U8D A;  1DMO A;  1KFX L;  4MRX A;  4OCI A;  3BXK A;  1REC A;  2A4J A;  4UPG A;  1BOC A;  3PLF B;  1NX1 A;  2KFH A;  2BL0 B;  1C7W A;  1QTX A;  4AQI A;  1TCF A;  4N5X A;  5AEQ A;  1R2U A;  3BUN B;  3OX6 A;  2FCE A;  2LVK A;  1XFV O;  2L2E A;  2BBN A;  3CR4 X;  2CT9 A;  4C0L A;  4PE0 A;  2KBI A;  1UWO A;  1OMR A;  1SKT A;  1Y1A A;  2MRD A;  3PAT A;  1K2H A;  4ORA B;  1S5G Y;  1L2O B;  1YUT A;  1QLK A;  2SAS A;  1GGW A;  1JSA A;  3RM1 A;  3QRX A;  1IWQ A;  2KDH A;  1XFW O;  3EVU A;  4MZL A;  2H2K A;  2CXJ A;  4CFQ A;  1S1E A;  3VRQ A;  3A8R A;  1K9P A;  1QJT A;  3TDU A;  2MHH A;  1WRK A;  2LV7 A;  2KYC A;  1AVS A;  1F70 A;  1V1F A;  4FTG A;  1Y1U A;  2LCP A;  4PHN A;  1RJV A;  2OS8 B;  2D8N A;  1MF8 B;  1RWY A;  3VGO A;  4PCW A;  1KWO B;  1DJH A;  2F3Z A;  3AAK A;  4WQ3 A;  2KAX A;  3D0Y A;  2JNX A;  2JPT A;  3GK2 A;  4F0Z B;  1DJG A;  1G8I A;  3I5H C;  1AJ4 A;  1IRJ A;  2IS9 A;  2LNK A;  5D7F A;  1KFU S;  1XK4 A;  1N0Y A;  4MLW A;  1KQM B;  4XJK A;  4GGN A;  4E68 A;  4GUK A;  1QAT A;  3OB2 B;  1CMF A;  2BE6 A;  2WC8 A;  2F2O A;  4DS7 A;  1LA0 A;  3I5F C;  1JC2 A;  1QAS A;  2G9B A;  2M97 A;  2JTT A;  5DKQ A;  2HQW A;  1UHK A;  3TDI A;  2G2B A;  1MXL C;  2L4I A;  1PAL A;  1TNX A;  2GGM A;  1PVA A;  4HRH A;  1DF0 A;  1BF5 A;  1KSO A;  3FWC A;  1FW4 A;  3CR2 A;  4NDD A;  1NYA A;  1DJY A;  1IQ5 A;  2M9G A;  3SIB A;  2LP2 A;  4HRE E;  3DVJ A;  1TIZ A;  1WLM A;  4NDC A;  1W7J B;  4PE1 A;  1B8C A;  3EKH A;  1EJ3 A;  3RLZ A;  2O5G A;  1SY9 A;  1YR5 A;  1MHO A;  3PSR A;  1AK8 A;  4AOM A;  2ISD A;  3I5G C;  1UP5 A;  2F3Y A;  1G4Y R;  2WCE A;  1LKJ A;  1HT9 A;  2BE4 A;  1QLS A;  1NX3 A;  1DJW A;  1AUI B;  5DKN A;  1L7Z A;  1BT6 A;  2KBM A;  1CDP A;  4TNC A;  1KSM A;  1J1E A;  1D1O A;  3HCM A;  2MLE C;  1ALW A;  2ZNE A;  3SG4 A;  3JVT C;  1QV0 A;  2AMI A;  4YGD B;  2M1K B;  3DF0 B;  1B7T Z;  2L5X B;  1OMV A;  2M7N A;  1A2X A;  5BPJ A;  1CB1 A;  1YUU A;  1JFJ A;  2LLT A;  2LC5 A;  1NSH A;  4MRY A;  1CM4 A;  2MJW B;  3GK4 X;  4MSP A;  3CGA A;  3DVE A;  1PUL A;  4GAO A;  5I2L A;  4CLN A;  1IQ3 A;  1F71 A;  1CLL A;  3DD4 A;  4HSZ A;  4R1E A;  4USL A;  1RFJ A;  3O4Y A;  1YRT B;  1CDL A;  3SJS A;  4PAL A;  4I5L B;  1XVJ A;  3ZWH A;  1WRL A;  2GV5 A;  2I94 A;  2M3W A;  2BEC A;  3VRN A;  1JWD A;  4QJ3 B;  2FCD A;  3HX4 A;  3WNX B;  1UHJ A;  2JXL A;  3I5H B;  2LMV A;  4JQ0 D;  1G33 A;  4L9M A;  3WHU B;  2EHB A;  4GBA A;  5CSJ A;  1CKK A;  1QXP A;  1AP4 A;  2LUX A;  1IJ5 A;  1A4P A;  1K9K A;  2LVI A;  4JPZ B;  3M0W A;  1CMG A;  2CCM A;  2EGD A;  5AFP A;  1QS7 A;  2Y1N A;  1OQP A;  1B7T Y;  1MQ1 A;  3C1V A;  3EKJ A;  3OP0 A;  1SMG A;  5CSF A;  3ICB A;  2K7D A;  2LP3 A;  3I5F B;  3SG5 A;  3EK8 A;  5K89 A;  1B9A A;  3OB1 B;  4PE7 A;  1SW8 A;  2AUC A;  4C0K A;  5KU1 A;  1BG1 A;  2KI6 D;  4DRW A;  2Q91 A;  1CDM A;  1GJY A;  3KO0 A;  1K95 A;  2HET A;  1QV1 A;  1C07 A;  5HYD A;  2KNE A;  2VRG A;  1XFY O;  3IF7 A;  5CSI A;  1YRU B;  5ER4 X;  1TOP A;  3EK7 A;  1F55 A;  1XFU O;  1FBV A;  3I5I C;  4N1G A;  5I8N A;  3NSK A;  4YI9 A;  3CZT X;  1NX0 A;  4QJ4 B;  2I2R E;  2F33 A;  1Y6W A;  2ZKM X;  2M49 B;  1IG5 A;  1ZMZ A;  1DJX A;  3I5G B;  3PN7 C;  4Q04 A;  3TS5 C;  1NX2 A;  1X02 A;  3DF0 A;  1TRF A;  5J3X A;  4DIR A;  4ETO A;  1C7V A;  2BCX A;  1XA5 A;  2KI4 C;  1DGV A;  4PHJ A;  3CS1 A;  1A03 A;  1VRK A;  1B1G A;  1EH2 A;  2SCP A;  3JVT B;  1NWD A;  4P2Y B;  2L4H A;  3O6B A;  1N2D A;  1BR1 B;  2KFG A;  4OVN F;  3OX5 A;  5I2O A;  1NUB A;  1QVI Z;  2ZN9 A;  3NSL A;  1MXE A;  2HF5 A;  1JFK A;  1SNL A;  2ZFD A;  3GK1 A;  2JT0 A;  2PVB A;  4ORC B;  3ZNI A;  3SIA A;  4OV2 A;  2MBX A;  1AJ5 A;  1JF0 A;  4PHM A;  2PMY A;  1KFU L;  2DOQ A;  3AKA A;  1K94 A;  1BR4 B;  5HKZ A;  2F8P A;  2L51 A;  1SBJ A;  2Q4U A;  3KEV A;  1NCY A;  4MN0 A;  3OHM B;  1TNQ A;  2GGZ A;  4M2P A;  2R2I A;  1JUO A;  5JOL A;  1SRA A;  1SL7 A;  2JC2 A;  2KAV A;  1A75 B;  5KTY A;  1CNP A;  2NLN A;  3FWB A;  2CTN A;  2FJU B;  1FF1 A;  5TNC A;  1YVH A;  3BUW B;  1NCX A;  5D69 A;  1FPW A;  2KSP A;  2OTG C;  1E8A A;  1YUS A;  1NCZ A;  2O60 A;  3DVM A;  1CTR A;  1R6P A;  5G08 A;  5GQQ C;  3CWG A;  3KHE A;  1NIW A;  3BOW B;  3WHT B;  4OKH A;  2BKH B;  5F6T A;  5AAN A;  3LL8 B;  1S3P A;  1BMO A;  1QVI Y;  2H61 C;  1S6J A;  2LE9 B;  2K0J A;  4GGF C;  1TNW A;  1YTZ C;  4GFT A;  1J7Q A;  4D1E A;  4NQG A;  3LLE A;  1OMD A;  4N1F A;  4YBH B;  4NDB A;  2JZI A;  1SK6 D;  4GNK B;  3LK0 A;  1QIV A;  2COL B;  1S6I A;  5HLV A;  1PRW A;  1YX8 A;  4MBE A;  4QJ5 B;  1DVI A;  2JT3 A;  1BOD A;  3AKB A;  1XO5 A;  1Y0V H;  2ZN8 A;  4I5K A;  4WRI A;  2KHN A;  1KK7 Y;  3VRR A;  1F54 A;  1SCM C;  3I5I B;  1UHI A;  1K96 A;  5FYX A;  3MSE B;  4MZK A;  2M7L A;  2M0R A;  2OPO A;  2JNF A;  3DVK A;  3PFV A;  3BYA A;  3PN7 B;  2KOT A;  4A4B A;  1B8L A;  3NXA A;  3TS5 B;  1M39 A;  4YI8 A;  3LK1 A;  1SR6 C;  2NCP A;  2PAS A;  3PAL A;  1DT7 B;  5JJG A;  3TUY C;  2KI4 B;  1K8U A;  2JT8 A;  1DTL A;  2KAY A;  2CBL A;  2ZND A;  2KGR A;  1KK8 C;  2M8U A;  1UUS A;  5KSZ A;  4DUQ A;  3H4S E;  1H4B A;  2FOT A;  1J7R A;  4YRU A;  3BUM B;  1KFX S;  2L50 A;  3AAJ A;  3JTD C;  1JF2 A;  1QX5 B;  4CPV A;  2E6W A;  1A75 A;  1HQV A;  2MLF C;  2E30 A;  2LAN A;  4HRG A;  1FI5 A;  1PSR A;  1SPY A;  4FQO A;  1YVL A;  2K7O A;  1XFZ O;  2P6B B;  3BQ3 A;  1M46 A;  2BCA A;  2KI6 C;  4I5N B;  1NPQ A;  1PK0 D;  2K8M B;  5CPV A;  1CFP A;  2M29 A;  4P5O E;  1H8B A;  2NZ0 A;  2JWW A;  1SL8 A;  3SG3 A;  2Y4Q A;  2KFF A;  1BLQ A;  3EVV A;  5DKR A;  1RTP 1;  2EC6 C;  1S6C A;  1SYM A;  2BCB A;  1J55 A;  1QIW A;  2LM5 A;  3BOW A;  3IQQ A;  5HLO A;  5CSN A;  1J7O A;  2LVV A;  2RGI A;  1WRZ A;  5HKW A;  3F45 A;  2F2P A;  1JBA A;  1ALV A;  1CDN A;  2V53 A;  2OTG B;  4YGB B;  5PAL A;  1YX7 A;  1B47 A;  2AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...