3DVEA

Crystal structure of ca2+/cam-cav2.2 iq domain complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dveA00
2CTNA 5IBWA 1LA3A 3DF0A 3LLEA 3O6BA 5DKRA 2O5GA 1RWYA 4XYNA 4OCIA 4ORAB 4ZCUA 4L9MA 1NX0A 2K2AA 3KO0A 1JSAA 1CM4A 5I8NA 1NSHA 4PALA 2VRGA 1S6CA 2L4IA 1UHKA 4HSZA 3PSRA 2HETA 2G9BA 3OX5A 1RK9A 1XFVO 2CXJA 4GGFC 2KYFA 3BOWB 1MF8B 1WDCB 5CSJA 1F55A 3IF7A 2JXCA 2K7BA 3FWCA 4GGNA 2M7LA 1XO5A 3EKHA 3LK1A 4DS7A 1OOJA 3TZ1A 2WCFA 2LANA 1A2XA 1K90D 4JWQA 4I5JA 5AXIA 3DVMA 3TUYB 1XA5A 2NXQA 1ALWA 3CLNA 1LVCD 1QS7A 1B8LA 1UWOA 1CLMA 2JWWA 4FQOA 2LHIA 4GBAA 3CGAA 4MEWA 2KFFA 2PVBA 1S36A 1U5IA 2M0RA 4YGEB 3SJSA 2ZNEA 2BCAA 1IKUA 1EH2A 2JC2A 3PN7B 3M0WA 2NLNA 3ZWHA 1V1GA 1X02A 2LMVA 5CPVA 2K8MB 1KQMB 2KGRA 1YVHA 2BBMA 1CLLA 2ZNDA 1N0YA 3EK7A 4HRHA 1K9PA 3JTDB 4QJ3B 1K9UA 1VRKA 1NYAA 1XFXO 3DD4A 4WQ2A 1YUSA 2BL0B 3SG7A 3EVRA 4PHJA 2CNPA 2MBXA 1TCOB 3SIBA 1TIZA 4BY4A 2K61A 1W7IB 2KBIA 2OTGB 3PFVA 4MZLA 1AHRA 2OS8B 2BE4A 1KK7Z 2WCEA 5PALA 4PCWA 1RECA 4GPLB 2LVIA 3GK2A 2BCXA 2WC8A 4R1EA 1BMOA 3C1VA 1C07A 1N2DA 1IRJA 3DVEA 1H8BA 4MLWA 4NDDA 2IS9A 2HF5A 4CFQA 2QACA 1CDLA 4NDBA 3WNXB 2L0PA 5CSNA 1DJGA 2KNEA 4M2PA 1BJFA 1CFDA 5AFPA 3DVKA 3LL8B 1PVBA 3CR4X 4NDCA 1Y1UA 2LCPA 1SPYA 1RFJA 2NCOA 2GV5A 4IL1A 3EK4A 4USLA 1QVIZ 3OP0A 1XK4A 2MAZA 2ZN8A 4DRWA 1BT6A 2PMYA 3D10A 4MSPA 2EC6C 2L98A 3SIAA 2H2KA 1F71A 1NCXA 1S5GY 5AANA 1IJ5A 1PALA 3I5IC 3TDZA 1BU3A 1UHIA 5ER5A 1J7QA 3KF9A 5DKNA 1Y1AA 3HX4A 3SG4A 4YI9A 2E6WA 1DF0B 3F45A 1K8UA 1AJ5A 1BR1B 3BYAA 1NUBA 2BKHB 1GGWA 4ORBB 1K93D 2LC5A 1EJ3A 2G2BA 3EKJA 2K0JA 2BKIB 4N1FA 1AVSA 2I18A 2I94A 1DJZA 1BG1A 1B47A 2MRDA 2KI6D 2F2OA 2L50A 1B8CA 2LP3A 3EVUA 1NX2A 5DKQA 1SCMC 2LHLA 3K21A 1L7ZA 1D1OA 4YGAA 1CFCA 3E3RA 4QJ5B 2KHNA 5I2LA 2WOSA 1IQ3A 1BF5A 5I2OA 1TNWA 4P2YB 1S3PA 1M63B 1CM1A 1TNXA 4CFRA 3VRRA 3BQ3A 3JVTB 1MUXA 5JJGA 1M46A 1CDPA 3CTNA 2EGDA 1M45A 2LVKA 1NWDA 3BXKA 4N1GA 5TNCA 1YX7A 2KYCA 1TOPA 2KQYA 1NP8A 1V1FA 2V53A 3AKAA 3BOWA 1ZUZA 1OZSA 3RLZA 2K7OA 3GK4X 4HREE 3BUNB 4GAOA 2LAPA 3A8RA 1WRLA 2M8UA 1MHOA 2LNKA 1PVAA 3VGOA 4AQIA 2R2IA 1EG4A 5GQQC 4PE1A 1A75A 3FWBA 1S6IA 1DT7B 3PALA 4E68A 2LP2A 1OMDA 1YRUB 2EHBA 3AKBA 1EXRA 1R2UA 1C7WA 1OMRA 4PHNA 1KSOA 3I5HB 2HPSA 2F8PA 1RROA 4MBEA 1KWOC 1OSAA 1EL4A 3PM8A 3OB1B 1K95A 2K2FA 5HKYA 1UP5A 2ZFDA 4MVFA 3I5GB 1RJVA 2KFGA 1AK8A 2LUXA 5HKZA 1XK4C 1ZFSA 1G4YR 2LVVA 3GK1A 1A29A 1CTRA 3BUWB 1FI6A 1M39A 1DGUA 2JNXA 3ICBA 1B4CA 1AJ4A 2PALA 1SY9A 4D1EA 3I5FB 1MWNA 1PK0D 1CDMA 5CSIA 1DJHA 1SW8A 1AUIB 1SKTA 1K9KA 2SASA 4OR9B 1F8HA 1CLBA 1YURA 2LLTA 1YUUA 1YX8A 1SNLA 1QATA 4F0ZB 1PULA 1OMVA 3CR2A 1YVLA 2ZRTA 1JF0A 1GGZA 4MZKA 1QJTA 1BR4B 3O2PA 2I2RE 1OZOA 4YBHB 4PHMA 1ALVA 1S1EA 1DTLA 3TS5C 2PRUA 4JPZB 5CSFA 2B1UA 1QTXA 2KAVA 1KK8C 5F6TA 4YGDB 1W7JB 1WLZA 1XFZO 1CNPA 2LMTA 1TRFA 3AAKA 1UUSA 1L2OC 4GUKA 1LINA 1SL9A 1QLKA 2GGMA 1H4BA 2KFHA 3OHMB 2K7CA 1KCYA 1S5GZ 2JPTA 3PATA 1DF0A 2LUCA 3VRQA 4PE7A 1A03A 1JFJA 1Y1XA 1TNPA 1MXLC 2JOJA 2LE9B 3IQOA 3NSKA 4OKHA 2KQ6A 1KFUL 2JZIA 2MLFC 4YGBB 1KSMA 1KWOB 3CR5X 2H61A 2JTTA 4N5XA 1WY9A 3TUYC 1EG3A 1LA0A 1BODA 1LXFC 1J7RA 1KFXL 2GGZA 1MQ1A 1SR6C 2M1KB 2JNFA 1WLMA 4CIDA 1FF1A 1J7PA 2KOTA 1B9AA 4MN0A 1K2HA 2LLUA 1B7TY 2Y5IA 2PSRA 2Y1NA 2NCPA 1F4OA 1YUTA 5KSZA 1KQMC 2F3YA 3MSEB 3D0YB 4MRXA 3NXAA 3JTDC 4WRIA 2MJWB 2L2EA 1JWDA 4AQJA 4TNCA 1SRAA 3BUMB 3EK8A 4M2OA 5BPJA 1Y6WA 2BL0C 5AERA 4I5KA 2JT8A 2KGBC 1HT9A 1BOCA 3SG3A 1MXEA 2AMIA 1LKJA 1ZOTB 2OTGC 4UPGA 2KAXA 3BUXB 4C0JA 1YR5A 1HQVA 4OV2A 4YRUA 2JRFA 3TS5B 3WXAA 1WRZA 4YI8A 1QX5B 3CZTX 3WHUB 5HLVA 1SL8A 1KK8B 1DGVA 1ODBA 4A4CA 3O78A 2BCBA 1KQVA 3SG6A 1PSRA 2D8NA 1QV0A 2CBLA 5HYDA 1DJIA 2P6BB 1L2OB 2TN4A 4HRGA 4XJKB 1E8AA 1YRTB 2EC6B 1QIVA 2JTZA 3NSIA 1QLSA 2MA2A 4NQGA 1QASA 5HLOA 1IJ6A 5I2QA 1PRWA 3DF0B 3I5IB 3CWGA 1MR8A 2HQ8A 2M9GA 1TNQA 1CKKA 1UHNA 2KI6C 1M31A 3OX6A 1CFFA 1NIWA 2Y1MA 1J1EA 2LM5A 2MLEC 2Q91A 1R6PA 3HCMA 1IGVA 1G33A 3SG2A 4Q04A 1G8IA 5ER4X 1QV1A 1YTZC 1JFKA 1A75B 1SR6B 4YGCB 1F54A 2PASA 3NSOA 4C0LA 2M1UA 2KI4C 1QXPA 4A4BA 2JT3A 1RTP1 3RM1A 1S26D 1FPWA 1CB1A 1DJWA 1SCMB 5KU1A 5J3XA 4CLNA 1PSBA 2ZRSA 1U5IB 3DVJA 4DCKA 2I7AA 4P5OE 1JF2A 3AAJA 2H61C 4ETOA 2O60A 2LVJA 1DJYA 3A4UB 4BY5A 1UHJA 4M2QA 2M97A 3NSLA 1OE9B 4I5LB 2WORA 2HQWA 1TTXA 2OPOA 3CS1A 4OVNF 4PE4A 1S6JA 2JULA 2M49B 5KTYA 3VRPA 1DJXA 2Q4UA 5FYXA 1NX1A 5D7FA 1JUOA 1OQPA 2WNDA 2KBMA 1J7OA 1K94A 1ZMZA 2F33A 4FTGA 2LV7A 1KK7Y 4C0KA 2E30A 3GOFA 4GGFA 5AEQA 1F70A 2CCMA 2ISDA 1WRKA 1TN4A 4WQ3A 1F4QA 3JVTC 3TDIA 1XYDA 2F3ZA 1SMGA 2M7NA 1CDNA 1DVIA 3OB2B 1GJYA 4JQ0D 2JT0A 1SCVA 1NCZA 3KEVA 3BUOB 1GQMA 2JXLA 1C7VA 1QX7A 1JC2A 2KDHA 1QIWA 3KPXA 4QJ4B 1IG5A 3FIAA 4PHKA 5D69A 1CMFA 1BLQA 1NX3A 2FOTA 2QPTA 1DMOA 2L4HA 1WDCC 2FCEA 1IWQA 1N65A 1QVIY 1SK6D 1TCFA 2AUCA 1IH0A 3KHEA 4ICBA 4I5NB 3FS7A 2A4JA 2RGIA 2BECA 1XFYO 1XFUO 1CFPA 3I5HC 1SYMA 2M3WA 3QRXA 1SL7A 1QX2A 4GFTA 3EVVA 4ZCVA 5K89A 1Y0VH 2ZN9A 1B7TZ 3ZNIA 4AOMA 4DUQA 2WCBA 4GNKB 3PN7C 2FCDA 3SG5A 3D0YA 2KI4B 3H4SE 1NPQA 2AAOA 2SCPA 3I5GC 1B8RA 2BE6A 5B8IB 1B1GA 2NZ0A 2MHHA 1KFUS 2CT9A 1K96A 2JQ6A 1FBVA 3LCPC 3PLFB 2LLSA 4MZJA 4MRYA 5HKWA 1Q80A 2L51A 1A4PA 3LK0A 4U8DA 5G08A 2Y4QA 3WHTB 1UURA 1FI5A 2BBNA 2FJUB 2JU0A 4CPVA 2LMUA 3O4YA 1SBJA 1J55A 1XFWO 2OS8C 3I5FC 1JBAA 1KFXS 5JOLA 2ZKMX 3IQQA 2M29A 4ORCB 3TDUA 4PDZA 2COLB 3VROA 1IQ5A 1NCYA 2K7DA 2KAYA 3VRNA 1UHHA 4XJKA 2L5XB 1ZACA 2KSPA 1FW4A 1J1DA 4PE0A 2DOQA 1XVJA 4DIRA 2F2PA 1CMGA 1AP4A
chains in the Genus database with same CATH superfamily
2CTNA 5IBWA 1LA3A 3DF0A 3LLEA 3O6BA 5DKRA 2O5GA 1OOFA 1RWYA 4XYNA 4OCIA 4ORAB 4ZCUA 1QWVA 4L9MA 1NX0A 3OBVA 2K2AA 3KO0A 1JSAA 1CM4A 5I8NA 1NSHA 4PALA 2GTEA 2VRGA 1S6CA 2L4IA 1UHKA 4HSZA 3PSRA 2HETA 2G9BA 3PJIA 3OX5A 1RK9A 1XFVO 2CXJA 3IVTA 2KYFA 4GGFC 3BOWB 1MF8B 1WDCB 5CSJA 1F55A 3IF7A 2JXCA 2K7BA 3FWCA 4GGNA 2M7LA 1XO5A 2WC5A 3EKHA 3LK1A 4DS7A 1OOJA 3TZ1A 2WCFA 2LANA 1A2XA 1K90D 4JWQA 4I5JA 5AXIA 3DVMA 3TUYB 1XA5A 2NXQA 1ALWA 3CLNA 1LVCD 1QS7A 4F7FA 1B8LA 1UWOA 1CLMA 2JWWA 4FQOA 2LHIA 4GBAA 3R1PA 3CGAA 4MEWA 2KFFA 2PVBA 1S36A 1U5IA 1T14A 2M0RA 4YGEB 3SJSA 3SS5A 2ZNEA 2BCAA 3RZSA 1IKUA 1DQEA 1EH2A 2JC2A 3PN7B 3M0WA 2NLNA 3ZWHA 3SS3A 3QMEA 1V1GA 1X02A 1W9ZA 2LMVA 1C3YA 5CPVA 2K8MB 1KQMB 2KGRA 3BFBA 1YVHA 2BBMA 1CLLA 2ZNDA 1N0YA 3EK7A 4HRHA 1K9PA 3JTDB 4QJ3B 1K9UA 3OGNA 4JD9A 5D3OA 1VRKA 1NYAA 1XFXO 3DD4A 4WQ2A 1YUSA 2BL0B 3SG7A 3EVRA 4PHJA 2CNPA 2MBXA 1TCOB 3SIBA 1TIZA 4BY4A 2K61A 1W7IB 2KBIA 4IJ7A 2OTGB 3PFVA 4MZLA 1AHRA 2OS8B 2BE4A 1KK7Z 2WCEA 5PALA 4PCWA 3UNWA 1RECA 4OZDA 4GPLB 2LVIA 3GK2A 2BCXA 2WCLA 2WC8A 1IIOA 4R1EA 5DICA 1BMOA 3C1VA 1C07A 1N2DA 1IRJA 2WC6A 3DVEA 1H8BA 4MLWA 4NDDA 2IS9A 2HF5A 4CFQA 2QACA 1CDLA 4NDBA 3WNXB 1LS8A 2L0PA 5CSNA 1DJGA 2KNEA 4M2PA 3FE8A 1BJFA 1CFDA 5AFPA 3PM2A 3DVKA 3D74A 3LL8B 1PVBA 3CR4X 4NDCA 1Y1UA 2LCPA 1SPYA 1RFJA 2NCOA 2GV5A 4IL1A 3S0AA 3EK4A 4USLA 1QVIZ 3OP0A 3BFHA 1XK4A 2MAZA 2ZN8A 4DRWA 1BT6A 2PMYA 3D10A 4MSPA 2EC6C 2BNXA 2L98A 3SIAA 2YGUA 2H2KA 1F71A 1NCXA 4PT1A 1S5GY 5AANA 1IJ5A 1PALA 3I5IC 3TDZA 1BU3A 1UHIA 5ER5A 1J7QA 3KF9A 5I94A 5DKNA 1OOHA 1Y1AA 3HX4A 3SG4A 4YI9A 2E6WA 1DF0B 3F45A 2ERBA 1K8UA 1AJ5A 1BR1B 2BAPA 2QEVA 3BYAA 1NUBA 2BKHB 1GGWA 4ORBB 3DY9A 1K93D 1OW4A 3B86A 2LC5A 3NHTA 1EJ3A 2G2BA 3EKJA 2KLDA 2K0JA 2BKIB 4N1FA 1AVSA 2I18A 2I94A 1DJZA 1XFRA 1BG1A 1B47A 2MRDA 2KI6D 2F2OA 2L50A 1B8CA 2LP3A 3D75A 3EVUA 1NX2A 5DKQA 1SCMC 3R1VA 2PYQA 2LHLA 3K21A 1L7ZA 1D1OA 4YGAA 1CFCA 3E3RA 4QJ5B 2KHNA 3V2LA 5I2LA 2WOSA 1IQ3A 1BF5A 5I2OA 3CZ2A 1TNWA 4P2YB 1S3PA 1M63B 1CM1A 1TNXA 5FI6A 3VRRA 4CFRA 4JKTA 3BQ3A 3JVTB 1MUXA 5JJGA 1M46A 1CDPA 3CTNA 2EGDA 1M45A 2LVKA 1NWDA 3BXKA 3CZ0A 4N1GA 1YX7A 2KYCA 5TNCA 2L5YA 1TOPA 2KQYA 3B6XA 1NP8A 1V1FA 2V53A 3AKAA 3BOWA 1ZUZA 1AP4A 1OZSA 3RLZA 2K7OA 3GK4X 4HREE 4INXA 3BUNB 4GAOA 2LAPA 3A8RA 1WRLA 2M8UA 1MHOA 2LNKA 1PVAA 3VGOA 4AQIA 2R2IA 1EG4A 3BFAA 5GQQC 4PE1A 1A75A 3FWBA 1S6IA 1DT7B 1OOIX 3PALA 4E68A 2LP2A 1OMDA 1YRUB 2EHBA 3AKBA 1EXRA 1R2UA 1C7WA 1OMRA 4PHNA 2QEHA 1KSOA 3I5HB 2HPSA 3VB1A 2F8PA 3L4LA 1RROA 4MBEA 1KWOC 1OSAA 1EL4A 3PM8A 3OB1B 1K95A 2K2FA 5HKYA 1UP5A 2ZFDA 4INWA 4MVFA 3I5GB 1RJVA 3CABA 2KFGA 1DEKA 1AK8A 2LUXA 5HKZA 1XK4C 1ZFSA 2P70A 1G4YR 2LVVA 3GK1A 1A29A 1CTRA 3BUWB 1FI6A 1M39A 1DGUA 2PQLA 3DYEA 2JNXA 5FI7A 2WCMA 3ICBA 3S0GA 1B4CA 1AJ4A 2PALA 1SY9A 4D1EA 3I5FB 1MWNA 1PK0D 3O4XA 1CDMA 5CSIA 1DJHA 1SW8A 1Z2CB 1AUIB 1SKTA 1K9KA 2SASA 4OR9B 1F8HA 1CLBA 1YURA 2LLTA 1YUUA 1YX8A 1SNLA 3B7AA 1QATA 3R72A 4F0ZB 1PULA 1OMVA 3CR2A 1YVLA 2ZRTA 1JF0A 1GGZA 4MZKA 3B87A 1QJTA 1BR4B 3O2PA 2I2RE 1OZOA 4YBHB 4PHMA 1ALVA 1S1EA 1DTLA 3TS5C 2WCJA 2PRUA 4JPZB 5CSFA 2B1UA 1QTXA 2KAVA 1KK8C 5F6TA 4YGDB 1W7JB 1WLZA 1XFZO 1CNPA 2LMTA 1TRFA 3AAKA 1UUSA 1L2OC 4GUKA 1LINA 1SL9A 1QLKA 2GGMA 1H4BA 2KFHA 3OHMB 2K7CA 1KCYA 1S5GZ 2JPTA 3PATA 1DF0A 2LUCA 3VRQA 2QDIA 4PE7A 1A03A 1JFJA 1Y1XA 1TNPA 3N7HA 1MXLC 2JOJA 2LE9B 3IQOA 3NSKA 4OKHA 2KQ6A 1KFUL 2JZIA 3D78A 3FE9A 2MLFC 4YGBB 1KSMA 1KWOB 1SSEB 3CR5X 2H61A 2JTTA 3D77A 4N5XA 1WY9A 3TUYC 1EG3A 1LA0A 1BODA 1LXFC 1J7RA 1KFXL 2GGZA 1MQ1A 1SR6C 2KLEA 2M1KB 3L4AA 2JNFA 1WLMA 4CIDA 1FF1A 1J7PA 1ORGA 2KOTA 1B9AA 4MN0A 1K2HA 2LLUA 1B7TY 2Y5IA 2PSRA 2Y1NA 2L2CA 2NCPA 1F4OA 1YUTA 5KSZA 1KQMC 2F3YA 3MSEB 3D0YB 4MRXA 3NXAA 3JTDC 3CYZA 4WRIA 3S0BA 2MJWB 2L2EA 1JWDA 4AQJA 4TNCA 1SRAA 1Z4HA 3BUMB 3EK8A 4M2OA 5BPJA 1Y6WA 2BL0C 5AERA 1DC1A 4I5KA 2JT8A 2KGBC 1HT9A 3K1EA 1BOCA 3SG3A 1MXEA 2AMIA 1LKJA 1ZOTB 2KPHA 2OTGC 4UPGA 2KAXA 3BUXB 4C0JA 1YR5A 1HQVA 4OV2A 4YRUA 2JRFA 3TS5B 3WXAA 1WRZA 3R1OA 4YI8A 1QX5B 3CZTX 3WHUB 5HLVA 1SL8A 1KK8B 3B88A 1DGVA 4FQTA 1ODBA 4A4CA 3O78A 2BCBA 1KQVA 3SG6A 1PSRA 2D8NA 1QV0A 2CBLA 5HYDA 1DJIA 2P6BB 1L2OB 2TN4A 3NHIA 4HRGA 1E8AA 1YRTB 2EC6B 4XJKB 3DZTA 1QIVA 2JTZA 3NSIA 1QLSA 2MA2A 4NQGA 1QASA 5HLOA 1IJ6A 5I2QA 1PRWA 3DF0B 3I5IB 3CWGA 1MR8A 2HQ8A 2M9GA 1TNQA 1CKKA 1UHNA 2JPOA 2KI6C 1TUZA 1M31A 3OX6A 1CFFA 1NIWA 2Y1MA 1J1EA 2LM5A 2MLEC 2Q91A 1R6PA 3HCMA 1IGVA 1G33A 3SG2A 4Q04A 1G8IA 4KYNA 5ER4X 1QV1A 1YTZC 3NGVA 1JFKA 1A75B 1SR6B 4YGCB 1F54A 2PASA 3NSOA 4C0LA 2M1UA 2KI4C 1QXPA 3D76A 2JT3A 4A4BA 1RTP1 2H8VA 3RM1A 1S26D 1FPWA 3EG5B 1CB1A 1DJWA 1TWOA 1SCMB 5KU1A 5J3XA 4CLNA 1PSBA 2ZRSA 1U5IB 3DVJA 4DCKA 1C3ZA 2I7AA 4P5OE 3S0DA 1JF2A 3AAJA 2H61C 3FE6A 4ETOA 3S0FA 2O60A 3CDNA 2LVJA 1DJYA 3A4UB 4BY5A 1UHJA 4M2QA 2M97A 2QEBA 3NSLA 1OE9B 4I5LB 2WORA 2HQWA 1TTXA 2OPOA 3CS1A 3Q8IA 4OVNF 1S6JA 2JULA 2M49B 4PE4A 5KTYA 3VRPA 1DJXA 2Q4UA 5FYXA 1NX1A 5D7FA 1JUOA 1OQPA 2WNDA 2KBMA 1J7OA 1K94A 1ZMZA 2F33A 4FTGA 2LV7A 1KK7Y 4C0KA 2E30A 3GOFA 4GGFA 5AEQA 1F70A 2CCMA 2ISDA 1WRKA 1TUJA 1TN4A 4WQ3A 2WCHA 1F4QA 3JVTC 3TDIA 2QEOA 1XYDA 2F3ZA 5EL2A 1SMGA 2M7NA 1CDNA 1DVIA 3OB2B 1GJYA 4JQ0D 3UO9A 2JT0A 1SCVA 1NCZA 3KEVA 3BUOB 1GQMA 2JXLA 1C7VA 1QX7A 1JC2A 2KDHA 3BJHA 1QIWA 3KPXA 4QJ4B 1IG5A 3FIAA 4PHKA 5D69A 1CMFA 1BLQA 1P28A 1NX3A 2FOTA 2QPTA 3SS4A 1DMOA 2L4HA 1WDCC 2FCEA 2K60A 1IWQA 1N65A 1QVIY 1SK6D 1TCFA 2AUCA 1IH0A 3KHEA 4ICBA 4I5NB 3FS7A 2A4JA 2RGIA 2BECA 1XFYO 1XFUO 2P71A 1CFPA 3I5HC 1SYMA 2M3WA 3QRXA 1SL7A 1QX2A 4GFTA 3EVVA 4ZCVA 5K89A 1Y0VH 2ZN9A 1B7TZ 3ZNIA 4AOMA 4DUQA 2WCBA 2WCKA 3PN7C 2FCDA 4GNKB 3SG5A 3DXLA 2FJYA 3D0YA 2KI4B 3H4SE 1NPQA 2AAOA 2SCPA 3I5GC 1B8RA 2BE6A 1GM0A 5FI2A 5B8IB 1B1GA 2NZ0A 2MHHA 1KFUS 2CT9A 1K96A 2JQ6A 1FBVA 3LCPC 3PLFB 2LLSA 4MZJA 4MRYA 5HKWA 1Q80A 1DELA 2L51A 1A4PA 3CZ1A 3LK0A 4U8DA 5G08A 2Y4QA 3WHTB 1UURA 1FI5A 2BBNA 2FJUB 2JU0A 4CPVA 2LMUA 3O4YA 1SBJA 1J55A 1XFWO 2OS8C 3I5FC 1JBAA 1KFXS 5JOLA 2ZKMX 3IQQA 2M29A 3D73A 4ORCB 5HL1A 3TDUA 4PDZA 2COLB 3VROA 1IQ5A 1NCYA 1OOGA 2K7DA 2KAYA 3VRNA 1UHHA 3S0EA 4XJKA 2L5XB 1ZACA 2KSPA 1FW4A 1J1DA 4PE0A 2DOQA 1XVJA 4DIRA 2F2PA 1CMGA 3L47A
chains in the Genus database with same CATH topology
2CTNA 5IBWA 1LA3A 3DF0A 3LLEA 3O6BA 5DKRA 2O5GA 1RWYA 4XYNA 4OCIA 4ORAB 4ZCUA 4L9MA 1NX0A 2K2AA 3KO0A 1JSAA 1CM4A 5I8NA 1NSHA 4PALA 2VRGA 1S6CA 2L4IA 1UHKA 4HSZA 3PSRA 2HETA 2G9BA 3OX5A 1RK9A 1XFVO 2CXJA 4GGFC 2KYFA 3BOWB 1MF8B 1WDCB 5CSJA 1F55A 3IF7A 2JXCA 2K7BA 3FWCA 4GGNA 2M7LA 1XO5A 3EKHA 3LK1A 4DS7A 1OOJA 3TZ1A 2WCFA 2LANA 1A2XA 1K90D 4JWQA 4I5JA 5AXIA 3DVMA 3TUYB 1XA5A 2NXQA 1ALWA 3CLNA 1LVCD 1QS7A 1B8LA 1UWOA 1CLMA 2JWWA 4FQOA 2LHIA 4GBAA 3CGAA 4MEWA 2KFFA 2PVBA 1S36A 1U5IA 2M0RA 4YGEB 3SJSA 2ZNEA 2BCAA 1IKUA 1EH2A 2JC2A 3PN7B 3M0WA 2NLNA 3ZWHA 1V1GA 1X02A 2LMVA 5CPVA 2K8MB 1KQMB 2KGRA 1YVHA 2BBMA 1CLLA 2ZNDA 1N0YA 3EK7A 4HRHA 1K9PA 3JTDB 4QJ3B 1K9UA 1VRKA 1NYAA 1XFXO 3DD4A 4WQ2A 1YUSA 2BL0B 3SG7A 3EVRA 4PHJA 2CNPA 2MBXA 1TCOB 3SIBA 1TIZA 4BY4A 2K61A 1W7IB 2KBIA 2OTGB 3PFVA 4MZLA 1AHRA 2OS8B 2BE4A 1KK7Z 2WCEA 5PALA 4PCWA 1RECA 4GPLB 2LVIA 3GK2A 2BCXA 2WC8A 4R1EA 1BMOA 3C1VA 1C07A 1N2DA 1IRJA 3DVEA 1H8BA 4MLWA 4NDDA 2IS9A 2HF5A 4CFQA 2QACA 1CDLA 4NDBA 3WNXB 2L0PA 5CSNA 1DJGA 2KNEA 4M2PA 1BJFA 1CFDA 5AFPA 3DVKA 3LL8B 1PVBA 3CR4X 4NDCA 1Y1UA 2LCPA 1SPYA 1RFJA 2NCOA 2GV5A 4IL1A 3EK4A 4USLA 1QVIZ 3OP0A 1XK4A 2MAZA 2ZN8A 4DRWA 1BT6A 2PMYA 3D10A 4MSPA 2EC6C 2L98A 3SIAA 2H2KA 1F71A 1NCXA 1S5GY 5AANA 1IJ5A 1PALA 3I5IC 3TDZA 1BU3A 1UHIA 5ER5A 1J7QA 3KF9A 5DKNA 1Y1AA 3HX4A 3SG4A 4YI9A 2E6WA 1DF0B 3F45A 1K8UA 1AJ5A 1BR1B 3BYAA 1NUBA 2BKHB 1GGWA 4ORBB 1K93D 2LC5A 1EJ3A 2G2BA 3EKJA 2K0JA 2BKIB 4N1FA 1AVSA 2I18A 2I94A 1DJZA 1BG1A 1B47A 2MRDA 2KI6D 2F2OA 2L50A 1B8CA 2LP3A 3EVUA 1NX2A 5DKQA 1SCMC 2LHLA 3K21A 1L7ZA 1D1OA 4YGAA 1CFCA 3E3RA 4QJ5B 2KHNA 5I2LA 2WOSA 1IQ3A 1BF5A 5I2OA 1TNWA 4P2YB 1S3PA 1M63B 1CM1A 1TNXA 4CFRA 3VRRA 3BQ3A 3JVTB 1MUXA 5JJGA 1M46A 1CDPA 3CTNA 2EGDA 1M45A 2LVKA 1NWDA 3BXKA 4N1GA 5TNCA 1YX7A 2KYCA 1TOPA 2KQYA 1NP8A 1V1FA 2V53A 3AKAA 3BOWA 1ZUZA 1OZSA 3RLZA 2K7OA 3GK4X 4HREE 3BUNB 4GAOA 2LAPA 3A8RA 1WRLA 2M8UA 1MHOA 2LNKA 1PVAA 3VGOA 4AQIA 2R2IA 1EG4A 5GQQC 4PE1A 1A75A 3FWBA 1S6IA 1DT7B 3PALA 4E68A 2LP2A 1OMDA 1YRUB 2EHBA 3AKBA 1EXRA 1R2UA 1C7WA 1OMRA 4PHNA 1KSOA 3I5HB 2HPSA 2F8PA 1RROA 4MBEA 1KWOC 1OSAA 1EL4A 3PM8A 3OB1B 1K95A 2K2FA 5HKYA 1UP5A 2ZFDA 4MVFA 3I5GB 1RJVA 2KFGA 1AK8A 2LUXA 5HKZA 1XK4C 1ZFSA 1G4YR 2LVVA 3GK1A 1A29A 1CTRA 3BUWB 1FI6A 1M39A 1DGUA 2JNXA 3ICBA 1B4CA 1AJ4A 2PALA 1SY9A 4D1EA 3I5FB 1MWNA 1PK0D 1CDMA 5CSIA 1DJHA 1SW8A 1AUIB 1SKTA 1K9KA 2SASA 4OR9B 1F8HA 1CLBA 1YURA 2LLTA 1YUUA 1YX8A 1SNLA 1QATA 4F0ZB 1PULA 1OMVA 3CR2A 1YVLA 2ZRTA 1JF0A 1GGZA 4MZKA 1QJTA 1BR4B 3O2PA 2I2RE 1OZOA 4YBHB 4PHMA 1ALVA 1S1EA 1DTLA 3TS5C 2PRUA 4JPZB 5CSFA 2B1UA 1QTXA 2KAVA 1KK8C 5F6TA 4YGDB 1W7JB 1WLZA 1XFZO 1CNPA 2LMTA 1TRFA 3AAKA 1UUSA 1L2OC 4GUKA 1LINA 1SL9A 1QLKA 2GGMA 1H4BA 2KFHA 3OHMB 2K7CA 1KCYA 1S5GZ 2JPTA 3PATA 1DF0A 2LUCA 3VRQA 4PE7A 1A03A 1JFJA 1Y1XA 1TNPA 1MXLC 2JOJA 2LE9B 3IQOA 3NSKA 4OKHA 2KQ6A 1KFUL 2JZIA 2MLFC 4YGBB 1KSMA 1KWOB 3CR5X 2H61A 2JTTA 4N5XA 1WY9A 3TUYC 1EG3A 1LA0A 1BODA 1LXFC 1J7RA 1KFXL 2GGZA 1MQ1A 1SR6C 2M1KB 2JNFA 1WLMA 4CIDA 1FF1A 1J7PA 2KOTA 1B9AA 4MN0A 1K2HA 2LLUA 1B7TY 2Y5IA 2PSRA 2Y1NA 2NCPA 1F4OA 1YUTA 5KSZA 1KQMC 2F3YA 3MSEB 3D0YB 4MRXA 3NXAA 3JTDC 4WRIA 2MJWB 2L2EA 1JWDA 4AQJA 4TNCA 1SRAA 3BUMB 3EK8A 4M2OA 5BPJA 1Y6WA 2BL0C 5AERA 4I5KA 2JT8A 2KGBC 1HT9A 1BOCA 3SG3A 1MXEA 2AMIA 1LKJA 1ZOTB 2OTGC 4UPGA 2KAXA 3BUXB 4C0JA 1YR5A 1HQVA 4OV2A 4YRUA 2JRFA 3TS5B 3WXAA 1WRZA 4YI8A 1QX5B 3CZTX 3WHUB 5HLVA 1SL8A 1KK8B 1DGVA 1ODBA 4A4CA 3O78A 2BCBA 1KQVA 3SG6A 1PSRA 2D8NA 1QV0A 2CBLA 5HYDA 1DJIA 2P6BB 1L2OB 2TN4A 4HRGA 4XJKB 1E8AA 1YRTB 2EC6B 1QIVA 2JTZA 3NSIA 1QLSA 2MA2A 4NQGA 1QASA 5HLOA 1IJ6A 5I2QA 1PRWA 3DF0B 3I5IB 3CWGA 1MR8A 2HQ8A 2M9GA 1TNQA 1CKKA 1UHNA 2KI6C 1M31A 3OX6A 1CFFA 1NIWA 2Y1MA 1J1EA 2LM5A 2MLEC 2Q91A 1R6PA 3HCMA 1IGVA 1G33A 3SG2A 4Q04A 1G8IA 5ER4X 1QV1A 1YTZC 1JFKA 1A75B 1SR6B 4YGCB 1F54A 2PASA 3NSOA 4C0LA 2M1UA 2KI4C 1QXPA 4A4BA 2JT3A 1RTP1 3RM1A 1S26D 1FPWA 1CB1A 1DJWA 1SCMB 5KU1A 5J3XA 4CLNA 1PSBA 2ZRSA 1U5IB 3DVJA 4DCKA 2I7AA 4P5OE 1JF2A 3AAJA 2H61C 4ETOA 2O60A 2LVJA 1DJYA 3A4UB 4BY5A 1UHJA 4M2QA 2M97A 3NSLA 1OE9B 4I5LB 2WORA 2HQWA 1TTXA 2OPOA 3CS1A 4OVNF 4PE4A 1S6JA 2JULA 2M49B 5KTYA 3VRPA 1DJXA 2Q4UA 5FYXA 1NX1A 5D7FA 1JUOA 1OQPA 2WNDA 2KBMA 1J7OA 1K94A 1ZMZA 2F33A 4FTGA 2LV7A 1KK7Y 4C0KA 2E30A 3GOFA 4GGFA 5AEQA 1F70A 2CCMA 2ISDA 1WRKA 1TN4A 4WQ3A 1F4QA 3JVTC 3TDIA 1XYDA 2F3ZA 1SMGA 2M7NA 1CDNA 1DVIA 3OB2B 1GJYA 4JQ0D 2JT0A 1SCVA 1NCZA 3KEVA 3BUOB 1GQMA 2JXLA 1C7VA 1QX7A 1JC2A 2KDHA 1QIWA 3KPXA 4QJ4B 1IG5A 3FIAA 4PHKA 5D69A 1CMFA 1BLQA 1NX3A 2FOTA 2QPTA 1DMOA 2L4HA 1WDCC 2FCEA 1IWQA 1N65A 1QVIY 1SK6D 1TCFA 2AUCA 1IH0A 3KHEA 4ICBA 4I5NB 3FS7A 2A4JA 2RGIA 2BECA 1XFYO 1XFUO 1CFPA 3I5HC 1SYMA 2M3WA 3QRXA 1SL7A 1QX2A 4GFTA 3EVVA 4ZCVA 5K89A 1Y0VH 2ZN9A 1B7TZ 3ZNIA 4AOMA 4DUQA 2WCBA 4GNKB 3PN7C 2FCDA 3SG5A 3D0YA 2KI4B 3H4SE 1NPQA 2AAOA 2SCPA 3I5GC 1B8RA 2BE6A 5B8IB 1B1GA 2NZ0A 2MHHA 1KFUS 2CT9A 1K96A 2JQ6A 1FBVA 3LCPC 3PLFB 2LLSA 4MZJA 4MRYA 5HKWA 1Q80A 2L51A 1A4PA 3LK0A 4U8DA 5G08A 2Y4QA 3WHTB 1UURA 1FI5A 2BBNA 2FJUB 2JU0A 4CPVA 2LMUA 3O4YA 1SBJA 1J55A 1XFWO 2OS8C 3I5FC 1JBAA 1KFXS 5JOLA 2ZKMX 3IQQA 2M29A 4ORCB 3TDUA 4PDZA 2COLB 3VROA 1IQ5A 1NCYA 2K7DA 2KAYA 3VRNA 1UHHA 4XJKA 2L5XB 1ZACA 2KSPA 1FW4A 1J1DA 4PE0A 2DOQA 1XVJA 4DIRA 2F2PA 1CMGA 1AP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTN A;  5IBW A;  1LA3 A;  3DF0 A;  3LLE A;  3O6B A;  5DKR A;  2O5G A;  1RWY A;  4XYN A;  4OCI A;  4ORA B;  4ZCU A;  4L9M A;  1NX0 A;  2K2A A;  3KO0 A;  1JSA A;  1CM4 A;  5I8N A;  1NSH A;  4PAL A;  2VRG A;  1S6C A;  2L4I A;  1UHK A;  4HSZ A;  3PSR A;  2HET A;  2G9B A;  3OX5 A;  1RK9 A;  1XFV O;  2CXJ A;  4GGF C;  2KYF A;  3BOW B;  1MF8 B;  1WDC B;  5CSJ A;  1F55 A;  3IF7 A;  2JXC A;  2K7B A;  3FWC A;  4GGN A;  2M7L A;  1XO5 A;  3EKH A;  3LK1 A;  4DS7 A;  1OOJ A;  3TZ1 A;  2WCF A;  2LAN A;  1A2X A;  1K90 D;  4JWQ A;  4I5J A;  5AXI A;  3DVM A;  3TUY B;  1XA5 A;  2NXQ A;  1ALW A;  3CLN A;  1LVC D;  1QS7 A;  1B8L A;  1UWO A;  1CLM A;  2JWW A;  4FQO A;  2LHI A;  4GBA A;  3CGA A;  4MEW A;  2KFF A;  2PVB A;  1S36 A;  1U5I A;  2M0R A;  4YGE B;  3SJS A;  2ZNE A;  2BCA A;  1IKU A;  1EH2 A;  2JC2 A;  3PN7 B;  3M0W A;  2NLN A;  3ZWH A;  1V1G A;  1X02 A;  2LMV A;  5CPV A;  2K8M B;  1KQM B;  2KGR A;  1YVH A;  2BBM A;  1CLL A;  2ZND A;  1N0Y A;  3EK7 A;  4HRH A;  1K9P A;  3JTD B;  4QJ3 B;  1K9U A;  1VRK A;  1NYA A;  1XFX O;  3DD4 A;  4WQ2 A;  1YUS A;  2BL0 B;  3SG7 A;  3EVR A;  4PHJ A;  2CNP A;  2MBX A;  1TCO B;  3SIB A;  1TIZ A;  4BY4 A;  2K61 A;  1W7I B;  2KBI A;  2OTG B;  3PFV A;  4MZL A;  1AHR A;  2OS8 B;  2BE4 A;  1KK7 Z;  2WCE A;  5PAL A;  4PCW A;  1REC A;  4GPL B;  2LVI A;  3GK2 A;  2BCX A;  2WC8 A;  4R1E A;  1BMO A;  3C1V A;  1C07 A;  1N2D A;  1IRJ A;  3DVE A;  1H8B A;  4MLW A;  4NDD A;  2IS9 A;  2HF5 A;  4CFQ A;  2QAC A;  1CDL A;  4NDB A;  3WNX B;  2L0P A;  5CSN A;  1DJG A;  2KNE A;  4M2P A;  1BJF A;  1CFD A;  5AFP A;  3DVK A;  3LL8 B;  1PVB A;  3CR4 X;  4NDC A;  1Y1U A;  2LCP A;  1SPY A;  1RFJ A;  2NCO A;  2GV5 A;  4IL1 A;  3EK4 A;  4USL A;  1QVI Z;  3OP0 A;  1XK4 A;  2MAZ A;  2ZN8 A;  4DRW A;  1BT6 A;  2PMY A;  3D10 A;  4MSP A;  2EC6 C;  2L98 A;  3SIA A;  2H2K A;  1F71 A;  1NCX A;  1S5G Y;  5AAN A;  1IJ5 A;  1PAL A;  3I5I C;  3TDZ A;  1BU3 A;  1UHI A;  5ER5 A;  1J7Q A;  3KF9 A;  5DKN A;  1Y1A A;  3HX4 A;  3SG4 A;  4YI9 A;  2E6W A;  1DF0 B;  3F45 A;  1K8U A;  1AJ5 A;  1BR1 B;  3BYA A;  1NUB A;  2BKH B;  1GGW A;  4ORB B;  1K93 D;  2LC5 A;  1EJ3 A;  2G2B A;  3EKJ A;  2K0J A;  2BKI B;  4N1F A;  1AVS A;  2I18 A;  2I94 A;  1DJZ A;  1BG1 A;  1B47 A;  2MRD A;  2KI6 D;  2F2O A;  2L50 A;  1B8C A;  2LP3 A;  3EVU A;  1NX2 A;  5DKQ A;  1SCM C;  2LHL A;  3K21 A;  1L7Z A;  1D1O A;  4YGA A;  1CFC A;  3E3R A;  4QJ5 B;  2KHN A;  5I2L A;  2WOS A;  1IQ3 A;  1BF5 A;  5I2O A;  1TNW A;  4P2Y B;  1S3P A;  1M63 B;  1CM1 A;  1TNX A;  4CFR A;  3VRR A;  3BQ3 A;  3JVT B;  1MUX A;  5JJG A;  1M46 A;  1CDP A;  3CTN A;  2EGD A;  1M45 A;  2LVK A;  1NWD A;  3BXK A;  4N1G A;  5TNC A;  1YX7 A;  2KYC A;  1TOP A;  2KQY A;  1NP8 A;  1V1F A;  2V53 A;  3AKA A;  3BOW A;  1ZUZ A;  1OZS A;  3RLZ A;  2K7O A;  3GK4 X;  4HRE E;  3BUN B;  4GAO A;  2LAP A;  3A8R A;  1WRL A;  2M8U A;  1MHO A;  2LNK A;  1PVA A;  3VGO A;  4AQI A;  2R2I A;  1EG4 A;  5GQQ C;  4PE1 A;  1A75 A;  3FWB A;  1S6I A;  1DT7 B;  3PAL A;  4E68 A;  2LP2 A;  1OMD A;  1YRU B;  2EHB A;  3AKB A;  1EXR A;  1R2U A;  1C7W A;  1OMR A;  4PHN A;  1KSO A;  3I5H B;  2HPS A;  2F8P A;  1RRO A;  4MBE A;  1KWO C;  1OSA A;  1EL4 A;  3PM8 A;  3OB1 B;  1K95 A;  2K2F A;  5HKY A;  1UP5 A;  2ZFD A;  4MVF A;  3I5G B;  1RJV A;  2KFG A;  1AK8 A;  2LUX A;  5HKZ A;  1XK4 C;  1ZFS A;  1G4Y R;  2LVV A;  3GK1 A;  1A29 A;  1CTR A;  3BUW B;  1FI6 A;  1M39 A;  1DGU A;  2JNX A;  3ICB A;  1B4C A;  1AJ4 A;  2PAL A;  1SY9 A;  4D1E A;  3I5F B;  1MWN A;  1PK0 D;  1CDM A;  5CSI A;  1DJH A;  1SW8 A;  1AUI B;  1SKT A;  1K9K A;  2SAS A;  4OR9 B;  1F8H A;  1CLB A;  1YUR A;  2LLT A;  1YUU A;  1YX8 A;  1SNL A;  1QAT A;  4F0Z B;  1PUL A;  1OMV A;  3CR2 A;  1YVL A;  2ZRT A;  1JF0 A;  1GGZ A;  4MZK A;  1QJT A;  1BR4 B;  3O2P A;  2I2R E;  1OZO A;  4YBH B;  4PHM A;  1ALV A;  1S1E A;  1DTL A;  3TS5 C;  2PRU A;  4JPZ B;  5CSF A;  2B1U A;  1QTX A;  2KAV A;  1KK8 C;  5F6T A;  4YGD B;  1W7J B;  1WLZ A;  1XFZ O;  1CNP A;  2LMT A;  1TRF A;  3AAK A;  1UUS A;  1L2O C;  4GUK A;  1LIN A;  1SL9 A;  1QLK A;  2GGM A;  1H4B A;  2KFH A;  3OHM B;  2K7C A;  1KCY A;  1S5G Z;  2JPT A;  3PAT A;  1DF0 A;  2LUC A;  3VRQ A;  4PE7 A;  1A03 A;  1JFJ A;  1Y1X A;  1TNP A;  1MXL C;  2JOJ A;  2LE9 B;  3IQO A;  3NSK A;  4OKH A;  2KQ6 A;  1KFU L;  2JZI A;  2MLF C;  4YGB B;  1KSM A;  1KWO B;  3CR5 X;  2H61 A;  2JTT A;  4N5X A;  1WY9 A;  3TUY C;  1EG3 A;  1LA0 A;  1BOD A;  1LXF C;  1J7R A;  1KFX L;  2GGZ A;  1MQ1 A;  1SR6 C;  2M1K B;  2JNF A;  1WLM A;  4CID A;  1FF1 A;  1J7P A;  2KOT A;  1B9A A;  4MN0 A;  1K2H A;  2LLU A;  1B7T Y;  2Y5I A;  2PSR A;  2Y1N A;  2NCP A;  1F4O A;  1YUT A;  5KSZ A;  1KQM C;  2F3Y A;  3MSE B;  3D0Y B;  4MRX A;  3NXA A;  3JTD C;  4WRI A;  2MJW B;  2L2E A;  1JWD A;  4AQJ A;  4TNC A;  1SRA A;  3BUM B;  3EK8 A;  4M2O A;  5BPJ A;  1Y6W A;  2BL0 C;  5AER A;  4I5K A;  2JT8 A;  2KGB C;  1HT9 A;  1BOC A;  3SG3 A;  1MXE A;  2AMI A;  1LKJ A;  1ZOT B;  2OTG C;  4UPG A;  2KAX A;  3BUX B;  4C0J A;  1YR5 A;  1HQV A;  4OV2 A;  4YRU A;  2JRF A;  3TS5 B;  3WXA A;  1WRZ A;  4YI8 A;  1QX5 B;  3CZT X;  3WHU B;  5HLV A;  1SL8 A;  1KK8 B;  1DGV A;  1ODB A;  4A4C A;  3O78 A;  2BCB A;  1KQV A;  3SG6 A;  1PSR A;  2D8N A;  1QV0 A;  2CBL A;  5HYD A;  1DJI A;  2P6B B;  1L2O B;  2TN4 A;  4HRG A;  4XJK B;  1E8A A;  1YRT B;  2EC6 B;  1QIV A;  2JTZ A;  3NSI A;  1QLS A;  2MA2 A;  4NQG A;  1QAS A;  5HLO A;  1IJ6 A;  5I2Q A;  1PRW A;  3DF0 B;  3I5I B;  3CWG A;  1MR8 A;  2HQ8 A;  2M9G A;  1TNQ A;  1CKK A;  1UHN A;  2KI6 C;  1M31 A;  3OX6 A;  1CFF A;  1NIW A;  2Y1M A;  1J1E A;  2LM5 A;  2MLE C;  2Q91 A;  1R6P A;  3HCM A;  1IGV A;  1G33 A;  3SG2 A;  4Q04 A;  1G8I A;  5ER4 X;  1QV1 A;  1YTZ C;  1JFK A;  1A75 B;  1SR6 B;  4YGC B;  1F54 A;  2PAS A;  3NSO A;  4C0L A;  2M1U A;  2KI4 C;  1QXP A;  4A4B A;  2JT3 A;  1RTP 1;  3RM1 A;  1S26 D;  1FPW A;  1CB1 A;  1DJW A;  1SCM B;  5KU1 A;  5J3X A;  4CLN A;  1PSB A;  2ZRS A;  1U5I B;  3DVJ A;  4DCK A;  2I7A A;  4P5O E;  1JF2 A;  3AAJ A;  2H61 C;  4ETO A;  2O60 A;  2LVJ A;  1DJY A;  3A4U B;  4BY5 A;  1UHJ A;  4M2Q A;  2M97 A;  3NSL A;  1OE9 B;  4I5L B;  2WOR A;  2HQW A;  1TTX A;  2OPO A;  3CS1 A;  4OVN F;  4PE4 A;  1S6J A;  2JUL A;  2M49 B;  5KTY A;  3VRP A;  1DJX A;  2Q4U A;  5FYX A;  1NX1 A;  5D7F A;  1JUO A;  1OQP A;  2WND A;  2KBM A;  1J7O A;  1K94 A;  1ZMZ A;  2F33 A;  4FTG A;  2LV7 A;  1KK7 Y;  4C0K A;  2E30 A;  3GOF A;  4GGF A;  5AEQ A;  1F70 A;  2CCM A;  2ISD A;  1WRK A;  1TN4 A;  4WQ3 A;  1F4Q A;  3JVT C;  3TDI A;  1XYD A;  2F3Z A;  1SMG A;  2M7N A;  1CDN A;  1DVI A;  3OB2 B;  1GJY A;  4JQ0 D;  2JT0 A;  1SCV A;  1NCZ A;  3KEV A;  3BUO B;  1GQM A;  2JXL A;  1C7V A;  1QX7 A;  1JC2 A;  2KDH A;  1QIW A;  3KPX A;  4QJ4 B;  1IG5 A;  3FIA A;  4PHK A;  5D69 A;  1CMF A;  1BLQ A;  1NX3 A;  2FOT A;  2QPT A;  1DMO A;  2L4H A;  1WDC C;  2FCE A;  1IWQ A;  1N65 A;  1QVI Y;  1SK6 D;  1TCF A;  2AUC A;  1IH0 A;  3KHE A;  4ICB A;  4I5N B;  3FS7 A;  2A4J A;  2RGI A;  2BEC A;  1XFY O;  1XFU O;  1CFP A;  3I5H C;  1SYM A;  2M3W A;  3QRX A;  1SL7 A;  1QX2 A;  4GFT A;  3EVV A;  4ZCV A;  5K89 A;  1Y0V H;  2ZN9 A;  1B7T Z;  3ZNI A;  4AOM A;  4DUQ A;  2WCB A;  4GNK B;  3PN7 C;  2FCD A;  3SG5 A;  3D0Y A;  2KI4 B;  3H4S E;  1NPQ A;  2AAO A;  2SCP A;  3I5G C;  1B8R A;  2BE6 A;  5B8I B;  1B1G A;  2NZ0 A;  2MHH A;  1KFU S;  2CT9 A;  1K96 A;  2JQ6 A;  1FBV A;  3LCP C;  3PLF B;  2LLS A;  4MZJ A;  4MRY A;  5HKW A;  1Q80 A;  2L51 A;  1A4P A;  3LK0 A;  4U8D A;  5G08 A;  2Y4Q A;  3WHT B;  1UUR A;  1FI5 A;  2BBN A;  2FJU B;  2JU0 A;  4CPV A;  2LMU A;  3O4Y A;  1SBJ A;  1J55 A;  1XFW O;  2OS8 C;  3I5F C;  1JBA A;  1KFX S;  5JOL A;  2ZKM X;  3IQQ A;  2M29 A;  4ORC B;  3TDU A;  4PDZ A;  2COL B;  3VRO A;  1IQ5 A;  1NCY A;  2K7D A;  2KAY A;  3VRN A;  1UHH A;  4XJK A;  2L5X B;  1ZAC A;  2KSP A;  1FW4 A;  1J1D A;  4PE0 A;  2DOQ A;  1XVJ A;  4DIR A;  2F2P A;  1CMG A;  1AP4 A; 
#chains in the Genus database with same CATH topology
 2CTN A;  5IBW A;  1LA3 A;  3DF0 A;  3LLE A;  3O6B A;  5DKR A;  2O5G A;  1OOF A;  1RWY A;  4XYN A;  4OCI A;  4ORA B;  4ZCU A;  1QWV A;  4L9M A;  1NX0 A;  3OBV A;  2K2A A;  3KO0 A;  1JSA A;  1CM4 A;  5I8N A;  1NSH A;  4PAL A;  2GTE A;  2VRG A;  1S6C A;  2L4I A;  1UHK A;  4HSZ A;  3PSR A;  2HET A;  2G9B A;  3PJI A;  3OX5 A;  1RK9 A;  1XFV O;  2CXJ A;  3IVT A;  2KYF A;  4GGF C;  3BOW B;  1MF8 B;  1WDC B;  5CSJ A;  1F55 A;  3IF7 A;  2JXC A;  2K7B A;  3FWC A;  4GGN A;  2M7L A;  1XO5 A;  2WC5 A;  3EKH A;  3LK1 A;  4DS7 A;  1OOJ A;  3TZ1 A;  2WCF A;  2LAN A;  1A2X A;  1K90 D;  4JWQ A;  4I5J A;  5AXI A;  3DVM A;  3TUY B;  1XA5 A;  2NXQ A;  1ALW A;  3CLN A;  1LVC D;  1QS7 A;  4F7F A;  1B8L A;  1UWO A;  1CLM A;  2JWW A;  4FQO A;  2LHI A;  4GBA A;  3R1P A;  3CGA A;  4MEW A;  2KFF A;  2PVB A;  1S36 A;  1U5I A;  1T14 A;  2M0R A;  4YGE B;  3SJS A;  3SS5 A;  2ZNE A;  2BCA A;  3RZS A;  1IKU A;  1DQE A;  1EH2 A;  2JC2 A;  3PN7 B;  3M0W A;  2NLN A;  3ZWH A;  3SS3 A;  3QME A;  1V1G A;  1X02 A;  1W9Z A;  2LMV A;  1C3Y A;  5CPV A;  2K8M B;  1KQM B;  2KGR A;  3BFB A;  1YVH A;  2BBM A;  1CLL A;  2ZND A;  1N0Y A;  3EK7 A;  4HRH A;  1K9P A;  3JTD B;  4QJ3 B;  1K9U A;  3OGN A;  4JD9 A;  5D3O A;  1VRK A;  1NYA A;  1XFX O;  3DD4 A;  4WQ2 A;  1YUS A;  2BL0 B;  3SG7 A;  3EVR A;  4PHJ A;  2CNP A;  2MBX A;  1TCO B;  3SIB A;  1TIZ A;  4BY4 A;  2K61 A;  1W7I B;  2KBI A;  4IJ7 A;  2OTG B;  3PFV A;  4MZL A;  1AHR A;  2OS8 B;  2BE4 A;  1KK7 Z;  2WCE A;  5PAL A;  4PCW A;  3UNW A;  1REC A;  4OZD A;  4GPL B;  2LVI A;  3GK2 A;  2BCX A;  2WCL A;  2WC8 A;  1IIO A;  4R1E A;  5DIC A;  1BMO A;  3C1V A;  1C07 A;  1N2D A;  1IRJ A;  2WC6 A;  3DVE A;  1H8B A;  4MLW A;  4NDD A;  2IS9 A;  2HF5 A;  4CFQ A;  2QAC A;  1CDL A;  4NDB A;  3WNX B;  1LS8 A;  2L0P A;  5CSN A;  1DJG A;  2KNE A;  4M2P A;  3FE8 A;  1BJF A;  1CFD A;  5AFP A;  3PM2 A;  3DVK A;  3D74 A;  3LL8 B;  1PVB A;  3CR4 X;  4NDC A;  1Y1U A;  2LCP A;  1SPY A;  1RFJ A;  2NCO A;  2GV5 A;  4IL1 A;  3S0A A;  3EK4 A;  4USL A;  1QVI Z;  3OP0 A;  3BFH A;  1XK4 A;  2MAZ A;  2ZN8 A;  4DRW A;  1BT6 A;  2PMY A;  3D10 A;  4MSP A;  2EC6 C;  2BNX A;  2L98 A;  3SIA A;  2YGU A;  2H2K A;  1F71 A;  1NCX A;  4PT1 A;  1S5G Y;  5AAN A;  1IJ5 A;  1PAL A;  3I5I C;  3TDZ A;  1BU3 A;  1UHI A;  5ER5 A;  1J7Q A;  3KF9 A;  5I94 A;  5DKN A;  1OOH A;  1Y1A A;  3HX4 A;  3SG4 A;  4YI9 A;  2E6W A;  1DF0 B;  3F45 A;  2ERB A;  1K8U A;  1AJ5 A;  1BR1 B;  2BAP A;  2QEV A;  3BYA A;  1NUB A;  2BKH B;  1GGW A;  4ORB B;  3DY9 A;  1K93 D;  1OW4 A;  3B86 A;  2LC5 A;  3NHT A;  1EJ3 A;  2G2B A;  3EKJ A;  2KLD A;  2K0J A;  2BKI B;  4N1F A;  1AVS A;  2I18 A;  2I94 A;  1DJZ A;  1XFR A;  1BG1 A;  1B47 A;  2MRD A;  2KI6 D;  2F2O A;  2L50 A;  1B8C A;  2LP3 A;  3D75 A;  3EVU A;  1NX2 A;  5DKQ A;  1SCM C;  3R1V A;  2PYQ A;  2LHL A;  3K21 A;  1L7Z A;  1D1O A;  4YGA A;  1CFC A;  3E3R A;  4QJ5 B;  2KHN A;  3V2L A;  5I2L A;  2WOS A;  1IQ3 A;  1BF5 A;  5I2O A;  3CZ2 A;  1TNW A;  4P2Y B;  1S3P A;  1M63 B;  1CM1 A;  1TNX A;  5FI6 A;  3VRR A;  4CFR A;  4JKT A;  3BQ3 A;  3JVT B;  1MUX A;  5JJG A;  1M46 A;  1CDP A;  3CTN A;  2EGD A;  1M45 A;  2LVK A;  1NWD A;  3BXK A;  3CZ0 A;  4N1G A;  1YX7 A;  2KYC A;  5TNC A;  2L5Y A;  1TOP A;  2KQY A;  3B6X A;  1NP8 A;  1V1F A;  2V53 A;  3AKA A;  3BOW A;  1ZUZ A;  1AP4 A;  1OZS A;  3RLZ A;  2K7O A;  3GK4 X;  4HRE E;  4INX A;  3BUN B;  4GAO A;  2LAP A;  3A8R A;  1WRL A;  2M8U A;  1MHO A;  2LNK A;  1PVA A;  3VGO A;  4AQI A;  2R2I A;  1EG4 A;  3BFA A;  5GQQ C;  4PE1 A;  1A75 A;  3FWB A;  1S6I A;  1DT7 B;  1OOI X;  3PAL A;  4E68 A;  2LP2 A;  1OMD A;  1YRU B;  2EHB A;  3AKB A;  1EXR A;  1R2U A;  1C7W A;  1OMR A;  4PHN A;  2QEH A;  1KSO A;  3I5H B;  2HPS A;  3VB1 A;  2F8P A;  3L4L A;  1RRO A;  4MBE A;  1KWO C;  1OSA A;  1EL4 A;  3PM8 A;  3OB1 B;  1K95 A;  2K2F A;  5HKY A;  1UP5 A;  2ZFD A;  4INW A;  4MVF A;  3I5G B;  1RJV A;  3CAB A;  2KFG A;  1DEK A;  1AK8 A;  2LUX A;  5HKZ A;  1XK4 C;  1ZFS A;  2P70 A;  1G4Y R;  2LVV A;  3GK1 A;  1A29 A;  1CTR A;  3BUW B;  1FI6 A;  1M39 A;  1DGU A;  2PQL A;  3DYE A;  2JNX A;  5FI7 A;  2WCM A;  3ICB A;  3S0G A;  1B4C A;  1AJ4 A;  2PAL A;  1SY9 A;  4D1E A;  3I5F B;  1MWN A;  1PK0 D;  3O4X A;  1CDM A;  5CSI A;  1DJH A;  1SW8 A;  1Z2C B;  1AUI B;  1SKT A;  1K9K A;  2SAS A;  4OR9 B;  1F8H A;  1CLB A;  1YUR A;  2LLT A;  1YUU A;  1YX8 A;  1SNL A;  3B7A A;  1QAT A;  3R72 A;  4F0Z B;  1PUL A;  1OMV A;  3CR2 A;  1YVL A;  2ZRT A;  1JF0 A;  1GGZ A;  4MZK A;  3B87 A;  1QJT A;  1BR4 B;  3O2P A;  2I2R E;  1OZO A;  4YBH B;  4PHM A;  1ALV A;  1S1E A;  1DTL A;  3TS5 C;  2WCJ A;  2PRU A;  4JPZ B;  5CSF A;  2B1U A;  1QTX A;  2KAV A;  1KK8 C;  5F6T A;  4YGD B;  1W7J B;  1WLZ A;  1XFZ O;  1CNP A;  2LMT A;  1TRF A;  3AAK A;  1UUS A;  1L2O C;  4GUK A;  1LIN A;  1SL9 A;  1QLK A;  2GGM A;  1H4B A;  2KFH A;  3OHM B;  2K7C A;  1KCY A;  1S5G Z;  2JPT A;  3PAT A;  1DF0 A;  2LUC A;  3VRQ A;  2QDI A;  4PE7 A;  1A03 A;  1JFJ A;  1Y1X A;  1TNP A;  3N7H A;  1MXL C;  2JOJ A;  2LE9 B;  3IQO A;  3NSK A;  4OKH A;  2KQ6 A;  1KFU L;  2JZI A;  3D78 A;  3FE9 A;  2MLF C;  4YGB B;  1KSM A;  1KWO B;  1SSE B;  3CR5 X;  2H61 A;  2JTT A;  3D77 A;  4N5X A;  1WY9 A;  3TUY C;  1EG3 A;  1LA0 A;  1BOD A;  1LXF C;  1J7R A;  1KFX L;  2GGZ A;  1MQ1 A;  1SR6 C;  2KLE A;  2M1K B;  3L4A A;  2JNF A;  1WLM A;  4CID A;  1FF1 A;  1J7P A;  1ORG A;  2KOT A;  1B9A A;  4MN0 A;  1K2H A;  2LLU A;  1B7T Y;  2Y5I A;  2PSR A;  2Y1N A;  2L2C A;  2NCP A;  1F4O A;  1YUT A;  5KSZ A;  1KQM C;  2F3Y A;  3MSE B;  3D0Y B;  4MRX A;  3NXA A;  3JTD C;  3CYZ A;  4WRI A;  3S0B A;  2MJW B;  2L2E A;  1JWD A;  4AQJ A;  4TNC A;  1SRA A;  1Z4H A;  3BUM B;  3EK8 A;  4M2O A;  5BPJ A;  1Y6W A;  2BL0 C;  5AER A;  1DC1 A;  4I5K A;  2JT8 A;  2KGB C;  1HT9 A;  3K1E A;  1BOC A;  3SG3 A;  1MXE A;  2AMI A;  1LKJ A;  1ZOT B;  2KPH A;  2OTG C;  4UPG A;  2KAX A;  3BUX B;  4C0J A;  1YR5 A;  1HQV A;  4OV2 A;  4YRU A;  2JRF A;  3TS5 B;  3WXA A;  1WRZ A;  3R1O A;  4YI8 A;  1QX5 B;  3CZT X;  3WHU B;  5HLV A;  1SL8 A;  1KK8 B;  3B88 A;  1DGV A;  4FQT A;  1ODB A;  4A4C A;  3O78 A;  2BCB A;  1KQV A;  3SG6 A;  1PSR A;  2D8N A;  1QV0 A;  2CBL A;  5HYD A;  1DJI A;  2P6B B;  1L2O B;  2TN4 A;  3NHI A;  4HRG A;  1E8A A;  1YRT B;  2EC6 B;  4XJK B;  3DZT A;  1QIV A;  2JTZ A;  3NSI A;  1QLS A;  2MA2 A;  4NQG A;  1QAS A;  5HLO A;  1IJ6 A;  5I2Q A;  1PRW A;  3DF0 B;  3I5I B;  3CWG A;  1MR8 A;  2HQ8 A;  2M9G A;  1TNQ A;  1CKK A;  1UHN A;  2JPO A;  2KI6 C;  1TUZ A;  1M31 A;  3OX6 A;  1CFF A;  1NIW A;  2Y1M A;  1J1E A;  2LM5 A;  2MLE C;  2Q91 A;  1R6P A;  3HCM A;  1IGV A;  1G33 A;  3SG2 A;  4Q04 A;  1G8I A;  4KYN A;  5ER4 X;  1QV1 A;  1YTZ C;  3NGV A;  1JFK A;  1A75 B;  1SR6 B;  4YGC B;  1F54 A;  2PAS A;  3NSO A;  4C0L A;  2M1U A;  2KI4 C;  1QXP A;  3D76 A;  2JT3 A;  4A4B A;  1RTP 1;  2H8V A;  3RM1 A;  1S26 D;  1FPW A;  3EG5 B;  1CB1 A;  1DJW A;  1TWO A;  1SCM B;  5KU1 A;  5J3X A;  4CLN A;  1PSB A;  2ZRS A;  1U5I B;  3DVJ A;  4DCK A;  1C3Z A;  2I7A A;  4P5O E;  3S0D A;  1JF2 A;  3AAJ A;  2H61 C;  3FE6 A;  4ETO A;  3S0F A;  2O60 A;  3CDN A;  2LVJ A;  1DJY A;  3A4U B;  4BY5 A;  1UHJ A;  4M2Q A;  2M97 A;  2QEB A;  3NSL A;  1OE9 B;  4I5L B;  2WOR A;  2HQW A;  1TTX A;  2OPO A;  3CS1 A;  3Q8I A;  4OVN F;  1S6J A;  2JUL A;  2M49 B;  4PE4 A;  5KTY A;  3VRP A;  1DJX A;  2Q4U A;  5FYX A;  1NX1 A;  5D7F A;  1JUO A;  1OQP A;  2WND A;  2KBM A;  1J7O A;  1K94 A;  1ZMZ A;  2F33 A;  4FTG A;  2LV7 A;  1KK7 Y;  4C0K A;  2E30 A;  3GOF A;  4GGF A;  5AEQ A;  1F70 A;  2CCM A;  2ISD A;  1WRK A;  1TUJ A;  1TN4 A;  4WQ3 A;  2WCH A;  1F4Q A;  3JVT C;  3TDI A;  2QEO A;  1XYD A;  2F3Z A;  5EL2 A;  1SMG A;  2M7N A;  1CDN A;  1DVI A;  3OB2 B;  1GJY A;  4JQ0 D;  3UO9 A;  2JT0 A;  1SCV A;  1NCZ A;  3KEV A;  3BUO B;  1GQM A;  2JXL A;  1C7V A;  1QX7 A;  1JC2 A;  2KDH A;  3BJH A;  1QIW A;  3KPX A;  4QJ4 B;  1IG5 A;  3FIA A;  4PHK A;  5D69 A;  1CMF A;  1BLQ A;  1P28 A;  1NX3 A;  2FOT A;  2QPT A;  3SS4 A;  1DMO A;  2L4H A;  1WDC C;  2FCE A;  2K60 A;  1IWQ A;  1N65 A;  1QVI Y;  1SK6 D;  1TCF A;  2AUC A;  1IH0 A;  3KHE A;  4ICB A;  4I5N B;  3FS7 A;  2A4J A;  2RGI A;  2BEC A;  1XFY O;  1XFU O;  2P71 A;  1CFP A;  3I5H C;  1SYM A;  2M3W A;  3QRX A;  1SL7 A;  1QX2 A;  4GFT A;  3EVV A;  4ZCV A;  5K89 A;  1Y0V H;  2ZN9 A;  1B7T Z;  3ZNI A;  4AOM A;  4DUQ A;  2WCB A;  2WCK A;  3PN7 C;  2FCD A;  4GNK B;  3SG5 A;  3DXL A;  2FJY A;  3D0Y A;  2KI4 B;  3H4S E;  1NPQ A;  2AAO A;  2SCP A;  3I5G C;  1B8R A;  2BE6 A;  1GM0 A;  5FI2 A;  5B8I B;  1B1G A;  2NZ0 A;  2MHH A;  1KFU S;  2CT9 A;  1K96 A;  2JQ6 A;  1FBV A;  3LCP C;  3PLF B;  2LLS A;  4MZJ A;  4MRY A;  5HKW A;  1Q80 A;  1DEL A;  2L51 A;  1A4P A;  3CZ1 A;  3LK0 A;  4U8D A;  5G08 A;  2Y4Q A;  3WHT B;  1UUR A;  1FI5 A;  2BBN A;  2FJU B;  2JU0 A;  4CPV A;  2LMU A;  3O4Y A;  1SBJ A;  1J55 A;  1XFW O;  2OS8 C;  3I5F C;  1JBA A;  1KFX S;  5JOL A;  2ZKM X;  3IQQ A;  2M29 A;  3D73 A;  4ORC B;  5HL1 A;  3TDU A;  4PDZ A;  2COL B;  3VRO A;  1IQ5 A;  1NCY A;  1OOG A;  2K7D A;  2KAY A;  3VRN A;  1UHH A;  3S0E A;  4XJK A;  2L5X B;  1ZAC A;  2KSP A;  1FW4 A;  1J1D A;  4PE0 A;  2DOQ A;  1XVJ A;  4DIR A;  2F2P A;  1CMG A;  3L47 A; 
#chains in the Genus database with same CATH homology
 2CTN A;  5IBW A;  1LA3 A;  3DF0 A;  3LLE A;  3O6B A;  5DKR A;  2O5G A;  1RWY A;  4XYN A;  4OCI A;  4ORA B;  4ZCU A;  4L9M A;  1NX0 A;  2K2A A;  3KO0 A;  1JSA A;  1CM4 A;  5I8N A;  1NSH A;  4PAL A;  2VRG A;  1S6C A;  2L4I A;  1UHK A;  4HSZ A;  3PSR A;  2HET A;  2G9B A;  3OX5 A;  1RK9 A;  1XFV O;  2CXJ A;  4GGF C;  2KYF A;  3BOW B;  1MF8 B;  1WDC B;  5CSJ A;  1F55 A;  3IF7 A;  2JXC A;  2K7B A;  3FWC A;  4GGN A;  2M7L A;  1XO5 A;  3EKH A;  3LK1 A;  4DS7 A;  1OOJ A;  3TZ1 A;  2WCF A;  2LAN A;  1A2X A;  1K90 D;  4JWQ A;  4I5J A;  5AXI A;  3DVM A;  3TUY B;  1XA5 A;  2NXQ A;  1ALW A;  3CLN A;  1LVC D;  1QS7 A;  1B8L A;  1UWO A;  1CLM A;  2JWW A;  4FQO A;  2LHI A;  4GBA A;  3CGA A;  4MEW A;  2KFF A;  2PVB A;  1S36 A;  1U5I A;  2M0R A;  4YGE B;  3SJS A;  2ZNE A;  2BCA A;  1IKU A;  1EH2 A;  2JC2 A;  3PN7 B;  3M0W A;  2NLN A;  3ZWH A;  1V1G A;  1X02 A;  2LMV A;  5CPV A;  2K8M B;  1KQM B;  2KGR A;  1YVH A;  2BBM A;  1CLL A;  2ZND A;  1N0Y A;  3EK7 A;  4HRH A;  1K9P A;  3JTD B;  4QJ3 B;  1K9U A;  1VRK A;  1NYA A;  1XFX O;  3DD4 A;  4WQ2 A;  1YUS A;  2BL0 B;  3SG7 A;  3EVR A;  4PHJ A;  2CNP A;  2MBX A;  1TCO B;  3SIB A;  1TIZ A;  4BY4 A;  2K61 A;  1W7I B;  2KBI A;  2OTG B;  3PFV A;  4MZL A;  1AHR A;  2OS8 B;  2BE4 A;  1KK7 Z;  2WCE A;  5PAL A;  4PCW A;  1REC A;  4GPL B;  2LVI A;  3GK2 A;  2BCX A;  2WC8 A;  4R1E A;  1BMO A;  3C1V A;  1C07 A;  1N2D A;  1IRJ A;  3DVE A;  1H8B A;  4MLW A;  4NDD A;  2IS9 A;  2HF5 A;  4CFQ A;  2QAC A;  1CDL A;  4NDB A;  3WNX B;  2L0P A;  5CSN A;  1DJG A;  2KNE A;  4M2P A;  1BJF A;  1CFD A;  5AFP A;  3DVK A;  3LL8 B;  1PVB A;  3CR4 X;  4NDC A;  1Y1U A;  2LCP A;  1SPY A;  1RFJ A;  2NCO A;  2GV5 A;  4IL1 A;  3EK4 A;  4USL A;  1QVI Z;  3OP0 A;  1XK4 A;  2MAZ A;  2ZN8 A;  4DRW A;  1BT6 A;  2PMY A;  3D10 A;  4MSP A;  2EC6 C;  2L98 A;  3SIA A;  2H2K A;  1F71 A;  1NCX A;  1S5G Y;  5AAN A;  1IJ5 A;  1PAL A;  3I5I C;  3TDZ A;  1BU3 A;  1UHI A;  5ER5 A;  1J7Q A;  3KF9 A;  5DKN A;  1Y1A A;  3HX4 A;  3SG4 A;  4YI9 A;  2E6W A;  1DF0 B;  3F45 A;  1K8U A;  1AJ5 A;  1BR1 B;  3BYA A;  1NUB A;  2BKH B;  1GGW A;  4ORB B;  1K93 D;  2LC5 A;  1EJ3 A;  2G2B A;  3EKJ A;  2K0J A;  2BKI B;  4N1F A;  1AVS A;  2I18 A;  2I94 A;  1DJZ A;  1BG1 A;  1B47 A;  2MRD A;  2KI6 D;  2F2O A;  2L50 A;  1B8C A;  2LP3 A;  3EVU A;  1NX2 A;  5DKQ A;  1SCM C;  2LHL A;  3K21 A;  1L7Z A;  1D1O A;  4YGA A;  1CFC A;  3E3R A;  4QJ5 B;  2KHN A;  5I2L A;  2WOS A;  1IQ3 A;  1BF5 A;  5I2O A;  1TNW A;  4P2Y B;  1S3P A;  1M63 B;  1CM1 A;  1TNX A;  4CFR A;  3VRR A;  3BQ3 A;  3JVT B;  1MUX A;  5JJG A;  1M46 A;  1CDP A;  3CTN A;  2EGD A;  1M45 A;  2LVK A;  1NWD A;  3BXK A;  4N1G A;  5TNC A;  1YX7 A;  2KYC A;  1TOP A;  2KQY A;  1NP8 A;  1V1F A;  2V53 A;  3AKA A;  3BOW A;  1ZUZ A;  1OZS A;  3RLZ A;  2K7O A;  3GK4 X;  4HRE E;  3BUN B;  4GAO A;  2LAP A;  3A8R A;  1WRL A;  2M8U A;  1MHO A;  2LNK A;  1PVA A;  3VGO A;  4AQI A;  2R2I A;  1EG4 A;  5GQQ C;  4PE1 A;  1A75 A;  3FWB A;  1S6I A;  1DT7 B;  3PAL A;  4E68 A;  2LP2 A;  1OMD A;  1YRU B;  2EHB A;  3AKB A;  1EXR A;  1R2U A;  1C7W A;  1OMR A;  4PHN A;  1KSO A;  3I5H B;  2HPS A;  2F8P A;  1RRO A;  4MBE A;  1KWO C;  1OSA A;  1EL4 A;  3PM8 A;  3OB1 B;  1K95 A;  2K2F A;  5HKY A;  1UP5 A;  2ZFD A;  4MVF A;  3I5G B;  1RJV A;  2KFG A;  1AK8 A;  2LUX A;  5HKZ A;  1XK4 C;  1ZFS A;  1G4Y R;  2LVV A;  3GK1 A;  1A29 A;  1CTR A;  3BUW B;  1FI6 A;  1M39 A;  1DGU A;  2JNX A;  3ICB A;  1B4C A;  1AJ4 A;  2PAL A;  1SY9 A;  4D1E A;  3I5F B;  1MWN A;  1PK0 D;  1CDM A;  5CSI A;  1DJH A;  1SW8 A;  1AUI B;  1SKT A;  1K9K A;  2SAS A;  4OR9 B;  1F8H A;  1CLB A;  1YUR A;  2LLT A;  1YUU A;  1YX8 A;  1SNL A;  1QAT A;  4F0Z B;  1PUL A;  1OMV A;  3CR2 A;  1YVL A;  2ZRT A;  1JF0 A;  1GGZ A;  4MZK A;  1QJT A;  1BR4 B;  3O2P A;  2I2R E;  1OZO A;  4YBH B;  4PHM A;  1ALV A;  1S1E A;  1DTL A;  3TS5 C;  2PRU A;  4JPZ B;  5CSF A;  2B1U A;  1QTX A;  2KAV A;  1KK8 C;  5F6T A;  4YGD B;  1W7J B;  1WLZ A;  1XFZ O;  1CNP A;  2LMT A;  1TRF A;  3AAK A;  1UUS A;  1L2O C;  4GUK A;  1LIN A;  1SL9 A;  1QLK A;  2GGM A;  1H4B A;  2KFH A;  3OHM B;  2K7C A;  1KCY A;  1S5G Z;  2JPT A;  3PAT A;  1DF0 A;  2LUC A;  3VRQ A;  4PE7 A;  1A03 A;  1JFJ A;  1Y1X A;  1TNP A;  1MXL C;  2JOJ A;  2LE9 B;  3IQO A;  3NSK A;  4OKH A;  2KQ6 A;  1KFU L;  2JZI A;  2MLF C;  4YGB B;  1KSM A;  1KWO B;  3CR5 X;  2H61 A;  2JTT A;  4N5X A;  1WY9 A;  3TUY C;  1EG3 A;  1LA0 A;  1BOD A;  1LXF C;  1J7R A;  1KFX L;  2GGZ A;  1MQ1 A;  1SR6 C;  2M1K B;  2JNF A;  1WLM A;  4CID A;  1FF1 A;  1J7P A;  2KOT A;  1B9A A;  4MN0 A;  1K2H A;  2LLU A;  1B7T Y;  2Y5I A;  2PSR A;  2Y1N A;  2NCP A;  1F4O A;  1YUT A;  5KSZ A;  1KQM C;  2F3Y A;  3MSE B;  3D0Y B;  4MRX A;  3NXA A;  3JTD C;  4WRI A;  2MJW B;  2L2E A;  1JWD A;  4AQJ A;  4TNC A;  1SRA A;  3BUM B;  3EK8 A;  4M2O A;  5BPJ A;  1Y6W A;  2BL0 C;  5AER A;  4I5K A;  2JT8 A;  2KGB C;  1HT9 A;  1BOC A;  3SG3 A;  1MXE A;  2AMI A;  1LKJ A;  1ZOT B;  2OTG C;  4UPG A;  2KAX A;  3BUX B;  4C0J A;  1YR5 A;  1HQV A;  4OV2 A;  4YRU A;  2JRF A;  3TS5 B;  3WXA A;  1WRZ A;  4YI8 A;  1QX5 B;  3CZT X;  3WHU B;  5HLV A;  1SL8 A;  1KK8 B;  1DGV A;  1ODB A;  4A4C A;  3O78 A;  2BCB A;  1KQV A;  3SG6 A;  1PSR A;  2D8N A;  1QV0 A;  2CBL A;  5HYD A;  1DJI A;  2P6B B;  1L2O B;  2TN4 A;  4HRG A;  4XJK B;  1E8A A;  1YRT B;  2EC6 B;  1QIV A;  2JTZ A;  3NSI A;  1QLS A;  2MA2 A;  4NQG A;  1QAS A;  5HLO A;  1IJ6 A;  5I2Q A;  1PRW A;  3DF0 B;  3I5I B;  3CWG A;  1MR8 A;  2HQ8 A;  2M9G A;  1TNQ A;  1CKK A;  1UHN A;  2KI6 C;  1M31 A;  3OX6 A;  1CFF A;  1NIW A;  2Y1M A;  1J1E A;  2LM5 A;  2MLE C;  2Q91 A;  1R6P A;  3HCM A;  1IGV A;  1G33 A;  3SG2 A;  4Q04 A;  1G8I A;  5ER4 X;  1QV1 A;  1YTZ C;  1JFK A;  1A75 B;  1SR6 B;  4YGC B;  1F54 A;  2PAS A;  3NSO A;  4C0L A;  2M1U A;  2KI4 C;  1QXP A;  4A4B A;  2JT3 A;  1RTP 1;  3RM1 A;  1S26 D;  1FPW A;  1CB1 A;  1DJW A;  1SCM B;  5KU1 A;  5J3X A;  4CLN A;  1PSB A;  2ZRS A;  1U5I B;  3DVJ A;  4DCK A;  2I7A A;  4P5O E;  1JF2 A;  3AAJ A;  2H61 C;  4ETO A;  2O60 A;  2LVJ A;  1DJY A;  3A4U B;  4BY5 A;  1UHJ A;  4M2Q A;  2M97 A;  3NSL A;  1OE9 B;  4I5L B;  2WOR A;  2HQW A;  1TTX A;  2OPO A;  3CS1 A;  4OVN F;  4PE4 A;  1S6J A;  2JUL A;  2M49 B;  5KTY A;  3VRP A;  1DJX A;  2Q4U A;  5FYX A;  1NX1 A;  5D7F A;  1JUO A;  1OQP A;  2WND A;  2KBM A;  1J7O A;  1K94 A;  1ZMZ A;  2F33 A;  4FTG A;  2LV7 A;  1KK7 Y;  4C0K A;  2E30 A;  3GOF A;  4GGF A;  5AEQ A;  1F70 A;  2CCM A;  2ISD A;  1WRK A;  1TN4 A;  4WQ3 A;  1F4Q A;  3JVT C;  3TDI A;  1XYD A;  2F3Z A;  1SMG A;  2M7N A;  1CDN A;  1DVI A;  3OB2 B;  1GJY A;  4JQ0 D;  2JT0 A;  1SCV A;  1NCZ A;  3KEV A;  3BUO B;  1GQM A;  2JXL A;  1C7V A;  1QX7 A;  1JC2 A;  2KDH A;  1QIW A;  3KPX A;  4QJ4 B;  1IG5 A;  3FIA A;  4PHK A;  5D69 A;  1CMF A;  1BLQ A;  1NX3 A;  2FOT A;  2QPT A;  1DMO A;  2L4H A;  1WDC C;  2FCE A;  1IWQ A;  1N65 A;  1QVI Y;  1SK6 D;  1TCF A;  2AUC A;  1IH0 A;  3KHE A;  4ICB A;  4I5N B;  3FS7 A;  2A4J A;  2RGI A;  2BEC A;  1XFY O;  1XFU O;  1CFP A;  3I5H C;  1SYM A;  2M3W A;  3QRX A;  1SL7 A;  1QX2 A;  4GFT A;  3EVV A;  4ZCV A;  5K89 A;  1Y0V H;  2ZN9 A;  1B7T Z;  3ZNI A;  4AOM A;  4DUQ A;  2WCB A;  4GNK B;  3PN7 C;  2FCD A;  3SG5 A;  3D0Y A;  2KI4 B;  3H4S E;  1NPQ A;  2AAO A;  2SCP A;  3I5G C;  1B8R A;  2BE6 A;  5B8I B;  1B1G A;  2NZ0 A;  2MHH A;  1KFU S;  2CT9 A;  1K96 A;  2JQ6 A;  1FBV A;  3LCP C;  3PLF B;  2LLS A;  4MZJ A;  4MRY A;  5HKW A;  1Q80 A;  2L51 A;  1A4P A;  3LK0 A;  4U8D A;  5G08 A;  2Y4Q A;  3WHT B;  1UUR A;  1FI5 A;  2BBN A;  2FJU B;  2JU0 A;  4CPV A;  2LMU A;  3O4Y A;  1SBJ A;  1J55 A;  1XFW O;  2OS8 C;  3I5F C;  1JBA A;  1KFX S;  5JOL A;  2ZKM X;  3IQQ A;  2M29 A;  4ORC B;  3TDU A;  4PDZ A;  2COL B;  3VRO A;  1IQ5 A;  1NCY A;  2K7D A;  2KAY A;  3VRN A;  1UHH A;  4XJK A;  2L5X B;  1ZAC A;  2KSP A;  1FW4 A;  1J1D A;  4PE0 A;  2DOQ A;  1XVJ A;  4DIR A;  2F2P A;  1CMG A;  1AP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...