2KI6D

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
97
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 26
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6D00
1LINA 2F33A 1BJFA 2ISDA 1OZSA 3JTDB 5F6TA 2HETA 4PHJA 2K7BA 3VRRA 1DF0B 3CR2A 1L2OC 4WRIA 3NSLA 3CGAA 3EKJA 1DTLA 1TNWA 3EVRA 1OOJA 4A4BA 1KWOB 1XFYO 5KTYA 3I5HB 1RROA 1QVIY 2LUXA 4JPZB 4C0KA 4E68A 2GGMA 2KOTA 2MBXA 1ODBA 1CFFA 1M63B 4N5XA 1LKJA 3MSEB 2NLNA 4I5KA 5JJGA 1SCVA 1YURA 5KSZA 1R2UA 1CMGA 1WLZA 5HLOA 2BL0C 3KF9A 1W7IB 4PHNA 2QPTA 1DJZA 3K21A 2M97A 1GQMA 4YRUA 1G8IA 2MA2A 2R2IA 5AANA 1FI6A 2LMUA 2M8UA 1RFJA 4M2OA 1KK8C 2FOTA 2JC2A 1SMGA 2WNDA 3CS1A 3FIAA 1TOPA 1YRTB 2GV5A 4CPVA 1OMVA 3OX6A 3ZWHA 2I2RE 5HYDA 1A2XA 1MHOA 1IG5A 2JPTA 2CNPA 2E6WA 4OR9B 2NXQA 2KAYA 1QV0A 2KQ6A 1UHNA 1ZUZA 2ZRTA 1GGWA 1JBAA 2LNKA 1S26D 1B8CA 2JU0A 3LK0A 1XFZO 1QVIZ 3LLEA 1DT7B 1LA0A 1Y0VH 2HPSA 1YVHA 1XFVO 3NXAA 1KFXL 3KPXA 4JWQA 3BOWB 1MUXA 5CSFA 3TUYC 2ZNDA 1S3PA 3D10A 1OZOA 1S5GZ 1CNPA 1KQMC 1SR6C 2JWWA 4GGFA 1SRAA 3CLNA 1QLKA 2LP2A 1GGZA 1QS7A 2F2PA 2M1UA 5G08A 4USLA 1SK6D 1X02A 2KI4B 1AJ4A 1OQPA 2JOJA 4CFRA 2F3ZA 2L2EA 1F8HA 2O60A 3IQOA 4MN0A 3SIAA 2V53A 5GQQC 1F54A 3I5FB 1M39A 2LLUA 2JT8A 4HRHA 1J7QA 2WCFA 1QX7A 1BLQA 3OP0A 4DIRA 1EL4A 2LVIA 1C7WA 5IBWA 2KNEA 3BUWB 3AKBA 1K96A 3A4UB 2EHBA 4N1GA 5HKZA 4NDBA 2I94A 2F2OA 1PSRA 5PALA 4WQ2A 1TIZA 1AJ5A 2OS8B 1DJGA 3EK8A 1J7OA 2JNFA 2LV7A 2CT9A 2MAZA 1SCMB 1SPYA 4PE1A 1QLSA 2WOSA 5B8IB 1MR8A 1BT6A 4MVFA 1CDNA 2LLSA 3DVEA 2FJUB 1CDMA 3CZTX 3CTNA 1M46A 3D0YB 4ZCUA 2M3WA 1S6IA 2BBNA 1RWYA 2DOQA 2K7DA 2OTGB 3VROA 3EKHA 4GUKA 2KGRA 2L51A 4JQ0D 1CTRA 2KI6C 5K89A 1XVJA 2K0JA 4D1EA 4GGFC 3LK1A 1PALA 2OPOA 4MBEA 4QJ4B 1K93D 1SKTA 2B1UA 4MRXA 4P5OE 1YUUA 2LC5A 2MLFC 3E3RA 3I5GB 4GPLB 1K8UA 4P2YB 4PHMA 3TS5C 1XFUO 3JVTB 2LMVA 3QRXA 1KQVA 4PALA 4AOMA 1A29A 1NIWA 2FCDA 4HREE 1CM1A 2L98A 1VRKA 2HQWA 1QX2A 2M49B 3I5IC 4OKHA 3OB2B 2LVKA 2QACA 1K95A 1SL8A 4M2QA 4YGBB 3PALA 4U8DA 4GGNA 1V1GA 3O4YA 2EC6B 2KDHA 3AKAA 4I5NB 3GK1A 1KFXS 3VRPA 4A4CA 1EH2A 1XYDA 3GK2A 1B4CA 3ZNIA 4C0LA 3EVUA 1MQ1A 1U5IA 1A03A 2Q91A 3CR4X 3PSRA 4HRGA 3RLZA 2L0PA 3SG2A 1QV1A 3H4SE 2O5GA 1B7TY 3TDUA 1GJYA 1SL7A 1Y1XA 2PVBA 4YBHB 3WHUB 5AERA 1IQ5A 2BECA 3JTDC 5TNCA 3HCMA 4OCIA 5D69A 2KYCA 2CTNA 1AUIB 5BPJA 2L4IA 2PMYA 1PVAA 4ICBA 1CMFA 1UWOA 2JULA 1XK4A 1EXRA 1DJHA 1KWOC 2BL0B 2LHIA 5AFPA 3I5HC 1TCFA 4PHKA 1IQ3A 3LL8B 3SG5A 2G2BA 3IQQA 1PRWA 2LVJA 1YUTA 2MJWB 2KFFA 1A75B 2M7LA 1R6PA 3SG7A 1CDPA 1DGVA 4MLWA 1BR4B 4NDCA 1NX3A 2K8MB 1KFUS 3DVKA 3O78A 3WXAA 2WC8A 5JOLA 4M2PA 1NUBA 4FTGA 4YGCB 5I2OA 1CB1A 2NCPA 2BKIB 2LCPA 1B9AA 4PCWA 1LA3A 1AK8A 2KBIA 1NX2A 5D7FA 4XJKB 3O2PA 1YVLA 1NCYA 2NZ0A 3SG6A 1FBVA 2MHHA 4GAOA 1E8AA 1S6JA 2ZNEA 5CPVA 3SIBA 1FF1A 2WORA 1UHIA 1FPWA 2JTTA 2LVVA 1F70A 1DGUA 4I5JA 1EJ3A 2KI6D 4MRYA 1SYMA 1WDCB 1JUOA 5HLVA 2Y1MA 3C1VA 5AXIA 4CLNA 2CXJA 2Y5IA 1J55A 5KU1A 1F4QA 4ETOA 1SR6B 5I8NA 1QTXA 3GK4X 1BF5A 1KCYA 2Y1NA 1JF0A 1TCOB 1ZFSA 3BUXB 3F45A 2LLTA 2K61A 2A4JA 2HQ8A 1QASA 1DVIA 2P6BB 3BUNB 1C07A 1LVCD 3CR5X 2JQ6A 2Q4UA 1NCZA 1CLLA 1XFWO 1YX8A 3LCPC 3SG3A 1UHHA 1H8BA 1IH0A 4AQJA 1KSMA 1XK4C 1OE9B 1XO5A 1N0YA 2BE6A 4WQ3A 4MZJA 2KAXA 3PN7B 2CCMA 5CSJA 5ER4X 3DF0B 4I5LB 1MXEA 1CFDA 1IJ6A 1B1GA 2KI4C 4TNCA 3TZ1A 2PASA 1NCXA 4BY4A 1B47A 2KFHA 1QIWA 1Y6WA 3GOFA 3I5FC 1HQVA 2AUCA 2FCEA 1YTZC 1K9UA 1G4YR 4PE4A 4DS7A 4GNKB 2L50A 1K9KA 1BR1B 3SG4A 1DF0A 2JRFA 1N65A 3OX5A 2G9BA 1AHRA 1TNQA 3PATA 1CLBA 1K90D 2K7OA 2PSRA 3O6BA 1JFJA 4L9MA 3VGOA 1UURA 2BCAA 4PDZA 4PE7A 1V1FA 1M45A 2OS8C 3M0WA 3BXKA 1LXFC 1SNLA 1SCMC 3KEVA 1RJVA 2H61A 1W7JB 4YGAA 3HX4A 3SJSA 2M29A 5DKQA 4C0JA 2OTGC 1JFKA 1AP4A 5HKYA 1NX0A 5I2QA 1OMRA 1OMDA 2LP3A 4Q04A 2AAOA 1ALWA 2H2KA 1A75A 1WLMA 1ZACA 3I5GC 5CSIA 1IGVA 1WRKA 2LHLA 1K9PA 3JVTC 1BODA 4HSZA 2M9GA 1DJIA 3OB1B 1K94A 1BOCA 1MWNA 4MZKA 1L2OB 1FW4A 3FWCA 1S36A 1DJWA 2BBMA 1YUSA 2TN4A 1PVBA 3AAJA 4AQIA 1IRJA 4XJKA 1YR5A 3NSOA 3KO0A 2EC6C 1NX1A 2HF5A 1EG4A 4R1EA 4UPGA 2KQYA 2F3YA 4ORCB 1UHKA 3ICBA 1G33A 5ER5A 3BOWA 3OHMB 2ZN9A 4N1FA 3PFVA 2F8PA 2LAPA 3BYAA 1UP5A 2E30A 2ZFDA 1ALVA 1CM4A 2LUCA 1F71A 1KK8B 2I7AA 2Y4QA 5CSNA 2EGDA 1OSAA 2H61C 1B8RA 1Q80A 3BUOB 3AAKA 2CBLA 3BQ3A 1CKKA 2D8NA 1DMOA 2ZKMX 1S5GY 1CDLA 1MF8B 1TNXA 1AVSA 2IS9A 3VRNA 2COLB 2KGBC 1ZMZA 3DF0A 1TTXA 1RK9A 1PK0D 1SBJA 1WRZA 1B7TZ 1QATA 2VRGA 2BCXA 2PALA 3KHEA 1IKUA 3VRQA 2KBMA 2M7NA 5J3XA 1QIVA 3TDIA 1L7ZA 1S1EA 2RGIA 2M1KB 1PSBA 1S6CA 2JT0A 4OV2A 4XYNA 1IJ5A 1B8LA 3TUYB 4YGEB 4YI9A 4QJ5B 1U5IB 1M31A 1QJTA 2NCOA 1KQMB 1YX7A 1JC2A 2M0RA 2BKHB 1F4OA 3WHTB 2KSPA 1RTP1 3A8RA 2L4HA 1DJXA 3CWGA 2KAVA 1F55A 3D0YA 5AEQA 4MZLA 1KK7Y 1MXLC 5I2LA 2LE9B 2AMIA 4NDDA 1YRUB 1XA5A 2JZIA 1EG3A 4GBAA 2MLEC 3PM8A 1WDCC 2KYFA 1CFPA 2JTZA 4CFQA 2JT3A 5DKNA 1NYAA 2GGZA 3RM1A 1NWDA 1SY9A 1JSAA 2JXLA 3DD4A 4FQOA 1H4BA 3DVMA 1CLMA 5HKWA 4NQGA 3FWBA 2JNXA 3TDZA 2SASA 1WRLA 4YI8A 3BUMB 1JF2A 1WY9A 2L5XB 1CFCA 2LM5A 3PN7C 2K7CA 4OVNF 1D1OA 1BMOA 2LMTA 1JWDA 3NSIA 4DCKA 4QJ3B 1TRFA 4CIDA 4DUQA 1J1DA 1IWQA 3NSKA 4ORAB 1BU3A 3EVVA 4PE0A 1KK7Z 2K2FA 4F0ZB 3IF7A 1J1EA 1QX5B 1KFUL 1J7RA 1QXPA 1XFXO 2I18A 3EK4A 2K2AA 5FYXA 1TNPA 1N2DA 2KFGA 1UUSA 3TS5B 1C7VA 3WNXB 3PLFB 4GFTA 3FS7A 1TN4A 1NPQA 1RECA 3I5IB 4MEWA 4DRWA 1SL9A 2WCEA 2PRUA 4ZCVA 2MRDA 2SCPA 4IL1A 4MSPA 1SW8A 2KHNA 1K2HA 2ZN8A 1Y1UA 2BE4A 1DJYA 4BY5A 1A4PA 2WCBA 4ORBB 5DKRA 1PULA 2JXCA 1J7PA 1HT9A 1Y1AA 1KSOA 1UHJA 1NP8A 1NSHA 1FI5A 3EK7A 1ZOTB 1BG1A 2BCBA 3DVJA 2LANA 2ZRSA 4YGDB
chains in the Genus database with same CATH superfamily
1LINA 2F33A 1BJFA 2ISDA 1OZSA 3JTDB 5F6TA 2HETA 4PHJA 2K7BA 3VRRA 1DF0B 5FI2A 3CR2A 1OW4A 1L2OC 4WRIA 3QMEA 3NSLA 3CGAA 3N7HA 3EKJA 1DTLA 1TNWA 3EVRA 1OOJA 3S0GA 4A4BA 1KWOB 1XFYO 3S0DA 5KTYA 3I5HB 1RROA 1QVIY 2LUXA 4JPZB 4C0KA 4E68A 2GGMA 1DQEA 2KOTA 2MBXA 1ODBA 1CFFA 1M63B 4N5XA 1LKJA 3MSEB 2NLNA 4I5KA 5JJGA 1SCVA 1YURA 5KSZA 1R2UA 3D74A 1CMGA 1WLZA 5HLOA 2BL0C 3KF9A 1W7IB 3BFAA 4PHNA 2QPTA 3VB1A 1DJZA 3K21A 2M97A 1GQMA 4YRUA 1G8IA 2MA2A 2R2IA 5AANA 1FI6A 3S0AA 2LMUA 2M8UA 1RFJA 4M2OA 1KK8C 5FI6A 2FOTA 2JC2A 1SMGA 2WNDA 3CS1A 3FIAA 1TOPA 3OBVA 4JKTA 1YRTB 1P28A 2GV5A 4CPVA 1OMVA 3OX6A 3ZWHA 2I2RE 5HYDA 1A2XA 2YGUA 1MHOA 3OGNA 1IG5A 2JPTA 2CNPA 2E6WA 4OR9B 2NXQA 2KAYA 3UNWA 1QV0A 2KQ6A 3CDNA 1IIOA 1UHNA 1ZUZA 2ZRTA 2P70A 1JBAA 1GGWA 2LNKA 1S26D 1B8CA 2JU0A 3LK0A 1XFZO 1QVIZ 3LLEA 1DT7B 1LA0A 1Y0VH 2HPSA 1YVHA 1XFVO 3NXAA 1KFXL 3KPXA 4JWQA 3BOWB 1MUXA 3DY9A 5CSFA 2ZNDA 1S3PA 3D10A 3TUYC 3S0EA 1OZOA 1S5GZ 1CNPA 1KQMC 2K60A 1SR6C 2JWWA 2KLDA 4GGFA 1SRAA 3CLNA 1QLKA 3SS3A 2LP2A 1GGZA 1QS7A 1T14A 2F2PA 2M1UA 5G08A 4USLA 1SK6D 1X02A 2KI4B 1AJ4A 1OQPA 2JOJA 3DXLA 4CFRA 2F3ZA 2L2EA 1F8HA 2O60A 2WC5A 3IQOA 4MN0A 1TWOA 3SIAA 2V53A 5GQQC 1F54A 3I5FB 1M39A 3DZTA 2LLUA 2JT8A 3V2LA 4HRHA 3FE9A 2WCFA 1J7QA 1QX7A 1BLQA 3OP0A 4DIRA 1EL4A 2LVIA 1C7WA 5IBWA 2KNEA 3BUWB 5HL1A 2P71A 3B7AA 2QDIA 3AKBA 4JD9A 1K96A 3A4UB 2EHBA 4N1GA 5HKZA 1W9ZA 4NDBA 2I94A 2QEOA 2F2OA 1PSRA 5PALA 4WQ2A 1TIZA 1AJ5A 2OS8B 1DJGA 3EK8A 1J7OA 2JNFA 2LV7A 2CT9A 2MAZA 1SCMB 1SPYA 4PE1A 1QLSA 2WOSA 5B8IB 1MR8A 1BT6A 4MVFA 1CDNA 3D75A 2LLSA 3DVEA 2FJUB 1CDMA 3CZTX 1OOIX 3CTNA 1M46A 3D0YB 4ZCUA 1TUZA 1S6IA 2BBNA 1RWYA 2DOQA 2K7DA 2M3WA 2OTGB 3R1PA 3VROA 3EKHA 4GUKA 2KGRA 2L51A 4JQ0D 1CTRA 2KI6C 3CZ2A 5K89A 1XVJA 2K0JA 4D1EA 4GGFC 3EG5B 3LK1A 1PALA 2OPOA 4MBEA 4QJ4B 1K93D 1SKTA 2B1UA 4MRXA 4P5OE 1YUUA 2LC5A 2MLFC 3E3RA 3I5GB 4GPLB 1K8UA 4P2YB 4PHMA 3TS5C 1XFUO 3JVTB 2LMVA 3QRXA 3R72A 4PALA 4AOMA 1A29A 1NIWA 2FCDA 4HREE 1CM1A 2L98A 1VRKA 2HQWA 1QX2A 2M49B 3IVTA 3I5IC 4OKHA 2ERBA 3OB2B 2LVKA 2QACA 1K95A 1SL8A 4M2QA 1OOGA 4YGBB 3PALA 4U8DA 4GGNA 1V1GA 3O4YA 2EC6B 2KDHA 3AKAA 4I5NB 3GK1A 1KFXS 3VRPA 4A4CA 1EH2A 1XYDA 3D78A 3GK2A 1B4CA 3ZNIA 4C0LA 3EVUA 2WCHA 1MQ1A 3B87A 3DYEA 1U5IA 1A03A 2Q91A 3CR4X 3PSRA 1ORGA 4HRGA 2L0PA 3RLZA 3SG2A 3SS4A 1QV1A 3H4SE 2O5GA 1B7TY 1Z2CB 3TDUA 1GJYA 1SL7A 1Y1XA 2PVBA 4YBHB 3WHUB 5AERA 1IQ5A 2BECA 2QEVA 3JTDC 5TNCA 3HCMA 4OCIA 5D69A 2KYCA 3BFBA 2CTNA 1AUIB 3PJIA 5BPJA 2L4IA 5I94A 2PMYA 1PVAA 4ICBA 1GM0A 1CMFA 1UWOA 2JULA 1XK4A 1EXRA 1DJHA 1KWOC 2BL0B 2LHIA 5AFPA 2QEHA 3I5HC 1TCFA 4PHKA 1IQ3A 3LL8B 3SG5A 2G2BA 2WCKA 3IQQA 1PRWA 2LVJA 1YUTA 2MJWB 1DC1A 2KFFA 1A75B 2H8VA 2M7LA 1R6PA 3SG7A 1CDPA 1DGVA 4MLWA 1BR4B 4NDCA 1NX3A 2K8MB 1KFUS 3DVKA 3O78A 3WXAA 2WC8A 5JOLA 3NGVA 4M2PA 1NUBA 4FTGA 4YGCB 2QEBA 5I2OA 1CB1A 2NCPA 2BKIB 3CABA 2LCPA 1B9AA 4PCWA 3S0BA 1LA3A 1AK8A 2KBIA 1NX2A 5D7FA 4XJKB 3O2PA 1YVLA 1NCYA 2NZ0A 3SG6A 3L47A 1FBVA 2FJYA 2MHHA 1E8AA 1S6JA 2ZNEA 4GAOA 5CPVA 3SIBA 1FF1A 2WORA 1UHIA 1FPWA 2JTTA 2WCLA 2LVVA 1F70A 1DGUA 4I5JA 1EJ3A 2KI6D 4MRYA 1SYMA 1WDCB 3CYZA 1JUOA 5HLVA 2Y1MA 3C1VA 5AXIA 1LS8A 4CLNA 2CXJA 2Y5IA 1J55A 5KU1A 1F4QA 4ETOA 1SR6B 2PYQA 1OOFA 4INWA 1QTXA 2WC6A 3GK4X 5I8NA 1BF5A 2Y1NA 1KCYA 1JF0A 3RZSA 1TCOB 1ZFSA 3BUXB 3F45A 2LLTA 2K61A 2A4JA 2HQ8A 1QASA 1DVIA 2P6BB 3BUNB 1C07A 1LVCD 3CR5X 2JQ6A 2Q4UA 1NCZA 1CLLA 1XFWO 1YX8A 3LCPC 3SG3A 1UHHA 1H8BA 1IH0A 4AQJA 1KSMA 1XK4C 1OE9B 1XO5A 1N0YA 2BE6A 4WQ3A 4MZJA 2KAXA 3PN7B 2CCMA 5CSJA 5ER4X 3DF0B 3FE6A 4I5LB 1MXEA 1CFDA 1DELA 1IJ6A 1B1GA 2KI4C 4TNCA 3Q8IA 3TZ1A 2PASA 1NCXA 3BFHA 4BY4A 1B47A 2KFHA 1QIWA 1Y6WA 3GOFA 3I5FC 1HQVA 2AUCA 2FCEA 1YTZC 1K9UA 1G4YR 4PE4A 4DS7A 4GNKB 2L50A 1K9KA 1BR1B 3SG4A 2GTEA 1DF0A 2JRFA 1N65A 3OX5A 2G9BA 1AHRA 1TNQA 3D73A 3D77A 4F7FA 3PATA 1CLBA 1K90D 2K7OA 2PSRA 3O6BA 1JFJA 3UO9A 4L9MA 3VGOA 1UURA 2BCAA 4PDZA 4PE7A 1KQVA 1V1FA 1M45A 2OS8C 3PM2A 3M0WA 3BXKA 1LXFC 1SNLA 1SCMC 3K1EA 3KEVA 1RJVA 2H61A 1W7JB 4YGAA 3HX4A 3SJSA 2M29A 5DKQA 4C0JA 2OTGC 1JFKA 1AP4A 5HKYA 1NX0A 5I2QA 1Z4HA 4INXA 1OMRA 1OMDA 2LP3A 4Q04A 2AAOA 1ALWA 2H2KA 1A75A 1DEKA 1WLMA 3CZ1A 1ZACA 3I5GC 5CSIA 1IGVA 1WRKA 2LHLA 1K9PA 3JVTC 1BODA 4HSZA 2M9GA 1DJIA 3OB1B 1K94A 1BOCA 1MWNA 4MZKA 1L2OB 3O4XA 1FW4A 3FWCA 1S36A 2KPHA 1DJWA 2BBMA 1YUSA 2TN4A 1PVBA 3AAJA 4AQIA 1IRJA 4XJKA 1YR5A 3NSOA 3KO0A 4OZDA 2EC6C 5D3OA 1NX1A 2HF5A 1EG4A 4R1EA 4UPGA 2KQYA 2F3YA 4ORCB 1UHKA 3ICBA 1G33A 5ER5A 3BOWA 3OHMB 2ZN9A 4N1FA 1C3ZA 3PFVA 2F8PA 2LAPA 3BYAA 1UP5A 3B86A 2E30A 2ZFDA 1ALVA 1CM4A 2LUCA 1F71A 1KK8B 3B6XA 2I7AA 2Y4QA 5CSNA 2EGDA 1OSAA 2H61C 1B8RA 1Q80A 3BUOB 3AAKA 2CBLA 3BQ3A 1CKKA 2D8NA 1DMOA 2ZKMX 1S5GY 1CDLA 1MF8B 1TNXA 1AVSA 2IS9A 3VRNA 2COLB 2KGBC 1ZMZA 3DF0A 2L5YA 4IJ7A 1TTXA 1RK9A 1PK0D 1SBJA 1WRZA 1B7TZ 1QATA 2VRGA 1QWVA 2BCXA 2PALA 2L2CA 3KHEA 1IKUA 3VRQA 2KBMA 2M7NA 5FI7A 5J3XA 3L4AA 1QIVA 3TDIA 1L7ZA 1S1EA 5EL2A 2WCJA 2RGIA 2M1KB 1PSBA 1S6CA 2JT0A 4OV2A 4XYNA 1IJ5A 1B8LA 1XFRA 3TUYB 3B88A 4YGEB 4YI9A 4QJ5B 1U5IB 1M31A 1QJTA 2NCOA 1KQMB 3BJHA 1YX7A 1JC2A 2M0RA 2BKHB 1F4OA 3WHTB 2KSPA 1RTP1 3A8RA 2L4HA 1DJXA 3CWGA 2KAVA 3S0FA 1F55A 3D0YA 2JPOA 2KLEA 5AEQA 4MZLA 1KK7Y 1MXLC 5I2LA 2LE9B 2AMIA 4NDDA 1YRUB 1XA5A 3NHTA 2JZIA 1EG3A 4GBAA 2MLEC 3PM8A 1WDCC 2KYFA 1CFPA 2JTZA 4CFQA 2JT3A 5DKNA 1SSEB 3SS5A 1NYAA 2GGZA 3RM1A 1NWDA 1SY9A 1JSAA 2JXLA 3CZ0A 3DD4A 4FQOA 3R1OA 1H4BA 3DVMA 1CLMA 5HKWA 4NQGA 3FWBA 4PT1A 2JNXA 3TDZA 2SASA 1WRLA 4YI8A 3BUMB 1JF2A 1WY9A 2L5XB 1CFCA 2LM5A 3PN7C 2K7CA 4OVNF 1D1OA 2BAPA 1BMOA 2LMTA 1JWDA 1C3YA 3NSIA 4DCKA 4QJ3B 1TRFA 4CIDA 4DUQA 1J1DA 1IWQA 3NSKA 4ORAB 1BU3A 3EVVA 4PE0A 1KK7Z 2K2FA 4F0ZB 3IF7A 1J1EA 1QX5B 1KFUL 1J7RA 1QXPA 1XFXO 2I18A 4FQTA 3EK4A 2K2AA 1TUJA 5FYXA 1TNPA 1N2DA 2KFGA 1UUSA 2BNXA 3TS5B 1C7VA 3WNXB 3PLFB 4GFTA 3FS7A 1TN4A 3L4LA 3R1VA 1NPQA 1RECA 3I5IB 4MEWA 4DRWA 1SL9A 2WCEA 2PRUA 4ZCVA 2MRDA 2SCPA 4IL1A 4MSPA 1SW8A 2KHNA 1K2HA 2ZN8A 1Y1UA 3FE8A 2BE4A 1DJYA 4BY5A 1A4PA 2WCBA 4ORBB 5DICA 5DKRA 1PULA 2JXCA 1J7PA 1HT9A 1Y1AA 1KSOA 3NHIA 1UHJA 2WCMA 1NP8A 1NSHA 1FI5A 3EK7A 2PQLA 1ZOTB 1BG1A 3D76A 2BCBA 4KYNA 1OOHA 3DVJA 2LANA 2ZRSA 4YGDB
chains in the Genus database with same CATH topology
1LINA 2F33A 1BJFA 2ISDA 1OZSA 3JTDB 5F6TA 2HETA 4PHJA 2K7BA 3VRRA 1DF0B 3CR2A 1L2OC 4WRIA 3NSLA 3CGAA 3EKJA 1DTLA 1TNWA 3EVRA 1OOJA 4A4BA 1KWOB 1XFYO 5KTYA 3I5HB 1RROA 1QVIY 2LUXA 4JPZB 4C0KA 4E68A 2GGMA 2KOTA 2MBXA 1ODBA 1CFFA 1M63B 4N5XA 1LKJA 3MSEB 2NLNA 4I5KA 5JJGA 1SCVA 1YURA 5KSZA 1R2UA 1CMGA 1WLZA 5HLOA 2BL0C 3KF9A 1W7IB 4PHNA 2QPTA 1DJZA 3K21A 2M97A 1GQMA 4YRUA 1G8IA 2MA2A 2R2IA 5AANA 1FI6A 2LMUA 2M8UA 1RFJA 4M2OA 1KK8C 2FOTA 2JC2A 1SMGA 2WNDA 3CS1A 3FIAA 1TOPA 1YRTB 2GV5A 4CPVA 1OMVA 3OX6A 3ZWHA 2I2RE 5HYDA 1A2XA 1MHOA 1IG5A 2JPTA 2CNPA 2E6WA 4OR9B 2NXQA 2KAYA 1QV0A 2KQ6A 1UHNA 1ZUZA 2ZRTA 1GGWA 1JBAA 2LNKA 1S26D 1B8CA 2JU0A 3LK0A 1XFZO 1QVIZ 3LLEA 1DT7B 1LA0A 1Y0VH 2HPSA 1YVHA 1XFVO 3NXAA 1KFXL 3KPXA 4JWQA 3BOWB 1MUXA 5CSFA 3TUYC 2ZNDA 1S3PA 3D10A 1OZOA 1S5GZ 1CNPA 1KQMC 1SR6C 2JWWA 4GGFA 1SRAA 3CLNA 1QLKA 2LP2A 1GGZA 1QS7A 2F2PA 2M1UA 5G08A 4USLA 1SK6D 1X02A 2KI4B 1AJ4A 1OQPA 2JOJA 4CFRA 2F3ZA 2L2EA 1F8HA 2O60A 3IQOA 4MN0A 3SIAA 2V53A 5GQQC 1F54A 3I5FB 1M39A 2LLUA 2JT8A 4HRHA 1J7QA 2WCFA 1QX7A 1BLQA 3OP0A 4DIRA 1EL4A 2LVIA 1C7WA 5IBWA 2KNEA 3BUWB 3AKBA 1K96A 3A4UB 2EHBA 4N1GA 5HKZA 4NDBA 2I94A 2F2OA 1PSRA 5PALA 4WQ2A 1TIZA 1AJ5A 2OS8B 1DJGA 3EK8A 1J7OA 2JNFA 2LV7A 2CT9A 2MAZA 1SCMB 1SPYA 4PE1A 1QLSA 2WOSA 5B8IB 1MR8A 1BT6A 4MVFA 1CDNA 2LLSA 3DVEA 2FJUB 1CDMA 3CZTX 3CTNA 1M46A 3D0YB 4ZCUA 2M3WA 1S6IA 2BBNA 1RWYA 2DOQA 2K7DA 2OTGB 3VROA 3EKHA 4GUKA 2KGRA 2L51A 4JQ0D 1CTRA 2KI6C 5K89A 1XVJA 2K0JA 4D1EA 4GGFC 3LK1A 1PALA 2OPOA 4MBEA 4QJ4B 1K93D 1SKTA 2B1UA 4MRXA 4P5OE 1YUUA 2LC5A 2MLFC 3E3RA 3I5GB 4GPLB 1K8UA 4P2YB 4PHMA 3TS5C 1XFUO 3JVTB 2LMVA 3QRXA 1KQVA 4PALA 4AOMA 1A29A 1NIWA 2FCDA 4HREE 1CM1A 2L98A 1VRKA 2HQWA 1QX2A 2M49B 3I5IC 4OKHA 3OB2B 2LVKA 2QACA 1K95A 1SL8A 4M2QA 4YGBB 3PALA 4U8DA 4GGNA 1V1GA 3O4YA 2EC6B 2KDHA 3AKAA 4I5NB 3GK1A 1KFXS 3VRPA 4A4CA 1EH2A 1XYDA 3GK2A 1B4CA 3ZNIA 4C0LA 3EVUA 1MQ1A 1U5IA 1A03A 2Q91A 3CR4X 3PSRA 4HRGA 3RLZA 2L0PA 3SG2A 1QV1A 3H4SE 2O5GA 1B7TY 3TDUA 1GJYA 1SL7A 1Y1XA 2PVBA 4YBHB 3WHUB 5AERA 1IQ5A 2BECA 3JTDC 5TNCA 3HCMA 4OCIA 5D69A 2KYCA 2CTNA 1AUIB 5BPJA 2L4IA 2PMYA 1PVAA 4ICBA 1CMFA 1UWOA 2JULA 1XK4A 1EXRA 1DJHA 1KWOC 2BL0B 2LHIA 5AFPA 3I5HC 1TCFA 4PHKA 1IQ3A 3LL8B 3SG5A 2G2BA 3IQQA 1PRWA 2LVJA 1YUTA 2MJWB 2KFFA 1A75B 2M7LA 1R6PA 3SG7A 1CDPA 1DGVA 4MLWA 1BR4B 4NDCA 1NX3A 2K8MB 1KFUS 3DVKA 3O78A 3WXAA 2WC8A 5JOLA 4M2PA 1NUBA 4FTGA 4YGCB 5I2OA 1CB1A 2NCPA 2BKIB 2LCPA 1B9AA 4PCWA 1LA3A 1AK8A 2KBIA 1NX2A 5D7FA 4XJKB 3O2PA 1YVLA 1NCYA 2NZ0A 3SG6A 1FBVA 2MHHA 4GAOA 1E8AA 1S6JA 2ZNEA 5CPVA 3SIBA 1FF1A 2WORA 1UHIA 1FPWA 2JTTA 2LVVA 1F70A 1DGUA 4I5JA 1EJ3A 2KI6D 4MRYA 1SYMA 1WDCB 1JUOA 5HLVA 2Y1MA 3C1VA 5AXIA 4CLNA 2CXJA 2Y5IA 1J55A 5KU1A 1F4QA 4ETOA 1SR6B 5I8NA 1QTXA 3GK4X 1BF5A 1KCYA 2Y1NA 1JF0A 1TCOB 1ZFSA 3BUXB 3F45A 2LLTA 2K61A 2A4JA 2HQ8A 1QASA 1DVIA 2P6BB 3BUNB 1C07A 1LVCD 3CR5X 2JQ6A 2Q4UA 1NCZA 1CLLA 1XFWO 1YX8A 3LCPC 3SG3A 1UHHA 1H8BA 1IH0A 4AQJA 1KSMA 1XK4C 1OE9B 1XO5A 1N0YA 2BE6A 4WQ3A 4MZJA 2KAXA 3PN7B 2CCMA 5CSJA 5ER4X 3DF0B 4I5LB 1MXEA 1CFDA 1IJ6A 1B1GA 2KI4C 4TNCA 3TZ1A 2PASA 1NCXA 4BY4A 1B47A 2KFHA 1QIWA 1Y6WA 3GOFA 3I5FC 1HQVA 2AUCA 2FCEA 1YTZC 1K9UA 1G4YR 4PE4A 4DS7A 4GNKB 2L50A 1K9KA 1BR1B 3SG4A 1DF0A 2JRFA 1N65A 3OX5A 2G9BA 1AHRA 1TNQA 3PATA 1CLBA 1K90D 2K7OA 2PSRA 3O6BA 1JFJA 4L9MA 3VGOA 1UURA 2BCAA 4PDZA 4PE7A 1V1FA 1M45A 2OS8C 3M0WA 3BXKA 1LXFC 1SNLA 1SCMC 3KEVA 1RJVA 2H61A 1W7JB 4YGAA 3HX4A 3SJSA 2M29A 5DKQA 4C0JA 2OTGC 1JFKA 1AP4A 5HKYA 1NX0A 5I2QA 1OMRA 1OMDA 2LP3A 4Q04A 2AAOA 1ALWA 2H2KA 1A75A 1WLMA 1ZACA 3I5GC 5CSIA 1IGVA 1WRKA 2LHLA 1K9PA 3JVTC 1BODA 4HSZA 2M9GA 1DJIA 3OB1B 1K94A 1BOCA 1MWNA 4MZKA 1L2OB 1FW4A 3FWCA 1S36A 1DJWA 2BBMA 1YUSA 2TN4A 1PVBA 3AAJA 4AQIA 1IRJA 4XJKA 1YR5A 3NSOA 3KO0A 2EC6C 1NX1A 2HF5A 1EG4A 4R1EA 4UPGA 2KQYA 2F3YA 4ORCB 1UHKA 3ICBA 1G33A 5ER5A 3BOWA 3OHMB 2ZN9A 4N1FA 3PFVA 2F8PA 2LAPA 3BYAA 1UP5A 2E30A 2ZFDA 1ALVA 1CM4A 2LUCA 1F71A 1KK8B 2I7AA 2Y4QA 5CSNA 2EGDA 1OSAA 2H61C 1B8RA 1Q80A 3BUOB 3AAKA 2CBLA 3BQ3A 1CKKA 2D8NA 1DMOA 2ZKMX 1S5GY 1CDLA 1MF8B 1TNXA 1AVSA 2IS9A 3VRNA 2COLB 2KGBC 1ZMZA 3DF0A 1TTXA 1RK9A 1PK0D 1SBJA 1WRZA 1B7TZ 1QATA 2VRGA 2BCXA 2PALA 3KHEA 1IKUA 3VRQA 2KBMA 2M7NA 5J3XA 1QIVA 3TDIA 1L7ZA 1S1EA 2RGIA 2M1KB 1PSBA 1S6CA 2JT0A 4OV2A 4XYNA 1IJ5A 1B8LA 3TUYB 4YGEB 4YI9A 4QJ5B 1U5IB 1M31A 1QJTA 2NCOA 1KQMB 1YX7A 1JC2A 2M0RA 2BKHB 1F4OA 3WHTB 2KSPA 1RTP1 3A8RA 2L4HA 1DJXA 3CWGA 2KAVA 1F55A 3D0YA 5AEQA 4MZLA 1KK7Y 1MXLC 5I2LA 2LE9B 2AMIA 4NDDA 1YRUB 1XA5A 2JZIA 1EG3A 4GBAA 2MLEC 3PM8A 1WDCC 2KYFA 1CFPA 2JTZA 4CFQA 2JT3A 5DKNA 1NYAA 2GGZA 3RM1A 1NWDA 1SY9A 1JSAA 2JXLA 3DD4A 4FQOA 1H4BA 3DVMA 1CLMA 5HKWA 4NQGA 3FWBA 2JNXA 3TDZA 2SASA 1WRLA 4YI8A 3BUMB 1JF2A 1WY9A 2L5XB 1CFCA 2LM5A 3PN7C 2K7CA 4OVNF 1D1OA 1BMOA 2LMTA 1JWDA 3NSIA 4DCKA 4QJ3B 1TRFA 4CIDA 4DUQA 1J1DA 1IWQA 3NSKA 4ORAB 1BU3A 3EVVA 4PE0A 1KK7Z 2K2FA 4F0ZB 3IF7A 1J1EA 1QX5B 1KFUL 1J7RA 1QXPA 1XFXO 2I18A 3EK4A 2K2AA 5FYXA 1TNPA 1N2DA 2KFGA 1UUSA 3TS5B 1C7VA 3WNXB 3PLFB 4GFTA 3FS7A 1TN4A 1NPQA 1RECA 3I5IB 4MEWA 4DRWA 1SL9A 2WCEA 2PRUA 4ZCVA 2MRDA 2SCPA 4IL1A 4MSPA 1SW8A 2KHNA 1K2HA 2ZN8A 1Y1UA 2BE4A 1DJYA 4BY5A 1A4PA 2WCBA 4ORBB 5DKRA 1PULA 2JXCA 1J7PA 1HT9A 1Y1AA 1KSOA 1UHJA 1NP8A 1NSHA 1FI5A 3EK7A 1ZOTB 1BG1A 2BCBA 3DVJA 2LANA 2ZRSA 4YGDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIN A;  2F33 A;  1BJF A;  2ISD A;  1OZS A;  3JTD B;  5F6T A;  2HET A;  4PHJ A;  2K7B A;  3VRR A;  1DF0 B;  3CR2 A;  1L2O C;  4WRI A;  3NSL A;  3CGA A;  3EKJ A;  1DTL A;  1TNW A;  3EVR A;  1OOJ A;  4A4B A;  1KWO B;  1XFY O;  5KTY A;  3I5H B;  1RRO A;  1QVI Y;  2LUX A;  4JPZ B;  4C0K A;  4E68 A;  2GGM A;  2KOT A;  2MBX A;  1ODB A;  1CFF A;  1M63 B;  4N5X A;  1LKJ A;  3MSE B;  2NLN A;  4I5K A;  5JJG A;  1SCV A;  1YUR A;  5KSZ A;  1R2U A;  1CMG A;  1WLZ A;  5HLO A;  2BL0 C;  3KF9 A;  1W7I B;  4PHN A;  2QPT A;  1DJZ A;  3K21 A;  2M97 A;  1GQM A;  4YRU A;  1G8I A;  2MA2 A;  2R2I A;  5AAN A;  1FI6 A;  2LMU A;  2M8U A;  1RFJ A;  4M2O A;  1KK8 C;  2FOT A;  2JC2 A;  1SMG A;  2WND A;  3CS1 A;  3FIA A;  1TOP A;  1YRT B;  2GV5 A;  4CPV A;  1OMV A;  3OX6 A;  3ZWH A;  2I2R E;  5HYD A;  1A2X A;  1MHO A;  1IG5 A;  2JPT A;  2CNP A;  2E6W A;  4OR9 B;  2NXQ A;  2KAY A;  1QV0 A;  2KQ6 A;  1UHN A;  1ZUZ A;  2ZRT A;  1GGW A;  1JBA A;  2LNK A;  1S26 D;  1B8C A;  2JU0 A;  3LK0 A;  1XFZ O;  1QVI Z;  3LLE A;  1DT7 B;  1LA0 A;  1Y0V H;  2HPS A;  1YVH A;  1XFV O;  3NXA A;  1KFX L;  3KPX A;  4JWQ A;  3BOW B;  1MUX A;  5CSF A;  3TUY C;  2ZND A;  1S3P A;  3D10 A;  1OZO A;  1S5G Z;  1CNP A;  1KQM C;  1SR6 C;  2JWW A;  4GGF A;  1SRA A;  3CLN A;  1QLK A;  2LP2 A;  1GGZ A;  1QS7 A;  2F2P A;  2M1U A;  5G08 A;  4USL A;  1SK6 D;  1X02 A;  2KI4 B;  1AJ4 A;  1OQP A;  2JOJ A;  4CFR A;  2F3Z A;  2L2E A;  1F8H A;  2O60 A;  3IQO A;  4MN0 A;  3SIA A;  2V53 A;  5GQQ C;  1F54 A;  3I5F B;  1M39 A;  2LLU A;  2JT8 A;  4HRH A;  1J7Q A;  2WCF A;  1QX7 A;  1BLQ A;  3OP0 A;  4DIR A;  1EL4 A;  2LVI A;  1C7W A;  5IBW A;  2KNE A;  3BUW B;  3AKB A;  1K96 A;  3A4U B;  2EHB A;  4N1G A;  5HKZ A;  4NDB A;  2I94 A;  2F2O A;  1PSR A;  5PAL A;  4WQ2 A;  1TIZ A;  1AJ5 A;  2OS8 B;  1DJG A;  3EK8 A;  1J7O A;  2JNF A;  2LV7 A;  2CT9 A;  2MAZ A;  1SCM B;  1SPY A;  4PE1 A;  1QLS A;  2WOS A;  5B8I B;  1MR8 A;  1BT6 A;  4MVF A;  1CDN A;  2LLS A;  3DVE A;  2FJU B;  1CDM A;  3CZT X;  3CTN A;  1M46 A;  3D0Y B;  4ZCU A;  2M3W A;  1S6I A;  2BBN A;  1RWY A;  2DOQ A;  2K7D A;  2OTG B;  3VRO A;  3EKH A;  4GUK A;  2KGR A;  2L51 A;  4JQ0 D;  1CTR A;  2KI6 C;  5K89 A;  1XVJ A;  2K0J A;  4D1E A;  4GGF C;  3LK1 A;  1PAL A;  2OPO A;  4MBE A;  4QJ4 B;  1K93 D;  1SKT A;  2B1U A;  4MRX A;  4P5O E;  1YUU A;  2LC5 A;  2MLF C;  3E3R A;  3I5G B;  4GPL B;  1K8U A;  4P2Y B;  4PHM A;  3TS5 C;  1XFU O;  3JVT B;  2LMV A;  3QRX A;  1KQV A;  4PAL A;  4AOM A;  1A29 A;  1NIW A;  2FCD A;  4HRE E;  1CM1 A;  2L98 A;  1VRK A;  2HQW A;  1QX2 A;  2M49 B;  3I5I C;  4OKH A;  3OB2 B;  2LVK A;  2QAC A;  1K95 A;  1SL8 A;  4M2Q A;  4YGB B;  3PAL A;  4U8D A;  4GGN A;  1V1G A;  3O4Y A;  2EC6 B;  2KDH A;  3AKA A;  4I5N B;  3GK1 A;  1KFX S;  3VRP A;  4A4C A;  1EH2 A;  1XYD A;  3GK2 A;  1B4C A;  3ZNI A;  4C0L A;  3EVU A;  1MQ1 A;  1U5I A;  1A03 A;  2Q91 A;  3CR4 X;  3PSR A;  4HRG A;  3RLZ A;  2L0P A;  3SG2 A;  1QV1 A;  3H4S E;  2O5G A;  1B7T Y;  3TDU A;  1GJY A;  1SL7 A;  1Y1X A;  2PVB A;  4YBH B;  3WHU B;  5AER A;  1IQ5 A;  2BEC A;  3JTD C;  5TNC A;  3HCM A;  4OCI A;  5D69 A;  2KYC A;  2CTN A;  1AUI B;  5BPJ A;  2L4I A;  2PMY A;  1PVA A;  4ICB A;  1CMF A;  1UWO A;  2JUL A;  1XK4 A;  1EXR A;  1DJH A;  1KWO C;  2BL0 B;  2LHI A;  5AFP A;  3I5H C;  1TCF A;  4PHK A;  1IQ3 A;  3LL8 B;  3SG5 A;  2G2B A;  3IQQ A;  1PRW A;  2LVJ A;  1YUT A;  2MJW B;  2KFF A;  1A75 B;  2M7L A;  1R6P A;  3SG7 A;  1CDP A;  1DGV A;  4MLW A;  1BR4 B;  4NDC A;  1NX3 A;  2K8M B;  1KFU S;  3DVK A;  3O78 A;  3WXA A;  2WC8 A;  5JOL A;  4M2P A;  1NUB A;  4FTG A;  4YGC B;  5I2O A;  1CB1 A;  2NCP A;  2BKI B;  2LCP A;  1B9A A;  4PCW A;  1LA3 A;  1AK8 A;  2KBI A;  1NX2 A;  5D7F A;  4XJK B;  3O2P A;  1YVL A;  1NCY A;  2NZ0 A;  3SG6 A;  1FBV A;  2MHH A;  4GAO A;  1E8A A;  1S6J A;  2ZNE A;  5CPV A;  3SIB A;  1FF1 A;  2WOR A;  1UHI A;  1FPW A;  2JTT A;  2LVV A;  1F70 A;  1DGU A;  4I5J A;  1EJ3 A;  2KI6 D;  4MRY A;  1SYM A;  1WDC B;  1JUO A;  5HLV A;  2Y1M A;  3C1V A;  5AXI A;  4CLN A;  2CXJ A;  2Y5I A;  1J55 A;  5KU1 A;  1F4Q A;  4ETO A;  1SR6 B;  5I8N A;  1QTX A;  3GK4 X;  1BF5 A;  1KCY A;  2Y1N A;  1JF0 A;  1TCO B;  1ZFS A;  3BUX B;  3F45 A;  2LLT A;  2K61 A;  2A4J A;  2HQ8 A;  1QAS A;  1DVI A;  2P6B B;  3BUN B;  1C07 A;  1LVC D;  3CR5 X;  2JQ6 A;  2Q4U A;  1NCZ A;  1CLL A;  1XFW O;  1YX8 A;  3LCP C;  3SG3 A;  1UHH A;  1H8B A;  1IH0 A;  4AQJ A;  1KSM A;  1XK4 C;  1OE9 B;  1XO5 A;  1N0Y A;  2BE6 A;  4WQ3 A;  4MZJ A;  2KAX A;  3PN7 B;  2CCM A;  5CSJ A;  5ER4 X;  3DF0 B;  4I5L B;  1MXE A;  1CFD A;  1IJ6 A;  1B1G A;  2KI4 C;  4TNC A;  3TZ1 A;  2PAS A;  1NCX A;  4BY4 A;  1B47 A;  2KFH A;  1QIW A;  1Y6W A;  3GOF A;  3I5F C;  1HQV A;  2AUC A;  2FCE A;  1YTZ C;  1K9U A;  1G4Y R;  4PE4 A;  4DS7 A;  4GNK B;  2L50 A;  1K9K A;  1BR1 B;  3SG4 A;  1DF0 A;  2JRF A;  1N65 A;  3OX5 A;  2G9B A;  1AHR A;  1TNQ A;  3PAT A;  1CLB A;  1K90 D;  2K7O A;  2PSR A;  3O6B A;  1JFJ A;  4L9M A;  3VGO A;  1UUR A;  2BCA A;  4PDZ A;  4PE7 A;  1V1F A;  1M45 A;  2OS8 C;  3M0W A;  3BXK A;  1LXF C;  1SNL A;  1SCM C;  3KEV A;  1RJV A;  2H61 A;  1W7J B;  4YGA A;  3HX4 A;  3SJS A;  2M29 A;  5DKQ A;  4C0J A;  2OTG C;  1JFK A;  1AP4 A;  5HKY A;  1NX0 A;  5I2Q A;  1OMR A;  1OMD A;  2LP3 A;  4Q04 A;  2AAO A;  1ALW A;  2H2K A;  1A75 A;  1WLM A;  1ZAC A;  3I5G C;  5CSI A;  1IGV A;  1WRK A;  2LHL A;  1K9P A;  3JVT C;  1BOD A;  4HSZ A;  2M9G A;  1DJI A;  3OB1 B;  1K94 A;  1BOC A;  1MWN A;  4MZK A;  1L2O B;  1FW4 A;  3FWC A;  1S36 A;  1DJW A;  2BBM A;  1YUS A;  2TN4 A;  1PVB A;  3AAJ A;  4AQI A;  1IRJ A;  4XJK A;  1YR5 A;  3NSO A;  3KO0 A;  2EC6 C;  1NX1 A;  2HF5 A;  1EG4 A;  4R1E A;  4UPG A;  2KQY A;  2F3Y A;  4ORC B;  1UHK A;  3ICB A;  1G33 A;  5ER5 A;  3BOW A;  3OHM B;  2ZN9 A;  4N1F A;  3PFV A;  2F8P A;  2LAP A;  3BYA A;  1UP5 A;  2E30 A;  2ZFD A;  1ALV A;  1CM4 A;  2LUC A;  1F71 A;  1KK8 B;  2I7A A;  2Y4Q A;  5CSN A;  2EGD A;  1OSA A;  2H61 C;  1B8R A;  1Q80 A;  3BUO B;  3AAK A;  2CBL A;  3BQ3 A;  1CKK A;  2D8N A;  1DMO A;  2ZKM X;  1S5G Y;  1CDL A;  1MF8 B;  1TNX A;  1AVS A;  2IS9 A;  3VRN A;  2COL B;  2KGB C;  1ZMZ A;  3DF0 A;  1TTX A;  1RK9 A;  1PK0 D;  1SBJ A;  1WRZ A;  1B7T Z;  1QAT A;  2VRG A;  2BCX A;  2PAL A;  3KHE A;  1IKU A;  3VRQ A;  2KBM A;  2M7N A;  5J3X A;  1QIV A;  3TDI A;  1L7Z A;  1S1E A;  2RGI A;  2M1K B;  1PSB A;  1S6C A;  2JT0 A;  4OV2 A;  4XYN A;  1IJ5 A;  1B8L A;  3TUY B;  4YGE B;  4YI9 A;  4QJ5 B;  1U5I B;  1M31 A;  1QJT A;  2NCO A;  1KQM B;  1YX7 A;  1JC2 A;  2M0R A;  2BKH B;  1F4O A;  3WHT B;  2KSP A;  1RTP 1;  3A8R A;  2L4H A;  1DJX A;  3CWG A;  2KAV A;  1F55 A;  3D0Y A;  5AEQ A;  4MZL A;  1KK7 Y;  1MXL C;  5I2L A;  2LE9 B;  2AMI A;  4NDD A;  1YRU B;  1XA5 A;  2JZI A;  1EG3 A;  4GBA A;  2MLE C;  3PM8 A;  1WDC C;  2KYF A;  1CFP A;  2JTZ A;  4CFQ A;  2JT3 A;  5DKN A;  1NYA A;  2GGZ A;  3RM1 A;  1NWD A;  1SY9 A;  1JSA A;  2JXL A;  3DD4 A;  4FQO A;  1H4B A;  3DVM A;  1CLM A;  5HKW A;  4NQG A;  3FWB A;  2JNX A;  3TDZ A;  2SAS A;  1WRL A;  4YI8 A;  3BUM B;  1JF2 A;  1WY9 A;  2L5X B;  1CFC A;  2LM5 A;  3PN7 C;  2K7C A;  4OVN F;  1D1O A;  1BMO A;  2LMT A;  1JWD A;  3NSI A;  4DCK A;  4QJ3 B;  1TRF A;  4CID A;  4DUQ A;  1J1D A;  1IWQ A;  3NSK A;  4ORA B;  1BU3 A;  3EVV A;  4PE0 A;  1KK7 Z;  2K2F A;  4F0Z B;  3IF7 A;  1J1E A;  1QX5 B;  1KFU L;  1J7R A;  1QXP A;  1XFX O;  2I18 A;  3EK4 A;  2K2A A;  5FYX A;  1TNP A;  1N2D A;  2KFG A;  1UUS A;  3TS5 B;  1C7V A;  3WNX B;  3PLF B;  4GFT A;  3FS7 A;  1TN4 A;  1NPQ A;  1REC A;  3I5I B;  4MEW A;  4DRW A;  1SL9 A;  2WCE A;  2PRU A;  4ZCV A;  2MRD A;  2SCP A;  4IL1 A;  4MSP A;  1SW8 A;  2KHN A;  1K2H A;  2ZN8 A;  1Y1U A;  2BE4 A;  1DJY A;  4BY5 A;  1A4P A;  2WCB A;  4ORB B;  5DKR A;  1PUL A;  2JXC A;  1J7P A;  1HT9 A;  1Y1A A;  1KSO A;  1UHJ A;  1NP8 A;  1NSH A;  1FI5 A;  3EK7 A;  1ZOT B;  1BG1 A;  2BCB A;  3DVJ A;  2LAN A;  2ZRS A;  4YGD B; 
#chains in the Genus database with same CATH topology
 1LIN A;  2F33 A;  1BJF A;  2ISD A;  1OZS A;  3JTD B;  5F6T A;  2HET A;  4PHJ A;  2K7B A;  3VRR A;  1DF0 B;  5FI2 A;  3CR2 A;  1OW4 A;  1L2O C;  4WRI A;  3QME A;  3NSL A;  3CGA A;  3N7H A;  3EKJ A;  1DTL A;  1TNW A;  3EVR A;  1OOJ A;  3S0G A;  4A4B A;  1KWO B;  1XFY O;  3S0D A;  5KTY A;  3I5H B;  1RRO A;  1QVI Y;  2LUX A;  4JPZ B;  4C0K A;  4E68 A;  2GGM A;  1DQE A;  2KOT A;  2MBX A;  1ODB A;  1CFF A;  1M63 B;  4N5X A;  1LKJ A;  3MSE B;  2NLN A;  4I5K A;  5JJG A;  1SCV A;  1YUR A;  5KSZ A;  1R2U A;  3D74 A;  1CMG A;  1WLZ A;  5HLO A;  2BL0 C;  3KF9 A;  1W7I B;  3BFA A;  4PHN A;  2QPT A;  3VB1 A;  1DJZ A;  3K21 A;  2M97 A;  1GQM A;  4YRU A;  1G8I A;  2MA2 A;  2R2I A;  5AAN A;  1FI6 A;  3S0A A;  2LMU A;  2M8U A;  1RFJ A;  4M2O A;  1KK8 C;  5FI6 A;  2FOT A;  2JC2 A;  1SMG A;  2WND A;  3CS1 A;  3FIA A;  1TOP A;  3OBV A;  4JKT A;  1YRT B;  1P28 A;  2GV5 A;  4CPV A;  1OMV A;  3OX6 A;  3ZWH A;  2I2R E;  5HYD A;  1A2X A;  2YGU A;  1MHO A;  3OGN A;  1IG5 A;  2JPT A;  2CNP A;  2E6W A;  4OR9 B;  2NXQ A;  2KAY A;  3UNW A;  1QV0 A;  2KQ6 A;  3CDN A;  1IIO A;  1UHN A;  1ZUZ A;  2ZRT A;  2P70 A;  1JBA A;  1GGW A;  2LNK A;  1S26 D;  1B8C A;  2JU0 A;  3LK0 A;  1XFZ O;  1QVI Z;  3LLE A;  1DT7 B;  1LA0 A;  1Y0V H;  2HPS A;  1YVH A;  1XFV O;  3NXA A;  1KFX L;  3KPX A;  4JWQ A;  3BOW B;  1MUX A;  3DY9 A;  5CSF A;  2ZND A;  1S3P A;  3D10 A;  3TUY C;  3S0E A;  1OZO A;  1S5G Z;  1CNP A;  1KQM C;  2K60 A;  1SR6 C;  2JWW A;  2KLD A;  4GGF A;  1SRA A;  3CLN A;  1QLK A;  3SS3 A;  2LP2 A;  1GGZ A;  1QS7 A;  1T14 A;  2F2P A;  2M1U A;  5G08 A;  4USL A;  1SK6 D;  1X02 A;  2KI4 B;  1AJ4 A;  1OQP A;  2JOJ A;  3DXL A;  4CFR A;  2F3Z A;  2L2E A;  1F8H A;  2O60 A;  2WC5 A;  3IQO A;  4MN0 A;  1TWO A;  3SIA A;  2V53 A;  5GQQ C;  1F54 A;  3I5F B;  1M39 A;  3DZT A;  2LLU A;  2JT8 A;  3V2L A;  4HRH A;  3FE9 A;  2WCF A;  1J7Q A;  1QX7 A;  1BLQ A;  3OP0 A;  4DIR A;  1EL4 A;  2LVI A;  1C7W A;  5IBW A;  2KNE A;  3BUW B;  5HL1 A;  2P71 A;  3B7A A;  2QDI A;  3AKB A;  4JD9 A;  1K96 A;  3A4U B;  2EHB A;  4N1G A;  5HKZ A;  1W9Z A;  4NDB A;  2I94 A;  2QEO A;  2F2O A;  1PSR A;  5PAL A;  4WQ2 A;  1TIZ A;  1AJ5 A;  2OS8 B;  1DJG A;  3EK8 A;  1J7O A;  2JNF A;  2LV7 A;  2CT9 A;  2MAZ A;  1SCM B;  1SPY A;  4PE1 A;  1QLS A;  2WOS A;  5B8I B;  1MR8 A;  1BT6 A;  4MVF A;  1CDN A;  3D75 A;  2LLS A;  3DVE A;  2FJU B;  1CDM A;  3CZT X;  1OOI X;  3CTN A;  1M46 A;  3D0Y B;  4ZCU A;  1TUZ A;  1S6I A;  2BBN A;  1RWY A;  2DOQ A;  2K7D A;  2M3W A;  2OTG B;  3R1P A;  3VRO A;  3EKH A;  4GUK A;  2KGR A;  2L51 A;  4JQ0 D;  1CTR A;  2KI6 C;  3CZ2 A;  5K89 A;  1XVJ A;  2K0J A;  4D1E A;  4GGF C;  3EG5 B;  3LK1 A;  1PAL A;  2OPO A;  4MBE A;  4QJ4 B;  1K93 D;  1SKT A;  2B1U A;  4MRX A;  4P5O E;  1YUU A;  2LC5 A;  2MLF C;  3E3R A;  3I5G B;  4GPL B;  1K8U A;  4P2Y B;  4PHM A;  3TS5 C;  1XFU O;  3JVT B;  2LMV A;  3QRX A;  3R72 A;  4PAL A;  4AOM A;  1A29 A;  1NIW A;  2FCD A;  4HRE E;  1CM1 A;  2L98 A;  1VRK A;  2HQW A;  1QX2 A;  2M49 B;  3IVT A;  3I5I C;  4OKH A;  2ERB A;  3OB2 B;  2LVK A;  2QAC A;  1K95 A;  1SL8 A;  4M2Q A;  1OOG A;  4YGB B;  3PAL A;  4U8D A;  4GGN A;  1V1G A;  3O4Y A;  2EC6 B;  2KDH A;  3AKA A;  4I5N B;  3GK1 A;  1KFX S;  3VRP A;  4A4C A;  1EH2 A;  1XYD A;  3D78 A;  3GK2 A;  1B4C A;  3ZNI A;  4C0L A;  3EVU A;  2WCH A;  1MQ1 A;  3B87 A;  3DYE A;  1U5I A;  1A03 A;  2Q91 A;  3CR4 X;  3PSR A;  1ORG A;  4HRG A;  2L0P A;  3RLZ A;  3SG2 A;  3SS4 A;  1QV1 A;  3H4S E;  2O5G A;  1B7T Y;  1Z2C B;  3TDU A;  1GJY A;  1SL7 A;  1Y1X A;  2PVB A;  4YBH B;  3WHU B;  5AER A;  1IQ5 A;  2BEC A;  2QEV A;  3JTD C;  5TNC A;  3HCM A;  4OCI A;  5D69 A;  2KYC A;  3BFB A;  2CTN A;  1AUI B;  3PJI A;  5BPJ A;  2L4I A;  5I94 A;  2PMY A;  1PVA A;  4ICB A;  1GM0 A;  1CMF A;  1UWO A;  2JUL A;  1XK4 A;  1EXR A;  1DJH A;  1KWO C;  2BL0 B;  2LHI A;  5AFP A;  2QEH A;  3I5H C;  1TCF A;  4PHK A;  1IQ3 A;  3LL8 B;  3SG5 A;  2G2B A;  2WCK A;  3IQQ A;  1PRW A;  2LVJ A;  1YUT A;  2MJW B;  1DC1 A;  2KFF A;  1A75 B;  2H8V A;  2M7L A;  1R6P A;  3SG7 A;  1CDP A;  1DGV A;  4MLW A;  1BR4 B;  4NDC A;  1NX3 A;  2K8M B;  1KFU S;  3DVK A;  3O78 A;  3WXA A;  2WC8 A;  5JOL A;  3NGV A;  4M2P A;  1NUB A;  4FTG A;  4YGC B;  2QEB A;  5I2O A;  1CB1 A;  2NCP A;  2BKI B;  3CAB A;  2LCP A;  1B9A A;  4PCW A;  3S0B A;  1LA3 A;  1AK8 A;  2KBI A;  1NX2 A;  5D7F A;  4XJK B;  3O2P A;  1YVL A;  1NCY A;  2NZ0 A;  3SG6 A;  3L47 A;  1FBV A;  2FJY A;  2MHH A;  1E8A A;  1S6J A;  2ZNE A;  4GAO A;  5CPV A;  3SIB A;  1FF1 A;  2WOR A;  1UHI A;  1FPW A;  2JTT A;  2WCL A;  2LVV A;  1F70 A;  1DGU A;  4I5J A;  1EJ3 A;  2KI6 D;  4MRY A;  1SYM A;  1WDC B;  3CYZ A;  1JUO A;  5HLV A;  2Y1M A;  3C1V A;  5AXI A;  1LS8 A;  4CLN A;  2CXJ A;  2Y5I A;  1J55 A;  5KU1 A;  1F4Q A;  4ETO A;  1SR6 B;  2PYQ A;  1OOF A;  4INW A;  1QTX A;  2WC6 A;  3GK4 X;  5I8N A;  1BF5 A;  2Y1N A;  1KCY A;  1JF0 A;  3RZS A;  1TCO B;  1ZFS A;  3BUX B;  3F45 A;  2LLT A;  2K61 A;  2A4J A;  2HQ8 A;  1QAS A;  1DVI A;  2P6B B;  3BUN B;  1C07 A;  1LVC D;  3CR5 X;  2JQ6 A;  2Q4U A;  1NCZ A;  1CLL A;  1XFW O;  1YX8 A;  3LCP C;  3SG3 A;  1UHH A;  1H8B A;  1IH0 A;  4AQJ A;  1KSM A;  1XK4 C;  1OE9 B;  1XO5 A;  1N0Y A;  2BE6 A;  4WQ3 A;  4MZJ A;  2KAX A;  3PN7 B;  2CCM A;  5CSJ A;  5ER4 X;  3DF0 B;  3FE6 A;  4I5L B;  1MXE A;  1CFD A;  1DEL A;  1IJ6 A;  1B1G A;  2KI4 C;  4TNC A;  3Q8I A;  3TZ1 A;  2PAS A;  1NCX A;  3BFH A;  4BY4 A;  1B47 A;  2KFH A;  1QIW A;  1Y6W A;  3GOF A;  3I5F C;  1HQV A;  2AUC A;  2FCE A;  1YTZ C;  1K9U A;  1G4Y R;  4PE4 A;  4DS7 A;  4GNK B;  2L50 A;  1K9K A;  1BR1 B;  3SG4 A;  2GTE A;  1DF0 A;  2JRF A;  1N65 A;  3OX5 A;  2G9B A;  1AHR A;  1TNQ A;  3D73 A;  3D77 A;  4F7F A;  3PAT A;  1CLB A;  1K90 D;  2K7O A;  2PSR A;  3O6B A;  1JFJ A;  3UO9 A;  4L9M A;  3VGO A;  1UUR A;  2BCA A;  4PDZ A;  4PE7 A;  1KQV A;  1V1F A;  1M45 A;  2OS8 C;  3PM2 A;  3M0W A;  3BXK A;  1LXF C;  1SNL A;  1SCM C;  3K1E A;  3KEV A;  1RJV A;  2H61 A;  1W7J B;  4YGA A;  3HX4 A;  3SJS A;  2M29 A;  5DKQ A;  4C0J A;  2OTG C;  1JFK A;  1AP4 A;  5HKY A;  1NX0 A;  5I2Q A;  1Z4H A;  4INX A;  1OMR A;  1OMD A;  2LP3 A;  4Q04 A;  2AAO A;  1ALW A;  2H2K A;  1A75 A;  1DEK A;  1WLM A;  3CZ1 A;  1ZAC A;  3I5G C;  5CSI A;  1IGV A;  1WRK A;  2LHL A;  1K9P A;  3JVT C;  1BOD A;  4HSZ A;  2M9G A;  1DJI A;  3OB1 B;  1K94 A;  1BOC A;  1MWN A;  4MZK A;  1L2O B;  3O4X A;  1FW4 A;  3FWC A;  1S36 A;  2KPH A;  1DJW A;  2BBM A;  1YUS A;  2TN4 A;  1PVB A;  3AAJ A;  4AQI A;  1IRJ A;  4XJK A;  1YR5 A;  3NSO A;  3KO0 A;  4OZD A;  2EC6 C;  5D3O A;  1NX1 A;  2HF5 A;  1EG4 A;  4R1E A;  4UPG A;  2KQY A;  2F3Y A;  4ORC B;  1UHK A;  3ICB A;  1G33 A;  5ER5 A;  3BOW A;  3OHM B;  2ZN9 A;  4N1F A;  1C3Z A;  3PFV A;  2F8P A;  2LAP A;  3BYA A;  1UP5 A;  3B86 A;  2E30 A;  2ZFD A;  1ALV A;  1CM4 A;  2LUC A;  1F71 A;  1KK8 B;  3B6X A;  2I7A A;  2Y4Q A;  5CSN A;  2EGD A;  1OSA A;  2H61 C;  1B8R A;  1Q80 A;  3BUO B;  3AAK A;  2CBL A;  3BQ3 A;  1CKK A;  2D8N A;  1DMO A;  2ZKM X;  1S5G Y;  1CDL A;  1MF8 B;  1TNX A;  1AVS A;  2IS9 A;  3VRN A;  2COL B;  2KGB C;  1ZMZ A;  3DF0 A;  2L5Y A;  4IJ7 A;  1TTX A;  1RK9 A;  1PK0 D;  1SBJ A;  1WRZ A;  1B7T Z;  1QAT A;  2VRG A;  1QWV A;  2BCX A;  2PAL A;  2L2C A;  3KHE A;  1IKU A;  3VRQ A;  2KBM A;  2M7N A;  5FI7 A;  5J3X A;  3L4A A;  1QIV A;  3TDI A;  1L7Z A;  1S1E A;  5EL2 A;  2WCJ A;  2RGI A;  2M1K B;  1PSB A;  1S6C A;  2JT0 A;  4OV2 A;  4XYN A;  1IJ5 A;  1B8L A;  1XFR A;  3TUY B;  3B88 A;  4YGE B;  4YI9 A;  4QJ5 B;  1U5I B;  1M31 A;  1QJT A;  2NCO A;  1KQM B;  3BJH A;  1YX7 A;  1JC2 A;  2M0R A;  2BKH B;  1F4O A;  3WHT B;  2KSP A;  1RTP 1;  3A8R A;  2L4H A;  1DJX A;  3CWG A;  2KAV A;  3S0F A;  1F55 A;  3D0Y A;  2JPO A;  2KLE A;  5AEQ A;  4MZL A;  1KK7 Y;  1MXL C;  5I2L A;  2LE9 B;  2AMI A;  4NDD A;  1YRU B;  1XA5 A;  3NHT A;  2JZI A;  1EG3 A;  4GBA A;  2MLE C;  3PM8 A;  1WDC C;  2KYF A;  1CFP A;  2JTZ A;  4CFQ A;  2JT3 A;  5DKN A;  1SSE B;  3SS5 A;  1NYA A;  2GGZ A;  3RM1 A;  1NWD A;  1SY9 A;  1JSA A;  2JXL A;  3CZ0 A;  3DD4 A;  4FQO A;  3R1O A;  1H4B A;  3DVM A;  1CLM A;  5HKW A;  4NQG A;  3FWB A;  4PT1 A;  2JNX A;  3TDZ A;  2SAS A;  1WRL A;  4YI8 A;  3BUM B;  1JF2 A;  1WY9 A;  2L5X B;  1CFC A;  2LM5 A;  3PN7 C;  2K7C A;  4OVN F;  1D1O A;  2BAP A;  1BMO A;  2LMT A;  1JWD A;  1C3Y A;  3NSI A;  4DCK A;  4QJ3 B;  1TRF A;  4CID A;  4DUQ A;  1J1D A;  1IWQ A;  3NSK A;  4ORA B;  1BU3 A;  3EVV A;  4PE0 A;  1KK7 Z;  2K2F A;  4F0Z B;  3IF7 A;  1J1E A;  1QX5 B;  1KFU L;  1J7R A;  1QXP A;  1XFX O;  2I18 A;  4FQT A;  3EK4 A;  2K2A A;  1TUJ A;  5FYX A;  1TNP A;  1N2D A;  2KFG A;  1UUS A;  2BNX A;  3TS5 B;  1C7V A;  3WNX B;  3PLF B;  4GFT A;  3FS7 A;  1TN4 A;  3L4L A;  3R1V A;  1NPQ A;  1REC A;  3I5I B;  4MEW A;  4DRW A;  1SL9 A;  2WCE A;  2PRU A;  4ZCV A;  2MRD A;  2SCP A;  4IL1 A;  4MSP A;  1SW8 A;  2KHN A;  1K2H A;  2ZN8 A;  1Y1U A;  3FE8 A;  2BE4 A;  1DJY A;  4BY5 A;  1A4P A;  2WCB A;  4ORB B;  5DIC A;  5DKR A;  1PUL A;  2JXC A;  1J7P A;  1HT9 A;  1Y1A A;  1KSO A;  3NHI A;  1UHJ A;  2WCM A;  1NP8 A;  1NSH A;  1FI5 A;  3EK7 A;  2PQL A;  1ZOT B;  1BG1 A;  3D76 A;  2BCB A;  4KYN A;  1OOH A;  3DVJ A;  2LAN A;  2ZRS A;  4YGD B; 
#chains in the Genus database with same CATH homology
 1LIN A;  2F33 A;  1BJF A;  2ISD A;  1OZS A;  3JTD B;  5F6T A;  2HET A;  4PHJ A;  2K7B A;  3VRR A;  1DF0 B;  3CR2 A;  1L2O C;  4WRI A;  3NSL A;  3CGA A;  3EKJ A;  1DTL A;  1TNW A;  3EVR A;  1OOJ A;  4A4B A;  1KWO B;  1XFY O;  5KTY A;  3I5H B;  1RRO A;  1QVI Y;  2LUX A;  4JPZ B;  4C0K A;  4E68 A;  2GGM A;  2KOT A;  2MBX A;  1ODB A;  1CFF A;  1M63 B;  4N5X A;  1LKJ A;  3MSE B;  2NLN A;  4I5K A;  5JJG A;  1SCV A;  1YUR A;  5KSZ A;  1R2U A;  1CMG A;  1WLZ A;  5HLO A;  2BL0 C;  3KF9 A;  1W7I B;  4PHN A;  2QPT A;  1DJZ A;  3K21 A;  2M97 A;  1GQM A;  4YRU A;  1G8I A;  2MA2 A;  2R2I A;  5AAN A;  1FI6 A;  2LMU A;  2M8U A;  1RFJ A;  4M2O A;  1KK8 C;  2FOT A;  2JC2 A;  1SMG A;  2WND A;  3CS1 A;  3FIA A;  1TOP A;  1YRT B;  2GV5 A;  4CPV A;  1OMV A;  3OX6 A;  3ZWH A;  2I2R E;  5HYD A;  1A2X A;  1MHO A;  1IG5 A;  2JPT A;  2CNP A;  2E6W A;  4OR9 B;  2NXQ A;  2KAY A;  1QV0 A;  2KQ6 A;  1UHN A;  1ZUZ A;  2ZRT A;  1GGW A;  1JBA A;  2LNK A;  1S26 D;  1B8C A;  2JU0 A;  3LK0 A;  1XFZ O;  1QVI Z;  3LLE A;  1DT7 B;  1LA0 A;  1Y0V H;  2HPS A;  1YVH A;  1XFV O;  3NXA A;  1KFX L;  3KPX A;  4JWQ A;  3BOW B;  1MUX A;  5CSF A;  3TUY C;  2ZND A;  1S3P A;  3D10 A;  1OZO A;  1S5G Z;  1CNP A;  1KQM C;  1SR6 C;  2JWW A;  4GGF A;  1SRA A;  3CLN A;  1QLK A;  2LP2 A;  1GGZ A;  1QS7 A;  2F2P A;  2M1U A;  5G08 A;  4USL A;  1SK6 D;  1X02 A;  2KI4 B;  1AJ4 A;  1OQP A;  2JOJ A;  4CFR A;  2F3Z A;  2L2E A;  1F8H A;  2O60 A;  3IQO A;  4MN0 A;  3SIA A;  2V53 A;  5GQQ C;  1F54 A;  3I5F B;  1M39 A;  2LLU A;  2JT8 A;  4HRH A;  1J7Q A;  2WCF A;  1QX7 A;  1BLQ A;  3OP0 A;  4DIR A;  1EL4 A;  2LVI A;  1C7W A;  5IBW A;  2KNE A;  3BUW B;  3AKB A;  1K96 A;  3A4U B;  2EHB A;  4N1G A;  5HKZ A;  4NDB A;  2I94 A;  2F2O A;  1PSR A;  5PAL A;  4WQ2 A;  1TIZ A;  1AJ5 A;  2OS8 B;  1DJG A;  3EK8 A;  1J7O A;  2JNF A;  2LV7 A;  2CT9 A;  2MAZ A;  1SCM B;  1SPY A;  4PE1 A;  1QLS A;  2WOS A;  5B8I B;  1MR8 A;  1BT6 A;  4MVF A;  1CDN A;  2LLS A;  3DVE A;  2FJU B;  1CDM A;  3CZT X;  3CTN A;  1M46 A;  3D0Y B;  4ZCU A;  2M3W A;  1S6I A;  2BBN A;  1RWY A;  2DOQ A;  2K7D A;  2OTG B;  3VRO A;  3EKH A;  4GUK A;  2KGR A;  2L51 A;  4JQ0 D;  1CTR A;  2KI6 C;  5K89 A;  1XVJ A;  2K0J A;  4D1E A;  4GGF C;  3LK1 A;  1PAL A;  2OPO A;  4MBE A;  4QJ4 B;  1K93 D;  1SKT A;  2B1U A;  4MRX A;  4P5O E;  1YUU A;  2LC5 A;  2MLF C;  3E3R A;  3I5G B;  4GPL B;  1K8U A;  4P2Y B;  4PHM A;  3TS5 C;  1XFU O;  3JVT B;  2LMV A;  3QRX A;  1KQV A;  4PAL A;  4AOM A;  1A29 A;  1NIW A;  2FCD A;  4HRE E;  1CM1 A;  2L98 A;  1VRK A;  2HQW A;  1QX2 A;  2M49 B;  3I5I C;  4OKH A;  3OB2 B;  2LVK A;  2QAC A;  1K95 A;  1SL8 A;  4M2Q A;  4YGB B;  3PAL A;  4U8D A;  4GGN A;  1V1G A;  3O4Y A;  2EC6 B;  2KDH A;  3AKA A;  4I5N B;  3GK1 A;  1KFX S;  3VRP A;  4A4C A;  1EH2 A;  1XYD A;  3GK2 A;  1B4C A;  3ZNI A;  4C0L A;  3EVU A;  1MQ1 A;  1U5I A;  1A03 A;  2Q91 A;  3CR4 X;  3PSR A;  4HRG A;  3RLZ A;  2L0P A;  3SG2 A;  1QV1 A;  3H4S E;  2O5G A;  1B7T Y;  3TDU A;  1GJY A;  1SL7 A;  1Y1X A;  2PVB A;  4YBH B;  3WHU B;  5AER A;  1IQ5 A;  2BEC A;  3JTD C;  5TNC A;  3HCM A;  4OCI A;  5D69 A;  2KYC A;  2CTN A;  1AUI B;  5BPJ A;  2L4I A;  2PMY A;  1PVA A;  4ICB A;  1CMF A;  1UWO A;  2JUL A;  1XK4 A;  1EXR A;  1DJH A;  1KWO C;  2BL0 B;  2LHI A;  5AFP A;  3I5H C;  1TCF A;  4PHK A;  1IQ3 A;  3LL8 B;  3SG5 A;  2G2B A;  3IQQ A;  1PRW A;  2LVJ A;  1YUT A;  2MJW B;  2KFF A;  1A75 B;  2M7L A;  1R6P A;  3SG7 A;  1CDP A;  1DGV A;  4MLW A;  1BR4 B;  4NDC A;  1NX3 A;  2K8M B;  1KFU S;  3DVK A;  3O78 A;  3WXA A;  2WC8 A;  5JOL A;  4M2P A;  1NUB A;  4FTG A;  4YGC B;  5I2O A;  1CB1 A;  2NCP A;  2BKI B;  2LCP A;  1B9A A;  4PCW A;  1LA3 A;  1AK8 A;  2KBI A;  1NX2 A;  5D7F A;  4XJK B;  3O2P A;  1YVL A;  1NCY A;  2NZ0 A;  3SG6 A;  1FBV A;  2MHH A;  4GAO A;  1E8A A;  1S6J A;  2ZNE A;  5CPV A;  3SIB A;  1FF1 A;  2WOR A;  1UHI A;  1FPW A;  2JTT A;  2LVV A;  1F70 A;  1DGU A;  4I5J A;  1EJ3 A;  2KI6 D;  4MRY A;  1SYM A;  1WDC B;  1JUO A;  5HLV A;  2Y1M A;  3C1V A;  5AXI A;  4CLN A;  2CXJ A;  2Y5I A;  1J55 A;  5KU1 A;  1F4Q A;  4ETO A;  1SR6 B;  5I8N A;  1QTX A;  3GK4 X;  1BF5 A;  1KCY A;  2Y1N A;  1JF0 A;  1TCO B;  1ZFS A;  3BUX B;  3F45 A;  2LLT A;  2K61 A;  2A4J A;  2HQ8 A;  1QAS A;  1DVI A;  2P6B B;  3BUN B;  1C07 A;  1LVC D;  3CR5 X;  2JQ6 A;  2Q4U A;  1NCZ A;  1CLL A;  1XFW O;  1YX8 A;  3LCP C;  3SG3 A;  1UHH A;  1H8B A;  1IH0 A;  4AQJ A;  1KSM A;  1XK4 C;  1OE9 B;  1XO5 A;  1N0Y A;  2BE6 A;  4WQ3 A;  4MZJ A;  2KAX A;  3PN7 B;  2CCM A;  5CSJ A;  5ER4 X;  3DF0 B;  4I5L B;  1MXE A;  1CFD A;  1IJ6 A;  1B1G A;  2KI4 C;  4TNC A;  3TZ1 A;  2PAS A;  1NCX A;  4BY4 A;  1B47 A;  2KFH A;  1QIW A;  1Y6W A;  3GOF A;  3I5F C;  1HQV A;  2AUC A;  2FCE A;  1YTZ C;  1K9U A;  1G4Y R;  4PE4 A;  4DS7 A;  4GNK B;  2L50 A;  1K9K A;  1BR1 B;  3SG4 A;  1DF0 A;  2JRF A;  1N65 A;  3OX5 A;  2G9B A;  1AHR A;  1TNQ A;  3PAT A;  1CLB A;  1K90 D;  2K7O A;  2PSR A;  3O6B A;  1JFJ A;  4L9M A;  3VGO A;  1UUR A;  2BCA A;  4PDZ A;  4PE7 A;  1V1F A;  1M45 A;  2OS8 C;  3M0W A;  3BXK A;  1LXF C;  1SNL A;  1SCM C;  3KEV A;  1RJV A;  2H61 A;  1W7J B;  4YGA A;  3HX4 A;  3SJS A;  2M29 A;  5DKQ A;  4C0J A;  2OTG C;  1JFK A;  1AP4 A;  5HKY A;  1NX0 A;  5I2Q A;  1OMR A;  1OMD A;  2LP3 A;  4Q04 A;  2AAO A;  1ALW A;  2H2K A;  1A75 A;  1WLM A;  1ZAC A;  3I5G C;  5CSI A;  1IGV A;  1WRK A;  2LHL A;  1K9P A;  3JVT C;  1BOD A;  4HSZ A;  2M9G A;  1DJI A;  3OB1 B;  1K94 A;  1BOC A;  1MWN A;  4MZK A;  1L2O B;  1FW4 A;  3FWC A;  1S36 A;  1DJW A;  2BBM A;  1YUS A;  2TN4 A;  1PVB A;  3AAJ A;  4AQI A;  1IRJ A;  4XJK A;  1YR5 A;  3NSO A;  3KO0 A;  2EC6 C;  1NX1 A;  2HF5 A;  1EG4 A;  4R1E A;  4UPG A;  2KQY A;  2F3Y A;  4ORC B;  1UHK A;  3ICB A;  1G33 A;  5ER5 A;  3BOW A;  3OHM B;  2ZN9 A;  4N1F A;  3PFV A;  2F8P A;  2LAP A;  3BYA A;  1UP5 A;  2E30 A;  2ZFD A;  1ALV A;  1CM4 A;  2LUC A;  1F71 A;  1KK8 B;  2I7A A;  2Y4Q A;  5CSN A;  2EGD A;  1OSA A;  2H61 C;  1B8R A;  1Q80 A;  3BUO B;  3AAK A;  2CBL A;  3BQ3 A;  1CKK A;  2D8N A;  1DMO A;  2ZKM X;  1S5G Y;  1CDL A;  1MF8 B;  1TNX A;  1AVS A;  2IS9 A;  3VRN A;  2COL B;  2KGB C;  1ZMZ A;  3DF0 A;  1TTX A;  1RK9 A;  1PK0 D;  1SBJ A;  1WRZ A;  1B7T Z;  1QAT A;  2VRG A;  2BCX A;  2PAL A;  3KHE A;  1IKU A;  3VRQ A;  2KBM A;  2M7N A;  5J3X A;  1QIV A;  3TDI A;  1L7Z A;  1S1E A;  2RGI A;  2M1K B;  1PSB A;  1S6C A;  2JT0 A;  4OV2 A;  4XYN A;  1IJ5 A;  1B8L A;  3TUY B;  4YGE B;  4YI9 A;  4QJ5 B;  1U5I B;  1M31 A;  1QJT A;  2NCO A;  1KQM B;  1YX7 A;  1JC2 A;  2M0R A;  2BKH B;  1F4O A;  3WHT B;  2KSP A;  1RTP 1;  3A8R A;  2L4H A;  1DJX A;  3CWG A;  2KAV A;  1F55 A;  3D0Y A;  5AEQ A;  4MZL A;  1KK7 Y;  1MXL C;  5I2L A;  2LE9 B;  2AMI A;  4NDD A;  1YRU B;  1XA5 A;  2JZI A;  1EG3 A;  4GBA A;  2MLE C;  3PM8 A;  1WDC C;  2KYF A;  1CFP A;  2JTZ A;  4CFQ A;  2JT3 A;  5DKN A;  1NYA A;  2GGZ A;  3RM1 A;  1NWD A;  1SY9 A;  1JSA A;  2JXL A;  3DD4 A;  4FQO A;  1H4B A;  3DVM A;  1CLM A;  5HKW A;  4NQG A;  3FWB A;  2JNX A;  3TDZ A;  2SAS A;  1WRL A;  4YI8 A;  3BUM B;  1JF2 A;  1WY9 A;  2L5X B;  1CFC A;  2LM5 A;  3PN7 C;  2K7C A;  4OVN F;  1D1O A;  1BMO A;  2LMT A;  1JWD A;  3NSI A;  4DCK A;  4QJ3 B;  1TRF A;  4CID A;  4DUQ A;  1J1D A;  1IWQ A;  3NSK A;  4ORA B;  1BU3 A;  3EVV A;  4PE0 A;  1KK7 Z;  2K2F A;  4F0Z B;  3IF7 A;  1J1E A;  1QX5 B;  1KFU L;  1J7R A;  1QXP A;  1XFX O;  2I18 A;  3EK4 A;  2K2A A;  5FYX A;  1TNP A;  1N2D A;  2KFG A;  1UUS A;  3TS5 B;  1C7V A;  3WNX B;  3PLF B;  4GFT A;  3FS7 A;  1TN4 A;  1NPQ A;  1REC A;  3I5I B;  4MEW A;  4DRW A;  1SL9 A;  2WCE A;  2PRU A;  4ZCV A;  2MRD A;  2SCP A;  4IL1 A;  4MSP A;  1SW8 A;  2KHN A;  1K2H A;  2ZN8 A;  1Y1U A;  2BE4 A;  1DJY A;  4BY5 A;  1A4P A;  2WCB A;  4ORB B;  5DKR A;  1PUL A;  2JXC A;  1J7P A;  1HT9 A;  1Y1A A;  1KSO A;  1UHJ A;  1NP8 A;  1NSH A;  1FI5 A;  3EK7 A;  1ZOT B;  1BG1 A;  2BCB A;  3DVJ A;  2LAN A;  2ZRS A;  4YGD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...