2KI6D

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
97
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6D00
2AAOA 2B1UA 2KFGA 4BY5A 1KK7Z 3SIAA 3SG2A 4DIRA 3TZ1A 1YUTA 1BT6A 4MBEA 2K7CA 4ORBB 3F45A 1F71A 5PALA 4GNKB 3PLFB 3EK4A 3SIBA 3NSIA 4ICBA 4L9MA 3PALA 1L2OB 2JRFA 1JC2A 1CM4A 1DJYA 2WORA 1LINA 2KQ6A 1YVHA 1J7RA 2WOSA 1SR6B 5AXIA 2GGMA 1IJ5A 4PHNA 1S6IA 2D8NA 1ZFSA 1IQ3A 4IL1A 2LLTA 1SR6C 4I5NB 1CFPA 2M1KB 4R1EA 4MSPA 4YRUA 1EJ3A 1SL9A 2MLFC 5IBWA 1MF8B 3OB1B 4CPVA 1HT9A 1OQPA 2EC6B 2Y1NA 1K93D 1U5IB 5AERA 1QVIY 2LUXA 2KFFA 4GGFA 4GBAA 2KBMA 2EC6C 3D0YB 1S6JA 1ALWA 1QIWA 1NUBA 1CLLA 1SRAA 5I2LA 1IG5A 1SY9A 3CR2A 1SL8A 2F3YA 3EVUA 1NCYA 1QVIZ 1FW4A 1IRJA 1Q80A 4PE4A 4DCKA 2P6BB 1Y1UA 2NCOA 1KWOC 2KGBC 1XFVO 4YGCB 1B9AA 2LV7A 3FWBA 3JVTB 4MRYA 1SPYA 1XFXO 1KQVA 2PVBA 1TNXA 4E68A 2G9BA 4PE7A 1SL7A 3GK4X 3SG4A 3JVTC 1ZOTB 3MSEB 1MQ1A 5I2OA 2HF5A 1SYMA 4YI8A 1K9UA 1C7VA 2OTGB 1SCVA 3BOWA 3RM1A 1YRUB 3I5HB 1DTLA 2LLUA 1BOCA 1UP5A 5AEQA 2OTGC 1UWOA 2O60A 1WDCB 4AOMA 1S5GY 2GV5A 4GFTA 3I5HC 4PDZA 3H4SE 5DKQA 5HLVA 1KFUL 2V53A 3NSKA 1B8CA 1WDCC 1WRLA 1M63B 1DGVA 3OX5A 2Y5IA 5CPVA 2KI4B 1WRKA 4FQOA 1K9PA 1S5GZ 2ZNEA 3JTDB 1QV0A 2L51A 4P2YB 2M8UA 1K96A 2KI4C 2WCEA 3DVKA 1OMRA 2K8MB 1YURA 1B7TY 2WCBA 1XK4C 1A75B 3JTDC 1SCMB 2O5GA 1SKTA 2JULA 4XJKB 1H4BA 3DVJA 2LP3A 1V1FA 1DJIA 1IKUA 4CFRA 2HQ8A 1DJXA 1KFUS 2LVJA 2JNXA 2K7BA 3IF7A 2F8PA 1GGWA 5D7FA 3TS5B 1FI6A 1RJVA 4QJ3B 1OOJA 1MUXA 2F3ZA 1UHIA 2BCAA 2R2IA 1DF0B 1KFXS 3AAKA 4PE0A 2JPTA 1OMVA 1NWDA 1K9KA 2DOQA 3TS5C 4I5LB 2K61A 1S1EA 2KGRA 1PSBA 3PM8A 5GQQC 1CTRA 4MVFA 3CR5X 4F0ZB 1K2HA 1PK0D 1W7IB 2CT9A 2K0JA 5DKRA 1LA0A 1YVLA 3DD4A 1GQMA 2IS9A 4USLA 1C7WA 1JFJA 1BMOA 2JQ6A 2LNKA 1TNQA 1M46A 2BE6A 2MBXA 1CDNA 1LKJA 1TTXA 2K2FA 1DGUA 1EL4A 2H61C 1JWDA 1CB1A 4N1GA 1OZOA 2PALA 3O6BA 1MHOA 3BXKA 3WHTB 2ZNDA 3BUXB 4PE1A 1TCFA 1RWYA 4CFQA 1EXRA 4PCWA 4M2PA 2BKHB 2LHIA 3AKAA 1G33A 2BBMA 5I8NA 2LVVA 1JF2A 3PATA 4JPZB 4WRIA 3OB2B 1M45A 1K8UA 4OV2A 3PN7B 5HKZA 1U5IA 3BUWB 5BPJA 2L50A 1A4PA 3I5IB 4HRGA 5TNCA 4GPLB 1G4YR 4P5OE 5J3XA 2KAYA 1B47A 1YRTB 3PN7C 2LM5A 2NLNA 3D0YA 5I2QA 1TNWA 2JZIA 5CSFA 1HQVA 3I5IC 3SG6A 1DJWA 1BR4B 1WY9A 1L7ZA 1ALVA 4ZCUA 1G8IA 4YGBB 1XYDA 1J1DA 1PVBA 3EVVA 1EG3A 1IGVA 1JF0A 1DT7B 2WNDA 2M0RA 1QXPA 2KSPA 1GGZA 2L0PA 4GAOA 4C0LA 1CMGA 2Q91A 3LCPC 1KWOB 3NXAA 1S26D 3AAJA 3VGOA 3CGAA 1QX5B 3DVMA 5KTYA 1M31A 4M2OA 2MA2A 1M39A 1N0YA 1RROA 2LMTA 2MAZA 1B8RA 4MZKA 5KSZA 1CLBA 2CXJA 2E30A 2KNEA 1UUSA 2JT3A 1BODA 1X02A 3OX6A 2QPTA 1NP8A 1J7OA 5K89A 1BJFA 1QIVA 1FF1A 2FCEA 2ZN9A 3BUOB 4HSZA 2F2PA 2CNPA 1NIWA 1NYAA 3VRQA 3PFVA 1CFDA 3WXAA 1GJYA 3DF0B 2I2RE 1QATA 1NCZA 1R6PA 1XO5A 2BCBA 1N65A 1A29A 1XA5A 3C1VA 3KF9A 2H2KA 1B8LA 3VRPA 2OS8B 1A2XA 3ZNIA 1OSAA 1QJTA 1J7PA 3TDIA 2JWWA 1F4OA 5B8IB 1PRWA 4AQJA 1YX7A 2GGZA 3GOFA 2OS8C 3BQ3A 4GUKA 1W7JB 4MEWA 1QX2A 2KQYA 2ZN8A 3KO0A 4N1FA 4OKHA 1AVSA 1QV1A 1CNPA 2L98A 2M3WA 3EVRA 4MRXA 2SASA 1AK8A 1IQ5A 3BYAA 3LK0A 1SW8A 1TOPA 3TDUA 2ISDA 2KFHA 1DVIA 4JWQA 2KBIA 2ZFDA 3RLZA 2JTTA 1BU3A 1CDPA 1CDLA 2CCMA 3BUMB 3FIAA 4MN0A 2LUCA 4NDBA 1CKKA 1VRKA 2M49B 1YX8A 3TDZA 1Y6WA 2M29A 5HKYA 3OP0A 2L2EA 1CLMA 1JFKA 2MRDA 1KQMB 1N2DA 2LAPA 1WLMA 3SJSA 1OMDA 3O4YA 1CDMA 2HQWA 4MZLA 4NDDA 2LE9B 3LK1A 1DF0A 1XVJA 1KQMC 4I5KA 1FI5A 1TCOB 1SBJA 1PALA 4MLWA 1UHKA 1RFJA 3NSLA 2EHBA 5CSNA 4UPGA 4HRHA 1A03A 1BLQA 2ZRTA 2A4JA 2TN4A 3LL8B 5F6TA 2NCPA 4TNCA 2AMIA 2BKIB 1F8HA 1BG1A 2JXLA 2KI6C 2K2AA 2LMUA 3A8RA 4CLNA 4QJ5B 2H61A 2LVKA 2LCPA 4C0JA 4NQGA 4GGNA 1DJGA 1XFUO 2M1UA 1MXEA 4BY4A 3CTNA 1QS7A 1F54A 2I18A 4ORCB 1E8AA 1TN4A 1UHJA 2JNFA 1OE9B 5JJGA 2K7OA 2LHLA 5FYXA 3O2PA 4NDCA 1Y1AA 2KAXA 2L5XB 4OCIA 5CSJA 5D69A 1IWQA 1BR1B 2KYFA 5HKWA 1KCYA 2L4HA 3VRRA 1LA3A 1QX7A 1XFYO 2CBLA 2NXQA 1AJ5A 2OPOA 1YUSA 3FS7A 2SCPA 4YGEB 1LXFC 3GK2A 4D1EA 3BUNB 4HREE 3SG7A 4CIDA 1UHNA 2LLSA 1KSMA 3NSOA 4DUQA 1LVCD 4DRWA 2PRUA 1NX0A 2MJWB 1QASA 2KDHA 1H8BA 2BECA 2LC5A 3SG3A 1ZMZA 1DJZA 1MR8A 3SG5A 1SK6D 4AQIA 2FOTA 1L2OC 3CLNA 3KPXA 4A4CA 3K21A 1ZUZA 4M2QA 2CTNA 2KYCA 1PVAA 3EKJA 5G08A 1NX2A 4A4BA 4ORAB 1CMFA 2M9GA 3GK1A 4DS7A 1YTZC 3PSRA 2BL0B 2PMYA 1JBAA 1S36A 1JUOA 1QTXA 1NPQA 3CWGA 2WCFA 4ZCVA 4MZJA 2BL0C 3A4UB 3ZWHA 1F70A 4Q04A 5ER4X 2KAVA 2JT8A 1CFCA 5DKNA 1YR5A 2L4IA 2JTZA 1NX1A 2I94A 1J7QA 1KK8B 4N5XA 1SMGA 2PSRA 1CFFA 1MXLC 3M0WA 1NSHA 1XFWO 3DF0A 1NCXA 3KHEA 2HETA 3TUYB 1Y0VH 2M7NA 1WLZA 4QJ4B 1F4QA 3LLEA 1KK8C 1RTP1 1K90D 1QLSA 2F2OA 1RK9A 2JT0A 2VRGA 3QRXA 5CSIA 3TUYC 1UURA 3CS1A 2MHHA 2LVIA 1DJHA 3DVEA 3I5FB 4U8DA 1JSAA 1S6CA 1EH2A 1WRZA 4GGFC 1OZSA 3VROA 1NX3A 1F55A 1AUIB 4PHJA 2HPSA 1V1GA 1TRFA 1K94A 3I5FC 3KEVA 2RGIA 4YBHB 1D1OA 2F33A 1AJ4A 2LP2A 1AP4A 4C0KA 4OVNF 2BCXA 2FJUB 2WC8A 1MWNA 2EGDA 4FTGA 2JOJA 4PHKA 3CZTX 5HLOA 3IQQA 1CM1A 1XK4A 5AFPA 2COLB 1IJ6A 2FCDA 1B1GA 4YGAA 2NZ0A 1Y1XA 3VRNA 3HX4A 1FPWA 1PSRA 2ZRSA 2G2BA 1A75A 3IQOA 4XJKA 1S3PA 2BBNA 2Y1MA 2QACA 2E6WA 2LMVA 2PASA 3HCMA 1J1EA 2MLEC 3AKBA 1BF5A 1AHRA 1TIZA 3BOWB 4ETOA 1ZACA 2I7AA 3EKHA 3D10A 1YUUA 4PHMA 5JOLA 3EK7A 5AANA 2Y4QA 1J55A 4YGDB 3WHUB 2LANA 1ODBA 1R2UA 4I5JA 1KFXL 1QLKA 2BE4A 2JU0A 2KOTA 2M97A 3ICBA 1C07A 1PULA 2K7DA 1SNLA 3OHMB 4PALA 3I5GB 3WNXB 3CR4X 3EK8A 1EG4A 2AUCA 4XYNA 2ZKMX 1RECA 4YI9A 2M7LA 2JC2A 2KHNA 3I5GC 3E3RA 5HYDA 1K95A 1SCMC 1XFZO 4WQ3A 1IH0A 1KSOA 1B7TZ 1UHHA 1DMOA 1KK7Y 1FBVA 3O78A 1B4CA 1TNPA 4OR9B 2JXCA 4JQ0D 5KU1A 3FWCA 2KI6D 4WQ2A 2Q4UA 5ER5A
chains in the Genus database with same CATH superfamily
2AAOA 2B1UA 2KFGA 4BY5A 1KK7Z 3SIAA 3SG2A 4DIRA 3TZ1A 4FQTA 1YUTA 1BT6A 4MBEA 2K7CA 4ORBB 3F45A 1F71A 5PALA 4GNKB 3PLFB 3EK4A 3SIBA 3NSIA 4ICBA 3UNWA 4L9MA 3PALA 1L2OB 3S0FA 2JRFA 1JC2A 1CM4A 1DJYA 2WORA 3R1VA 1LINA 2KQ6A 1YVHA 1DC1A 2WC6A 1J7RA 1T14A 2WOSA 1SR6B 5AXIA 3V2LA 4IJ7A 2GGMA 1IJ5A 4PHNA 1S6IA 2D8NA 1ZFSA 1IQ3A 4IL1A 2LLTA 1SR6C 4I5NB 1CFPA 2M1KB 4R1EA 4MSPA 4YRUA 1EJ3A 1SL9A 2MLFC 3SS3A 5IBWA 1MF8B 3OB1B 4CPVA 1HT9A 1OQPA 2EC6B 2Y1NA 3FE8A 1K93D 1U5IB 5AERA 1QVIY 3PJIA 2LUXA 2KFFA 4GGFA 4GBAA 2KBMA 2EC6C 3D0YB 1S6JA 1ALWA 1QIWA 1XFRA 1NUBA 1CLLA 1SRAA 5I2LA 1IG5A 1SY9A 3CR2A 1SL8A 2F3YA 3EVUA 1NCYA 1QVIZ 1FW4A 1IRJA 1Q80A 4PE4A 3DYEA 4DCKA 2P6BB 1Y1UA 2NCOA 1KWOC 2KGBC 1XFVO 4YGCB 1B9AA 2LV7A 3FWBA 3JVTB 4MRYA 1SPYA 1TWOA 1XFXO 3D78A 1KQVA 2PVBA 1TNXA 4E68A 2G9BA 4PE7A 1SL7A 3GK4X 3SG4A 3JVTC 1ZOTB 1OOGA 3MSEB 1MQ1A 5I2OA 2HF5A 5FI7A 1SYMA 4YI8A 1K9UA 1C7VA 2OTGB 1SCVA 3BOWA 3RM1A 1YRUB 4INXA 1CKKA 3I5HB 1DTLA 2LLUA 1BOCA 1UP5A 5AEQA 2OTGC 1UWOA 2O60A 1WDCB 4AOMA 1S5GY 2GV5A 4GFTA 3I5HC 4PDZA 3H4SE 5DKQA 5HLVA 1KFUL 2QDIA 3OGNA 2V53A 3NSKA 1B8CA 1WDCC 1WRLA 1M63B 1DGVA 3OX5A 2Y5IA 5CPVA 2KI4B 1WRKA 3S0DA 4FQOA 1K9PA 1S5GZ 2ZNEA 3JTDB 1QV0A 2L51A 4P2YB 2M8UA 1K96A 2KI4C 2WCEA 3BJHA 3DVKA 1OMRA 2K8MB 4F7FA 1YURA 1B7TY 2WCBA 1XK4C 1A75B 3JTDC 1SCMB 2O5GA 1SKTA 2JULA 4XJKB 2WCMA 2YGUA 3DVJA 1H4BA 2LP3A 1V1FA 1DJIA 1IKUA 4CFRA 2HQ8A 1DJXA 1KFUS 2LVJA 2JNXA 2K7BA 3BFBA 3IF7A 2F8PA 1GGWA 5D7FA 3TS5B 1FI6A 1RJVA 4QJ3B 1OOJA 1MUXA 2F3ZA 1UHIA 2BCAA 2R2IA 1DF0B 1KFXS 3AAKA 3QMEA 4PE0A 2JPTA 1OMVA 1NWDA 1K9KA 2DOQA 3TS5C 1TUJA 4I5LB 5D3OA 2K61A 1S1EA 2KGRA 1PSBA 3PM8A 5GQQC 1CTRA 4MVFA 3CR5X 4F0ZB 1K2HA 3R1OA 3Q8IA 1PK0D 1W7IB 2CT9A 2K0JA 5DKRA 1GM0A 1LA0A 1YVLA 3DD4A 1Z4HA 1GQMA 2IS9A 4USLA 1C7WA 1JFJA 1BMOA 2JQ6A 2LNKA 3CZ2A 1TNQA 1M46A 2L5YA 2BE6A 2MBXA 1CDNA 1LKJA 1TTXA 2K2FA 1DGUA 1EL4A 2H61C 1JWDA 1CB1A 1ORGA 3D73A 3D75A 4N1GA 1OZOA 1OW4A 2PALA 3O6BA 5HL1A 1MHOA 3BXKA 3WHTB 2ZNDA 3BUXB 1OOHA 4PE1A 1TCFA 1RWYA 4CFQA 1EXRA 4PCWA 4M2PA 1QWVA 2BKHB 2LHIA 3AKAA 1G33A 2BBMA 5I8NA 3OBVA 2LVVA 1JF2A 3PATA 4JPZB 4WRIA 3IVTA 1M45A 1K8UA 3OB2B 3PN7B 4OV2A 1U5IA 3BUWB 5HKZA 5BPJA 2L50A 1A4PA 3I5IB 4HRGA 5TNCA 4GPLB 1G4YR 4P5OE 5J3XA 3FE6A 2KAYA 1B47A 1YRTB 3PN7C 2LM5A 2NLNA 3D0YA 5I2QA 1TNWA 1DELA 2JZIA 1HQVA 3I5IC 5CSFA 2H8VA 2PQLA 3SG6A 1DJWA 3RZSA 1BR4B 1WY9A 1L7ZA 1ALVA 5EL2A 4ZCUA 1G8IA 4YGBB 1XYDA 1J1DA 1PVBA 3EVVA 1EG3A 1IGVA 1JF0A 1DT7B 2WNDA 2M0RA 3CZ1A 1QXPA 2KSPA 3D77A 1GGZA 2L0PA 3PM2A 4GAOA 4JKTA 4C0LA 1CMGA 2Q91A 3LCPC 1KWOB 3NXAA 1S26D 3AAJA 3VGOA 3CGAA 1QX5B 3DVMA 5KTYA 1M31A 4M2OA 2MA2A 1M39A 1N0YA 1RROA 2LMTA 2MAZA 1B8RA 4MZKA 5KSZA 1CLBA 2CXJA 2E30A 2KNEA 1UUSA 2JT3A 1BODA 1X02A 3OX6A 2QPTA 1NP8A 2KLDA 5K89A 1J7OA 1BJFA 1QIVA 1FF1A 2FCEA 2ZN9A 3BUOB 4HSZA 5ER5A 2F2PA 2CNPA 1NIWA 1NYAA 3VRQA 3DZTA 3PFVA 1CFDA 3CABA 3B86A 3WXAA 1GJYA 3DF0B 2I2RE 1QATA 1NCZA 1R6PA 1XO5A 2BCBA 1N65A 1A29A 1XA5A 3C1VA 3KF9A 2WCLA 2H2KA 1B8LA 3VRPA 2OS8B 1A2XA 3B87A 3ZNIA 1OSAA 1QJTA 1J7PA 3TDIA 2JWWA 1F4OA 5B8IB 1PRWA 2KPHA 3CYZA 4AQJA 1YX7A 2GGZA 3GOFA 1DQEA 2OS8C 3BQ3A 4GUKA 1W7JB 4MEWA 1QX2A 2KQYA 2ZN8A 3KO0A 4N1FA 4OKHA 1AVSA 1QV1A 1CNPA 2L98A 2M3WA 3EVRA 4MRXA 2SASA 1AK8A 1IQ5A 3BYAA 3LK0A 1SW8A 1TOPA 3TDUA 2ISDA 3S0BA 2KFHA 1DVIA 4JWQA 2KBIA 2ZFDA 3RLZA 2JTTA 1BU3A 1CDPA 1CDLA 2CCMA 2BNXA 2ERBA 3BUMB 2LUCA 3FIAA 4MN0A 4NDBA 4PT1A 1VRKA 3SS4A 3BFHA 2M49B 1YX8A 3TDZA 1LS8A 1Y6WA 2M29A 5HKYA 3OP0A 2L2EA 1CLMA 1JFKA 2MRDA 1KQMB 2P70A 1N2DA 2LAPA 1WLMA 3SJSA 1OMDA 3O4YA 1CDMA 2HQWA 4MZLA 4NDDA 2LE9B 3LK1A 1DF0A 1XVJA 1KQMC 4I5KA 2QEHA 1FI5A 1TCOB 1SBJA 1PALA 4MLWA 1UHKA 1RFJA 3NSLA 3EG5B 1Z2CB 2EHBA 3O4XA 1IIOA 5CSNA 4UPGA 4HRHA 1A03A 1BLQA 2ZRTA 2A4JA 2TN4A 3LL8B 5F6TA 2NCPA 2BAPA 4TNCA 2AMIA 2BKIB 3B7AA 1F8HA 1BG1A 3D76A 2JXLA 2KI6C 2K2AA 2LMUA 3A8RA 4CLNA 4QJ5B 2H61A 2LVKA 3R1PA 2LCPA 4C0JA 4NQGA 4GGNA 1DJGA 1XFUO 2M1UA 1MXEA 3NHTA 4BY4A 3CTNA 1QS7A 1F54A 2I18A 3B6XA 4ORCB 1E8AA 3BFAA 1TN4A 1UHJA 2JNFA 1OE9B 5JJGA 2K7OA 2LHLA 3B88A 5FYXA 1SSEB 3O2PA 4NDCA 1Y1AA 2KAXA 2L5XB 4OCIA 5CSJA 5D69A 1IWQA 1BR1B 2L2CA 2KYFA 5HKWA 1KCYA 5FI2A 2L4HA 3VRRA 1LA3A 1QX7A 1XFYO 2CBLA 2NXQA 1AJ5A 2OPOA 1YUSA 3FS7A 3S0EA 2WCKA 2SCPA 4YGEB 1LXFC 3GK2A 2P71A 4D1EA 3BUNB 4HREE 3SG7A 4CIDA 1UHNA 2LLSA 1KSMA 1OOIX 3NSOA 2QEOA 4DUQA 1LVCD 4DRWA 2PRUA 2WCHA 1NX0A 2MJWB 1QASA 2KDHA 1H8BA 2BECA 2LC5A 1W9ZA 3DY9A 3SG3A 1ZMZA 1DJZA 1MR8A 3SG5A 1SK6D 4AQIA 2FOTA 1L2OC 3CLNA 3KPXA 4A4CA 3K21A 1ZUZA 4M2QA 2CTNA 2KYCA 1PVAA 3EKJA 5G08A 1NX2A 4A4BA 2PYQA 4ORAB 1CMFA 2M9GA 3GK1A 4DS7A 1YTZC 3S0GA 2WC5A 3PSRA 2BL0B 2PMYA 3D74A 1JBAA 1S36A 1JUOA 1QTXA 4INWA 1NPQA 3CWGA 2WCFA 4ZCVA 3CDNA 4MZJA 2BL0C 3A4UB 3ZWHA 1F70A 4Q04A 5ER4X 2KAVA 3R72A 2JT8A 1CFCA 5DKNA 1YR5A 1OOFA 2L4IA 2JTZA 5FI6A 1NX1A 2I94A 1J7QA 1KK8B 4N5XA 1SMGA 2PSRA 1CFFA 1MXLC 3M0WA 1NSHA 1XFWO 3DF0A 1NCXA 3KHEA 2HETA 3TUYB 1Y0VH 2M7NA 1WLZA 4QJ4B 1F4QA 3LLEA 1KK8C 1RTP1 1K90D 1QLSA 2F2OA 1RK9A 2JT0A 2VRGA 1C3ZA 3QRXA 5CSIA 3SS5A 3TUYC 1UURA 3CS1A 2JPOA 2MHHA 2LVIA 2QEVA 1DJHA 3DVEA 3I5FB 4U8DA 3NHIA 1JSAA 1S6CA 1EH2A 1WRZA 4GGFC 1OZSA 3VROA 1NX3A 1F55A 1AUIB 4PHJA 2HPSA 1V1GA 1TRFA 1K94A 3I5FC 3KEVA 2RGIA 4YBHB 3UO9A 2F33A 1D1OA 1AJ4A 2LP2A 1AP4A 4C0KA 4OVNF 2BCXA 2FJUB 2WC8A 1MWNA 2EGDA 4FTGA 2JOJA 4PHKA 3CZTX 5HLOA 3IQQA 1CM1A 1XK4A 5AFPA 2COLB 1IJ6A 2FCDA 3L4AA 1B1GA 4YGAA 2K60A 1Y1XA 2NZ0A 3N7HA 3HX4A 3VRNA 1FPWA 1PSRA 2ZRSA 2G2BA 3S0AA 1A75A 3IQOA 5I94A 4XJKA 4KYNA 1C3YA 1S3PA 2BBNA 2Y1MA 2QACA 2E6WA 2LMVA 2PASA 3HCMA 1J1EA 1TUZA 2MLEC 3AKBA 1BF5A 1AHRA 1TIZA 3BOWB 4ETOA 1ZACA 2I7AA 2KLEA 3EKHA 3FE9A 3D10A 1YUUA 4PHMA 5JOLA 3EK7A 4JD9A 5AANA 2Y4QA 1J55A 5DICA 4YGDB 3WHUB 2LANA 3VB1A 1ODBA 2QEBA 1R2UA 4I5JA 1KFXL 1QLKA 2BE4A 2GTEA 2JU0A 2KOTA 2M97A 3ICBA 3L4LA 1C07A 1PULA 3CZ0A 2K7DA 1SNLA 3OHMB 4PALA 3I5GB 3WNXB 3CR4X 3EK8A 1EG4A 2AUCA 4XYNA 2ZKMX 1RECA 4YI9A 2M7LA 2WCJA 2JC2A 2KHNA 3I5GC 3E3RA 5HYDA 1K95A 1SCMC 1XFZO 3NGVA 4WQ3A 1IH0A 1KSOA 1B7TZ 1UHHA 3K1EA 1DMOA 1KK7Y 1FBVA 1DEKA 3O78A 1B4CA 1TNPA 3L47A 4OR9B 2JXCA 4JQ0D 4OZDA 5KU1A 3DXLA 3FWCA 2KI6D 4WQ2A 2Q4UA 2FJYA 1P28A
chains in the Genus database with same CATH topology
2AAOA 2B1UA 2KFGA 4BY5A 1KK7Z 3SIAA 3SG2A 4DIRA 3TZ1A 1YUTA 1BT6A 4MBEA 2K7CA 4ORBB 3F45A 1F71A 5PALA 4GNKB 3PLFB 3EK4A 3SIBA 3NSIA 4ICBA 4L9MA 3PALA 1L2OB 2JRFA 1JC2A 1CM4A 1DJYA 2WORA 1LINA 2KQ6A 1YVHA 1J7RA 2WOSA 1SR6B 5AXIA 2GGMA 1IJ5A 4PHNA 1S6IA 2D8NA 1ZFSA 1IQ3A 4IL1A 2LLTA 1SR6C 4I5NB 1CFPA 2M1KB 4R1EA 4MSPA 4YRUA 1EJ3A 1SL9A 2MLFC 5IBWA 1MF8B 3OB1B 4CPVA 1HT9A 1OQPA 2EC6B 2Y1NA 1K93D 1U5IB 5AERA 1QVIY 2LUXA 2KFFA 4GGFA 4GBAA 2KBMA 2EC6C 3D0YB 1S6JA 1ALWA 1QIWA 1NUBA 1CLLA 1SRAA 5I2LA 1IG5A 1SY9A 3CR2A 1SL8A 2F3YA 3EVUA 1NCYA 1QVIZ 1FW4A 1IRJA 1Q80A 4PE4A 4DCKA 2P6BB 1Y1UA 2NCOA 1KWOC 2KGBC 1XFVO 4YGCB 1B9AA 2LV7A 3FWBA 3JVTB 4MRYA 1SPYA 1XFXO 1KQVA 2PVBA 1TNXA 4E68A 2G9BA 4PE7A 1SL7A 3GK4X 3SG4A 3JVTC 1ZOTB 3MSEB 1MQ1A 5I2OA 2HF5A 1SYMA 4YI8A 1K9UA 1C7VA 2OTGB 1SCVA 3BOWA 3RM1A 1YRUB 3I5HB 1DTLA 2LLUA 1BOCA 1UP5A 5AEQA 2OTGC 1UWOA 2O60A 1WDCB 4AOMA 1S5GY 2GV5A 4GFTA 3I5HC 4PDZA 3H4SE 5DKQA 5HLVA 1KFUL 2V53A 3NSKA 1B8CA 1WDCC 1WRLA 1M63B 1DGVA 3OX5A 2Y5IA 5CPVA 2KI4B 1WRKA 4FQOA 1K9PA 1S5GZ 2ZNEA 3JTDB 1QV0A 2L51A 4P2YB 2M8UA 1K96A 2KI4C 2WCEA 3DVKA 1OMRA 2K8MB 1YURA 1B7TY 2WCBA 1XK4C 1A75B 3JTDC 1SCMB 2O5GA 1SKTA 2JULA 4XJKB 1H4BA 3DVJA 2LP3A 1V1FA 1DJIA 1IKUA 4CFRA 2HQ8A 1DJXA 1KFUS 2LVJA 2JNXA 2K7BA 3IF7A 2F8PA 1GGWA 5D7FA 3TS5B 1FI6A 1RJVA 4QJ3B 1OOJA 1MUXA 2F3ZA 1UHIA 2BCAA 2R2IA 1DF0B 1KFXS 3AAKA 4PE0A 2JPTA 1OMVA 1NWDA 1K9KA 2DOQA 3TS5C 4I5LB 2K61A 1S1EA 2KGRA 1PSBA 3PM8A 5GQQC 1CTRA 4MVFA 3CR5X 4F0ZB 1K2HA 1PK0D 1W7IB 2CT9A 2K0JA 5DKRA 1LA0A 1YVLA 3DD4A 1GQMA 2IS9A 4USLA 1C7WA 1JFJA 1BMOA 2JQ6A 2LNKA 1TNQA 1M46A 2BE6A 2MBXA 1CDNA 1LKJA 1TTXA 2K2FA 1DGUA 1EL4A 2H61C 1JWDA 1CB1A 4N1GA 1OZOA 2PALA 3O6BA 1MHOA 3BXKA 3WHTB 2ZNDA 3BUXB 4PE1A 1TCFA 1RWYA 4CFQA 1EXRA 4PCWA 4M2PA 2BKHB 2LHIA 3AKAA 1G33A 2BBMA 5I8NA 2LVVA 1JF2A 3PATA 4JPZB 4WRIA 3OB2B 1M45A 1K8UA 4OV2A 3PN7B 5HKZA 1U5IA 3BUWB 5BPJA 2L50A 1A4PA 3I5IB 4HRGA 5TNCA 4GPLB 1G4YR 4P5OE 5J3XA 2KAYA 1B47A 1YRTB 3PN7C 2LM5A 2NLNA 3D0YA 5I2QA 1TNWA 2JZIA 5CSFA 1HQVA 3I5IC 3SG6A 1DJWA 1BR4B 1WY9A 1L7ZA 1ALVA 4ZCUA 1G8IA 4YGBB 1XYDA 1J1DA 1PVBA 3EVVA 1EG3A 1IGVA 1JF0A 1DT7B 2WNDA 2M0RA 1QXPA 2KSPA 1GGZA 2L0PA 4GAOA 4C0LA 1CMGA 2Q91A 3LCPC 1KWOB 3NXAA 1S26D 3AAJA 3VGOA 3CGAA 1QX5B 3DVMA 5KTYA 1M31A 4M2OA 2MA2A 1M39A 1N0YA 1RROA 2LMTA 2MAZA 1B8RA 4MZKA 5KSZA 1CLBA 2CXJA 2E30A 2KNEA 1UUSA 2JT3A 1BODA 1X02A 3OX6A 2QPTA 1NP8A 1J7OA 5K89A 1BJFA 1QIVA 1FF1A 2FCEA 2ZN9A 3BUOB 4HSZA 2F2PA 2CNPA 1NIWA 1NYAA 3VRQA 3PFVA 1CFDA 3WXAA 1GJYA 3DF0B 2I2RE 1QATA 1NCZA 1R6PA 1XO5A 2BCBA 1N65A 1A29A 1XA5A 3C1VA 3KF9A 2H2KA 1B8LA 3VRPA 2OS8B 1A2XA 3ZNIA 1OSAA 1QJTA 1J7PA 3TDIA 2JWWA 1F4OA 5B8IB 1PRWA 4AQJA 1YX7A 2GGZA 3GOFA 2OS8C 3BQ3A 4GUKA 1W7JB 4MEWA 1QX2A 2KQYA 2ZN8A 3KO0A 4N1FA 4OKHA 1AVSA 1QV1A 1CNPA 2L98A 2M3WA 3EVRA 4MRXA 2SASA 1AK8A 1IQ5A 3BYAA 3LK0A 1SW8A 1TOPA 3TDUA 2ISDA 2KFHA 1DVIA 4JWQA 2KBIA 2ZFDA 3RLZA 2JTTA 1BU3A 1CDPA 1CDLA 2CCMA 3BUMB 3FIAA 4MN0A 2LUCA 4NDBA 1CKKA 1VRKA 2M49B 1YX8A 3TDZA 1Y6WA 2M29A 5HKYA 3OP0A 2L2EA 1CLMA 1JFKA 2MRDA 1KQMB 1N2DA 2LAPA 1WLMA 3SJSA 1OMDA 3O4YA 1CDMA 2HQWA 4MZLA 4NDDA 2LE9B 3LK1A 1DF0A 1XVJA 1KQMC 4I5KA 1FI5A 1TCOB 1SBJA 1PALA 4MLWA 1UHKA 1RFJA 3NSLA 2EHBA 5CSNA 4UPGA 4HRHA 1A03A 1BLQA 2ZRTA 2A4JA 2TN4A 3LL8B 5F6TA 2NCPA 4TNCA 2AMIA 2BKIB 1F8HA 1BG1A 2JXLA 2KI6C 2K2AA 2LMUA 3A8RA 4CLNA 4QJ5B 2H61A 2LVKA 2LCPA 4C0JA 4NQGA 4GGNA 1DJGA 1XFUO 2M1UA 1MXEA 4BY4A 3CTNA 1QS7A 1F54A 2I18A 4ORCB 1E8AA 1TN4A 1UHJA 2JNFA 1OE9B 5JJGA 2K7OA 2LHLA 5FYXA 3O2PA 4NDCA 1Y1AA 2KAXA 2L5XB 4OCIA 5CSJA 5D69A 1IWQA 1BR1B 2KYFA 5HKWA 1KCYA 2L4HA 3VRRA 1LA3A 1QX7A 1XFYO 2CBLA 2NXQA 1AJ5A 2OPOA 1YUSA 3FS7A 2SCPA 4YGEB 1LXFC 3GK2A 4D1EA 3BUNB 4HREE 3SG7A 4CIDA 1UHNA 2LLSA 1KSMA 3NSOA 4DUQA 1LVCD 4DRWA 2PRUA 1NX0A 2MJWB 1QASA 2KDHA 1H8BA 2BECA 2LC5A 3SG3A 1ZMZA 1DJZA 1MR8A 3SG5A 1SK6D 4AQIA 2FOTA 1L2OC 3CLNA 3KPXA 4A4CA 3K21A 1ZUZA 4M2QA 2CTNA 2KYCA 1PVAA 3EKJA 5G08A 1NX2A 4A4BA 4ORAB 1CMFA 2M9GA 3GK1A 4DS7A 1YTZC 3PSRA 2BL0B 2PMYA 1JBAA 1S36A 1JUOA 1QTXA 1NPQA 3CWGA 2WCFA 4ZCVA 4MZJA 2BL0C 3A4UB 3ZWHA 1F70A 4Q04A 5ER4X 2KAVA 2JT8A 1CFCA 5DKNA 1YR5A 2L4IA 2JTZA 1NX1A 2I94A 1J7QA 1KK8B 4N5XA 1SMGA 2PSRA 1CFFA 1MXLC 3M0WA 1NSHA 1XFWO 3DF0A 1NCXA 3KHEA 2HETA 3TUYB 1Y0VH 2M7NA 1WLZA 4QJ4B 1F4QA 3LLEA 1KK8C 1RTP1 1K90D 1QLSA 2F2OA 1RK9A 2JT0A 2VRGA 3QRXA 5CSIA 3TUYC 1UURA 3CS1A 2MHHA 2LVIA 1DJHA 3DVEA 3I5FB 4U8DA 1JSAA 1S6CA 1EH2A 1WRZA 4GGFC 1OZSA 3VROA 1NX3A 1F55A 1AUIB 4PHJA 2HPSA 1V1GA 1TRFA 1K94A 3I5FC 3KEVA 2RGIA 4YBHB 1D1OA 2F33A 1AJ4A 2LP2A 1AP4A 4C0KA 4OVNF 2BCXA 2FJUB 2WC8A 1MWNA 2EGDA 4FTGA 2JOJA 4PHKA 3CZTX 5HLOA 3IQQA 1CM1A 1XK4A 5AFPA 2COLB 1IJ6A 2FCDA 1B1GA 4YGAA 2NZ0A 1Y1XA 3VRNA 3HX4A 1FPWA 1PSRA 2ZRSA 2G2BA 1A75A 3IQOA 4XJKA 1S3PA 2BBNA 2Y1MA 2QACA 2E6WA 2LMVA 2PASA 3HCMA 1J1EA 2MLEC 3AKBA 1BF5A 1AHRA 1TIZA 3BOWB 4ETOA 1ZACA 2I7AA 3EKHA 3D10A 1YUUA 4PHMA 5JOLA 3EK7A 5AANA 2Y4QA 1J55A 4YGDB 3WHUB 2LANA 1ODBA 1R2UA 4I5JA 1KFXL 1QLKA 2BE4A 2JU0A 2KOTA 2M97A 3ICBA 1C07A 1PULA 2K7DA 1SNLA 3OHMB 4PALA 3I5GB 3WNXB 3CR4X 3EK8A 1EG4A 2AUCA 4XYNA 2ZKMX 1RECA 4YI9A 2M7LA 2JC2A 2KHNA 3I5GC 3E3RA 5HYDA 1K95A 1SCMC 1XFZO 4WQ3A 1IH0A 1KSOA 1B7TZ 1UHHA 1DMOA 1KK7Y 1FBVA 3O78A 1B4CA 1TNPA 4OR9B 2JXCA 4JQ0D 5KU1A 3FWCA 2KI6D 4WQ2A 2Q4UA 5ER5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAO A;  2B1U A;  2KFG A;  4BY5 A;  1KK7 Z;  3SIA A;  3SG2 A;  4DIR A;  3TZ1 A;  1YUT A;  1BT6 A;  4MBE A;  2K7C A;  4ORB B;  3F45 A;  1F71 A;  5PAL A;  4GNK B;  3PLF B;  3EK4 A;  3SIB A;  3NSI A;  4ICB A;  4L9M A;  3PAL A;  1L2O B;  2JRF A;  1JC2 A;  1CM4 A;  1DJY A;  2WOR A;  1LIN A;  2KQ6 A;  1YVH A;  1J7R A;  2WOS A;  1SR6 B;  5AXI A;  2GGM A;  1IJ5 A;  4PHN A;  1S6I A;  2D8N A;  1ZFS A;  1IQ3 A;  4IL1 A;  2LLT A;  1SR6 C;  4I5N B;  1CFP A;  2M1K B;  4R1E A;  4MSP A;  4YRU A;  1EJ3 A;  1SL9 A;  2MLF C;  5IBW A;  1MF8 B;  3OB1 B;  4CPV A;  1HT9 A;  1OQP A;  2EC6 B;  2Y1N A;  1K93 D;  1U5I B;  5AER A;  1QVI Y;  2LUX A;  2KFF A;  4GGF A;  4GBA A;  2KBM A;  2EC6 C;  3D0Y B;  1S6J A;  1ALW A;  1QIW A;  1NUB A;  1CLL A;  1SRA A;  5I2L A;  1IG5 A;  1SY9 A;  3CR2 A;  1SL8 A;  2F3Y A;  3EVU A;  1NCY A;  1QVI Z;  1FW4 A;  1IRJ A;  1Q80 A;  4PE4 A;  4DCK A;  2P6B B;  1Y1U A;  2NCO A;  1KWO C;  2KGB C;  1XFV O;  4YGC B;  1B9A A;  2LV7 A;  3FWB A;  3JVT B;  4MRY A;  1SPY A;  1XFX O;  1KQV A;  2PVB A;  1TNX A;  4E68 A;  2G9B A;  4PE7 A;  1SL7 A;  3GK4 X;  3SG4 A;  3JVT C;  1ZOT B;  3MSE B;  1MQ1 A;  5I2O A;  2HF5 A;  1SYM A;  4YI8 A;  1K9U A;  1C7V A;  2OTG B;  1SCV A;  3BOW A;  3RM1 A;  1YRU B;  3I5H B;  1DTL A;  2LLU A;  1BOC A;  1UP5 A;  5AEQ A;  2OTG C;  1UWO A;  2O60 A;  1WDC B;  4AOM A;  1S5G Y;  2GV5 A;  4GFT A;  3I5H C;  4PDZ A;  3H4S E;  5DKQ A;  5HLV A;  1KFU L;  2V53 A;  3NSK A;  1B8C A;  1WDC C;  1WRL A;  1M63 B;  1DGV A;  3OX5 A;  2Y5I A;  5CPV A;  2KI4 B;  1WRK A;  4FQO A;  1K9P A;  1S5G Z;  2ZNE A;  3JTD B;  1QV0 A;  2L51 A;  4P2Y B;  2M8U A;  1K96 A;  2KI4 C;  2WCE A;  3DVK A;  1OMR A;  2K8M B;  1YUR A;  1B7T Y;  2WCB A;  1XK4 C;  1A75 B;  3JTD C;  1SCM B;  2O5G A;  1SKT A;  2JUL A;  4XJK B;  1H4B A;  3DVJ A;  2LP3 A;  1V1F A;  1DJI A;  1IKU A;  4CFR A;  2HQ8 A;  1DJX A;  1KFU S;  2LVJ A;  2JNX A;  2K7B A;  3IF7 A;  2F8P A;  1GGW A;  5D7F A;  3TS5 B;  1FI6 A;  1RJV A;  4QJ3 B;  1OOJ A;  1MUX A;  2F3Z A;  1UHI A;  2BCA A;  2R2I A;  1DF0 B;  1KFX S;  3AAK A;  4PE0 A;  2JPT A;  1OMV A;  1NWD A;  1K9K A;  2DOQ A;  3TS5 C;  4I5L B;  2K61 A;  1S1E A;  2KGR A;  1PSB A;  3PM8 A;  5GQQ C;  1CTR A;  4MVF A;  3CR5 X;  4F0Z B;  1K2H A;  1PK0 D;  1W7I B;  2CT9 A;  2K0J A;  5DKR A;  1LA0 A;  1YVL A;  3DD4 A;  1GQM A;  2IS9 A;  4USL A;  1C7W A;  1JFJ A;  1BMO A;  2JQ6 A;  2LNK A;  1TNQ A;  1M46 A;  2BE6 A;  2MBX A;  1CDN A;  1LKJ A;  1TTX A;  2K2F A;  1DGU A;  1EL4 A;  2H61 C;  1JWD A;  1CB1 A;  4N1G A;  1OZO A;  2PAL A;  3O6B A;  1MHO A;  3BXK A;  3WHT B;  2ZND A;  3BUX B;  4PE1 A;  1TCF A;  1RWY A;  4CFQ A;  1EXR A;  4PCW A;  4M2P A;  2BKH B;  2LHI A;  3AKA A;  1G33 A;  2BBM A;  5I8N A;  2LVV A;  1JF2 A;  3PAT A;  4JPZ B;  4WRI A;  3OB2 B;  1M45 A;  1K8U A;  4OV2 A;  3PN7 B;  5HKZ A;  1U5I A;  3BUW B;  5BPJ A;  2L50 A;  1A4P A;  3I5I B;  4HRG A;  5TNC A;  4GPL B;  1G4Y R;  4P5O E;  5J3X A;  2KAY A;  1B47 A;  1YRT B;  3PN7 C;  2LM5 A;  2NLN A;  3D0Y A;  5I2Q A;  1TNW A;  2JZI A;  5CSF A;  1HQV A;  3I5I C;  3SG6 A;  1DJW A;  1BR4 B;  1WY9 A;  1L7Z A;  1ALV A;  4ZCU A;  1G8I A;  4YGB B;  1XYD A;  1J1D A;  1PVB A;  3EVV A;  1EG3 A;  1IGV A;  1JF0 A;  1DT7 B;  2WND A;  2M0R A;  1QXP A;  2KSP A;  1GGZ A;  2L0P A;  4GAO A;  4C0L A;  1CMG A;  2Q91 A;  3LCP C;  1KWO B;  3NXA A;  1S26 D;  3AAJ A;  3VGO A;  3CGA A;  1QX5 B;  3DVM A;  5KTY A;  1M31 A;  4M2O A;  2MA2 A;  1M39 A;  1N0Y A;  1RRO A;  2LMT A;  2MAZ A;  1B8R A;  4MZK A;  5KSZ A;  1CLB A;  2CXJ A;  2E30 A;  2KNE A;  1UUS A;  2JT3 A;  1BOD A;  1X02 A;  3OX6 A;  2QPT A;  1NP8 A;  1J7O A;  5K89 A;  1BJF A;  1QIV A;  1FF1 A;  2FCE A;  2ZN9 A;  3BUO B;  4HSZ A;  2F2P A;  2CNP A;  1NIW A;  1NYA A;  3VRQ A;  3PFV A;  1CFD A;  3WXA A;  1GJY A;  3DF0 B;  2I2R E;  1QAT A;  1NCZ A;  1R6P A;  1XO5 A;  2BCB A;  1N65 A;  1A29 A;  1XA5 A;  3C1V A;  3KF9 A;  2H2K A;  1B8L A;  3VRP A;  2OS8 B;  1A2X A;  3ZNI A;  1OSA A;  1QJT A;  1J7P A;  3TDI A;  2JWW A;  1F4O A;  5B8I B;  1PRW A;  4AQJ A;  1YX7 A;  2GGZ A;  3GOF A;  2OS8 C;  3BQ3 A;  4GUK A;  1W7J B;  4MEW A;  1QX2 A;  2KQY A;  2ZN8 A;  3KO0 A;  4N1F A;  4OKH A;  1AVS A;  1QV1 A;  1CNP A;  2L98 A;  2M3W A;  3EVR A;  4MRX A;  2SAS A;  1AK8 A;  1IQ5 A;  3BYA A;  3LK0 A;  1SW8 A;  1TOP A;  3TDU A;  2ISD A;  2KFH A;  1DVI A;  4JWQ A;  2KBI A;  2ZFD A;  3RLZ A;  2JTT A;  1BU3 A;  1CDP A;  1CDL A;  2CCM A;  3BUM B;  3FIA A;  4MN0 A;  2LUC A;  4NDB A;  1CKK A;  1VRK A;  2M49 B;  1YX8 A;  3TDZ A;  1Y6W A;  2M29 A;  5HKY A;  3OP0 A;  2L2E A;  1CLM A;  1JFK A;  2MRD A;  1KQM B;  1N2D A;  2LAP A;  1WLM A;  3SJS A;  1OMD A;  3O4Y A;  1CDM A;  2HQW A;  4MZL A;  4NDD A;  2LE9 B;  3LK1 A;  1DF0 A;  1XVJ A;  1KQM C;  4I5K A;  1FI5 A;  1TCO B;  1SBJ A;  1PAL A;  4MLW A;  1UHK A;  1RFJ A;  3NSL A;  2EHB A;  5CSN A;  4UPG A;  4HRH A;  1A03 A;  1BLQ A;  2ZRT A;  2A4J A;  2TN4 A;  3LL8 B;  5F6T A;  2NCP A;  4TNC A;  2AMI A;  2BKI B;  1F8H A;  1BG1 A;  2JXL A;  2KI6 C;  2K2A A;  2LMU A;  3A8R A;  4CLN A;  4QJ5 B;  2H61 A;  2LVK A;  2LCP A;  4C0J A;  4NQG A;  4GGN A;  1DJG A;  1XFU O;  2M1U A;  1MXE A;  4BY4 A;  3CTN A;  1QS7 A;  1F54 A;  2I18 A;  4ORC B;  1E8A A;  1TN4 A;  1UHJ A;  2JNF A;  1OE9 B;  5JJG A;  2K7O A;  2LHL A;  5FYX A;  3O2P A;  4NDC A;  1Y1A A;  2KAX A;  2L5X B;  4OCI A;  5CSJ A;  5D69 A;  1IWQ A;  1BR1 B;  2KYF A;  5HKW A;  1KCY A;  2L4H A;  3VRR A;  1LA3 A;  1QX7 A;  1XFY O;  2CBL A;  2NXQ A;  1AJ5 A;  2OPO A;  1YUS A;  3FS7 A;  2SCP A;  4YGE B;  1LXF C;  3GK2 A;  4D1E A;  3BUN B;  4HRE E;  3SG7 A;  4CID A;  1UHN A;  2LLS A;  1KSM A;  3NSO A;  4DUQ A;  1LVC D;  4DRW A;  2PRU A;  1NX0 A;  2MJW B;  1QAS A;  2KDH A;  1H8B A;  2BEC A;  2LC5 A;  3SG3 A;  1ZMZ A;  1DJZ A;  1MR8 A;  3SG5 A;  1SK6 D;  4AQI A;  2FOT A;  1L2O C;  3CLN A;  3KPX A;  4A4C A;  3K21 A;  1ZUZ A;  4M2Q A;  2CTN A;  2KYC A;  1PVA A;  3EKJ A;  5G08 A;  1NX2 A;  4A4B A;  4ORA B;  1CMF A;  2M9G A;  3GK1 A;  4DS7 A;  1YTZ C;  3PSR A;  2BL0 B;  2PMY A;  1JBA A;  1S36 A;  1JUO A;  1QTX A;  1NPQ A;  3CWG A;  2WCF A;  4ZCV A;  4MZJ A;  2BL0 C;  3A4U B;  3ZWH A;  1F70 A;  4Q04 A;  5ER4 X;  2KAV A;  2JT8 A;  1CFC A;  5DKN A;  1YR5 A;  2L4I A;  2JTZ A;  1NX1 A;  2I94 A;  1J7Q A;  1KK8 B;  4N5X A;  1SMG A;  2PSR A;  1CFF A;  1MXL C;  3M0W A;  1NSH A;  1XFW O;  3DF0 A;  1NCX A;  3KHE A;  2HET A;  3TUY B;  1Y0V H;  2M7N A;  1WLZ A;  4QJ4 B;  1F4Q A;  3LLE A;  1KK8 C;  1RTP 1;  1K90 D;  1QLS A;  2F2O A;  1RK9 A;  2JT0 A;  2VRG A;  3QRX A;  5CSI A;  3TUY C;  1UUR A;  3CS1 A;  2MHH A;  2LVI A;  1DJH A;  3DVE A;  3I5F B;  4U8D A;  1JSA A;  1S6C A;  1EH2 A;  1WRZ A;  4GGF C;  1OZS A;  3VRO A;  1NX3 A;  1F55 A;  1AUI B;  4PHJ A;  2HPS A;  1V1G A;  1TRF A;  1K94 A;  3I5F C;  3KEV A;  2RGI A;  4YBH B;  1D1O A;  2F33 A;  1AJ4 A;  2LP2 A;  1AP4 A;  4C0K A;  4OVN F;  2BCX A;  2FJU B;  2WC8 A;  1MWN A;  2EGD A;  4FTG A;  2JOJ A;  4PHK A;  3CZT X;  5HLO A;  3IQQ A;  1CM1 A;  1XK4 A;  5AFP A;  2COL B;  1IJ6 A;  2FCD A;  1B1G A;  4YGA A;  2NZ0 A;  1Y1X A;  3VRN A;  3HX4 A;  1FPW A;  1PSR A;  2ZRS A;  2G2B A;  1A75 A;  3IQO A;  4XJK A;  1S3P A;  2BBN A;  2Y1M A;  2QAC A;  2E6W A;  2LMV A;  2PAS A;  3HCM A;  1J1E A;  2MLE C;  3AKB A;  1BF5 A;  1AHR A;  1TIZ A;  3BOW B;  4ETO A;  1ZAC A;  2I7A A;  3EKH A;  3D10 A;  1YUU A;  4PHM A;  5JOL A;  3EK7 A;  5AAN A;  2Y4Q A;  1J55 A;  4YGD B;  3WHU B;  2LAN A;  1ODB A;  1R2U A;  4I5J A;  1KFX L;  1QLK A;  2BE4 A;  2JU0 A;  2KOT A;  2M97 A;  3ICB A;  1C07 A;  1PUL A;  2K7D A;  1SNL A;  3OHM B;  4PAL A;  3I5G B;  3WNX B;  3CR4 X;  3EK8 A;  1EG4 A;  2AUC A;  4XYN A;  2ZKM X;  1REC A;  4YI9 A;  2M7L A;  2JC2 A;  2KHN A;  3I5G C;  3E3R A;  5HYD A;  1K95 A;  1SCM C;  1XFZ O;  4WQ3 A;  1IH0 A;  1KSO A;  1B7T Z;  1UHH A;  1DMO A;  1KK7 Y;  1FBV A;  3O78 A;  1B4C A;  1TNP A;  4OR9 B;  2JXC A;  4JQ0 D;  5KU1 A;  3FWC A;  2KI6 D;  4WQ2 A;  2Q4U A;  5ER5 A; 
#chains in the Genus database with same CATH topology
 2AAO A;  2B1U A;  2KFG A;  4BY5 A;  1KK7 Z;  3SIA A;  3SG2 A;  4DIR A;  3TZ1 A;  4FQT A;  1YUT A;  1BT6 A;  4MBE A;  2K7C A;  4ORB B;  3F45 A;  1F71 A;  5PAL A;  4GNK B;  3PLF B;  3EK4 A;  3SIB A;  3NSI A;  4ICB A;  3UNW A;  4L9M A;  3PAL A;  1L2O B;  3S0F A;  2JRF A;  1JC2 A;  1CM4 A;  1DJY A;  2WOR A;  3R1V A;  1LIN A;  2KQ6 A;  1YVH A;  1DC1 A;  2WC6 A;  1J7R A;  1T14 A;  2WOS A;  1SR6 B;  5AXI A;  3V2L A;  4IJ7 A;  2GGM A;  1IJ5 A;  4PHN A;  1S6I A;  2D8N A;  1ZFS A;  1IQ3 A;  4IL1 A;  2LLT A;  1SR6 C;  4I5N B;  1CFP A;  2M1K B;  4R1E A;  4MSP A;  4YRU A;  1EJ3 A;  1SL9 A;  2MLF C;  3SS3 A;  5IBW A;  1MF8 B;  3OB1 B;  4CPV A;  1HT9 A;  1OQP A;  2EC6 B;  2Y1N A;  3FE8 A;  1K93 D;  1U5I B;  5AER A;  1QVI Y;  3PJI A;  2LUX A;  2KFF A;  4GGF A;  4GBA A;  2KBM A;  2EC6 C;  3D0Y B;  1S6J A;  1ALW A;  1QIW A;  1XFR A;  1NUB A;  1CLL A;  1SRA A;  5I2L A;  1IG5 A;  1SY9 A;  3CR2 A;  1SL8 A;  2F3Y A;  3EVU A;  1NCY A;  1QVI Z;  1FW4 A;  1IRJ A;  1Q80 A;  4PE4 A;  3DYE A;  4DCK A;  2P6B B;  1Y1U A;  2NCO A;  1KWO C;  2KGB C;  1XFV O;  4YGC B;  1B9A A;  2LV7 A;  3FWB A;  3JVT B;  4MRY A;  1SPY A;  1TWO A;  1XFX O;  3D78 A;  1KQV A;  2PVB A;  1TNX A;  4E68 A;  2G9B A;  4PE7 A;  1SL7 A;  3GK4 X;  3SG4 A;  3JVT C;  1ZOT B;  1OOG A;  3MSE B;  1MQ1 A;  5I2O A;  2HF5 A;  5FI7 A;  1SYM A;  4YI8 A;  1K9U A;  1C7V A;  2OTG B;  1SCV A;  3BOW A;  3RM1 A;  1YRU B;  4INX A;  1CKK A;  3I5H B;  1DTL A;  2LLU A;  1BOC A;  1UP5 A;  5AEQ A;  2OTG C;  1UWO A;  2O60 A;  1WDC B;  4AOM A;  1S5G Y;  2GV5 A;  4GFT A;  3I5H C;  4PDZ A;  3H4S E;  5DKQ A;  5HLV A;  1KFU L;  2QDI A;  3OGN A;  2V53 A;  3NSK A;  1B8C A;  1WDC C;  1WRL A;  1M63 B;  1DGV A;  3OX5 A;  2Y5I A;  5CPV A;  2KI4 B;  1WRK A;  3S0D A;  4FQO A;  1K9P A;  1S5G Z;  2ZNE A;  3JTD B;  1QV0 A;  2L51 A;  4P2Y B;  2M8U A;  1K96 A;  2KI4 C;  2WCE A;  3BJH A;  3DVK A;  1OMR A;  2K8M B;  4F7F A;  1YUR A;  1B7T Y;  2WCB A;  1XK4 C;  1A75 B;  3JTD C;  1SCM B;  2O5G A;  1SKT A;  2JUL A;  4XJK B;  2WCM A;  2YGU A;  3DVJ A;  1H4B A;  2LP3 A;  1V1F A;  1DJI A;  1IKU A;  4CFR A;  2HQ8 A;  1DJX A;  1KFU S;  2LVJ A;  2JNX A;  2K7B A;  3BFB A;  3IF7 A;  2F8P A;  1GGW A;  5D7F A;  3TS5 B;  1FI6 A;  1RJV A;  4QJ3 B;  1OOJ A;  1MUX A;  2F3Z A;  1UHI A;  2BCA A;  2R2I A;  1DF0 B;  1KFX S;  3AAK A;  3QME A;  4PE0 A;  2JPT A;  1OMV A;  1NWD A;  1K9K A;  2DOQ A;  3TS5 C;  1TUJ A;  4I5L B;  5D3O A;  2K61 A;  1S1E A;  2KGR A;  1PSB A;  3PM8 A;  5GQQ C;  1CTR A;  4MVF A;  3CR5 X;  4F0Z B;  1K2H A;  3R1O A;  3Q8I A;  1PK0 D;  1W7I B;  2CT9 A;  2K0J A;  5DKR A;  1GM0 A;  1LA0 A;  1YVL A;  3DD4 A;  1Z4H A;  1GQM A;  2IS9 A;  4USL A;  1C7W A;  1JFJ A;  1BMO A;  2JQ6 A;  2LNK A;  3CZ2 A;  1TNQ A;  1M46 A;  2L5Y A;  2BE6 A;  2MBX A;  1CDN A;  1LKJ A;  1TTX A;  2K2F A;  1DGU A;  1EL4 A;  2H61 C;  1JWD A;  1CB1 A;  1ORG A;  3D73 A;  3D75 A;  4N1G A;  1OZO A;  1OW4 A;  2PAL A;  3O6B A;  5HL1 A;  1MHO A;  3BXK A;  3WHT B;  2ZND A;  3BUX B;  1OOH A;  4PE1 A;  1TCF A;  1RWY A;  4CFQ A;  1EXR A;  4PCW A;  4M2P A;  1QWV A;  2BKH B;  2LHI A;  3AKA A;  1G33 A;  2BBM A;  5I8N A;  3OBV A;  2LVV A;  1JF2 A;  3PAT A;  4JPZ B;  4WRI A;  3IVT A;  1M45 A;  1K8U A;  3OB2 B;  3PN7 B;  4OV2 A;  1U5I A;  3BUW B;  5HKZ A;  5BPJ A;  2L50 A;  1A4P A;  3I5I B;  4HRG A;  5TNC A;  4GPL B;  1G4Y R;  4P5O E;  5J3X A;  3FE6 A;  2KAY A;  1B47 A;  1YRT B;  3PN7 C;  2LM5 A;  2NLN A;  3D0Y A;  5I2Q A;  1TNW A;  1DEL A;  2JZI A;  1HQV A;  3I5I C;  5CSF A;  2H8V A;  2PQL A;  3SG6 A;  1DJW A;  3RZS A;  1BR4 B;  1WY9 A;  1L7Z A;  1ALV A;  5EL2 A;  4ZCU A;  1G8I A;  4YGB B;  1XYD A;  1J1D A;  1PVB A;  3EVV A;  1EG3 A;  1IGV A;  1JF0 A;  1DT7 B;  2WND A;  2M0R A;  3CZ1 A;  1QXP A;  2KSP A;  3D77 A;  1GGZ A;  2L0P A;  3PM2 A;  4GAO A;  4JKT A;  4C0L A;  1CMG A;  2Q91 A;  3LCP C;  1KWO B;  3NXA A;  1S26 D;  3AAJ A;  3VGO A;  3CGA A;  1QX5 B;  3DVM A;  5KTY A;  1M31 A;  4M2O A;  2MA2 A;  1M39 A;  1N0Y A;  1RRO A;  2LMT A;  2MAZ A;  1B8R A;  4MZK A;  5KSZ A;  1CLB A;  2CXJ A;  2E30 A;  2KNE A;  1UUS A;  2JT3 A;  1BOD A;  1X02 A;  3OX6 A;  2QPT A;  1NP8 A;  2KLD A;  5K89 A;  1J7O A;  1BJF A;  1QIV A;  1FF1 A;  2FCE A;  2ZN9 A;  3BUO B;  4HSZ A;  5ER5 A;  2F2P A;  2CNP A;  1NIW A;  1NYA A;  3VRQ A;  3DZT A;  3PFV A;  1CFD A;  3CAB A;  3B86 A;  3WXA A;  1GJY A;  3DF0 B;  2I2R E;  1QAT A;  1NCZ A;  1R6P A;  1XO5 A;  2BCB A;  1N65 A;  1A29 A;  1XA5 A;  3C1V A;  3KF9 A;  2WCL A;  2H2K A;  1B8L A;  3VRP A;  2OS8 B;  1A2X A;  3B87 A;  3ZNI A;  1OSA A;  1QJT A;  1J7P A;  3TDI A;  2JWW A;  1F4O A;  5B8I B;  1PRW A;  2KPH A;  3CYZ A;  4AQJ A;  1YX7 A;  2GGZ A;  3GOF A;  1DQE A;  2OS8 C;  3BQ3 A;  4GUK A;  1W7J B;  4MEW A;  1QX2 A;  2KQY A;  2ZN8 A;  3KO0 A;  4N1F A;  4OKH A;  1AVS A;  1QV1 A;  1CNP A;  2L98 A;  2M3W A;  3EVR A;  4MRX A;  2SAS A;  1AK8 A;  1IQ5 A;  3BYA A;  3LK0 A;  1SW8 A;  1TOP A;  3TDU A;  2ISD A;  3S0B A;  2KFH A;  1DVI A;  4JWQ A;  2KBI A;  2ZFD A;  3RLZ A;  2JTT A;  1BU3 A;  1CDP A;  1CDL A;  2CCM A;  2BNX A;  2ERB A;  3BUM B;  2LUC A;  3FIA A;  4MN0 A;  4NDB A;  4PT1 A;  1VRK A;  3SS4 A;  3BFH A;  2M49 B;  1YX8 A;  3TDZ A;  1LS8 A;  1Y6W A;  2M29 A;  5HKY A;  3OP0 A;  2L2E A;  1CLM A;  1JFK A;  2MRD A;  1KQM B;  2P70 A;  1N2D A;  2LAP A;  1WLM A;  3SJS A;  1OMD A;  3O4Y A;  1CDM A;  2HQW A;  4MZL A;  4NDD A;  2LE9 B;  3LK1 A;  1DF0 A;  1XVJ A;  1KQM C;  4I5K A;  2QEH A;  1FI5 A;  1TCO B;  1SBJ A;  1PAL A;  4MLW A;  1UHK A;  1RFJ A;  3NSL A;  3EG5 B;  1Z2C B;  2EHB A;  3O4X A;  1IIO A;  5CSN A;  4UPG A;  4HRH A;  1A03 A;  1BLQ A;  2ZRT A;  2A4J A;  2TN4 A;  3LL8 B;  5F6T A;  2NCP A;  2BAP A;  4TNC A;  2AMI A;  2BKI B;  3B7A A;  1F8H A;  1BG1 A;  3D76 A;  2JXL A;  2KI6 C;  2K2A A;  2LMU A;  3A8R A;  4CLN A;  4QJ5 B;  2H61 A;  2LVK A;  3R1P A;  2LCP A;  4C0J A;  4NQG A;  4GGN A;  1DJG A;  1XFU O;  2M1U A;  1MXE A;  3NHT A;  4BY4 A;  3CTN A;  1QS7 A;  1F54 A;  2I18 A;  3B6X A;  4ORC B;  1E8A A;  3BFA A;  1TN4 A;  1UHJ A;  2JNF A;  1OE9 B;  5JJG A;  2K7O A;  2LHL A;  3B88 A;  5FYX A;  1SSE B;  3O2P A;  4NDC A;  1Y1A A;  2KAX A;  2L5X B;  4OCI A;  5CSJ A;  5D69 A;  1IWQ A;  1BR1 B;  2L2C A;  2KYF A;  5HKW A;  1KCY A;  5FI2 A;  2L4H A;  3VRR A;  1LA3 A;  1QX7 A;  1XFY O;  2CBL A;  2NXQ A;  1AJ5 A;  2OPO A;  1YUS A;  3FS7 A;  3S0E A;  2WCK A;  2SCP A;  4YGE B;  1LXF C;  3GK2 A;  2P71 A;  4D1E A;  3BUN B;  4HRE E;  3SG7 A;  4CID A;  1UHN A;  2LLS A;  1KSM A;  1OOI X;  3NSO A;  2QEO A;  4DUQ A;  1LVC D;  4DRW A;  2PRU A;  2WCH A;  1NX0 A;  2MJW B;  1QAS A;  2KDH A;  1H8B A;  2BEC A;  2LC5 A;  1W9Z A;  3DY9 A;  3SG3 A;  1ZMZ A;  1DJZ A;  1MR8 A;  3SG5 A;  1SK6 D;  4AQI A;  2FOT A;  1L2O C;  3CLN A;  3KPX A;  4A4C A;  3K21 A;  1ZUZ A;  4M2Q A;  2CTN A;  2KYC A;  1PVA A;  3EKJ A;  5G08 A;  1NX2 A;  4A4B A;  2PYQ A;  4ORA B;  1CMF A;  2M9G A;  3GK1 A;  4DS7 A;  1YTZ C;  3S0G A;  2WC5 A;  3PSR A;  2BL0 B;  2PMY A;  3D74 A;  1JBA A;  1S36 A;  1JUO A;  1QTX A;  4INW A;  1NPQ A;  3CWG A;  2WCF A;  4ZCV A;  3CDN A;  4MZJ A;  2BL0 C;  3A4U B;  3ZWH A;  1F70 A;  4Q04 A;  5ER4 X;  2KAV A;  3R72 A;  2JT8 A;  1CFC A;  5DKN A;  1YR5 A;  1OOF A;  2L4I A;  2JTZ A;  5FI6 A;  1NX1 A;  2I94 A;  1J7Q A;  1KK8 B;  4N5X A;  1SMG A;  2PSR A;  1CFF A;  1MXL C;  3M0W A;  1NSH A;  1XFW O;  3DF0 A;  1NCX A;  3KHE A;  2HET A;  3TUY B;  1Y0V H;  2M7N A;  1WLZ A;  4QJ4 B;  1F4Q A;  3LLE A;  1KK8 C;  1RTP 1;  1K90 D;  1QLS A;  2F2O A;  1RK9 A;  2JT0 A;  2VRG A;  1C3Z A;  3QRX A;  5CSI A;  3SS5 A;  3TUY C;  1UUR A;  3CS1 A;  2JPO A;  2MHH A;  2LVI A;  2QEV A;  1DJH A;  3DVE A;  3I5F B;  4U8D A;  3NHI A;  1JSA A;  1S6C A;  1EH2 A;  1WRZ A;  4GGF C;  1OZS A;  3VRO A;  1NX3 A;  1F55 A;  1AUI B;  4PHJ A;  2HPS A;  1V1G A;  1TRF A;  1K94 A;  3I5F C;  3KEV A;  2RGI A;  4YBH B;  3UO9 A;  2F33 A;  1D1O A;  1AJ4 A;  2LP2 A;  1AP4 A;  4C0K A;  4OVN F;  2BCX A;  2FJU B;  2WC8 A;  1MWN A;  2EGD A;  4FTG A;  2JOJ A;  4PHK A;  3CZT X;  5HLO A;  3IQQ A;  1CM1 A;  1XK4 A;  5AFP A;  2COL B;  1IJ6 A;  2FCD A;  3L4A A;  1B1G A;  4YGA A;  2K60 A;  1Y1X A;  2NZ0 A;  3N7H A;  3HX4 A;  3VRN A;  1FPW A;  1PSR A;  2ZRS A;  2G2B A;  3S0A A;  1A75 A;  3IQO A;  5I94 A;  4XJK A;  4KYN A;  1C3Y A;  1S3P A;  2BBN A;  2Y1M A;  2QAC A;  2E6W A;  2LMV A;  2PAS A;  3HCM A;  1J1E A;  1TUZ A;  2MLE C;  3AKB A;  1BF5 A;  1AHR A;  1TIZ A;  3BOW B;  4ETO A;  1ZAC A;  2I7A A;  2KLE A;  3EKH A;  3FE9 A;  3D10 A;  1YUU A;  4PHM A;  5JOL A;  3EK7 A;  4JD9 A;  5AAN A;  2Y4Q A;  1J55 A;  5DIC A;  4YGD B;  3WHU B;  2LAN A;  3VB1 A;  1ODB A;  2QEB A;  1R2U A;  4I5J A;  1KFX L;  1QLK A;  2BE4 A;  2GTE A;  2JU0 A;  2KOT A;  2M97 A;  3ICB A;  3L4L A;  1C07 A;  1PUL A;  3CZ0 A;  2K7D A;  1SNL A;  3OHM B;  4PAL A;  3I5G B;  3WNX B;  3CR4 X;  3EK8 A;  1EG4 A;  2AUC A;  4XYN A;  2ZKM X;  1REC A;  4YI9 A;  2M7L A;  2WCJ A;  2JC2 A;  2KHN A;  3I5G C;  3E3R A;  5HYD A;  1K95 A;  1SCM C;  1XFZ O;  3NGV A;  4WQ3 A;  1IH0 A;  1KSO A;  1B7T Z;  1UHH A;  3K1E A;  1DMO A;  1KK7 Y;  1FBV A;  1DEK A;  3O78 A;  1B4C A;  1TNP A;  3L47 A;  4OR9 B;  2JXC A;  4JQ0 D;  4OZD A;  5KU1 A;  3DXL A;  3FWC A;  2KI6 D;  4WQ2 A;  2Q4U A;  2FJY A;  1P28 A; 
#chains in the Genus database with same CATH homology
 2AAO A;  2B1U A;  2KFG A;  4BY5 A;  1KK7 Z;  3SIA A;  3SG2 A;  4DIR A;  3TZ1 A;  1YUT A;  1BT6 A;  4MBE A;  2K7C A;  4ORB B;  3F45 A;  1F71 A;  5PAL A;  4GNK B;  3PLF B;  3EK4 A;  3SIB A;  3NSI A;  4ICB A;  4L9M A;  3PAL A;  1L2O B;  2JRF A;  1JC2 A;  1CM4 A;  1DJY A;  2WOR A;  1LIN A;  2KQ6 A;  1YVH A;  1J7R A;  2WOS A;  1SR6 B;  5AXI A;  2GGM A;  1IJ5 A;  4PHN A;  1S6I A;  2D8N A;  1ZFS A;  1IQ3 A;  4IL1 A;  2LLT A;  1SR6 C;  4I5N B;  1CFP A;  2M1K B;  4R1E A;  4MSP A;  4YRU A;  1EJ3 A;  1SL9 A;  2MLF C;  5IBW A;  1MF8 B;  3OB1 B;  4CPV A;  1HT9 A;  1OQP A;  2EC6 B;  2Y1N A;  1K93 D;  1U5I B;  5AER A;  1QVI Y;  2LUX A;  2KFF A;  4GGF A;  4GBA A;  2KBM A;  2EC6 C;  3D0Y B;  1S6J A;  1ALW A;  1QIW A;  1NUB A;  1CLL A;  1SRA A;  5I2L A;  1IG5 A;  1SY9 A;  3CR2 A;  1SL8 A;  2F3Y A;  3EVU A;  1NCY A;  1QVI Z;  1FW4 A;  1IRJ A;  1Q80 A;  4PE4 A;  4DCK A;  2P6B B;  1Y1U A;  2NCO A;  1KWO C;  2KGB C;  1XFV O;  4YGC B;  1B9A A;  2LV7 A;  3FWB A;  3JVT B;  4MRY A;  1SPY A;  1XFX O;  1KQV A;  2PVB A;  1TNX A;  4E68 A;  2G9B A;  4PE7 A;  1SL7 A;  3GK4 X;  3SG4 A;  3JVT C;  1ZOT B;  3MSE B;  1MQ1 A;  5I2O A;  2HF5 A;  1SYM A;  4YI8 A;  1K9U A;  1C7V A;  2OTG B;  1SCV A;  3BOW A;  3RM1 A;  1YRU B;  3I5H B;  1DTL A;  2LLU A;  1BOC A;  1UP5 A;  5AEQ A;  2OTG C;  1UWO A;  2O60 A;  1WDC B;  4AOM A;  1S5G Y;  2GV5 A;  4GFT A;  3I5H C;  4PDZ A;  3H4S E;  5DKQ A;  5HLV A;  1KFU L;  2V53 A;  3NSK A;  1B8C A;  1WDC C;  1WRL A;  1M63 B;  1DGV A;  3OX5 A;  2Y5I A;  5CPV A;  2KI4 B;  1WRK A;  4FQO A;  1K9P A;  1S5G Z;  2ZNE A;  3JTD B;  1QV0 A;  2L51 A;  4P2Y B;  2M8U A;  1K96 A;  2KI4 C;  2WCE A;  3DVK A;  1OMR A;  2K8M B;  1YUR A;  1B7T Y;  2WCB A;  1XK4 C;  1A75 B;  3JTD C;  1SCM B;  2O5G A;  1SKT A;  2JUL A;  4XJK B;  1H4B A;  3DVJ A;  2LP3 A;  1V1F A;  1DJI A;  1IKU A;  4CFR A;  2HQ8 A;  1DJX A;  1KFU S;  2LVJ A;  2JNX A;  2K7B A;  3IF7 A;  2F8P A;  1GGW A;  5D7F A;  3TS5 B;  1FI6 A;  1RJV A;  4QJ3 B;  1OOJ A;  1MUX A;  2F3Z A;  1UHI A;  2BCA A;  2R2I A;  1DF0 B;  1KFX S;  3AAK A;  4PE0 A;  2JPT A;  1OMV A;  1NWD A;  1K9K A;  2DOQ A;  3TS5 C;  4I5L B;  2K61 A;  1S1E A;  2KGR A;  1PSB A;  3PM8 A;  5GQQ C;  1CTR A;  4MVF A;  3CR5 X;  4F0Z B;  1K2H A;  1PK0 D;  1W7I B;  2CT9 A;  2K0J A;  5DKR A;  1LA0 A;  1YVL A;  3DD4 A;  1GQM A;  2IS9 A;  4USL A;  1C7W A;  1JFJ A;  1BMO A;  2JQ6 A;  2LNK A;  1TNQ A;  1M46 A;  2BE6 A;  2MBX A;  1CDN A;  1LKJ A;  1TTX A;  2K2F A;  1DGU A;  1EL4 A;  2H61 C;  1JWD A;  1CB1 A;  4N1G A;  1OZO A;  2PAL A;  3O6B A;  1MHO A;  3BXK A;  3WHT B;  2ZND A;  3BUX B;  4PE1 A;  1TCF A;  1RWY A;  4CFQ A;  1EXR A;  4PCW A;  4M2P A;  2BKH B;  2LHI A;  3AKA A;  1G33 A;  2BBM A;  5I8N A;  2LVV A;  1JF2 A;  3PAT A;  4JPZ B;  4WRI A;  3OB2 B;  1M45 A;  1K8U A;  4OV2 A;  3PN7 B;  5HKZ A;  1U5I A;  3BUW B;  5BPJ A;  2L50 A;  1A4P A;  3I5I B;  4HRG A;  5TNC A;  4GPL B;  1G4Y R;  4P5O E;  5J3X A;  2KAY A;  1B47 A;  1YRT B;  3PN7 C;  2LM5 A;  2NLN A;  3D0Y A;  5I2Q A;  1TNW A;  2JZI A;  5CSF A;  1HQV A;  3I5I C;  3SG6 A;  1DJW A;  1BR4 B;  1WY9 A;  1L7Z A;  1ALV A;  4ZCU A;  1G8I A;  4YGB B;  1XYD A;  1J1D A;  1PVB A;  3EVV A;  1EG3 A;  1IGV A;  1JF0 A;  1DT7 B;  2WND A;  2M0R A;  1QXP A;  2KSP A;  1GGZ A;  2L0P A;  4GAO A;  4C0L A;  1CMG A;  2Q91 A;  3LCP C;  1KWO B;  3NXA A;  1S26 D;  3AAJ A;  3VGO A;  3CGA A;  1QX5 B;  3DVM A;  5KTY A;  1M31 A;  4M2O A;  2MA2 A;  1M39 A;  1N0Y A;  1RRO A;  2LMT A;  2MAZ A;  1B8R A;  4MZK A;  5KSZ A;  1CLB A;  2CXJ A;  2E30 A;  2KNE A;  1UUS A;  2JT3 A;  1BOD A;  1X02 A;  3OX6 A;  2QPT A;  1NP8 A;  1J7O A;  5K89 A;  1BJF A;  1QIV A;  1FF1 A;  2FCE A;  2ZN9 A;  3BUO B;  4HSZ A;  2F2P A;  2CNP A;  1NIW A;  1NYA A;  3VRQ A;  3PFV A;  1CFD A;  3WXA A;  1GJY A;  3DF0 B;  2I2R E;  1QAT A;  1NCZ A;  1R6P A;  1XO5 A;  2BCB A;  1N65 A;  1A29 A;  1XA5 A;  3C1V A;  3KF9 A;  2H2K A;  1B8L A;  3VRP A;  2OS8 B;  1A2X A;  3ZNI A;  1OSA A;  1QJT A;  1J7P A;  3TDI A;  2JWW A;  1F4O A;  5B8I B;  1PRW A;  4AQJ A;  1YX7 A;  2GGZ A;  3GOF A;  2OS8 C;  3BQ3 A;  4GUK A;  1W7J B;  4MEW A;  1QX2 A;  2KQY A;  2ZN8 A;  3KO0 A;  4N1F A;  4OKH A;  1AVS A;  1QV1 A;  1CNP A;  2L98 A;  2M3W A;  3EVR A;  4MRX A;  2SAS A;  1AK8 A;  1IQ5 A;  3BYA A;  3LK0 A;  1SW8 A;  1TOP A;  3TDU A;  2ISD A;  2KFH A;  1DVI A;  4JWQ A;  2KBI A;  2ZFD A;  3RLZ A;  2JTT A;  1BU3 A;  1CDP A;  1CDL A;  2CCM A;  3BUM B;  3FIA A;  4MN0 A;  2LUC A;  4NDB A;  1CKK A;  1VRK A;  2M49 B;  1YX8 A;  3TDZ A;  1Y6W A;  2M29 A;  5HKY A;  3OP0 A;  2L2E A;  1CLM A;  1JFK A;  2MRD A;  1KQM B;  1N2D A;  2LAP A;  1WLM A;  3SJS A;  1OMD A;  3O4Y A;  1CDM A;  2HQW A;  4MZL A;  4NDD A;  2LE9 B;  3LK1 A;  1DF0 A;  1XVJ A;  1KQM C;  4I5K A;  1FI5 A;  1TCO B;  1SBJ A;  1PAL A;  4MLW A;  1UHK A;  1RFJ A;  3NSL A;  2EHB A;  5CSN A;  4UPG A;  4HRH A;  1A03 A;  1BLQ A;  2ZRT A;  2A4J A;  2TN4 A;  3LL8 B;  5F6T A;  2NCP A;  4TNC A;  2AMI A;  2BKI B;  1F8H A;  1BG1 A;  2JXL A;  2KI6 C;  2K2A A;  2LMU A;  3A8R A;  4CLN A;  4QJ5 B;  2H61 A;  2LVK A;  2LCP A;  4C0J A;  4NQG A;  4GGN A;  1DJG A;  1XFU O;  2M1U A;  1MXE A;  4BY4 A;  3CTN A;  1QS7 A;  1F54 A;  2I18 A;  4ORC B;  1E8A A;  1TN4 A;  1UHJ A;  2JNF A;  1OE9 B;  5JJG A;  2K7O A;  2LHL A;  5FYX A;  3O2P A;  4NDC A;  1Y1A A;  2KAX A;  2L5X B;  4OCI A;  5CSJ A;  5D69 A;  1IWQ A;  1BR1 B;  2KYF A;  5HKW A;  1KCY A;  2L4H A;  3VRR A;  1LA3 A;  1QX7 A;  1XFY O;  2CBL A;  2NXQ A;  1AJ5 A;  2OPO A;  1YUS A;  3FS7 A;  2SCP A;  4YGE B;  1LXF C;  3GK2 A;  4D1E A;  3BUN B;  4HRE E;  3SG7 A;  4CID A;  1UHN A;  2LLS A;  1KSM A;  3NSO A;  4DUQ A;  1LVC D;  4DRW A;  2PRU A;  1NX0 A;  2MJW B;  1QAS A;  2KDH A;  1H8B A;  2BEC A;  2LC5 A;  3SG3 A;  1ZMZ A;  1DJZ A;  1MR8 A;  3SG5 A;  1SK6 D;  4AQI A;  2FOT A;  1L2O C;  3CLN A;  3KPX A;  4A4C A;  3K21 A;  1ZUZ A;  4M2Q A;  2CTN A;  2KYC A;  1PVA A;  3EKJ A;  5G08 A;  1NX2 A;  4A4B A;  4ORA B;  1CMF A;  2M9G A;  3GK1 A;  4DS7 A;  1YTZ C;  3PSR A;  2BL0 B;  2PMY A;  1JBA A;  1S36 A;  1JUO A;  1QTX A;  1NPQ A;  3CWG A;  2WCF A;  4ZCV A;  4MZJ A;  2BL0 C;  3A4U B;  3ZWH A;  1F70 A;  4Q04 A;  5ER4 X;  2KAV A;  2JT8 A;  1CFC A;  5DKN A;  1YR5 A;  2L4I A;  2JTZ A;  1NX1 A;  2I94 A;  1J7Q A;  1KK8 B;  4N5X A;  1SMG A;  2PSR A;  1CFF A;  1MXL C;  3M0W A;  1NSH A;  1XFW O;  3DF0 A;  1NCX A;  3KHE A;  2HET A;  3TUY B;  1Y0V H;  2M7N A;  1WLZ A;  4QJ4 B;  1F4Q A;  3LLE A;  1KK8 C;  1RTP 1;  1K90 D;  1QLS A;  2F2O A;  1RK9 A;  2JT0 A;  2VRG A;  3QRX A;  5CSI A;  3TUY C;  1UUR A;  3CS1 A;  2MHH A;  2LVI A;  1DJH A;  3DVE A;  3I5F B;  4U8D A;  1JSA A;  1S6C A;  1EH2 A;  1WRZ A;  4GGF C;  1OZS A;  3VRO A;  1NX3 A;  1F55 A;  1AUI B;  4PHJ A;  2HPS A;  1V1G A;  1TRF A;  1K94 A;  3I5F C;  3KEV A;  2RGI A;  4YBH B;  1D1O A;  2F33 A;  1AJ4 A;  2LP2 A;  1AP4 A;  4C0K A;  4OVN F;  2BCX A;  2FJU B;  2WC8 A;  1MWN A;  2EGD A;  4FTG A;  2JOJ A;  4PHK A;  3CZT X;  5HLO A;  3IQQ A;  1CM1 A;  1XK4 A;  5AFP A;  2COL B;  1IJ6 A;  2FCD A;  1B1G A;  4YGA A;  2NZ0 A;  1Y1X A;  3VRN A;  3HX4 A;  1FPW A;  1PSR A;  2ZRS A;  2G2B A;  1A75 A;  3IQO A;  4XJK A;  1S3P A;  2BBN A;  2Y1M A;  2QAC A;  2E6W A;  2LMV A;  2PAS A;  3HCM A;  1J1E A;  2MLE C;  3AKB A;  1BF5 A;  1AHR A;  1TIZ A;  3BOW B;  4ETO A;  1ZAC A;  2I7A A;  3EKH A;  3D10 A;  1YUU A;  4PHM A;  5JOL A;  3EK7 A;  5AAN A;  2Y4Q A;  1J55 A;  4YGD B;  3WHU B;  2LAN A;  1ODB A;  1R2U A;  4I5J A;  1KFX L;  1QLK A;  2BE4 A;  2JU0 A;  2KOT A;  2M97 A;  3ICB A;  1C07 A;  1PUL A;  2K7D A;  1SNL A;  3OHM B;  4PAL A;  3I5G B;  3WNX B;  3CR4 X;  3EK8 A;  1EG4 A;  2AUC A;  4XYN A;  2ZKM X;  1REC A;  4YI9 A;  2M7L A;  2JC2 A;  2KHN A;  3I5G C;  3E3R A;  5HYD A;  1K95 A;  1SCM C;  1XFZ O;  4WQ3 A;  1IH0 A;  1KSO A;  1B7T Z;  1UHH A;  1DMO A;  1KK7 Y;  1FBV A;  3O78 A;  1B4C A;  1TNP A;  4OR9 B;  2JXC A;  4JQ0 D;  5KU1 A;  3FWC A;  2KI6 D;  4WQ2 A;  2Q4U A;  5ER5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...