3DVEA

Crystal structure of ca2+/cam-cav2.2 iq domain complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dveA00
3D0YB 4UPGA 2L50A 1AK8A 1B8CA 1M45A 2ZKMX 4HREE 1B7TY 2ZNEA 2A4JA 5ER4X 1DJIA 1F54A 1AHRA 1A4PA 1TTXA 1WRZA 4N1FA 1NCZA 2LP2A 3EVUA 2LE9B 2LANA 1NYAA 1RECA 4DS7A 2CTNA 1MXLC 1H4BA 1JFKA 5D7FA 1DTLA 5K89A 1OMRA 1KK8C 1GJYA 1JWDA 4OKHA 2LLUA 2AAOA 4JWQA 1KK8B 1KK7Y 1XO5A 2G2BA 4PHNA 1TCFA 2JPTA 2L4HA 2AUCA 2BKHB 2KNEA 2M1KB 4IL1A 1C7WA 1QXPA 3BUNB 3LK0A 3TZ1A 3D0YA 3K21A 1QS7A 2DOQA 2GGMA 2QACA 3GK2A 5HYDA 1SR6C 3OP0A 3OHMB 3SJSA 1F70A 2MLFC 5KTYA 1MF8B 1PSRA 4Q04A 4CFRA 4XJKB 1SR6B 1DJYA 5HKWA 4DIRA 2VRGA 2D8NA 4MLWA 4MSPA 3GK4X 1QIVA 1NX3A 5I2OA 1YR5A 1LKJA 3EKHA 1RTP1 2EHBA 4DUQA 3DF0A 4MEWA 4NDDA 4QJ5B 2O5GA 1FBVA 1DF0A 1XFWO 3FIAA 2OTGC 4NDCA 3O6BA 1SW8A 5CSIA 2KI6D 4AQIA 2OTGB 4HRGA 2RGIA 2JNXA 4FTGA 2M9GA 1CM1A 2JU0A 2WCEA 3C1VA 2WCFA 5HLVA 3DVJA 1UHJA 1H8BA 1UURA 1K93D 2JZIA 4MRXA 5TNCA 1ALWA 4XJKA 1PVBA 1LA0A 1ZACA 1LXFC 3LLEA 1YRUB 4MRYA 4DRWA 3DVKA 1NX1A 2KGRA 1PALA 1B1GA 3GK1A 2PSRA 2MHHA 2LUXA 4CIDA 1S6JA 1ODBA 1JC2A 1WLZA 2JXLA 3EVVA 4C0LA 1XFXO 3OX6A 1CNPA 1FPWA 3AAKA 1BOCA 2LLSA 4YRUA 1GGWA 2I2RE 4F0ZB 4MZLA 2KSPA 2KBMA 2KDHA 1KFXL 1WRLA 3ICBA 1NCYA 1AUIB 1JFJA 2GV5A 4PALA 2BECA 2LM5A 3AAJA 1DJWA 1IWQA 1LINA 3HX4A 2F3YA 4GBAA 5DKQA 1TCOB 4PHMA 1CDPA 1BU3A 4ZCUA 1PK0D 1YTZC 1X02A 2LAPA 1XFZO 1QX7A 2Y1MA 3LL8B 2BBMA 4AQJA 1U5IB 1IKUA 2KGBC 4WQ2A 1KWOB 1F71A 1ZUZA 2LNKA 3DD4A 1J7QA 1KFUS 3AKAA 4XYNA 3PATA 1QJTA 1S3PA 1J1EA 1AVSA 1TNXA 3OX5A 1XFVO 2B1UA 3O2PA 4MZJA 2AMIA 4YI9A 3QRXA 5HLOA 5AFPA 1YX8A 1BG1A 4D1EA 1NSHA 1IJ5A 3SIAA 1J7PA 4GPLB 1YX7A 2LUCA 4QJ3B 1K8UA 1J7OA 2M49B 4ORCB 1PVAA 2LLTA 2H61C 2KYCA 2ZRTA 3BQ3A 1M63B 2KAYA 3VRNA 2LMVA 2ISDA 2FJUB 1IRJA 3BXKA 2Q4UA 1TNWA 1EL4A 3VRPA 2M7NA 1XFUO 1F8HA 1W7JB 1N65A 4GAOA 4BY5A 1R6PA 2GGZA 1QIWA 3KHEA 4MZKA 2MBXA 1PULA 2LC5A 1YUSA 3WHUB 1C07A 2M1UA 1QX5B 3CR5X 1A2XA 1M46A 5CSJA 2NZ0A 1KQVA 1SK6D 1GGZA 1QVIZ 3OB2B 1K9UA 2FCDA 5CPVA 1MQ1A 1HQVA 1KSMA 1QATA 2HQ8A 2JNFA 4A4BA 1Y1AA 2G9BA 2KI4C 3SG4A 5AANA 1WDCC 1E8AA 1LA3A 2KI4B 2H61A 1WDCB 4FQOA 1FI5A 1XK4C 1D1OA 2BE6A 1CDMA 1CDLA 1A29A 1TNQA 4PE7A 4U8DA 4DCKA 3KO0A 1K9PA 1MR8A 2JXCA 2HETA 1YUTA 1J7RA 4PCWA 1B7TZ 1DMOA 3EK7A 1NX2A 4YGAA 4HSZA 2JC2A 3VROA 4YGDB 1NCXA 3CZTX 2KFFA 4ZCVA 1MUXA 5I2LA 1SL9A 1BODA 5BPJA 2HF5A 4A4CA 3H4SE 4ORBB 5DKNA 3SIBA 4PHKA 3IQOA 3RM1A 1DJZA 4GNKB 2KQYA 3EKJA 5IBWA 1DGVA 3JVTC 1CLLA 1CMGA 5FYXA 2TN4A 1TOPA 2KOTA 1L2OC 3JVTB 2LV7A 3NXAA 3ZNIA 1UHNA 1KK7Z 2LVVA 2H2KA 1L2OB 1G8IA 1QLKA 5AEQA 1OZOA 2LHIA 1S26D 1YRTB 1SRAA 2KFGA 1HT9A 5AERA 2M3WA 4YBHB 4I5NB 2ZN8A 2K0JA 2K7CA 4OV2A 2K8MB 2JT0A 4I5LB 2JT8A 3I5FC 3I5HB 2L98A 2PALA 1CFCA 2I94A 2M7LA 1QASA 1F55A 1TIZA 2IS9A 1OE9B 2F2PA 1EXRA 3I5FB 3TDZA 1AJ4A 1SYMA 1NPQA 2BCXA 1NX0A 3KF9A 3NSKA 3SG7A 1DT7B 2F33A 4N1GA 5JJGA 1RWYA 2JT3A 1CDNA 4AOMA 1JBAA 3VRRA 1NP8A 4TNCA 2CBLA 1UWOA 1CLBA 2P6BB 4GFTA 1QX2A 5AXIA 2WCBA 2L5XB 2Y4QA 2LCPA 2M97A 1Y6WA 1YVLA 1SMGA 1BR4B 2LMTA 4OVNF 3M0WA 1KCYA 1JF2A 1IQ5A 2KAVA 4C0JA 2K61A 5D69A 2LHLA 1L7ZA 3TUYC 1OMVA 1GQMA 1VRKA 1Y0VH 2K7DA 2HQWA 2KI6C 3TUYB 1KWOC 3VGOA 1SCVA 1XA5A 3SG3A 4PE1A 2PVBA 2FOTA 1BF5A 3E3RA 4OCIA 2BCAA 3OB1B 4PE0A 4M2OA 2L2EA 3PFVA 4CLNA 4I5KA 3IQQA 5KSZA 3AKBA 1V1GA 1CB1A 3WNXB 1EJ3A 1YUUA 2NCOA 4CFQA 1C7VA 1OQPA 1BT6A 2PRUA 4QJ4B 1FI6A 4HRHA 1MWNA 1B47A 2K2FA 3BYAA 1YURA 5I8NA 1IG5A 1CLMA 1QV1A 3WHTB 1DJHA 3WXAA 3FS7A 1RK9A 1NUBA 1MHOA 1TRFA 4P5OE 1AP4A 2JULA 5CSFA 3BUMB 2KHNA 2SASA 1DGUA 2CNPA 2NLNA 2K7OA 2L51A 1CMFA 1KFXS 1U5IA 1S5GY 1YVHA 2F2OA 1BR1B 2KQ6A 2V53A 2ZFDA 4C0KA 1J1DA 2WOSA 1SNLA 5CSNA 5I2QA 3D10A 1J55A 1SPYA 2M0RA 3SG6A 1RFJA 1TNPA 2MA2A 1OZSA 1NWDA 5KU1A 1SCMC 1UHIA 1UHHA 2MJWB 3BOWB 3CTNA 2KFHA 4ICBA 4BY4A 4GGNA 1SCMB 4MVFA 5JOLA 5HKYA 2OPOA 3HCMA 4PE4A 2BE4A 4GGFC 1SKTA 3MSEB 4JPZB 1FW4A 2EGDA 3PSRA 4ORAB 1RJVA 1M31A 4PDZA 1FF1A 2F8PA 1DJXA 1KSOA 2CT9A 2HPSA 1CFFA 3DF0B 1SBJA 2WC8A 1SY9A 4JQ0D 4MN0A 1K2HA 3LK1A 1DF0B 1S5GZ 2L4IA 1UHKA 2BL0C 3CR2A 1Y1UA 1AJ5A 1OSAA 3I5IC 3JTDC 1CFPA 1M39A 2BL0B 2BBNA 1BJFA 5HKZA 1DJGA 3JTDB 3I5IB 3BUWB 2WORA 1TN4A 1S6IA 3BUOB 3BOWA 1WY9A 1IGVA 4MBEA 4YI8A 5F6TA 1A75B 1B8LA 1K95A 2F3ZA 2LVKA 3LCPC 3NSLA 1B4CA 2LVJA 2ZN9A 2WNDA 1V1FA 4M2QA 3O78A 4GGFA 1RROA 1SL8A 2NCPA 3VRQA 1JF0A 2JRFA 2CXJA 2LMUA 1KQMC 2NXQA 2BCBA 2O60A 3CWGA 1K94A 1XK4A 3PALA 3SG5A 2L0PA 4ETOA 3I5HC 2JTZA 3CS1A 1KQMB 1QV0A 4P2YB 1QLSA 1ZMZA 2I18A 3PN7C 5GQQC 2LVIA 3A4UB 1S6CA 2R2IA 3EK8A 1XVJA 2LP3A 1JUOA 3PN7B 3TS5C 1IH0A 4USLA 1CFDA 5J3XA 2K7BA 1EG4A 1XYDA 3TS5B 3F45A 1B8RA 4NQGA 5ER5A 1JSAA 1WRKA 3NSIA 2KBIA 3SG2A 1KFUL 1CM4A 1BLQA 1EH2A 3EVRA 1A75A 1UUSA 2MLEC 1ALVA 3BUXB 3DVMA 3O4YA 5G08A 4YGBB 2JQ6A 4GUKA 2JOJA 2ZNDA 5PALA 1CKKA 2FCEA 2PMYA 2M8UA 2MAZA 2E6WA 2KYFA 3GOFA 2Y1NA 1MXEA 2KAXA 1A03A 1QTXA 4R1EA 1F4QA 1S36A 2MRDA 1W7IB 4YGEB 3CGAA 4CPVA 2Q91A 1G33A 2ZRSA 1ZOTB 1ZFSA 3FWCA 1OOJA 3KEVA 2JWWA 4PHJA 1S1EA 2COLB 3I5GC 3DVEA 3CR4X 1IJ6A 3NSOA 1R2UA 4OR9B 2QPTA 3I5GB 1K90D 4E68A 1B9AA 1UP5A 3ZWHA 2I7AA 4L9MA 3CLNA 1PRWA 3IF7A 2SCPA 1BMOA 1F4OA 1PSBA 2BKIB 1DVIA 2K2AA 4WRIA 1OMDA 3PLFB 1Q80A 1SL7A 4WQ3A 1NIWA 5DKRA 1QVIY 2Y5IA 2EC6C 2M29A 1LVCD 1N2DA 3A8RA 5B8IB 1WLMA 1N0YA 3PM8A 2E30A 1XFYO 1K9KA 1G4YR 2EC6B 4YGCB 3FWBA 3TDIA 1IQ3A 2JTTA 2OS8C 1CTRA 3KPXA 1EG3A 4NDBA 2PASA 4M2PA 2CCMA 3EK4A 4N5XA 4I5JA 2OS8B 1Y1XA 3RLZA 1K96A 3TDUA
chains in the Genus database with same CATH superfamily
3D0YB 4UPGA 2L50A 1AK8A 1B8CA 1M45A 2ZKMX 4HREE 1B7TY 2ZNEA 2A4JA 5ER4X 1DJIA 1F54A 1AHRA 1A4PA 1TTXA 1WRZA 4N1FA 3NGVA 1NCZA 2LP2A 3EVUA 2LE9B 2LANA 1NYAA 1RECA 4DS7A 2P71A 2WC5A 2CTNA 1MXLC 1H4BA 1JFKA 5D7FA 1DTLA 5K89A 1OMRA 1KK8C 1GJYA 3R1PA 1JWDA 4OKHA 2LLUA 2AAOA 4JWQA 1KK8B 1KK7Y 1XO5A 2K60A 1XFRA 2G2BA 3BFHA 4PHNA 1TCFA 2JPTA 2L4HA 2AUCA 2BKHB 2KNEA 2M1KB 3D74A 1C7WA 4IL1A 1QXPA 3BUNB 3LK0A 3TZ1A 3D0YA 3K21A 1QS7A 2DOQA 2GGMA 2QACA 3GK2A 5HYDA 1SR6C 3OP0A 3OHMB 3SJSA 1F70A 2MLFC 5KTYA 1MF8B 1PSRA 4Q04A 4CFRA 4XJKB 1SR6B 1DJYA 3NHIA 5HKWA 3D76A 2VRGA 2D8NA 4MLWA 4DIRA 4MSPA 3GK4X 1QIVA 1NX3A 5I2OA 1YR5A 1LKJA 3EKHA 1RTP1 2EHBA 4DUQA 3DF0A 4MEWA 4NDDA 4QJ5B 2O5GA 3DYEA 1FBVA 1DF0A 1XFWO 3FIAA 2OTGC 1DELA 4NDCA 3O6BA 1SW8A 5CSIA 2KI6D 4AQIA 2OTGB 4HRGA 2RGIA 5FI6A 2JNXA 3CZ1A 4FTGA 4OZDA 2M9GA 1CM1A 2JU0A 2WCEA 3C1VA 2WCFA 3L4AA 5HLVA 1TUJA 3S0FA 3DVJA 1GM0A 1UHJA 1H8BA 1UURA 1K93D 2JZIA 4MRXA 5TNCA 1OW4A 1ALWA 4XJKA 1PVBA 1LA0A 1ZACA 1LXFC 3LLEA 1YRUB 4MRYA 4DRWA 3DVKA 1NX1A 2KGRA 1PALA 1B1GA 3GK1A 2PSRA 2MHHA 2LUXA 4CIDA 1S6JA 1ODBA 1JC2A 1WLZA 2JXLA 3EVVA 4C0LA 1XFXO 3OX6A 3DXLA 1CNPA 1FPWA 3AAKA 1BOCA 2LLSA 4YRUA 1GGWA 2I2RE 4F0ZB 4MZLA 2KSPA 2KBMA 2KDHA 1KFXL 1WRLA 3ICBA 1NCYA 3PM2A 2WCMA 1AUIB 1JFJA 3S0AA 2GV5A 4PALA 2BECA 2LM5A 3AAJA 1DJWA 1IWQA 1LINA 3HX4A 2F3YA 4GBAA 5DKQA 1TCOB 4PHMA 1CDPA 1BU3A 4ZCUA 1PK0D 1YTZC 1X02A 2LAPA 1XFZO 1QX7A 2Y1MA 3LL8B 2BBMA 2QEBA 4AQJA 1U5IB 1IKUA 2KGBC 4WQ2A 1KWOB 1F71A 1ZUZA 2LNKA 3DD4A 1J7QA 1KFUS 3AKAA 4XYNA 3PATA 1QJTA 1S3PA 3L47A 1J1EA 1AVSA 1TNXA 3N7HA 3OX5A 1XFVO 2B1UA 3O2PA 4MZJA 2AMIA 4YI9A 3QRXA 5HLOA 5AFPA 1YX8A 1BG1A 3K1EA 4D1EA 1NSHA 1IJ5A 3SIAA 1J7PA 4GPLB 1YX7A 2LUCA 4QJ3B 1K8UA 1J7OA 2M49B 4ORCB 1PVAA 2LLTA 2H61C 2KYCA 2ZRTA 3BQ3A 1M63B 2KAYA 3VRNA 2LMVA 2ISDA 1IIOA 2FJUB 1IRJA 2WCLA 3BXKA 3CYZA 2Q4UA 1TNWA 1EL4A 3VRPA 2M7NA 1XFUO 1F8HA 1W7JB 1N65A 4GAOA 4BY5A 1R6PA 2GGZA 1QIWA 3KHEA 4MZKA 2MBXA 1PULA 2LC5A 1YUSA 3WHUB 3BFAA 1C07A 2M1UA 3UO9A 1QX5B 3CR5X 1A2XA 1M46A 3VB1A 5CSJA 2NZ0A 1KQVA 1SK6D 1GGZA 1QVIZ 3OB2B 1K9UA 2FCDA 5CPVA 1MQ1A 3O4XA 1HQVA 1KSMA 1QATA 3R1VA 2HQ8A 2JNFA 4A4BA 1Y1AA 2G9BA 2KI4C 3SG4A 5AANA 1WDCC 1E8AA 1LA3A 1OOHA 1P28A 2KI4B 2H61A 1WDCB 4FQOA 1FI5A 1XK4C 1D1OA 2BE6A 2WCJA 3CABA 1TWOA 1CDMA 1CDLA 1A29A 1TNQA 3OGNA 4PE7A 4U8DA 4DCKA 3KO0A 1K9PA 1MR8A 2JXCA 2HETA 1YUTA 1J7RA 4PCWA 1B7TZ 1DMOA 3EK7A 1NX2A 4YGAA 4HSZA 2JC2A 3VROA 5D3OA 4YGDB 1NCXA 3CZTX 5DICA 2KFFA 4ZCVA 1MUXA 5I2LA 1SL9A 1BODA 5BPJA 2HF5A 3FE9A 4A4CA 3Q8IA 3H4SE 2QEVA 4ORBB 5DKNA 3SIBA 4PHKA 3IQOA 3RM1A 1DJZA 3EG5B 3CZ0A 1DEKA 2KQYA 4GNKB 3EKJA 5IBWA 1DGVA 3JVTC 1CLLA 1CMGA 5FYXA 2TN4A 1TOPA 2KOTA 1L2OC 3JVTB 2LV7A 3NXAA 3ZNIA 1UHNA 1KK7Z 2LVVA 2H2KA 1L2OB 1OOGA 1G8IA 1QLKA 5AEQA 1W9ZA 1OZOA 2LHIA 1S26D 1YRTB 1SRAA 2KFGA 1HT9A 5AERA 2M3WA 4YBHB 4I5NB 2ZN8A 2K0JA 2K7CA 2YGUA 4OV2A 2K8MB 2JT0A 4I5LB 2JT8A 3I5FC 3I5HB 2P70A 2L98A 2PALA 1CFCA 2I94A 2M7LA 1QASA 3B86A 1TIZA 2IS9A 1OE9B 2F2PA 1EXRA 3I5FB 3TDZA 1AJ4A 1SYMA 3SS5A 1NPQA 2BCXA 1NX0A 3KF9A 3NSKA 3SG7A 1DT7B 2F33A 4N1GA 5JJGA 1RWYA 2JT3A 1CDNA 4AOMA 1JBAA 3VRRA 1NP8A 4TNCA 2PQLA 2CBLA 3S0GA 1UWOA 3D77A 1CLBA 2P6BB 4GFTA 1QX2A 5AXIA 2WCBA 2L5XB 2Y4QA 2LCPA 2M97A 1C3YA 1Y6WA 1YVLA 1SMGA 1BR4B 2LMTA 4OVNF 3S0DA 3M0WA 1KCYA 1JF2A 1IQ5A 4INXA 2KAVA 4C0JA 2K61A 5D69A 2LHLA 5I94A 1L7ZA 3TUYC 1OMVA 1GQMA 1VRKA 1Y0VH 2K7DA 2HQWA 3D75A 2KI6C 3TUYB 1KWOC 3VGOA 1SCVA 1XA5A 3SG3A 4PE1A 2PVBA 2FOTA 1BF5A 3E3RA 4OCIA 2BCAA 1C3ZA 3OB1B 4PE0A 2QEOA 2L2EA 3PFVA 4M2OA 3OBVA 4CLNA 4I5KA 3IQQA 5KSZA 3AKBA 1V1GA 1CB1A 3WNXB 1QWVA 1EJ3A 1YUUA 2NCOA 4KYNA 3D73A 4CFQA 1C7VA 1OQPA 1BT6A 2QDIA 2PRUA 4QJ4B 1FI6A 4HRHA 1MWNA 1B47A 3SS3A 2K2FA 3BYAA 1YURA 5I8NA 1IG5A 1LS8A 1CLMA 1QV1A 2WCKA 1DJHA 3WHTB 3WXAA 3FS7A 1RK9A 1NUBA 1MHOA 1TRFA 4P5OE 1AP4A 2JULA 5CSFA 3BUMB 2KHNA 2SASA 1ORGA 1DGUA 2CNPA 2NLNA 2K7OA 2L51A 1CMFA 1KFXS 1U5IA 1S5GY 1YVHA 2F2OA 1BR1B 2KQ6A 2V53A 2ZFDA 3S0EA 4C0KA 1J1DA 2WOSA 1SNLA 5CSNA 5I2QA 4F7FA 3D10A 1J55A 1SPYA 2M0RA 2WCHA 3SG6A 1RFJA 1TNPA 2MA2A 1OZSA 1NWDA 5KU1A 1OOFA 1SCMC 1UHIA 1DQEA 1UHHA 2QEHA 2MJWB 3BOWB 3NHTA 5HL1A 3CTNA 2KFHA 4ICBA 4BY4A 4GGNA 1SCMB 4MVFA 5JOLA 5HKYA 2OPOA 3B6XA 3HCMA 4PE4A 2BE4A 3V2LA 4GGFC 1SKTA 3MSEB 3BFBA 1FW4A 2EGDA 2JPOA 3PSRA 4JPZB 4ORAB 1RJVA 2L2CA 1M31A 4PDZA 5FI2A 2F8PA 1DJXA 1FF1A 2BNXA 1KSOA 2CT9A 2HPSA 1CFFA 3DF0B 1SBJA 2WC8A 1SY9A 4JQ0D 4MN0A 1K2HA 3LK1A 1DF0B 1S5GZ 2KLDA 2L4IA 1F55A 1UHKA 3QMEA 2BL0C 1Z4HA 3CR2A 1Y1UA 3L4LA 4PT1A 1AJ5A 1OSAA 3I5IC 2GTEA 3JTDC 1CFPA 1M39A 2BL0B 2BBNA 1BJFA 5HKZA 3DZTA 1DJGA 3JTDB 3I5IB 3BUWB 2WORA 1TN4A 1S6IA 1DC1A 3BUOB 3BOWA 1WY9A 1IGVA 1T14A 4MBEA 4YI8A 5F6TA 3BJHA 1A75B 1B8LA 1K95A 2F3ZA 2LVKA 3LCPC 3NSLA 1B4CA 2LVJA 2ZN9A 2WNDA 2ERBA 1V1FA 2WC6A 4M2QA 3O78A 3CDNA 4GGFA 1RROA 1SL8A 2NCPA 3VRQA 1JF0A 2JRFA 2CXJA 2LMUA 1KQMC 2NXQA 2BCBA 2O60A 3CWGA 1K94A 1XK4A 3PALA 3SG5A 2L0PA 4ETOA 3I5HC 2JTZA 3CS1A 1KQMB 2L5YA 1QV0A 4P2YB 1QLSA 1ZMZA 2I18A 3PN7C 5GQQC 2LVIA 3A4UB 1S6CA 2R2IA 2BAPA 3EK8A 3PJIA 1XVJA 1OOIX 1JUOA 2LP3A 3PN7B 3TS5C 4USLA 1IH0A 1CFDA 5J3XA 2K7BA 2PYQA 1EG4A 1XYDA 3TS5B 3F45A 1B8RA 4NQGA 3B88A 5ER5A 1JSAA 1WRKA 3NSIA 3S0BA 2KBIA 3SG2A 1KFUL 1CM4A 1BLQA 1EH2A 3EVRA 1A75A 1UUSA 2FJYA 2MLEC 1ALVA 3BUXB 3CZ2A 3DVMA 3O4YA 5G08A 4YGBB 2JQ6A 4GUKA 2JOJA 2ZNDA 5PALA 1CKKA 2FCEA 2PMYA 2M8UA 2MAZA 2E6WA 2KYFA 3GOFA 3RZSA 2Y1NA 1MXEA 2KAXA 1A03A 1QTXA 4R1EA 1F4QA 1S36A 2MRDA 1W7IB 4YGEB 3CGAA 4CPVA 2Q91A 1G33A 3R72A 4FQTA 2ZRSA 1TUZA 1ZOTB 1ZFSA 3IVTA 3FWCA 1OOJA 3KEVA 2JWWA 4PHJA 4IJ7A 1S1EA 3D78A 2COLB 3I5GC 3DVEA 2KPHA 1IJ6A 1SSEB 3CR4X 1Z2CB 1R2UA 3NSOA 4OR9B 2QPTA 3R1OA 3I5GB 1K90D 4E68A 1B9AA 1UP5A 2KLEA 3ZWHA 2I7AA 4L9MA 3CLNA 1PRWA 3IF7A 2SCPA 3FE6A 1BMOA 1F4OA 1PSBA 2BKIB 1DVIA 3FE8A 3B87A 2K2AA 4WRIA 1OMDA 3PLFB 1Q80A 1SL7A 4WQ3A 1NIWA 5DKRA 1QVIY 2Y5IA 2EC6C 2M29A 5EL2A 1LVCD 1N2DA 3A8RA 5B8IB 1WLMA 1N0YA 3PM8A 2E30A 1XFYO 1K9KA 1G4YR 2EC6B 4YGCB 3UNWA 3FWBA 2H8VA 3TDIA 1IQ3A 2JTTA 2OS8C 1CTRA 3KPXA 1EG3A 4NDBA 2PASA 4JD9A 2CCMA 4M2PA 3EK4A 4INWA 4I5JA 2OS8B 1Y1XA 4N5XA 3RLZA 4JKTA 3B7AA 1K96A 3TDUA 5FI7A 3SS4A 3DY9A
chains in the Genus database with same CATH topology
3D0YB 4UPGA 2L50A 1AK8A 1B8CA 1M45A 2ZKMX 4HREE 1B7TY 2ZNEA 2A4JA 5ER4X 1DJIA 1F54A 1AHRA 1A4PA 1TTXA 1WRZA 4N1FA 1NCZA 2LP2A 3EVUA 2LE9B 2LANA 1NYAA 1RECA 4DS7A 2CTNA 1MXLC 1H4BA 1JFKA 5D7FA 1DTLA 5K89A 1OMRA 1KK8C 1GJYA 1JWDA 4OKHA 2LLUA 2AAOA 4JWQA 1KK8B 1KK7Y 1XO5A 2G2BA 4PHNA 1TCFA 2JPTA 2L4HA 2AUCA 2BKHB 2KNEA 2M1KB 4IL1A 1C7WA 1QXPA 3BUNB 3LK0A 3TZ1A 3D0YA 3K21A 1QS7A 2DOQA 2GGMA 2QACA 3GK2A 5HYDA 1SR6C 3OP0A 3OHMB 3SJSA 1F70A 2MLFC 5KTYA 1MF8B 1PSRA 4Q04A 4CFRA 4XJKB 1SR6B 1DJYA 5HKWA 4DIRA 2VRGA 2D8NA 4MLWA 4MSPA 3GK4X 1QIVA 1NX3A 5I2OA 1YR5A 1LKJA 3EKHA 1RTP1 2EHBA 4DUQA 3DF0A 4MEWA 4NDDA 4QJ5B 2O5GA 1FBVA 1DF0A 1XFWO 3FIAA 2OTGC 4NDCA 3O6BA 1SW8A 5CSIA 2KI6D 4AQIA 2OTGB 4HRGA 2RGIA 2JNXA 4FTGA 2M9GA 1CM1A 2JU0A 2WCEA 3C1VA 2WCFA 5HLVA 3DVJA 1UHJA 1H8BA 1UURA 1K93D 2JZIA 4MRXA 5TNCA 1ALWA 4XJKA 1PVBA 1LA0A 1ZACA 1LXFC 3LLEA 1YRUB 4MRYA 4DRWA 3DVKA 1NX1A 2KGRA 1PALA 1B1GA 3GK1A 2PSRA 2MHHA 2LUXA 4CIDA 1S6JA 1ODBA 1JC2A 1WLZA 2JXLA 3EVVA 4C0LA 1XFXO 3OX6A 1CNPA 1FPWA 3AAKA 1BOCA 2LLSA 4YRUA 1GGWA 2I2RE 4F0ZB 4MZLA 2KSPA 2KBMA 2KDHA 1KFXL 1WRLA 3ICBA 1NCYA 1AUIB 1JFJA 2GV5A 4PALA 2BECA 2LM5A 3AAJA 1DJWA 1IWQA 1LINA 3HX4A 2F3YA 4GBAA 5DKQA 1TCOB 4PHMA 1CDPA 1BU3A 4ZCUA 1PK0D 1YTZC 1X02A 2LAPA 1XFZO 1QX7A 2Y1MA 3LL8B 2BBMA 4AQJA 1U5IB 1IKUA 2KGBC 4WQ2A 1KWOB 1F71A 1ZUZA 2LNKA 3DD4A 1J7QA 1KFUS 3AKAA 4XYNA 3PATA 1QJTA 1S3PA 1J1EA 1AVSA 1TNXA 3OX5A 1XFVO 2B1UA 3O2PA 4MZJA 2AMIA 4YI9A 3QRXA 5HLOA 5AFPA 1YX8A 1BG1A 4D1EA 1NSHA 1IJ5A 3SIAA 1J7PA 4GPLB 1YX7A 2LUCA 4QJ3B 1K8UA 1J7OA 2M49B 4ORCB 1PVAA 2LLTA 2H61C 2KYCA 2ZRTA 3BQ3A 1M63B 2KAYA 3VRNA 2LMVA 2ISDA 2FJUB 1IRJA 3BXKA 2Q4UA 1TNWA 1EL4A 3VRPA 2M7NA 1XFUO 1F8HA 1W7JB 1N65A 4GAOA 4BY5A 1R6PA 2GGZA 1QIWA 3KHEA 4MZKA 2MBXA 1PULA 2LC5A 1YUSA 3WHUB 1C07A 2M1UA 1QX5B 3CR5X 1A2XA 1M46A 5CSJA 2NZ0A 1KQVA 1SK6D 1GGZA 1QVIZ 3OB2B 1K9UA 2FCDA 5CPVA 1MQ1A 1HQVA 1KSMA 1QATA 2HQ8A 2JNFA 4A4BA 1Y1AA 2G9BA 2KI4C 3SG4A 5AANA 1WDCC 1E8AA 1LA3A 2KI4B 2H61A 1WDCB 4FQOA 1FI5A 1XK4C 1D1OA 2BE6A 1CDMA 1CDLA 1A29A 1TNQA 4PE7A 4U8DA 4DCKA 3KO0A 1K9PA 1MR8A 2JXCA 2HETA 1YUTA 1J7RA 4PCWA 1B7TZ 1DMOA 3EK7A 1NX2A 4YGAA 4HSZA 2JC2A 3VROA 4YGDB 1NCXA 3CZTX 2KFFA 4ZCVA 1MUXA 5I2LA 1SL9A 1BODA 5BPJA 2HF5A 4A4CA 3H4SE 4ORBB 5DKNA 3SIBA 4PHKA 3IQOA 3RM1A 1DJZA 4GNKB 2KQYA 3EKJA 5IBWA 1DGVA 3JVTC 1CLLA 1CMGA 5FYXA 2TN4A 1TOPA 2KOTA 1L2OC 3JVTB 2LV7A 3NXAA 3ZNIA 1UHNA 1KK7Z 2LVVA 2H2KA 1L2OB 1G8IA 1QLKA 5AEQA 1OZOA 2LHIA 1S26D 1YRTB 1SRAA 2KFGA 1HT9A 5AERA 2M3WA 4YBHB 4I5NB 2ZN8A 2K0JA 2K7CA 4OV2A 2K8MB 2JT0A 4I5LB 2JT8A 3I5FC 3I5HB 2L98A 2PALA 1CFCA 2I94A 2M7LA 1QASA 1F55A 1TIZA 2IS9A 1OE9B 2F2PA 1EXRA 3I5FB 3TDZA 1AJ4A 1SYMA 1NPQA 2BCXA 1NX0A 3KF9A 3NSKA 3SG7A 1DT7B 2F33A 4N1GA 5JJGA 1RWYA 2JT3A 1CDNA 4AOMA 1JBAA 3VRRA 1NP8A 4TNCA 2CBLA 1UWOA 1CLBA 2P6BB 4GFTA 1QX2A 5AXIA 2WCBA 2L5XB 2Y4QA 2LCPA 2M97A 1Y6WA 1YVLA 1SMGA 1BR4B 2LMTA 4OVNF 3M0WA 1KCYA 1JF2A 1IQ5A 2KAVA 4C0JA 2K61A 5D69A 2LHLA 1L7ZA 3TUYC 1OMVA 1GQMA 1VRKA 1Y0VH 2K7DA 2HQWA 2KI6C 3TUYB 1KWOC 3VGOA 1SCVA 1XA5A 3SG3A 4PE1A 2PVBA 2FOTA 1BF5A 3E3RA 4OCIA 2BCAA 3OB1B 4PE0A 4M2OA 2L2EA 3PFVA 4CLNA 4I5KA 3IQQA 5KSZA 3AKBA 1V1GA 1CB1A 3WNXB 1EJ3A 1YUUA 2NCOA 4CFQA 1C7VA 1OQPA 1BT6A 2PRUA 4QJ4B 1FI6A 4HRHA 1MWNA 1B47A 2K2FA 3BYAA 1YURA 5I8NA 1IG5A 1CLMA 1QV1A 3WHTB 1DJHA 3WXAA 3FS7A 1RK9A 1NUBA 1MHOA 1TRFA 4P5OE 1AP4A 2JULA 5CSFA 3BUMB 2KHNA 2SASA 1DGUA 2CNPA 2NLNA 2K7OA 2L51A 1CMFA 1KFXS 1U5IA 1S5GY 1YVHA 2F2OA 1BR1B 2KQ6A 2V53A 2ZFDA 4C0KA 1J1DA 2WOSA 1SNLA 5CSNA 5I2QA 3D10A 1J55A 1SPYA 2M0RA 3SG6A 1RFJA 1TNPA 2MA2A 1OZSA 1NWDA 5KU1A 1SCMC 1UHIA 1UHHA 2MJWB 3BOWB 3CTNA 2KFHA 4ICBA 4BY4A 4GGNA 1SCMB 4MVFA 5JOLA 5HKYA 2OPOA 3HCMA 4PE4A 2BE4A 4GGFC 1SKTA 3MSEB 4JPZB 1FW4A 2EGDA 3PSRA 4ORAB 1RJVA 1M31A 4PDZA 1FF1A 2F8PA 1DJXA 1KSOA 2CT9A 2HPSA 1CFFA 3DF0B 1SBJA 2WC8A 1SY9A 4JQ0D 4MN0A 1K2HA 3LK1A 1DF0B 1S5GZ 2L4IA 1UHKA 2BL0C 3CR2A 1Y1UA 1AJ5A 1OSAA 3I5IC 3JTDC 1CFPA 1M39A 2BL0B 2BBNA 1BJFA 5HKZA 1DJGA 3JTDB 3I5IB 3BUWB 2WORA 1TN4A 1S6IA 3BUOB 3BOWA 1WY9A 1IGVA 4MBEA 4YI8A 5F6TA 1A75B 1B8LA 1K95A 2F3ZA 2LVKA 3LCPC 3NSLA 1B4CA 2LVJA 2ZN9A 2WNDA 1V1FA 4M2QA 3O78A 4GGFA 1RROA 1SL8A 2NCPA 3VRQA 1JF0A 2JRFA 2CXJA 2LMUA 1KQMC 2NXQA 2BCBA 2O60A 3CWGA 1K94A 1XK4A 3PALA 3SG5A 2L0PA 4ETOA 3I5HC 2JTZA 3CS1A 1KQMB 1QV0A 4P2YB 1QLSA 1ZMZA 2I18A 3PN7C 5GQQC 2LVIA 3A4UB 1S6CA 2R2IA 3EK8A 1XVJA 2LP3A 1JUOA 3PN7B 3TS5C 1IH0A 4USLA 1CFDA 5J3XA 2K7BA 1EG4A 1XYDA 3TS5B 3F45A 1B8RA 4NQGA 5ER5A 1JSAA 1WRKA 3NSIA 2KBIA 3SG2A 1KFUL 1CM4A 1BLQA 1EH2A 3EVRA 1A75A 1UUSA 2MLEC 1ALVA 3BUXB 3DVMA 3O4YA 5G08A 4YGBB 2JQ6A 4GUKA 2JOJA 2ZNDA 5PALA 1CKKA 2FCEA 2PMYA 2M8UA 2MAZA 2E6WA 2KYFA 3GOFA 2Y1NA 1MXEA 2KAXA 1A03A 1QTXA 4R1EA 1F4QA 1S36A 2MRDA 1W7IB 4YGEB 3CGAA 4CPVA 2Q91A 1G33A 2ZRSA 1ZOTB 1ZFSA 3FWCA 1OOJA 3KEVA 2JWWA 4PHJA 1S1EA 2COLB 3I5GC 3DVEA 3CR4X 1IJ6A 3NSOA 1R2UA 4OR9B 2QPTA 3I5GB 1K90D 4E68A 1B9AA 1UP5A 3ZWHA 2I7AA 4L9MA 3CLNA 1PRWA 3IF7A 2SCPA 1BMOA 1F4OA 1PSBA 2BKIB 1DVIA 2K2AA 4WRIA 1OMDA 3PLFB 1Q80A 1SL7A 4WQ3A 1NIWA 5DKRA 1QVIY 2Y5IA 2EC6C 2M29A 1LVCD 1N2DA 3A8RA 5B8IB 1WLMA 1N0YA 3PM8A 2E30A 1XFYO 1K9KA 1G4YR 2EC6B 4YGCB 3FWBA 3TDIA 1IQ3A 2JTTA 2OS8C 1CTRA 3KPXA 1EG3A 4NDBA 2PASA 4M2PA 2CCMA 3EK4A 4N5XA 4I5JA 2OS8B 1Y1XA 3RLZA 1K96A 3TDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Y B;  4UPG A;  2L50 A;  1AK8 A;  1B8C A;  1M45 A;  2ZKM X;  4HRE E;  1B7T Y;  2ZNE A;  2A4J A;  5ER4 X;  1DJI A;  1F54 A;  1AHR A;  1A4P A;  1TTX A;  1WRZ A;  4N1F A;  1NCZ A;  2LP2 A;  3EVU A;  2LE9 B;  2LAN A;  1NYA A;  1REC A;  4DS7 A;  2CTN A;  1MXL C;  1H4B A;  1JFK A;  5D7F A;  1DTL A;  5K89 A;  1OMR A;  1KK8 C;  1GJY A;  1JWD A;  4OKH A;  2LLU A;  2AAO A;  4JWQ A;  1KK8 B;  1KK7 Y;  1XO5 A;  2G2B A;  4PHN A;  1TCF A;  2JPT A;  2L4H A;  2AUC A;  2BKH B;  2KNE A;  2M1K B;  4IL1 A;  1C7W A;  1QXP A;  3BUN B;  3LK0 A;  3TZ1 A;  3D0Y A;  3K21 A;  1QS7 A;  2DOQ A;  2GGM A;  2QAC A;  3GK2 A;  5HYD A;  1SR6 C;  3OP0 A;  3OHM B;  3SJS A;  1F70 A;  2MLF C;  5KTY A;  1MF8 B;  1PSR A;  4Q04 A;  4CFR A;  4XJK B;  1SR6 B;  1DJY A;  5HKW A;  4DIR A;  2VRG A;  2D8N A;  4MLW A;  4MSP A;  3GK4 X;  1QIV A;  1NX3 A;  5I2O A;  1YR5 A;  1LKJ A;  3EKH A;  1RTP 1;  2EHB A;  4DUQ A;  3DF0 A;  4MEW A;  4NDD A;  4QJ5 B;  2O5G A;  1FBV A;  1DF0 A;  1XFW O;  3FIA A;  2OTG C;  4NDC A;  3O6B A;  1SW8 A;  5CSI A;  2KI6 D;  4AQI A;  2OTG B;  4HRG A;  2RGI A;  2JNX A;  4FTG A;  2M9G A;  1CM1 A;  2JU0 A;  2WCE A;  3C1V A;  2WCF A;  5HLV A;  3DVJ A;  1UHJ A;  1H8B A;  1UUR A;  1K93 D;  2JZI A;  4MRX A;  5TNC A;  1ALW A;  4XJK A;  1PVB A;  1LA0 A;  1ZAC A;  1LXF C;  3LLE A;  1YRU B;  4MRY A;  4DRW A;  3DVK A;  1NX1 A;  2KGR A;  1PAL A;  1B1G A;  3GK1 A;  2PSR A;  2MHH A;  2LUX A;  4CID A;  1S6J A;  1ODB A;  1JC2 A;  1WLZ A;  2JXL A;  3EVV A;  4C0L A;  1XFX O;  3OX6 A;  1CNP A;  1FPW A;  3AAK A;  1BOC A;  2LLS A;  4YRU A;  1GGW A;  2I2R E;  4F0Z B;  4MZL A;  2KSP A;  2KBM A;  2KDH A;  1KFX L;  1WRL A;  3ICB A;  1NCY A;  1AUI B;  1JFJ A;  2GV5 A;  4PAL A;  2BEC A;  2LM5 A;  3AAJ A;  1DJW A;  1IWQ A;  1LIN A;  3HX4 A;  2F3Y A;  4GBA A;  5DKQ A;  1TCO B;  4PHM A;  1CDP A;  1BU3 A;  4ZCU A;  1PK0 D;  1YTZ C;  1X02 A;  2LAP A;  1XFZ O;  1QX7 A;  2Y1M A;  3LL8 B;  2BBM A;  4AQJ A;  1U5I B;  1IKU A;  2KGB C;  4WQ2 A;  1KWO B;  1F71 A;  1ZUZ A;  2LNK A;  3DD4 A;  1J7Q A;  1KFU S;  3AKA A;  4XYN A;  3PAT A;  1QJT A;  1S3P A;  1J1E A;  1AVS A;  1TNX A;  3OX5 A;  1XFV O;  2B1U A;  3O2P A;  4MZJ A;  2AMI A;  4YI9 A;  3QRX A;  5HLO A;  5AFP A;  1YX8 A;  1BG1 A;  4D1E A;  1NSH A;  1IJ5 A;  3SIA A;  1J7P A;  4GPL B;  1YX7 A;  2LUC A;  4QJ3 B;  1K8U A;  1J7O A;  2M49 B;  4ORC B;  1PVA A;  2LLT A;  2H61 C;  2KYC A;  2ZRT A;  3BQ3 A;  1M63 B;  2KAY A;  3VRN A;  2LMV A;  2ISD A;  2FJU B;  1IRJ A;  3BXK A;  2Q4U A;  1TNW A;  1EL4 A;  3VRP A;  2M7N A;  1XFU O;  1F8H A;  1W7J B;  1N65 A;  4GAO A;  4BY5 A;  1R6P A;  2GGZ A;  1QIW A;  3KHE A;  4MZK A;  2MBX A;  1PUL A;  2LC5 A;  1YUS A;  3WHU B;  1C07 A;  2M1U A;  1QX5 B;  3CR5 X;  1A2X A;  1M46 A;  5CSJ A;  2NZ0 A;  1KQV A;  1SK6 D;  1GGZ A;  1QVI Z;  3OB2 B;  1K9U A;  2FCD A;  5CPV A;  1MQ1 A;  1HQV A;  1KSM A;  1QAT A;  2HQ8 A;  2JNF A;  4A4B A;  1Y1A A;  2G9B A;  2KI4 C;  3SG4 A;  5AAN A;  1WDC C;  1E8A A;  1LA3 A;  2KI4 B;  2H61 A;  1WDC B;  4FQO A;  1FI5 A;  1XK4 C;  1D1O A;  2BE6 A;  1CDM A;  1CDL A;  1A29 A;  1TNQ A;  4PE7 A;  4U8D A;  4DCK A;  3KO0 A;  1K9P A;  1MR8 A;  2JXC A;  2HET A;  1YUT A;  1J7R A;  4PCW A;  1B7T Z;  1DMO A;  3EK7 A;  1NX2 A;  4YGA A;  4HSZ A;  2JC2 A;  3VRO A;  4YGD B;  1NCX A;  3CZT X;  2KFF A;  4ZCV A;  1MUX A;  5I2L A;  1SL9 A;  1BOD A;  5BPJ A;  2HF5 A;  4A4C A;  3H4S E;  4ORB B;  5DKN A;  3SIB A;  4PHK A;  3IQO A;  3RM1 A;  1DJZ A;  4GNK B;  2KQY A;  3EKJ A;  5IBW A;  1DGV A;  3JVT C;  1CLL A;  1CMG A;  5FYX A;  2TN4 A;  1TOP A;  2KOT A;  1L2O C;  3JVT B;  2LV7 A;  3NXA A;  3ZNI A;  1UHN A;  1KK7 Z;  2LVV A;  2H2K A;  1L2O B;  1G8I A;  1QLK A;  5AEQ A;  1OZO A;  2LHI A;  1S26 D;  1YRT B;  1SRA A;  2KFG A;  1HT9 A;  5AER A;  2M3W A;  4YBH B;  4I5N B;  2ZN8 A;  2K0J A;  2K7C A;  4OV2 A;  2K8M B;  2JT0 A;  4I5L B;  2JT8 A;  3I5F C;  3I5H B;  2L98 A;  2PAL A;  1CFC A;  2I94 A;  2M7L A;  1QAS A;  1F55 A;  1TIZ A;  2IS9 A;  1OE9 B;  2F2P A;  1EXR A;  3I5F B;  3TDZ A;  1AJ4 A;  1SYM A;  1NPQ A;  2BCX A;  1NX0 A;  3KF9 A;  3NSK A;  3SG7 A;  1DT7 B;  2F33 A;  4N1G A;  5JJG A;  1RWY A;  2JT3 A;  1CDN A;  4AOM A;  1JBA A;  3VRR A;  1NP8 A;  4TNC A;  2CBL A;  1UWO A;  1CLB A;  2P6B B;  4GFT A;  1QX2 A;  5AXI A;  2WCB A;  2L5X B;  2Y4Q A;  2LCP A;  2M97 A;  1Y6W A;  1YVL A;  1SMG A;  1BR4 B;  2LMT A;  4OVN F;  3M0W A;  1KCY A;  1JF2 A;  1IQ5 A;  2KAV A;  4C0J A;  2K61 A;  5D69 A;  2LHL A;  1L7Z A;  3TUY C;  1OMV A;  1GQM A;  1VRK A;  1Y0V H;  2K7D A;  2HQW A;  2KI6 C;  3TUY B;  1KWO C;  3VGO A;  1SCV A;  1XA5 A;  3SG3 A;  4PE1 A;  2PVB A;  2FOT A;  1BF5 A;  3E3R A;  4OCI A;  2BCA A;  3OB1 B;  4PE0 A;  4M2O A;  2L2E A;  3PFV A;  4CLN A;  4I5K A;  3IQQ A;  5KSZ A;  3AKB A;  1V1G A;  1CB1 A;  3WNX B;  1EJ3 A;  1YUU A;  2NCO A;  4CFQ A;  1C7V A;  1OQP A;  1BT6 A;  2PRU A;  4QJ4 B;  1FI6 A;  4HRH A;  1MWN A;  1B47 A;  2K2F A;  3BYA A;  1YUR A;  5I8N A;  1IG5 A;  1CLM A;  1QV1 A;  3WHT B;  1DJH A;  3WXA A;  3FS7 A;  1RK9 A;  1NUB A;  1MHO A;  1TRF A;  4P5O E;  1AP4 A;  2JUL A;  5CSF A;  3BUM B;  2KHN A;  2SAS A;  1DGU A;  2CNP A;  2NLN A;  2K7O A;  2L51 A;  1CMF A;  1KFX S;  1U5I A;  1S5G Y;  1YVH A;  2F2O A;  1BR1 B;  2KQ6 A;  2V53 A;  2ZFD A;  4C0K A;  1J1D A;  2WOS A;  1SNL A;  5CSN A;  5I2Q A;  3D10 A;  1J55 A;  1SPY A;  2M0R A;  3SG6 A;  1RFJ A;  1TNP A;  2MA2 A;  1OZS A;  1NWD A;  5KU1 A;  1SCM C;  1UHI A;  1UHH A;  2MJW B;  3BOW B;  3CTN A;  2KFH A;  4ICB A;  4BY4 A;  4GGN A;  1SCM B;  4MVF A;  5JOL A;  5HKY A;  2OPO A;  3HCM A;  4PE4 A;  2BE4 A;  4GGF C;  1SKT A;  3MSE B;  4JPZ B;  1FW4 A;  2EGD A;  3PSR A;  4ORA B;  1RJV A;  1M31 A;  4PDZ A;  1FF1 A;  2F8P A;  1DJX A;  1KSO A;  2CT9 A;  2HPS A;  1CFF A;  3DF0 B;  1SBJ A;  2WC8 A;  1SY9 A;  4JQ0 D;  4MN0 A;  1K2H A;  3LK1 A;  1DF0 B;  1S5G Z;  2L4I A;  1UHK A;  2BL0 C;  3CR2 A;  1Y1U A;  1AJ5 A;  1OSA A;  3I5I C;  3JTD C;  1CFP A;  1M39 A;  2BL0 B;  2BBN A;  1BJF A;  5HKZ A;  1DJG A;  3JTD B;  3I5I B;  3BUW B;  2WOR A;  1TN4 A;  1S6I A;  3BUO B;  3BOW A;  1WY9 A;  1IGV A;  4MBE A;  4YI8 A;  5F6T A;  1A75 B;  1B8L A;  1K95 A;  2F3Z A;  2LVK A;  3LCP C;  3NSL A;  1B4C A;  2LVJ A;  2ZN9 A;  2WND A;  1V1F A;  4M2Q A;  3O78 A;  4GGF A;  1RRO A;  1SL8 A;  2NCP A;  3VRQ A;  1JF0 A;  2JRF A;  2CXJ A;  2LMU A;  1KQM C;  2NXQ A;  2BCB A;  2O60 A;  3CWG A;  1K94 A;  1XK4 A;  3PAL A;  3SG5 A;  2L0P A;  4ETO A;  3I5H C;  2JTZ A;  3CS1 A;  1KQM B;  1QV0 A;  4P2Y B;  1QLS A;  1ZMZ A;  2I18 A;  3PN7 C;  5GQQ C;  2LVI A;  3A4U B;  1S6C A;  2R2I A;  3EK8 A;  1XVJ A;  2LP3 A;  1JUO A;  3PN7 B;  3TS5 C;  1IH0 A;  4USL A;  1CFD A;  5J3X A;  2K7B A;  1EG4 A;  1XYD A;  3TS5 B;  3F45 A;  1B8R A;  4NQG A;  5ER5 A;  1JSA A;  1WRK A;  3NSI A;  2KBI A;  3SG2 A;  1KFU L;  1CM4 A;  1BLQ A;  1EH2 A;  3EVR A;  1A75 A;  1UUS A;  2MLE C;  1ALV A;  3BUX B;  3DVM A;  3O4Y A;  5G08 A;  4YGB B;  2JQ6 A;  4GUK A;  2JOJ A;  2ZND A;  5PAL A;  1CKK A;  2FCE A;  2PMY A;  2M8U A;  2MAZ A;  2E6W A;  2KYF A;  3GOF A;  2Y1N A;  1MXE A;  2KAX A;  1A03 A;  1QTX A;  4R1E A;  1F4Q A;  1S36 A;  2MRD A;  1W7I B;  4YGE B;  3CGA A;  4CPV A;  2Q91 A;  1G33 A;  2ZRS A;  1ZOT B;  1ZFS A;  3FWC A;  1OOJ A;  3KEV A;  2JWW A;  4PHJ A;  1S1E A;  2COL B;  3I5G C;  3DVE A;  3CR4 X;  1IJ6 A;  3NSO A;  1R2U A;  4OR9 B;  2QPT A;  3I5G B;  1K90 D;  4E68 A;  1B9A A;  1UP5 A;  3ZWH A;  2I7A A;  4L9M A;  3CLN A;  1PRW A;  3IF7 A;  2SCP A;  1BMO A;  1F4O A;  1PSB A;  2BKI B;  1DVI A;  2K2A A;  4WRI A;  1OMD A;  3PLF B;  1Q80 A;  1SL7 A;  4WQ3 A;  1NIW A;  5DKR A;  1QVI Y;  2Y5I A;  2EC6 C;  2M29 A;  1LVC D;  1N2D A;  3A8R A;  5B8I B;  1WLM A;  1N0Y A;  3PM8 A;  2E30 A;  1XFY O;  1K9K A;  1G4Y R;  2EC6 B;  4YGC B;  3FWB A;  3TDI A;  1IQ3 A;  2JTT A;  2OS8 C;  1CTR A;  3KPX A;  1EG3 A;  4NDB A;  2PAS A;  4M2P A;  2CCM A;  3EK4 A;  4N5X A;  4I5J A;  2OS8 B;  1Y1X A;  3RLZ A;  1K96 A;  3TDU A; 
#chains in the Genus database with same CATH topology
 3D0Y B;  4UPG A;  2L50 A;  1AK8 A;  1B8C A;  1M45 A;  2ZKM X;  4HRE E;  1B7T Y;  2ZNE A;  2A4J A;  5ER4 X;  1DJI A;  1F54 A;  1AHR A;  1A4P A;  1TTX A;  1WRZ A;  4N1F A;  3NGV A;  1NCZ A;  2LP2 A;  3EVU A;  2LE9 B;  2LAN A;  1NYA A;  1REC A;  4DS7 A;  2P71 A;  2WC5 A;  2CTN A;  1MXL C;  1H4B A;  1JFK A;  5D7F A;  1DTL A;  5K89 A;  1OMR A;  1KK8 C;  1GJY A;  3R1P A;  1JWD A;  4OKH A;  2LLU A;  2AAO A;  4JWQ A;  1KK8 B;  1KK7 Y;  1XO5 A;  2K60 A;  1XFR A;  2G2B A;  3BFH A;  4PHN A;  1TCF A;  2JPT A;  2L4H A;  2AUC A;  2BKH B;  2KNE A;  2M1K B;  3D74 A;  1C7W A;  4IL1 A;  1QXP A;  3BUN B;  3LK0 A;  3TZ1 A;  3D0Y A;  3K21 A;  1QS7 A;  2DOQ A;  2GGM A;  2QAC A;  3GK2 A;  5HYD A;  1SR6 C;  3OP0 A;  3OHM B;  3SJS A;  1F70 A;  2MLF C;  5KTY A;  1MF8 B;  1PSR A;  4Q04 A;  4CFR A;  4XJK B;  1SR6 B;  1DJY A;  3NHI A;  5HKW A;  3D76 A;  2VRG A;  2D8N A;  4MLW A;  4DIR A;  4MSP A;  3GK4 X;  1QIV A;  1NX3 A;  5I2O A;  1YR5 A;  1LKJ A;  3EKH A;  1RTP 1;  2EHB A;  4DUQ A;  3DF0 A;  4MEW A;  4NDD A;  4QJ5 B;  2O5G A;  3DYE A;  1FBV A;  1DF0 A;  1XFW O;  3FIA A;  2OTG C;  1DEL A;  4NDC A;  3O6B A;  1SW8 A;  5CSI A;  2KI6 D;  4AQI A;  2OTG B;  4HRG A;  2RGI A;  5FI6 A;  2JNX A;  3CZ1 A;  4FTG A;  4OZD A;  2M9G A;  1CM1 A;  2JU0 A;  2WCE A;  3C1V A;  2WCF A;  3L4A A;  5HLV A;  1TUJ A;  3S0F A;  3DVJ A;  1GM0 A;  1UHJ A;  1H8B A;  1UUR A;  1K93 D;  2JZI A;  4MRX A;  5TNC A;  1OW4 A;  1ALW A;  4XJK A;  1PVB A;  1LA0 A;  1ZAC A;  1LXF C;  3LLE A;  1YRU B;  4MRY A;  4DRW A;  3DVK A;  1NX1 A;  2KGR A;  1PAL A;  1B1G A;  3GK1 A;  2PSR A;  2MHH A;  2LUX A;  4CID A;  1S6J A;  1ODB A;  1JC2 A;  1WLZ A;  2JXL A;  3EVV A;  4C0L A;  1XFX O;  3OX6 A;  3DXL A;  1CNP A;  1FPW A;  3AAK A;  1BOC A;  2LLS A;  4YRU A;  1GGW A;  2I2R E;  4F0Z B;  4MZL A;  2KSP A;  2KBM A;  2KDH A;  1KFX L;  1WRL A;  3ICB A;  1NCY A;  3PM2 A;  2WCM A;  1AUI B;  1JFJ A;  3S0A A;  2GV5 A;  4PAL A;  2BEC A;  2LM5 A;  3AAJ A;  1DJW A;  1IWQ A;  1LIN A;  3HX4 A;  2F3Y A;  4GBA A;  5DKQ A;  1TCO B;  4PHM A;  1CDP A;  1BU3 A;  4ZCU A;  1PK0 D;  1YTZ C;  1X02 A;  2LAP A;  1XFZ O;  1QX7 A;  2Y1M A;  3LL8 B;  2BBM A;  2QEB A;  4AQJ A;  1U5I B;  1IKU A;  2KGB C;  4WQ2 A;  1KWO B;  1F71 A;  1ZUZ A;  2LNK A;  3DD4 A;  1J7Q A;  1KFU S;  3AKA A;  4XYN A;  3PAT A;  1QJT A;  1S3P A;  3L47 A;  1J1E A;  1AVS A;  1TNX A;  3N7H A;  3OX5 A;  1XFV O;  2B1U A;  3O2P A;  4MZJ A;  2AMI A;  4YI9 A;  3QRX A;  5HLO A;  5AFP A;  1YX8 A;  1BG1 A;  3K1E A;  4D1E A;  1NSH A;  1IJ5 A;  3SIA A;  1J7P A;  4GPL B;  1YX7 A;  2LUC A;  4QJ3 B;  1K8U A;  1J7O A;  2M49 B;  4ORC B;  1PVA A;  2LLT A;  2H61 C;  2KYC A;  2ZRT A;  3BQ3 A;  1M63 B;  2KAY A;  3VRN A;  2LMV A;  2ISD A;  1IIO A;  2FJU B;  1IRJ A;  2WCL A;  3BXK A;  3CYZ A;  2Q4U A;  1TNW A;  1EL4 A;  3VRP A;  2M7N A;  1XFU O;  1F8H A;  1W7J B;  1N65 A;  4GAO A;  4BY5 A;  1R6P A;  2GGZ A;  1QIW A;  3KHE A;  4MZK A;  2MBX A;  1PUL A;  2LC5 A;  1YUS A;  3WHU B;  3BFA A;  1C07 A;  2M1U A;  3UO9 A;  1QX5 B;  3CR5 X;  1A2X A;  1M46 A;  3VB1 A;  5CSJ A;  2NZ0 A;  1KQV A;  1SK6 D;  1GGZ A;  1QVI Z;  3OB2 B;  1K9U A;  2FCD A;  5CPV A;  1MQ1 A;  3O4X A;  1HQV A;  1KSM A;  1QAT A;  3R1V A;  2HQ8 A;  2JNF A;  4A4B A;  1Y1A A;  2G9B A;  2KI4 C;  3SG4 A;  5AAN A;  1WDC C;  1E8A A;  1LA3 A;  1OOH A;  1P28 A;  2KI4 B;  2H61 A;  1WDC B;  4FQO A;  1FI5 A;  1XK4 C;  1D1O A;  2BE6 A;  2WCJ A;  3CAB A;  1TWO A;  1CDM A;  1CDL A;  1A29 A;  1TNQ A;  3OGN A;  4PE7 A;  4U8D A;  4DCK A;  3KO0 A;  1K9P A;  1MR8 A;  2JXC A;  2HET A;  1YUT A;  1J7R A;  4PCW A;  1B7T Z;  1DMO A;  3EK7 A;  1NX2 A;  4YGA A;  4HSZ A;  2JC2 A;  3VRO A;  5D3O A;  4YGD B;  1NCX A;  3CZT X;  5DIC A;  2KFF A;  4ZCV A;  1MUX A;  5I2L A;  1SL9 A;  1BOD A;  5BPJ A;  2HF5 A;  3FE9 A;  4A4C A;  3Q8I A;  3H4S E;  2QEV A;  4ORB B;  5DKN A;  3SIB A;  4PHK A;  3IQO A;  3RM1 A;  1DJZ A;  3EG5 B;  3CZ0 A;  1DEK A;  2KQY A;  4GNK B;  3EKJ A;  5IBW A;  1DGV A;  3JVT C;  1CLL A;  1CMG A;  5FYX A;  2TN4 A;  1TOP A;  2KOT A;  1L2O C;  3JVT B;  2LV7 A;  3NXA A;  3ZNI A;  1UHN A;  1KK7 Z;  2LVV A;  2H2K A;  1L2O B;  1OOG A;  1G8I A;  1QLK A;  5AEQ A;  1W9Z A;  1OZO A;  2LHI A;  1S26 D;  1YRT B;  1SRA A;  2KFG A;  1HT9 A;  5AER A;  2M3W A;  4YBH B;  4I5N B;  2ZN8 A;  2K0J A;  2K7C A;  2YGU A;  4OV2 A;  2K8M B;  2JT0 A;  4I5L B;  2JT8 A;  3I5F C;  3I5H B;  2P70 A;  2L98 A;  2PAL A;  1CFC A;  2I94 A;  2M7L A;  1QAS A;  3B86 A;  1TIZ A;  2IS9 A;  1OE9 B;  2F2P A;  1EXR A;  3I5F B;  3TDZ A;  1AJ4 A;  1SYM A;  3SS5 A;  1NPQ A;  2BCX A;  1NX0 A;  3KF9 A;  3NSK A;  3SG7 A;  1DT7 B;  2F33 A;  4N1G A;  5JJG A;  1RWY A;  2JT3 A;  1CDN A;  4AOM A;  1JBA A;  3VRR A;  1NP8 A;  4TNC A;  2PQL A;  2CBL A;  3S0G A;  1UWO A;  3D77 A;  1CLB A;  2P6B B;  4GFT A;  1QX2 A;  5AXI A;  2WCB A;  2L5X B;  2Y4Q A;  2LCP A;  2M97 A;  1C3Y A;  1Y6W A;  1YVL A;  1SMG A;  1BR4 B;  2LMT A;  4OVN F;  3S0D A;  3M0W A;  1KCY A;  1JF2 A;  1IQ5 A;  4INX A;  2KAV A;  4C0J A;  2K61 A;  5D69 A;  2LHL A;  5I94 A;  1L7Z A;  3TUY C;  1OMV A;  1GQM A;  1VRK A;  1Y0V H;  2K7D A;  2HQW A;  3D75 A;  2KI6 C;  3TUY B;  1KWO C;  3VGO A;  1SCV A;  1XA5 A;  3SG3 A;  4PE1 A;  2PVB A;  2FOT A;  1BF5 A;  3E3R A;  4OCI A;  2BCA A;  1C3Z A;  3OB1 B;  4PE0 A;  2QEO A;  2L2E A;  3PFV A;  4M2O A;  3OBV A;  4CLN A;  4I5K A;  3IQQ A;  5KSZ A;  3AKB A;  1V1G A;  1CB1 A;  3WNX B;  1QWV A;  1EJ3 A;  1YUU A;  2NCO A;  4KYN A;  3D73 A;  4CFQ A;  1C7V A;  1OQP A;  1BT6 A;  2QDI A;  2PRU A;  4QJ4 B;  1FI6 A;  4HRH A;  1MWN A;  1B47 A;  3SS3 A;  2K2F A;  3BYA A;  1YUR A;  5I8N A;  1IG5 A;  1LS8 A;  1CLM A;  1QV1 A;  2WCK A;  1DJH A;  3WHT B;  3WXA A;  3FS7 A;  1RK9 A;  1NUB A;  1MHO A;  1TRF A;  4P5O E;  1AP4 A;  2JUL A;  5CSF A;  3BUM B;  2KHN A;  2SAS A;  1ORG A;  1DGU A;  2CNP A;  2NLN A;  2K7O A;  2L51 A;  1CMF A;  1KFX S;  1U5I A;  1S5G Y;  1YVH A;  2F2O A;  1BR1 B;  2KQ6 A;  2V53 A;  2ZFD A;  3S0E A;  4C0K A;  1J1D A;  2WOS A;  1SNL A;  5CSN A;  5I2Q A;  4F7F A;  3D10 A;  1J55 A;  1SPY A;  2M0R A;  2WCH A;  3SG6 A;  1RFJ A;  1TNP A;  2MA2 A;  1OZS A;  1NWD A;  5KU1 A;  1OOF A;  1SCM C;  1UHI A;  1DQE A;  1UHH A;  2QEH A;  2MJW B;  3BOW B;  3NHT A;  5HL1 A;  3CTN A;  2KFH A;  4ICB A;  4BY4 A;  4GGN A;  1SCM B;  4MVF A;  5JOL A;  5HKY A;  2OPO A;  3B6X A;  3HCM A;  4PE4 A;  2BE4 A;  3V2L A;  4GGF C;  1SKT A;  3MSE B;  3BFB A;  1FW4 A;  2EGD A;  2JPO A;  3PSR A;  4JPZ B;  4ORA B;  1RJV A;  2L2C A;  1M31 A;  4PDZ A;  5FI2 A;  2F8P A;  1DJX A;  1FF1 A;  2BNX A;  1KSO A;  2CT9 A;  2HPS A;  1CFF A;  3DF0 B;  1SBJ A;  2WC8 A;  1SY9 A;  4JQ0 D;  4MN0 A;  1K2H A;  3LK1 A;  1DF0 B;  1S5G Z;  2KLD A;  2L4I A;  1F55 A;  1UHK A;  3QME A;  2BL0 C;  1Z4H A;  3CR2 A;  1Y1U A;  3L4L A;  4PT1 A;  1AJ5 A;  1OSA A;  3I5I C;  2GTE A;  3JTD C;  1CFP A;  1M39 A;  2BL0 B;  2BBN A;  1BJF A;  5HKZ A;  3DZT A;  1DJG A;  3JTD B;  3I5I B;  3BUW B;  2WOR A;  1TN4 A;  1S6I A;  1DC1 A;  3BUO B;  3BOW A;  1WY9 A;  1IGV A;  1T14 A;  4MBE A;  4YI8 A;  5F6T A;  3BJH A;  1A75 B;  1B8L A;  1K95 A;  2F3Z A;  2LVK A;  3LCP C;  3NSL A;  1B4C A;  2LVJ A;  2ZN9 A;  2WND A;  2ERB A;  1V1F A;  2WC6 A;  4M2Q A;  3O78 A;  3CDN A;  4GGF A;  1RRO A;  1SL8 A;  2NCP A;  3VRQ A;  1JF0 A;  2JRF A;  2CXJ A;  2LMU A;  1KQM C;  2NXQ A;  2BCB A;  2O60 A;  3CWG A;  1K94 A;  1XK4 A;  3PAL A;  3SG5 A;  2L0P A;  4ETO A;  3I5H C;  2JTZ A;  3CS1 A;  1KQM B;  2L5Y A;  1QV0 A;  4P2Y B;  1QLS A;  1ZMZ A;  2I18 A;  3PN7 C;  5GQQ C;  2LVI A;  3A4U B;  1S6C A;  2R2I A;  2BAP A;  3EK8 A;  3PJI A;  1XVJ A;  1OOI X;  1JUO A;  2LP3 A;  3PN7 B;  3TS5 C;  4USL A;  1IH0 A;  1CFD A;  5J3X A;  2K7B A;  2PYQ A;  1EG4 A;  1XYD A;  3TS5 B;  3F45 A;  1B8R A;  4NQG A;  3B88 A;  5ER5 A;  1JSA A;  1WRK A;  3NSI A;  3S0B A;  2KBI A;  3SG2 A;  1KFU L;  1CM4 A;  1BLQ A;  1EH2 A;  3EVR A;  1A75 A;  1UUS A;  2FJY A;  2MLE C;  1ALV A;  3BUX B;  3CZ2 A;  3DVM A;  3O4Y A;  5G08 A;  4YGB B;  2JQ6 A;  4GUK A;  2JOJ A;  2ZND A;  5PAL A;  1CKK A;  2FCE A;  2PMY A;  2M8U A;  2MAZ A;  2E6W A;  2KYF A;  3GOF A;  3RZS A;  2Y1N A;  1MXE A;  2KAX A;  1A03 A;  1QTX A;  4R1E A;  1F4Q A;  1S36 A;  2MRD A;  1W7I B;  4YGE B;  3CGA A;  4CPV A;  2Q91 A;  1G33 A;  3R72 A;  4FQT A;  2ZRS A;  1TUZ A;  1ZOT B;  1ZFS A;  3IVT A;  3FWC A;  1OOJ A;  3KEV A;  2JWW A;  4PHJ A;  4IJ7 A;  1S1E A;  3D78 A;  2COL B;  3I5G C;  3DVE A;  2KPH A;  1IJ6 A;  1SSE B;  3CR4 X;  1Z2C B;  1R2U A;  3NSO A;  4OR9 B;  2QPT A;  3R1O A;  3I5G B;  1K90 D;  4E68 A;  1B9A A;  1UP5 A;  2KLE A;  3ZWH A;  2I7A A;  4L9M A;  3CLN A;  1PRW A;  3IF7 A;  2SCP A;  3FE6 A;  1BMO A;  1F4O A;  1PSB A;  2BKI B;  1DVI A;  3FE8 A;  3B87 A;  2K2A A;  4WRI A;  1OMD A;  3PLF B;  1Q80 A;  1SL7 A;  4WQ3 A;  1NIW A;  5DKR A;  1QVI Y;  2Y5I A;  2EC6 C;  2M29 A;  5EL2 A;  1LVC D;  1N2D A;  3A8R A;  5B8I B;  1WLM A;  1N0Y A;  3PM8 A;  2E30 A;  1XFY O;  1K9K A;  1G4Y R;  2EC6 B;  4YGC B;  3UNW A;  3FWB A;  2H8V A;  3TDI A;  1IQ3 A;  2JTT A;  2OS8 C;  1CTR A;  3KPX A;  1EG3 A;  4NDB A;  2PAS A;  4JD9 A;  2CCM A;  4M2P A;  3EK4 A;  4INW A;  4I5J A;  2OS8 B;  1Y1X A;  4N5X A;  3RLZ A;  4JKT A;  3B7A A;  1K96 A;  3TDU A;  5FI7 A;  3SS4 A;  3DY9 A; 
#chains in the Genus database with same CATH homology
 3D0Y B;  4UPG A;  2L50 A;  1AK8 A;  1B8C A;  1M45 A;  2ZKM X;  4HRE E;  1B7T Y;  2ZNE A;  2A4J A;  5ER4 X;  1DJI A;  1F54 A;  1AHR A;  1A4P A;  1TTX A;  1WRZ A;  4N1F A;  1NCZ A;  2LP2 A;  3EVU A;  2LE9 B;  2LAN A;  1NYA A;  1REC A;  4DS7 A;  2CTN A;  1MXL C;  1H4B A;  1JFK A;  5D7F A;  1DTL A;  5K89 A;  1OMR A;  1KK8 C;  1GJY A;  1JWD A;  4OKH A;  2LLU A;  2AAO A;  4JWQ A;  1KK8 B;  1KK7 Y;  1XO5 A;  2G2B A;  4PHN A;  1TCF A;  2JPT A;  2L4H A;  2AUC A;  2BKH B;  2KNE A;  2M1K B;  4IL1 A;  1C7W A;  1QXP A;  3BUN B;  3LK0 A;  3TZ1 A;  3D0Y A;  3K21 A;  1QS7 A;  2DOQ A;  2GGM A;  2QAC A;  3GK2 A;  5HYD A;  1SR6 C;  3OP0 A;  3OHM B;  3SJS A;  1F70 A;  2MLF C;  5KTY A;  1MF8 B;  1PSR A;  4Q04 A;  4CFR A;  4XJK B;  1SR6 B;  1DJY A;  5HKW A;  4DIR A;  2VRG A;  2D8N A;  4MLW A;  4MSP A;  3GK4 X;  1QIV A;  1NX3 A;  5I2O A;  1YR5 A;  1LKJ A;  3EKH A;  1RTP 1;  2EHB A;  4DUQ A;  3DF0 A;  4MEW A;  4NDD A;  4QJ5 B;  2O5G A;  1FBV A;  1DF0 A;  1XFW O;  3FIA A;  2OTG C;  4NDC A;  3O6B A;  1SW8 A;  5CSI A;  2KI6 D;  4AQI A;  2OTG B;  4HRG A;  2RGI A;  2JNX A;  4FTG A;  2M9G A;  1CM1 A;  2JU0 A;  2WCE A;  3C1V A;  2WCF A;  5HLV A;  3DVJ A;  1UHJ A;  1H8B A;  1UUR A;  1K93 D;  2JZI A;  4MRX A;  5TNC A;  1ALW A;  4XJK A;  1PVB A;  1LA0 A;  1ZAC A;  1LXF C;  3LLE A;  1YRU B;  4MRY A;  4DRW A;  3DVK A;  1NX1 A;  2KGR A;  1PAL A;  1B1G A;  3GK1 A;  2PSR A;  2MHH A;  2LUX A;  4CID A;  1S6J A;  1ODB A;  1JC2 A;  1WLZ A;  2JXL A;  3EVV A;  4C0L A;  1XFX O;  3OX6 A;  1CNP A;  1FPW A;  3AAK A;  1BOC A;  2LLS A;  4YRU A;  1GGW A;  2I2R E;  4F0Z B;  4MZL A;  2KSP A;  2KBM A;  2KDH A;  1KFX L;  1WRL A;  3ICB A;  1NCY A;  1AUI B;  1JFJ A;  2GV5 A;  4PAL A;  2BEC A;  2LM5 A;  3AAJ A;  1DJW A;  1IWQ A;  1LIN A;  3HX4 A;  2F3Y A;  4GBA A;  5DKQ A;  1TCO B;  4PHM A;  1CDP A;  1BU3 A;  4ZCU A;  1PK0 D;  1YTZ C;  1X02 A;  2LAP A;  1XFZ O;  1QX7 A;  2Y1M A;  3LL8 B;  2BBM A;  4AQJ A;  1U5I B;  1IKU A;  2KGB C;  4WQ2 A;  1KWO B;  1F71 A;  1ZUZ A;  2LNK A;  3DD4 A;  1J7Q A;  1KFU S;  3AKA A;  4XYN A;  3PAT A;  1QJT A;  1S3P A;  1J1E A;  1AVS A;  1TNX A;  3OX5 A;  1XFV O;  2B1U A;  3O2P A;  4MZJ A;  2AMI A;  4YI9 A;  3QRX A;  5HLO A;  5AFP A;  1YX8 A;  1BG1 A;  4D1E A;  1NSH A;  1IJ5 A;  3SIA A;  1J7P A;  4GPL B;  1YX7 A;  2LUC A;  4QJ3 B;  1K8U A;  1J7O A;  2M49 B;  4ORC B;  1PVA A;  2LLT A;  2H61 C;  2KYC A;  2ZRT A;  3BQ3 A;  1M63 B;  2KAY A;  3VRN A;  2LMV A;  2ISD A;  2FJU B;  1IRJ A;  3BXK A;  2Q4U A;  1TNW A;  1EL4 A;  3VRP A;  2M7N A;  1XFU O;  1F8H A;  1W7J B;  1N65 A;  4GAO A;  4BY5 A;  1R6P A;  2GGZ A;  1QIW A;  3KHE A;  4MZK A;  2MBX A;  1PUL A;  2LC5 A;  1YUS A;  3WHU B;  1C07 A;  2M1U A;  1QX5 B;  3CR5 X;  1A2X A;  1M46 A;  5CSJ A;  2NZ0 A;  1KQV A;  1SK6 D;  1GGZ A;  1QVI Z;  3OB2 B;  1K9U A;  2FCD A;  5CPV A;  1MQ1 A;  1HQV A;  1KSM A;  1QAT A;  2HQ8 A;  2JNF A;  4A4B A;  1Y1A A;  2G9B A;  2KI4 C;  3SG4 A;  5AAN A;  1WDC C;  1E8A A;  1LA3 A;  2KI4 B;  2H61 A;  1WDC B;  4FQO A;  1FI5 A;  1XK4 C;  1D1O A;  2BE6 A;  1CDM A;  1CDL A;  1A29 A;  1TNQ A;  4PE7 A;  4U8D A;  4DCK A;  3KO0 A;  1K9P A;  1MR8 A;  2JXC A;  2HET A;  1YUT A;  1J7R A;  4PCW A;  1B7T Z;  1DMO A;  3EK7 A;  1NX2 A;  4YGA A;  4HSZ A;  2JC2 A;  3VRO A;  4YGD B;  1NCX A;  3CZT X;  2KFF A;  4ZCV A;  1MUX A;  5I2L A;  1SL9 A;  1BOD A;  5BPJ A;  2HF5 A;  4A4C A;  3H4S E;  4ORB B;  5DKN A;  3SIB A;  4PHK A;  3IQO A;  3RM1 A;  1DJZ A;  4GNK B;  2KQY A;  3EKJ A;  5IBW A;  1DGV A;  3JVT C;  1CLL A;  1CMG A;  5FYX A;  2TN4 A;  1TOP A;  2KOT A;  1L2O C;  3JVT B;  2LV7 A;  3NXA A;  3ZNI A;  1UHN A;  1KK7 Z;  2LVV A;  2H2K A;  1L2O B;  1G8I A;  1QLK A;  5AEQ A;  1OZO A;  2LHI A;  1S26 D;  1YRT B;  1SRA A;  2KFG A;  1HT9 A;  5AER A;  2M3W A;  4YBH B;  4I5N B;  2ZN8 A;  2K0J A;  2K7C A;  4OV2 A;  2K8M B;  2JT0 A;  4I5L B;  2JT8 A;  3I5F C;  3I5H B;  2L98 A;  2PAL A;  1CFC A;  2I94 A;  2M7L A;  1QAS A;  1F55 A;  1TIZ A;  2IS9 A;  1OE9 B;  2F2P A;  1EXR A;  3I5F B;  3TDZ A;  1AJ4 A;  1SYM A;  1NPQ A;  2BCX A;  1NX0 A;  3KF9 A;  3NSK A;  3SG7 A;  1DT7 B;  2F33 A;  4N1G A;  5JJG A;  1RWY A;  2JT3 A;  1CDN A;  4AOM A;  1JBA A;  3VRR A;  1NP8 A;  4TNC A;  2CBL A;  1UWO A;  1CLB A;  2P6B B;  4GFT A;  1QX2 A;  5AXI A;  2WCB A;  2L5X B;  2Y4Q A;  2LCP A;  2M97 A;  1Y6W A;  1YVL A;  1SMG A;  1BR4 B;  2LMT A;  4OVN F;  3M0W A;  1KCY A;  1JF2 A;  1IQ5 A;  2KAV A;  4C0J A;  2K61 A;  5D69 A;  2LHL A;  1L7Z A;  3TUY C;  1OMV A;  1GQM A;  1VRK A;  1Y0V H;  2K7D A;  2HQW A;  2KI6 C;  3TUY B;  1KWO C;  3VGO A;  1SCV A;  1XA5 A;  3SG3 A;  4PE1 A;  2PVB A;  2FOT A;  1BF5 A;  3E3R A;  4OCI A;  2BCA A;  3OB1 B;  4PE0 A;  4M2O A;  2L2E A;  3PFV A;  4CLN A;  4I5K A;  3IQQ A;  5KSZ A;  3AKB A;  1V1G A;  1CB1 A;  3WNX B;  1EJ3 A;  1YUU A;  2NCO A;  4CFQ A;  1C7V A;  1OQP A;  1BT6 A;  2PRU A;  4QJ4 B;  1FI6 A;  4HRH A;  1MWN A;  1B47 A;  2K2F A;  3BYA A;  1YUR A;  5I8N A;  1IG5 A;  1CLM A;  1QV1 A;  3WHT B;  1DJH A;  3WXA A;  3FS7 A;  1RK9 A;  1NUB A;  1MHO A;  1TRF A;  4P5O E;  1AP4 A;  2JUL A;  5CSF A;  3BUM B;  2KHN A;  2SAS A;  1DGU A;  2CNP A;  2NLN A;  2K7O A;  2L51 A;  1CMF A;  1KFX S;  1U5I A;  1S5G Y;  1YVH A;  2F2O A;  1BR1 B;  2KQ6 A;  2V53 A;  2ZFD A;  4C0K A;  1J1D A;  2WOS A;  1SNL A;  5CSN A;  5I2Q A;  3D10 A;  1J55 A;  1SPY A;  2M0R A;  3SG6 A;  1RFJ A;  1TNP A;  2MA2 A;  1OZS A;  1NWD A;  5KU1 A;  1SCM C;  1UHI A;  1UHH A;  2MJW B;  3BOW B;  3CTN A;  2KFH A;  4ICB A;  4BY4 A;  4GGN A;  1SCM B;  4MVF A;  5JOL A;  5HKY A;  2OPO A;  3HCM A;  4PE4 A;  2BE4 A;  4GGF C;  1SKT A;  3MSE B;  4JPZ B;  1FW4 A;  2EGD A;  3PSR A;  4ORA B;  1RJV A;  1M31 A;  4PDZ A;  1FF1 A;  2F8P A;  1DJX A;  1KSO A;  2CT9 A;  2HPS A;  1CFF A;  3DF0 B;  1SBJ A;  2WC8 A;  1SY9 A;  4JQ0 D;  4MN0 A;  1K2H A;  3LK1 A;  1DF0 B;  1S5G Z;  2L4I A;  1UHK A;  2BL0 C;  3CR2 A;  1Y1U A;  1AJ5 A;  1OSA A;  3I5I C;  3JTD C;  1CFP A;  1M39 A;  2BL0 B;  2BBN A;  1BJF A;  5HKZ A;  1DJG A;  3JTD B;  3I5I B;  3BUW B;  2WOR A;  1TN4 A;  1S6I A;  3BUO B;  3BOW A;  1WY9 A;  1IGV A;  4MBE A;  4YI8 A;  5F6T A;  1A75 B;  1B8L A;  1K95 A;  2F3Z A;  2LVK A;  3LCP C;  3NSL A;  1B4C A;  2LVJ A;  2ZN9 A;  2WND A;  1V1F A;  4M2Q A;  3O78 A;  4GGF A;  1RRO A;  1SL8 A;  2NCP A;  3VRQ A;  1JF0 A;  2JRF A;  2CXJ A;  2LMU A;  1KQM C;  2NXQ A;  2BCB A;  2O60 A;  3CWG A;  1K94 A;  1XK4 A;  3PAL A;  3SG5 A;  2L0P A;  4ETO A;  3I5H C;  2JTZ A;  3CS1 A;  1KQM B;  1QV0 A;  4P2Y B;  1QLS A;  1ZMZ A;  2I18 A;  3PN7 C;  5GQQ C;  2LVI A;  3A4U B;  1S6C A;  2R2I A;  3EK8 A;  1XVJ A;  2LP3 A;  1JUO A;  3PN7 B;  3TS5 C;  1IH0 A;  4USL A;  1CFD A;  5J3X A;  2K7B A;  1EG4 A;  1XYD A;  3TS5 B;  3F45 A;  1B8R A;  4NQG A;  5ER5 A;  1JSA A;  1WRK A;  3NSI A;  2KBI A;  3SG2 A;  1KFU L;  1CM4 A;  1BLQ A;  1EH2 A;  3EVR A;  1A75 A;  1UUS A;  2MLE C;  1ALV A;  3BUX B;  3DVM A;  3O4Y A;  5G08 A;  4YGB B;  2JQ6 A;  4GUK A;  2JOJ A;  2ZND A;  5PAL A;  1CKK A;  2FCE A;  2PMY A;  2M8U A;  2MAZ A;  2E6W A;  2KYF A;  3GOF A;  2Y1N A;  1MXE A;  2KAX A;  1A03 A;  1QTX A;  4R1E A;  1F4Q A;  1S36 A;  2MRD A;  1W7I B;  4YGE B;  3CGA A;  4CPV A;  2Q91 A;  1G33 A;  2ZRS A;  1ZOT B;  1ZFS A;  3FWC A;  1OOJ A;  3KEV A;  2JWW A;  4PHJ A;  1S1E A;  2COL B;  3I5G C;  3DVE A;  3CR4 X;  1IJ6 A;  3NSO A;  1R2U A;  4OR9 B;  2QPT A;  3I5G B;  1K90 D;  4E68 A;  1B9A A;  1UP5 A;  3ZWH A;  2I7A A;  4L9M A;  3CLN A;  1PRW A;  3IF7 A;  2SCP A;  1BMO A;  1F4O A;  1PSB A;  2BKI B;  1DVI A;  2K2A A;  4WRI A;  1OMD A;  3PLF B;  1Q80 A;  1SL7 A;  4WQ3 A;  1NIW A;  5DKR A;  1QVI Y;  2Y5I A;  2EC6 C;  2M29 A;  1LVC D;  1N2D A;  3A8R A;  5B8I B;  1WLM A;  1N0Y A;  3PM8 A;  2E30 A;  1XFY O;  1K9K A;  1G4Y R;  2EC6 B;  4YGC B;  3FWB A;  3TDI A;  1IQ3 A;  2JTT A;  2OS8 C;  1CTR A;  3KPX A;  1EG3 A;  4NDB A;  2PAS A;  4M2P A;  2CCM A;  3EK4 A;  4N5X A;  4I5J A;  2OS8 B;  1Y1X A;  3RLZ A;  1K96 A;  3TDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...