2KI6D

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
97
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 26
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6D00
1L7ZA 2BBMA 3SIAA 4NQGA 2L5XB 1YUTA 1FI6A 3SJSA 2WC8A 1MUXA 1YUUA 1KSMA 2LP2A 1XFWO 3RLZA 1SL9A 1KCYA 2B1UA 4MN0A 4DCKA 4P2YB 5AXIA 5HKWA 3LK1A 3GK1A 4GBAA 1K9PA 2A4JA 2R2IA 3D0YA 2LV7A 1WLZA 2JT3A 1SBJA 3CR4X 4CLNA 1UP5A 2LUCA 4NDDA 2BE4A 2L50A 1OE9B 4Q04A 1B9AA 3DF0A 5I2LA 1Y1AA 1A29A 1S6IA 2JU0A 1W7JB 1S6CA 1CFCA 1TOPA 1L2OC 4WRIA 5K89A 1DT7B 1KQMC 1FI5A 3KEVA 2H2KA 4MBEA 3D0YB 1L2OB 3A4UB 1K96A 1TNPA 3NXAA 2KBMA 2KAYA 1EXRA 2KQYA 1IQ5A 1A03A 3HCMA 4ORBB 3DF0B 1N2DA 3FIAA 3LLEA 2MA2A 4YGEB 5DKQA 1YRTB 2LAPA 3CGAA 4PE7A 1DJYA 1A75A 1CFDA 1UWOA 1QX5B 2L98A 2MLFC 2ZFDA 4HSZA 1FBVA 4PE4A 1QXPA 2WORA 4CFRA 1ZMZA 1YRUB 1Y1UA 2M97A 2PASA 4DRWA 1J7OA 3ZNIA 1TTXA 3KPXA 3JVTB 4CFQA 2LMTA 1IWQA 2CT9A 4ORAB 2JXLA 5PALA 1XA5A 1K8UA 1WRKA 1PULA 2LM5A 3CR2A 1SRAA 2ZRSA 3WHUB 2F2PA 2RGIA 1S1EA 3BYAA 1SY9A 1G8IA 1J1EA 1NP8A 4E68A 2LVJA 4DUQA 1NCXA 2K0JA 1WLMA 1QIVA 1AVSA 5D69A 2ZKMX 2M3WA 1CLBA 3D10A 1DTLA 2KQ6A 3TS5B 3WXAA 1SMGA 4MVFA 1LA0A 2MRDA 2L0PA 1SR6C 1RWYA 2JQ6A 1S5GZ 1QIWA 2JRFA 2OPOA 4QJ4B 3EK7A 1CTRA 1UHJA 4FTGA 1QV0A 3I5FB 1M46A 1N0YA 4N1GA 4ETOA 1YR5A 2LNKA 3CWGA 1RECA 3SG5A 4PHMA 2F8PA 3I5HB 2LLSA 2F33A 1SNLA 3CLNA 1B1GA 2BKIB 4CPVA 1XFVO 1ZOTB 3CTNA 4XJKA 5I2QA 1AJ5A 2CTNA 4M2OA 1EG3A 1BR1B 5CSJA 1DMOA 2LMVA 4PHJA 1F8HA 1TRFA 4C0KA 1PSBA 1F71A 4MEWA 1K95A 2SCPA 1TNXA 1S6JA 4IL1A 1NSHA 5B8IB 3KHEA 2O60A 2Q91A 1AJ4A 4XJKB 3K21A 1KK8B 3A8RA 2WCFA 1WRZA 1BF5A 2HQWA 1DGUA 5ER4X 1HT9A 3SG2A 2ISDA 1YUSA 1RK9A 1S5GY 2HQ8A 1UUSA 1WRLA 4R1EA 3FS7A 2GGMA 2LANA 3VRRA 3BOWA 2O5GA 2KDHA 2NCOA 3EK4A 1NPQA 2K2FA 3CR5X 1DJGA 2AAOA 3OB1B 1F4QA 1F54A 3EKHA 1Y0VH 1ALVA 1IGVA 3TDIA 1DJXA 3DVMA 1DJHA 4DS7A 1MQ1A 1JBAA 3BOWB 3WHTB 1LKJA 2KI4C 1LA3A 1WY9A 2JT8A 4F0ZB 3ICBA 2BECA 1D1OA 1TNWA 2KI4B 4BY4A 1WDCC 1DF0A 4GNKB 1QATA 3HX4A 4OV2A 2M29A 3O4YA 4PCWA 2JNXA 2MBXA 1BR4B 4PE1A 1SYMA 1AK8A 2LP3A 5JOLA 1NX1A 2Y1MA 5AANA 1EL4A 2Q4UA 1AP4A 1QV1A 1DF0B 1Y1XA 1S36A 3IF7A 2LE9B 3E3RA 1V1FA 1B8RA 1G33A 4HREE 1QX2A 1LVCD 2NLNA 2L4HA 2COLB 1NCZA 2ZN9A 4PE0A 1KSOA 4M2PA 2MHHA 1RJVA 2TN4A 1PVAA 1GQMA 2LUXA 2LLUA 4ICBA 3F45A 2KFFA 4A4CA 1J55A 4PHKA 4MRXA 2CBLA 4HRHA 3ZWHA 1MHOA 1NX2A 1BLQA 4I5NB 3AAJA 1KQMB 1JF0A 3OHMB 1H4BA 1OMRA 1QASA 3I5GC 4QJ3B 1IKUA 2ZNEA 3SG4A 4OVNF 1K2HA 1C7VA 4MRYA 3TUYC 2K7CA 1FF1A 2MLEC 5AFPA 4TNCA 1OMVA 2KOTA 2I18A 2NCPA 1XFZO 3GK2A 5HYDA 5D7FA 1CLMA 1B4CA 2KI6D 2FJUB 3NSLA 2M1KB 2OS8C 2LHIA 4MZLA 5AERA 2WNDA 4AQJA 3DD4A 1UHHA 2D8NA 1B7TZ 5BPJA 2KAVA 1YX7A 3JTDC 2IS9A 2FOTA 2WCBA 2KHNA 3SG3A 2HETA 3GOFA 1CDPA 3JTDB 5J3XA 4M2QA 2OTGC 1YURA 1IG5A 3LCPC 2KFHA 2L4IA 1DGVA 2FCEA 2LLTA 4L9MA 2AUCA 4YI8A 2NZ0A 1RROA 2K8MB 4HRGA 1CKKA 2KFGA 2M7NA 3PN7C 1NYAA 3AAKA 3RM1A 1S26D 4CIDA 4YGAA 1SR6B 2LVIA 3PN7B 2JWWA 4PHNA 5KSZA 5HKYA 4A4BA 3I5IC 1G4YR 1KQVA 4YGDB 1BODA 3EVRA 1XFUO 2KBIA 3EK8A 1SCMC 3C1VA 1TCOB 2EC6C 1VRKA 1ZFSA 1B7TY 1UHNA 2M1UA 3TZ1A 2BBNA 1V1GA 1MXEA 3DVEA 1A4PA 1KWOC 1UHIA 2LVVA 4YI9A 1GGZA 2KGBC 3PM8A 1BG1A 1CDLA 2KYFA 1J7QA 1YVHA 1CLLA 1XFXO 2NXQA 4N5XA 1M39A 2JXCA 2PMYA 4USLA 3BQ3A 3H4SE 1EJ3A 4WQ3A 2ZNDA 1TIZA 1BMOA 1LINA 4JPZB 2PRUA 2E6WA 5TNCA 4MZJA 2SASA 4PALA 1XK4C 5KTYA 2M8UA 1K90D 1NWDA 2JNFA 4XYNA 2H61C 1ODBA 1JC2A 3OP0A 4OCIA 1KFUS 3KO0A 2M49B 1C7WA 1PALA 1AHRA 2GGZA 2JTZA 4GGFC 1IRJA 1SL7A 3IQOA 1XO5A 1Y6WA 1F55A 1QX7A 3PATA 2WCEA 3CZTX 1OMDA 1SPYA 4AOMA 3O78A 1CM4A 2FCDA 1OZOA 1X02A 2Y1NA 2PVBA 1IQ3A 5CSIA 2M7LA 1QS7A 4P5OE 4GUKA 2M9GA 2MAZA 2JOJA 3VROA 3SIBA 1WDCB 4JWQA 1J7RA 4NDBA 2JZIA 2QACA 1PRWA 1QLKA 1DVIA 1M31A 1TN4A 2KNEA 1UHKA 5AEQA 1FW4A 3AKBA 1M63B 2ZN8A 3EVVA 1IH0A 2BKHB 4GPLB 3VRNA 1AUIB 1R2UA 2G9BA 2F3ZA 2JT0A 1PK0D 1BOCA 2JC2A 1BU3A 3CS1A 3VRQA 2JULA 1GGWA 1CNPA 4GGNA 1SCVA 1CMFA 1EG4A 3BUMB 1HQVA 1BT6A 2HF5A 2Y5IA 3BUWB 4GFTA 1YVLA 4QJ5B 3LL8B 4ZCVA 4DIRA 1DJZA 1K9KA 2CXJA 2K7OA 4C0LA 1JFJA 2K7DA 1IJ5A 1XYDA 2BCAA 3DVKA 3I5GB 1FPWA 4YGCB 2PSRA 1ZUZA 1K9UA 2I2RE 3TUYB 1GJYA 1QVIZ 1KK7Z 1JFKA 4NDCA 1JSAA 3BUNB 1YX8A 2L2EA 3KF9A 4YRUA 3M0WA 5HLVA 1F4OA 1XFYO 1R6PA 2EHBA 5ER5A 2OS8B 1KFXS 1KFUL 5HKZA 2KYCA 3PFVA 1LXFC 3TDUA 3FWCA 1CDNA 3SG7A 4JQ0D 3OX5A 1B47A 1U5IA 4C0JA 1PVBA 4UPGA 1RTP1 1TCFA 3GK4X 3PLFB 1OSAA 5G08A 3TDZA 2KAXA 4YGBB 2OTGB 2BCBA 2HPSA 2LCPA 3SG6A 1OQPA 3PSRA 3EKJA 1IJ6A 3JVTC 1U5IB 3WNXB 2K61A 3O2PA 4WQ2A 2EGDA 2BL0C 1NX0A 1QVIY 1KK7Y 1A75B 1K94A 2V53A 2P6BB 2BL0B 5HLOA 4D1EA 1CMGA 1SW8A 2VRGA 1JUOA 4U8DA 1CM1A 2E30A 1SL8A 3I5IB 1OZSA 2GV5A 1CDMA 2Y4QA 1SCMB 5DKRA 1H8BA 2EC6B 3TS5C 5F6TA 4BY5A 4I5LB 2I7AA 1KWOB 3BUOB 3EVUA 3I5FC 5KU1A 1JWDA 1Q80A 1UURA 4OR9B 5GQQC 1XK4A 4GAOA 4ZCUA 5CSFA 1MWNA 2H61A 1QJTA 3I5HC 1NCYA 1N65A 2ZRTA 5DKNA 5JJGA 4YBHB 1W7IB 4GGFA 1SKTA 2AMIA 3FWBA 2K2AA 1C07A 1F70A 1B8LA 4N1FA 2JPTA 3PALA 2K7BA 5CSNA 4MLWA 3OX6A 1NX3A 1B8CA 3NSKA 1S3PA 3BUXB 3VRPA 1A2XA 1OOJA 2BCXA 2MJWB 1J7PA 1MF8B 4AQIA 1K93D 2LC5A 2F3YA 1MXLC 1KK8C 5IBWA 1SK6D 1ZACA 1J1DA 5I8NA 4PDZA 3OB2B 1QLSA 1ALWA 3NSOA 2BE6A 1CFFA 1XVJA 1KFXL 4I5JA 4FQOA 1QTXA 5CPVA 3QRXA 1EH2A 1RFJA 1DJIA 3NSIA 1YTZC 1E8AA 1MR8A 2WOSA 1NIWA 2KI6C 2I94A 1DJWA 4OKHA 2DOQA 3O6BA 2CCMA 2LHLA 3MSEB 2G2BA 1NUBA 2KGRA 2PALA 1JF2A 3AKAA 4MZKA 3VGOA 2L51A 4ORCB 3BXKA 1M45A 2F2OA 1BJFA 1CFPA 4I5KA 2JTTA 2M0RA 1CB1A 1TNQA 2KSPA 3LK0A 3IQQA 5FYXA 1PSRA 2QPTA 5I2OA 2LVKA 2CNPA 4MSPA 3DVJA 2LMUA
chains in the Genus database with same CATH superfamily
1L7ZA 2BBMA 3SIAA 4NQGA 1C3YA 4FQTA 2L5XB 3UO9A 1YUTA 1FI6A 3SJSA 4F7FA 2WC8A 1MUXA 1YUUA 1KSMA 2LP2A 2WC5A 1XFWO 3RLZA 1SL9A 1KCYA 3Q8IA 2B1UA 4MN0A 1DEKA 4DCKA 4P2YB 5AXIA 5HKWA 3L4LA 3LK1A 3GK1A 4GBAA 1K9PA 2A4JA 2R2IA 3D0YA 2LV7A 1WLZA 2JT3A 1SBJA 3CR4X 3B7AA 2PQLA 4CLNA 1UP5A 2LUCA 4NDDA 2BE4A 2L50A 1OE9B 4Q04A 1B9AA 3DF0A 5I2LA 1Y1AA 1A29A 1S6IA 2JU0A 1W7JB 1S6CA 1CFCA 1TOPA 1L2OC 4WRIA 5K89A 1DT7B 1KQMC 1FI5A 3KEVA 2H2KA 4MBEA 3O4XA 3D0YB 1L2OB 3A4UB 1K96A 1TNPA 3NXAA 2KBMA 2KAYA 1EXRA 2KQYA 1IQ5A 1A03A 3HCMA 3BFBA 3FE9A 3DF0B 4ORBB 1N2DA 3FIAA 3LLEA 2MA2A 4KYNA 4YGEB 5DKQA 1YRTB 4JD9A 2WCKA 2LAPA 3CGAA 4PE7A 1DJYA 1A75A 1CFDA 1UWOA 1QX5B 2L98A 2MLFC 2ZFDA 4HSZA 1FBVA 4PE4A 1QXPA 2WORA 4CFRA 1ZMZA 1YRUB 1Y1UA 2M97A 3PJIA 2PASA 4DRWA 1J7OA 3ZNIA 1TTXA 3KPXA 3JVTB 4CFQA 2LMTA 1IWQA 1SSEB 2CT9A 2JXLA 2P71A 1XA5A 1K8UA 1WRKA 1PULA 2LM5A 3CR2A 3CYZA 1SRAA 5FI2A 3CZ2A 2ZRSA 3WHUB 2F2PA 3D76A 2RGIA 5D3OA 3NGVA 1S1EA 5EL2A 3BYAA 1SY9A 1G8IA 1J1EA 1NP8A 4E68A 2LVJA 4DUQA 1NCXA 2K0JA 1WLMA 1QIVA 1AVSA 5D69A 2ZKMX 2M3WA 1CLBA 3D10A 1DTLA 2JPOA 2KQ6A 2WCHA 3TS5B 3WXAA 3S0AA 1SMGA 4MVFA 1LA0A 2MRDA 3PM2A 2L0PA 3D78A 1SR6C 1RWYA 2JQ6A 1S5GZ 1QIWA 2JRFA 2OPOA 2WCLA 4QJ4B 3EK7A 1GM0A 1CTRA 1UHJA 4FTGA 1QV0A 3I5FB 1M46A 1N0YA 4N1GA 4ETOA 3BFAA 1YR5A 2LNKA 3CWGA 1RECA 1QWVA 3SG5A 4PHMA 2F8PA 3I5HB 2LLSA 2F33A 1SNLA 3CLNA 1B1GA 2BKIB 4CPVA 1OOGA 1XFVO 1ZOTB 3CTNA 3OBVA 4PT1A 1AJ5A 2CTNA 4M2OA 1EG3A 4XJKA 5I2QA 1BR1B 5CSJA 1DMOA 2LMVA 3CDNA 4PHJA 1F8HA 1TRFA 4C0KA 1PSBA 1F71A 4JKTA 4MEWA 1K95A 2SCPA 1TNXA 1S6JA 4IL1A 1NSHA 1T14A 5B8IB 3KHEA 2O60A 2Q91A 1AJ4A 4XJKB 3K21A 1KK8B 3A8RA 2WCFA 1WRZA 1BF5A 2HQWA 1DGUA 5ER4X 1HT9A 3NHIA 3SG2A 2ISDA 1YUSA 1RK9A 1S5GY 2HQ8A 1UUSA 1WRLA 4R1EA 3FS7A 2H8VA 2GGMA 2LANA 3VRRA 3BOWA 1TUJA 2O5GA 2KDHA 2NCOA 3EK4A 1NPQA 2K2FA 3CR5X 3S0EA 1DJGA 2AAOA 3OB1B 1F4QA 1F54A 3EKHA 1Y0VH 1ALVA 1IGVA 3TDIA 1DJXA 1XFRA 3DVMA 4INXA 1DJHA 4DS7A 1MQ1A 1JBAA 3BOWB 3WHTB 1LKJA 2KI4C 1LA3A 1WY9A 2JT8A 4F0ZB 3ICBA 2BECA 3SS5A 1D1OA 1TNWA 2KI4B 4BY4A 1WDCC 1DF0A 4GNKB 1QATA 3HX4A 4OV2A 2M29A 3O4YA 4PCWA 2JNXA 2MBXA 1BR4B 4PE1A 1SYMA 1AK8A 2LP3A 5JOLA 1NX1A 2Y1MA 5AANA 1EL4A 2Q4UA 1AP4A 1QV1A 1DF0B 1Y1XA 1S36A 3IF7A 2LE9B 3R1VA 3E3RA 3L47A 3FE8A 3NHTA 1V1FA 3BJHA 1B8RA 1G33A 4HREE 1QX2A 1LVCD 2NLNA 2L4HA 2COLB 1NCZA 2ZN9A 4PE0A 1KSOA 3N7HA 1OOIX 1Z2CB 4M2PA 2MHHA 1RJVA 2TN4A 1PVAA 1GQMA 2LUXA 2LLUA 4ICBA 3F45A 2KFFA 4A4CA 1J55A 4PHKA 4MRXA 2CBLA 4HRHA 3ZWHA 1MHOA 1NX2A 1BLQA 4I5NB 3AAJA 1KQMB 1JF0A 3OHMB 1H4BA 1OMRA 1QASA 3I5GC 4QJ3B 1IKUA 2ZNEA 3BFHA 3D73A 3R1PA 4OVNF 3SG4A 1K2HA 1C7VA 4MRYA 3CZ0A 2K7CA 3TUYC 1FF1A 2MLEC 5AFPA 3D75A 1OMVA 4TNCA 2KOTA 2I18A 2NCPA 1XFZO 3GK2A 5HYDA 5D7FA 1CLMA 1B4CA 2KI6D 2FJUB 3NSLA 2M1KB 2OS8C 2LHIA 4MZLA 5AERA 2WNDA 2GTEA 4AQJA 2WCMA 3DD4A 1UHHA 2D8NA 1B7TZ 5BPJA 2KAVA 1YX7A 3JTDC 3S0FA 2IS9A 2FOTA 2WCBA 2KHNA 3SG3A 1OW4A 2HETA 3GOFA 5PALA 1CDPA 3JTDB 5J3XA 4M2QA 2OTGC 1YURA 1IG5A 3LCPC 2KFHA 2L4IA 1DGVA 1P28A 2FCEA 2LLTA 4L9MA 2AUCA 4YI8A 2NZ0A 1RROA 2K8MB 4HRGA 1CKKA 2KFGA 2M7NA 3PN7C 1NYAA 3AAKA 3RM1A 1S26D 4CIDA 4YGAA 1SR6B 2LVIA 3PN7B 2JWWA 4PHNA 5KSZA 5HKYA 4A4BA 3I5IC 1G4YR 3D74A 1KQVA 4YGDB 1BODA 3EVRA 2P70A 1XFUO 2KBIA 3D77A 1SCMC 2BNXA 3C1VA 3EK8A 1TCOB 2EC6C 1VRKA 1ZFSA 3CZ1A 1B7TY 1UHNA 2M1UA 3TZ1A 2BBNA 1V1GA 1MXEA 3DVEA 3EG5B 1A4PA 1KWOC 1UHIA 2LVVA 4YI9A 1GGZA 2KGBC 3PM8A 1BG1A 1CDLA 2KYFA 3RZSA 1J7QA 1YVHA 1CLLA 1XFXO 2NXQA 4N5XA 1M39A 2JXCA 2PMYA 4USLA 3BQ3A 3H4SE 1EJ3A 4WQ3A 1DC1A 2ZNDA 1TIZA 1BMOA 1LINA 4JPZB 2PRUA 2E6WA 5TNCA 4MZJA 2SASA 4PALA 1XK4C 5KTYA 2M8UA 1K90D 4IJ7A 1NWDA 2JNFA 4XYNA 2H61C 1ODBA 1JC2A 1W9ZA 3OP0A 4OCIA 1KFUS 3KO0A 2M49B 3OGNA 2QEBA 1C7WA 1PALA 1AHRA 2GGZA 2JTZA 4GGFC 1IRJA 1SL7A 3UNWA 3IQOA 1XO5A 1Y6WA 1F55A 1QX7A 3PATA 2WCEA 3QMEA 3CZTX 2ERBA 1OMDA 1SPYA 4AOMA 3O78A 1CM4A 1OOHA 1OZOA 2FCDA 5HL1A 1X02A 2Y1NA 2PVBA 1IQ3A 5CSIA 2M7LA 1QS7A 4P5OE 4GUKA 2QEVA 2M9GA 2MAZA 2JOJA 3VROA 2QEOA 3SIBA 1WDCB 2QEHA 1TWOA 4JWQA 1J7RA 4NDBA 2JZIA 2QACA 3DYEA 1PRWA 1QLKA 1DVIA 1M31A 1TN4A 2KNEA 1UHKA 5AEQA 1FW4A 3AKBA 1M63B 2ZN8A 3EVVA 1IH0A 2BKHB 4GPLB 2KPHA 3B87A 3VRNA 1AUIB 1R2UA 2G9BA 2F3ZA 2JT0A 2QDIA 1PK0D 1BOCA 2JC2A 2PYQA 1BU3A 3CS1A 3DXLA 3VRQA 2JULA 3B86A 1GGWA 1CNPA 3IVTA 4GGNA 1SCVA 1CMFA 1EG4A 3DZTA 3BUMB 3B88A 1HQVA 1BT6A 2HF5A 2Y5IA 3BUWB 4GFTA 1YVLA 4QJ5B 3LL8B 1LS8A 4ZCVA 1DJZA 4DIRA 1K9KA 2CXJA 2K7OA 4C0LA 1JFJA 2K7DA 1IJ5A 1XYDA 2L2CA 3S0BA 3CABA 5FI6A 3S0DA 2BCAA 3DVKA 3I5GB 1FPWA 4YGCB 2FJYA 2PSRA 1ZUZA 3SS4A 1K9UA 4OZDA 3FE6A 2I2RE 3TUYB 1GJYA 1QVIZ 1KK7Z 1JFKA 4NDCA 1JSAA 1ORGA 3BUNB 1YX8A 2L2EA 3KF9A 4YRUA 3L4AA 2K60A 3V2LA 3M0WA 5HLVA 1F4OA 1XFYO 1R6PA 2EHBA 5ER5A 2OS8B 1KFXS 1KFUL 5HKZA 1IIOA 2KYCA 3PFVA 1LXFC 3TDUA 3FWCA 1CDNA 3SG7A 4JQ0D 3OX5A 1B47A 1U5IA 4C0JA 1PVBA 4UPGA 1RTP1 1TCFA 3GK4X 3SS3A 3PLFB 1OSAA 5G08A 3TDZA 2KAXA 4YGBB 2OTGB 2BCBA 2HPSA 2LCPA 3SG6A 5I94A 1OQPA 3PSRA 3EKJA 1IJ6A 3JVTC 1C3ZA 1U5IB 3WNXB 2K61A 3B6XA 3O2PA 4WQ2A 2EGDA 2BL0C 1NX0A 1QVIY 2BAPA 1KK7Y 1A75B 1K94A 2V53A 2P6BB 2BL0B 3R72A 2KLDA 5HLOA 4D1EA 1CMGA 1SW8A 2VRGA 1JUOA 4U8DA 1CM1A 3S0GA 2E30A 1SL8A 3I5IB 1OZSA 2GV5A 1CDMA 2Y4QA 1DELA 1SCMB 5DKRA 1H8BA 2EC6B 3TS5C 5F6TA 4BY5A 4I5LB 3K1EA 2I7AA 1KWOB 3BUOB 3EVUA 3I5FC 5KU1A 1JWDA 1Q80A 1UURA 4OR9B 5GQQC 1XK4A 4GAOA 1OOFA 5CSFA 4ZCUA 1MWNA 2H61A 1QJTA 3I5HC 1NCYA 1N65A 2ZRTA 3R1OA 5DKNA 5JJGA 4YBHB 1W7IB 4GGFA 1SKTA 2AMIA 3FWBA 5DICA 2K2AA 1C07A 1F70A 1B8LA 4N1FA 2JPTA 3PALA 2K7BA 5CSNA 4MLWA 3OX6A 1NX3A 1B8CA 3NSKA 1S3PA 3BUXB 3VB1A 3VRPA 1A2XA 1OOJA 2BCXA 2MJWB 1J7PA 1MF8B 4AQIA 1K93D 2LC5A 2F3YA 1MXLC 2L5YA 1KK8C 5IBWA 1SK6D 1ZACA 1J1DA 1DQEA 5I8NA 4PDZA 3OB2B 1QLSA 1ALWA 3NSOA 2BE6A 1CFFA 1XVJA 1KFXL 4I5JA 4FQOA 1QTXA 5CPVA 3QRXA 1EH2A 1RFJA 1DJIA 3NSIA 5FI7A 1YTZC 4INWA 1E8AA 1MR8A 2WOSA 1NIWA 2KI6C 1Z4HA 2I94A 1DJWA 4OKHA 2DOQA 3O6BA 2CCMA 2LHLA 3MSEB 1TUZA 2G2BA 2WC6A 1NUBA 2KGRA 2PALA 1JF2A 3AKAA 4MZKA 3VGOA 2L51A 4ORCB 3BXKA 3DY9A 1M45A 2F2OA 1BJFA 1CFPA 4I5KA 2JTTA 2M0RA 1CB1A 1TNQA 2KSPA 3LK0A 3IQQA 2YGUA 5FYXA 1PSRA 2QPTA 4ORAB 2LVKA 5I2OA 2CNPA 4MSPA 3DVJA 2WCJA 2KLEA 2LMUA
chains in the Genus database with same CATH topology
1L7ZA 2BBMA 3SIAA 4NQGA 2L5XB 1YUTA 1FI6A 3SJSA 2WC8A 1MUXA 1YUUA 1KSMA 2LP2A 1XFWO 3RLZA 1SL9A 1KCYA 2B1UA 4MN0A 4DCKA 4P2YB 5AXIA 5HKWA 3LK1A 3GK1A 4GBAA 1K9PA 2A4JA 2R2IA 3D0YA 2LV7A 1WLZA 2JT3A 1SBJA 3CR4X 4CLNA 1UP5A 2LUCA 4NDDA 2BE4A 2L50A 1OE9B 4Q04A 1B9AA 3DF0A 5I2LA 1Y1AA 1A29A 1S6IA 2JU0A 1W7JB 1S6CA 1CFCA 1TOPA 1L2OC 4WRIA 5K89A 1DT7B 1KQMC 1FI5A 3KEVA 2H2KA 4MBEA 3D0YB 1L2OB 3A4UB 1K96A 1TNPA 3NXAA 2KBMA 2KAYA 1EXRA 2KQYA 1IQ5A 1A03A 3HCMA 4ORBB 3DF0B 1N2DA 3FIAA 3LLEA 2MA2A 4YGEB 5DKQA 1YRTB 2LAPA 3CGAA 4PE7A 1DJYA 1A75A 1CFDA 1UWOA 1QX5B 2L98A 2MLFC 2ZFDA 4HSZA 1FBVA 4PE4A 1QXPA 2WORA 4CFRA 1ZMZA 1YRUB 1Y1UA 2M97A 2PASA 4DRWA 1J7OA 3ZNIA 1TTXA 3KPXA 3JVTB 4CFQA 2LMTA 1IWQA 2CT9A 4ORAB 2JXLA 5PALA 1XA5A 1K8UA 1WRKA 1PULA 2LM5A 3CR2A 1SRAA 2ZRSA 3WHUB 2F2PA 2RGIA 1S1EA 3BYAA 1SY9A 1G8IA 1J1EA 1NP8A 4E68A 2LVJA 4DUQA 1NCXA 2K0JA 1WLMA 1QIVA 1AVSA 5D69A 2ZKMX 2M3WA 1CLBA 3D10A 1DTLA 2KQ6A 3TS5B 3WXAA 1SMGA 4MVFA 1LA0A 2MRDA 2L0PA 1SR6C 1RWYA 2JQ6A 1S5GZ 1QIWA 2JRFA 2OPOA 4QJ4B 3EK7A 1CTRA 1UHJA 4FTGA 1QV0A 3I5FB 1M46A 1N0YA 4N1GA 4ETOA 1YR5A 2LNKA 3CWGA 1RECA 3SG5A 4PHMA 2F8PA 3I5HB 2LLSA 2F33A 1SNLA 3CLNA 1B1GA 2BKIB 4CPVA 1XFVO 1ZOTB 3CTNA 4XJKA 5I2QA 1AJ5A 2CTNA 4M2OA 1EG3A 1BR1B 5CSJA 1DMOA 2LMVA 4PHJA 1F8HA 1TRFA 4C0KA 1PSBA 1F71A 4MEWA 1K95A 2SCPA 1TNXA 1S6JA 4IL1A 1NSHA 5B8IB 3KHEA 2O60A 2Q91A 1AJ4A 4XJKB 3K21A 1KK8B 3A8RA 2WCFA 1WRZA 1BF5A 2HQWA 1DGUA 5ER4X 1HT9A 3SG2A 2ISDA 1YUSA 1RK9A 1S5GY 2HQ8A 1UUSA 1WRLA 4R1EA 3FS7A 2GGMA 2LANA 3VRRA 3BOWA 2O5GA 2KDHA 2NCOA 3EK4A 1NPQA 2K2FA 3CR5X 1DJGA 2AAOA 3OB1B 1F4QA 1F54A 3EKHA 1Y0VH 1ALVA 1IGVA 3TDIA 1DJXA 3DVMA 1DJHA 4DS7A 1MQ1A 1JBAA 3BOWB 3WHTB 1LKJA 2KI4C 1LA3A 1WY9A 2JT8A 4F0ZB 3ICBA 2BECA 1D1OA 1TNWA 2KI4B 4BY4A 1WDCC 1DF0A 4GNKB 1QATA 3HX4A 4OV2A 2M29A 3O4YA 4PCWA 2JNXA 2MBXA 1BR4B 4PE1A 1SYMA 1AK8A 2LP3A 5JOLA 1NX1A 2Y1MA 5AANA 1EL4A 2Q4UA 1AP4A 1QV1A 1DF0B 1Y1XA 1S36A 3IF7A 2LE9B 3E3RA 1V1FA 1B8RA 1G33A 4HREE 1QX2A 1LVCD 2NLNA 2L4HA 2COLB 1NCZA 2ZN9A 4PE0A 1KSOA 4M2PA 2MHHA 1RJVA 2TN4A 1PVAA 1GQMA 2LUXA 2LLUA 4ICBA 3F45A 2KFFA 4A4CA 1J55A 4PHKA 4MRXA 2CBLA 4HRHA 3ZWHA 1MHOA 1NX2A 1BLQA 4I5NB 3AAJA 1KQMB 1JF0A 3OHMB 1H4BA 1OMRA 1QASA 3I5GC 4QJ3B 1IKUA 2ZNEA 3SG4A 4OVNF 1K2HA 1C7VA 4MRYA 3TUYC 2K7CA 1FF1A 2MLEC 5AFPA 4TNCA 1OMVA 2KOTA 2I18A 2NCPA 1XFZO 3GK2A 5HYDA 5D7FA 1CLMA 1B4CA 2KI6D 2FJUB 3NSLA 2M1KB 2OS8C 2LHIA 4MZLA 5AERA 2WNDA 4AQJA 3DD4A 1UHHA 2D8NA 1B7TZ 5BPJA 2KAVA 1YX7A 3JTDC 2IS9A 2FOTA 2WCBA 2KHNA 3SG3A 2HETA 3GOFA 1CDPA 3JTDB 5J3XA 4M2QA 2OTGC 1YURA 1IG5A 3LCPC 2KFHA 2L4IA 1DGVA 2FCEA 2LLTA 4L9MA 2AUCA 4YI8A 2NZ0A 1RROA 2K8MB 4HRGA 1CKKA 2KFGA 2M7NA 3PN7C 1NYAA 3AAKA 3RM1A 1S26D 4CIDA 4YGAA 1SR6B 2LVIA 3PN7B 2JWWA 4PHNA 5KSZA 5HKYA 4A4BA 3I5IC 1G4YR 1KQVA 4YGDB 1BODA 3EVRA 1XFUO 2KBIA 3EK8A 1SCMC 3C1VA 1TCOB 2EC6C 1VRKA 1ZFSA 1B7TY 1UHNA 2M1UA 3TZ1A 2BBNA 1V1GA 1MXEA 3DVEA 1A4PA 1KWOC 1UHIA 2LVVA 4YI9A 1GGZA 2KGBC 3PM8A 1BG1A 1CDLA 2KYFA 1J7QA 1YVHA 1CLLA 1XFXO 2NXQA 4N5XA 1M39A 2JXCA 2PMYA 4USLA 3BQ3A 3H4SE 1EJ3A 4WQ3A 2ZNDA 1TIZA 1BMOA 1LINA 4JPZB 2PRUA 2E6WA 5TNCA 4MZJA 2SASA 4PALA 1XK4C 5KTYA 2M8UA 1K90D 1NWDA 2JNFA 4XYNA 2H61C 1ODBA 1JC2A 3OP0A 4OCIA 1KFUS 3KO0A 2M49B 1C7WA 1PALA 1AHRA 2GGZA 2JTZA 4GGFC 1IRJA 1SL7A 3IQOA 1XO5A 1Y6WA 1F55A 1QX7A 3PATA 2WCEA 3CZTX 1OMDA 1SPYA 4AOMA 3O78A 1CM4A 2FCDA 1OZOA 1X02A 2Y1NA 2PVBA 1IQ3A 5CSIA 2M7LA 1QS7A 4P5OE 4GUKA 2M9GA 2MAZA 2JOJA 3VROA 3SIBA 1WDCB 4JWQA 1J7RA 4NDBA 2JZIA 2QACA 1PRWA 1QLKA 1DVIA 1M31A 1TN4A 2KNEA 1UHKA 5AEQA 1FW4A 3AKBA 1M63B 2ZN8A 3EVVA 1IH0A 2BKHB 4GPLB 3VRNA 1AUIB 1R2UA 2G9BA 2F3ZA 2JT0A 1PK0D 1BOCA 2JC2A 1BU3A 3CS1A 3VRQA 2JULA 1GGWA 1CNPA 4GGNA 1SCVA 1CMFA 1EG4A 3BUMB 1HQVA 1BT6A 2HF5A 2Y5IA 3BUWB 4GFTA 1YVLA 4QJ5B 3LL8B 4ZCVA 4DIRA 1DJZA 1K9KA 2CXJA 2K7OA 4C0LA 1JFJA 2K7DA 1IJ5A 1XYDA 2BCAA 3DVKA 3I5GB 1FPWA 4YGCB 2PSRA 1ZUZA 1K9UA 2I2RE 3TUYB 1GJYA 1QVIZ 1KK7Z 1JFKA 4NDCA 1JSAA 3BUNB 1YX8A 2L2EA 3KF9A 4YRUA 3M0WA 5HLVA 1F4OA 1XFYO 1R6PA 2EHBA 5ER5A 2OS8B 1KFXS 1KFUL 5HKZA 2KYCA 3PFVA 1LXFC 3TDUA 3FWCA 1CDNA 3SG7A 4JQ0D 3OX5A 1B47A 1U5IA 4C0JA 1PVBA 4UPGA 1RTP1 1TCFA 3GK4X 3PLFB 1OSAA 5G08A 3TDZA 2KAXA 4YGBB 2OTGB 2BCBA 2HPSA 2LCPA 3SG6A 1OQPA 3PSRA 3EKJA 1IJ6A 3JVTC 1U5IB 3WNXB 2K61A 3O2PA 4WQ2A 2EGDA 2BL0C 1NX0A 1QVIY 1KK7Y 1A75B 1K94A 2V53A 2P6BB 2BL0B 5HLOA 4D1EA 1CMGA 1SW8A 2VRGA 1JUOA 4U8DA 1CM1A 2E30A 1SL8A 3I5IB 1OZSA 2GV5A 1CDMA 2Y4QA 1SCMB 5DKRA 1H8BA 2EC6B 3TS5C 5F6TA 4BY5A 4I5LB 2I7AA 1KWOB 3BUOB 3EVUA 3I5FC 5KU1A 1JWDA 1Q80A 1UURA 4OR9B 5GQQC 1XK4A 4GAOA 4ZCUA 5CSFA 1MWNA 2H61A 1QJTA 3I5HC 1NCYA 1N65A 2ZRTA 5DKNA 5JJGA 4YBHB 1W7IB 4GGFA 1SKTA 2AMIA 3FWBA 2K2AA 1C07A 1F70A 1B8LA 4N1FA 2JPTA 3PALA 2K7BA 5CSNA 4MLWA 3OX6A 1NX3A 1B8CA 3NSKA 1S3PA 3BUXB 3VRPA 1A2XA 1OOJA 2BCXA 2MJWB 1J7PA 1MF8B 4AQIA 1K93D 2LC5A 2F3YA 1MXLC 1KK8C 5IBWA 1SK6D 1ZACA 1J1DA 5I8NA 4PDZA 3OB2B 1QLSA 1ALWA 3NSOA 2BE6A 1CFFA 1XVJA 1KFXL 4I5JA 4FQOA 1QTXA 5CPVA 3QRXA 1EH2A 1RFJA 1DJIA 3NSIA 1YTZC 1E8AA 1MR8A 2WOSA 1NIWA 2KI6C 2I94A 1DJWA 4OKHA 2DOQA 3O6BA 2CCMA 2LHLA 3MSEB 2G2BA 1NUBA 2KGRA 2PALA 1JF2A 3AKAA 4MZKA 3VGOA 2L51A 4ORCB 3BXKA 1M45A 2F2OA 1BJFA 1CFPA 4I5KA 2JTTA 2M0RA 1CB1A 1TNQA 2KSPA 3LK0A 3IQQA 5FYXA 1PSRA 2QPTA 5I2OA 2LVKA 2CNPA 4MSPA 3DVJA 2LMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7Z A;  2BBM A;  3SIA A;  4NQG A;  2L5X B;  1YUT A;  1FI6 A;  3SJS A;  2WC8 A;  1MUX A;  1YUU A;  1KSM A;  2LP2 A;  1XFW O;  3RLZ A;  1SL9 A;  1KCY A;  2B1U A;  4MN0 A;  4DCK A;  4P2Y B;  5AXI A;  5HKW A;  3LK1 A;  3GK1 A;  4GBA A;  1K9P A;  2A4J A;  2R2I A;  3D0Y A;  2LV7 A;  1WLZ A;  2JT3 A;  1SBJ A;  3CR4 X;  4CLN A;  1UP5 A;  2LUC A;  4NDD A;  2BE4 A;  2L50 A;  1OE9 B;  4Q04 A;  1B9A A;  3DF0 A;  5I2L A;  1Y1A A;  1A29 A;  1S6I A;  2JU0 A;  1W7J B;  1S6C A;  1CFC A;  1TOP A;  1L2O C;  4WRI A;  5K89 A;  1DT7 B;  1KQM C;  1FI5 A;  3KEV A;  2H2K A;  4MBE A;  3D0Y B;  1L2O B;  3A4U B;  1K96 A;  1TNP A;  3NXA A;  2KBM A;  2KAY A;  1EXR A;  2KQY A;  1IQ5 A;  1A03 A;  3HCM A;  4ORB B;  3DF0 B;  1N2D A;  3FIA A;  3LLE A;  2MA2 A;  4YGE B;  5DKQ A;  1YRT B;  2LAP A;  3CGA A;  4PE7 A;  1DJY A;  1A75 A;  1CFD A;  1UWO A;  1QX5 B;  2L98 A;  2MLF C;  2ZFD A;  4HSZ A;  1FBV A;  4PE4 A;  1QXP A;  2WOR A;  4CFR A;  1ZMZ A;  1YRU B;  1Y1U A;  2M97 A;  2PAS A;  4DRW A;  1J7O A;  3ZNI A;  1TTX A;  3KPX A;  3JVT B;  4CFQ A;  2LMT A;  1IWQ A;  2CT9 A;  4ORA B;  2JXL A;  5PAL A;  1XA5 A;  1K8U A;  1WRK A;  1PUL A;  2LM5 A;  3CR2 A;  1SRA A;  2ZRS A;  3WHU B;  2F2P A;  2RGI A;  1S1E A;  3BYA A;  1SY9 A;  1G8I A;  1J1E A;  1NP8 A;  4E68 A;  2LVJ A;  4DUQ A;  1NCX A;  2K0J A;  1WLM A;  1QIV A;  1AVS A;  5D69 A;  2ZKM X;  2M3W A;  1CLB A;  3D10 A;  1DTL A;  2KQ6 A;  3TS5 B;  3WXA A;  1SMG A;  4MVF A;  1LA0 A;  2MRD A;  2L0P A;  1SR6 C;  1RWY A;  2JQ6 A;  1S5G Z;  1QIW A;  2JRF A;  2OPO A;  4QJ4 B;  3EK7 A;  1CTR A;  1UHJ A;  4FTG A;  1QV0 A;  3I5F B;  1M46 A;  1N0Y A;  4N1G A;  4ETO A;  1YR5 A;  2LNK A;  3CWG A;  1REC A;  3SG5 A;  4PHM A;  2F8P A;  3I5H B;  2LLS A;  2F33 A;  1SNL A;  3CLN A;  1B1G A;  2BKI B;  4CPV A;  1XFV O;  1ZOT B;  3CTN A;  4XJK A;  5I2Q A;  1AJ5 A;  2CTN A;  4M2O A;  1EG3 A;  1BR1 B;  5CSJ A;  1DMO A;  2LMV A;  4PHJ A;  1F8H A;  1TRF A;  4C0K A;  1PSB A;  1F71 A;  4MEW A;  1K95 A;  2SCP A;  1TNX A;  1S6J A;  4IL1 A;  1NSH A;  5B8I B;  3KHE A;  2O60 A;  2Q91 A;  1AJ4 A;  4XJK B;  3K21 A;  1KK8 B;  3A8R A;  2WCF A;  1WRZ A;  1BF5 A;  2HQW A;  1DGU A;  5ER4 X;  1HT9 A;  3SG2 A;  2ISD A;  1YUS A;  1RK9 A;  1S5G Y;  2HQ8 A;  1UUS A;  1WRL A;  4R1E A;  3FS7 A;  2GGM A;  2LAN A;  3VRR A;  3BOW A;  2O5G A;  2KDH A;  2NCO A;  3EK4 A;  1NPQ A;  2K2F A;  3CR5 X;  1DJG A;  2AAO A;  3OB1 B;  1F4Q A;  1F54 A;  3EKH A;  1Y0V H;  1ALV A;  1IGV A;  3TDI A;  1DJX A;  3DVM A;  1DJH A;  4DS7 A;  1MQ1 A;  1JBA A;  3BOW B;  3WHT B;  1LKJ A;  2KI4 C;  1LA3 A;  1WY9 A;  2JT8 A;  4F0Z B;  3ICB A;  2BEC A;  1D1O A;  1TNW A;  2KI4 B;  4BY4 A;  1WDC C;  1DF0 A;  4GNK B;  1QAT A;  3HX4 A;  4OV2 A;  2M29 A;  3O4Y A;  4PCW A;  2JNX A;  2MBX A;  1BR4 B;  4PE1 A;  1SYM A;  1AK8 A;  2LP3 A;  5JOL A;  1NX1 A;  2Y1M A;  5AAN A;  1EL4 A;  2Q4U A;  1AP4 A;  1QV1 A;  1DF0 B;  1Y1X A;  1S36 A;  3IF7 A;  2LE9 B;  3E3R A;  1V1F A;  1B8R A;  1G33 A;  4HRE E;  1QX2 A;  1LVC D;  2NLN A;  2L4H A;  2COL B;  1NCZ A;  2ZN9 A;  4PE0 A;  1KSO A;  4M2P A;  2MHH A;  1RJV A;  2TN4 A;  1PVA A;  1GQM A;  2LUX A;  2LLU A;  4ICB A;  3F45 A;  2KFF A;  4A4C A;  1J55 A;  4PHK A;  4MRX A;  2CBL A;  4HRH A;  3ZWH A;  1MHO A;  1NX2 A;  1BLQ A;  4I5N B;  3AAJ A;  1KQM B;  1JF0 A;  3OHM B;  1H4B A;  1OMR A;  1QAS A;  3I5G C;  4QJ3 B;  1IKU A;  2ZNE A;  3SG4 A;  4OVN F;  1K2H A;  1C7V A;  4MRY A;  3TUY C;  2K7C A;  1FF1 A;  2MLE C;  5AFP A;  4TNC A;  1OMV A;  2KOT A;  2I18 A;  2NCP A;  1XFZ O;  3GK2 A;  5HYD A;  5D7F A;  1CLM A;  1B4C A;  2KI6 D;  2FJU B;  3NSL A;  2M1K B;  2OS8 C;  2LHI A;  4MZL A;  5AER A;  2WND A;  4AQJ A;  3DD4 A;  1UHH A;  2D8N A;  1B7T Z;  5BPJ A;  2KAV A;  1YX7 A;  3JTD C;  2IS9 A;  2FOT A;  2WCB A;  2KHN A;  3SG3 A;  2HET A;  3GOF A;  1CDP A;  3JTD B;  5J3X A;  4M2Q A;  2OTG C;  1YUR A;  1IG5 A;  3LCP C;  2KFH A;  2L4I A;  1DGV A;  2FCE A;  2LLT A;  4L9M A;  2AUC A;  4YI8 A;  2NZ0 A;  1RRO A;  2K8M B;  4HRG A;  1CKK A;  2KFG A;  2M7N A;  3PN7 C;  1NYA A;  3AAK A;  3RM1 A;  1S26 D;  4CID A;  4YGA A;  1SR6 B;  2LVI A;  3PN7 B;  2JWW A;  4PHN A;  5KSZ A;  5HKY A;  4A4B A;  3I5I C;  1G4Y R;  1KQV A;  4YGD B;  1BOD A;  3EVR A;  1XFU O;  2KBI A;  3EK8 A;  1SCM C;  3C1V A;  1TCO B;  2EC6 C;  1VRK A;  1ZFS A;  1B7T Y;  1UHN A;  2M1U A;  3TZ1 A;  2BBN A;  1V1G A;  1MXE A;  3DVE A;  1A4P A;  1KWO C;  1UHI A;  2LVV A;  4YI9 A;  1GGZ A;  2KGB C;  3PM8 A;  1BG1 A;  1CDL A;  2KYF A;  1J7Q A;  1YVH A;  1CLL A;  1XFX O;  2NXQ A;  4N5X A;  1M39 A;  2JXC A;  2PMY A;  4USL A;  3BQ3 A;  3H4S E;  1EJ3 A;  4WQ3 A;  2ZND A;  1TIZ A;  1BMO A;  1LIN A;  4JPZ B;  2PRU A;  2E6W A;  5TNC A;  4MZJ A;  2SAS A;  4PAL A;  1XK4 C;  5KTY A;  2M8U A;  1K90 D;  1NWD A;  2JNF A;  4XYN A;  2H61 C;  1ODB A;  1JC2 A;  3OP0 A;  4OCI A;  1KFU S;  3KO0 A;  2M49 B;  1C7W A;  1PAL A;  1AHR A;  2GGZ A;  2JTZ A;  4GGF C;  1IRJ A;  1SL7 A;  3IQO A;  1XO5 A;  1Y6W A;  1F55 A;  1QX7 A;  3PAT A;  2WCE A;  3CZT X;  1OMD A;  1SPY A;  4AOM A;  3O78 A;  1CM4 A;  2FCD A;  1OZO A;  1X02 A;  2Y1N A;  2PVB A;  1IQ3 A;  5CSI A;  2M7L A;  1QS7 A;  4P5O E;  4GUK A;  2M9G A;  2MAZ A;  2JOJ A;  3VRO A;  3SIB A;  1WDC B;  4JWQ A;  1J7R A;  4NDB A;  2JZI A;  2QAC A;  1PRW A;  1QLK A;  1DVI A;  1M31 A;  1TN4 A;  2KNE A;  1UHK A;  5AEQ A;  1FW4 A;  3AKB A;  1M63 B;  2ZN8 A;  3EVV A;  1IH0 A;  2BKH B;  4GPL B;  3VRN A;  1AUI B;  1R2U A;  2G9B A;  2F3Z A;  2JT0 A;  1PK0 D;  1BOC A;  2JC2 A;  1BU3 A;  3CS1 A;  3VRQ A;  2JUL A;  1GGW A;  1CNP A;  4GGN A;  1SCV A;  1CMF A;  1EG4 A;  3BUM B;  1HQV A;  1BT6 A;  2HF5 A;  2Y5I A;  3BUW B;  4GFT A;  1YVL A;  4QJ5 B;  3LL8 B;  4ZCV A;  4DIR A;  1DJZ A;  1K9K A;  2CXJ A;  2K7O A;  4C0L A;  1JFJ A;  2K7D A;  1IJ5 A;  1XYD A;  2BCA A;  3DVK A;  3I5G B;  1FPW A;  4YGC B;  2PSR A;  1ZUZ A;  1K9U A;  2I2R E;  3TUY B;  1GJY A;  1QVI Z;  1KK7 Z;  1JFK A;  4NDC A;  1JSA A;  3BUN B;  1YX8 A;  2L2E A;  3KF9 A;  4YRU A;  3M0W A;  5HLV A;  1F4O A;  1XFY O;  1R6P A;  2EHB A;  5ER5 A;  2OS8 B;  1KFX S;  1KFU L;  5HKZ A;  2KYC A;  3PFV A;  1LXF C;  3TDU A;  3FWC A;  1CDN A;  3SG7 A;  4JQ0 D;  3OX5 A;  1B47 A;  1U5I A;  4C0J A;  1PVB A;  4UPG A;  1RTP 1;  1TCF A;  3GK4 X;  3PLF B;  1OSA A;  5G08 A;  3TDZ A;  2KAX A;  4YGB B;  2OTG B;  2BCB A;  2HPS A;  2LCP A;  3SG6 A;  1OQP A;  3PSR A;  3EKJ A;  1IJ6 A;  3JVT C;  1U5I B;  3WNX B;  2K61 A;  3O2P A;  4WQ2 A;  2EGD A;  2BL0 C;  1NX0 A;  1QVI Y;  1KK7 Y;  1A75 B;  1K94 A;  2V53 A;  2P6B B;  2BL0 B;  5HLO A;  4D1E A;  1CMG A;  1SW8 A;  2VRG A;  1JUO A;  4U8D A;  1CM1 A;  2E30 A;  1SL8 A;  3I5I B;  1OZS A;  2GV5 A;  1CDM A;  2Y4Q A;  1SCM B;  5DKR A;  1H8B A;  2EC6 B;  3TS5 C;  5F6T A;  4BY5 A;  4I5L B;  2I7A A;  1KWO B;  3BUO B;  3EVU A;  3I5F C;  5KU1 A;  1JWD A;  1Q80 A;  1UUR A;  4OR9 B;  5GQQ C;  1XK4 A;  4GAO A;  4ZCU A;  5CSF A;  1MWN A;  2H61 A;  1QJT A;  3I5H C;  1NCY A;  1N65 A;  2ZRT A;  5DKN A;  5JJG A;  4YBH B;  1W7I B;  4GGF A;  1SKT A;  2AMI A;  3FWB A;  2K2A A;  1C07 A;  1F70 A;  1B8L A;  4N1F A;  2JPT A;  3PAL A;  2K7B A;  5CSN A;  4MLW A;  3OX6 A;  1NX3 A;  1B8C A;  3NSK A;  1S3P A;  3BUX B;  3VRP A;  1A2X A;  1OOJ A;  2BCX A;  2MJW B;  1J7P A;  1MF8 B;  4AQI A;  1K93 D;  2LC5 A;  2F3Y A;  1MXL C;  1KK8 C;  5IBW A;  1SK6 D;  1ZAC A;  1J1D A;  5I8N A;  4PDZ A;  3OB2 B;  1QLS A;  1ALW A;  3NSO A;  2BE6 A;  1CFF A;  1XVJ A;  1KFX L;  4I5J A;  4FQO A;  1QTX A;  5CPV A;  3QRX A;  1EH2 A;  1RFJ A;  1DJI A;  3NSI A;  1YTZ C;  1E8A A;  1MR8 A;  2WOS A;  1NIW A;  2KI6 C;  2I94 A;  1DJW A;  4OKH A;  2DOQ A;  3O6B A;  2CCM A;  2LHL A;  3MSE B;  2G2B A;  1NUB A;  2KGR A;  2PAL A;  1JF2 A;  3AKA A;  4MZK A;  3VGO A;  2L51 A;  4ORC B;  3BXK A;  1M45 A;  2F2O A;  1BJF A;  1CFP A;  4I5K A;  2JTT A;  2M0R A;  1CB1 A;  1TNQ A;  2KSP A;  3LK0 A;  3IQQ A;  5FYX A;  1PSR A;  2QPT A;  5I2O A;  2LVK A;  2CNP A;  4MSP A;  3DVJ A;  2LMU A; 
#chains in the Genus database with same CATH topology
 1L7Z A;  2BBM A;  3SIA A;  4NQG A;  1C3Y A;  4FQT A;  2L5X B;  3UO9 A;  1YUT A;  1FI6 A;  3SJS A;  4F7F A;  2WC8 A;  1MUX A;  1YUU A;  1KSM A;  2LP2 A;  2WC5 A;  1XFW O;  3RLZ A;  1SL9 A;  1KCY A;  3Q8I A;  2B1U A;  4MN0 A;  1DEK A;  4DCK A;  4P2Y B;  5AXI A;  5HKW A;  3L4L A;  3LK1 A;  3GK1 A;  4GBA A;  1K9P A;  2A4J A;  2R2I A;  3D0Y A;  2LV7 A;  1WLZ A;  2JT3 A;  1SBJ A;  3CR4 X;  3B7A A;  2PQL A;  4CLN A;  1UP5 A;  2LUC A;  4NDD A;  2BE4 A;  2L50 A;  1OE9 B;  4Q04 A;  1B9A A;  3DF0 A;  5I2L A;  1Y1A A;  1A29 A;  1S6I A;  2JU0 A;  1W7J B;  1S6C A;  1CFC A;  1TOP A;  1L2O C;  4WRI A;  5K89 A;  1DT7 B;  1KQM C;  1FI5 A;  3KEV A;  2H2K A;  4MBE A;  3O4X A;  3D0Y B;  1L2O B;  3A4U B;  1K96 A;  1TNP A;  3NXA A;  2KBM A;  2KAY A;  1EXR A;  2KQY A;  1IQ5 A;  1A03 A;  3HCM A;  3BFB A;  3FE9 A;  3DF0 B;  4ORB B;  1N2D A;  3FIA A;  3LLE A;  2MA2 A;  4KYN A;  4YGE B;  5DKQ A;  1YRT B;  4JD9 A;  2WCK A;  2LAP A;  3CGA A;  4PE7 A;  1DJY A;  1A75 A;  1CFD A;  1UWO A;  1QX5 B;  2L98 A;  2MLF C;  2ZFD A;  4HSZ A;  1FBV A;  4PE4 A;  1QXP A;  2WOR A;  4CFR A;  1ZMZ A;  1YRU B;  1Y1U A;  2M97 A;  3PJI A;  2PAS A;  4DRW A;  1J7O A;  3ZNI A;  1TTX A;  3KPX A;  3JVT B;  4CFQ A;  2LMT A;  1IWQ A;  1SSE B;  2CT9 A;  2JXL A;  2P71 A;  1XA5 A;  1K8U A;  1WRK A;  1PUL A;  2LM5 A;  3CR2 A;  3CYZ A;  1SRA A;  5FI2 A;  3CZ2 A;  2ZRS A;  3WHU B;  2F2P A;  3D76 A;  2RGI A;  5D3O A;  3NGV A;  1S1E A;  5EL2 A;  3BYA A;  1SY9 A;  1G8I A;  1J1E A;  1NP8 A;  4E68 A;  2LVJ A;  4DUQ A;  1NCX A;  2K0J A;  1WLM A;  1QIV A;  1AVS A;  5D69 A;  2ZKM X;  2M3W A;  1CLB A;  3D10 A;  1DTL A;  2JPO A;  2KQ6 A;  2WCH A;  3TS5 B;  3WXA A;  3S0A A;  1SMG A;  4MVF A;  1LA0 A;  2MRD A;  3PM2 A;  2L0P A;  3D78 A;  1SR6 C;  1RWY A;  2JQ6 A;  1S5G Z;  1QIW A;  2JRF A;  2OPO A;  2WCL A;  4QJ4 B;  3EK7 A;  1GM0 A;  1CTR A;  1UHJ A;  4FTG A;  1QV0 A;  3I5F B;  1M46 A;  1N0Y A;  4N1G A;  4ETO A;  3BFA A;  1YR5 A;  2LNK A;  3CWG A;  1REC A;  1QWV A;  3SG5 A;  4PHM A;  2F8P A;  3I5H B;  2LLS A;  2F33 A;  1SNL A;  3CLN A;  1B1G A;  2BKI B;  4CPV A;  1OOG A;  1XFV O;  1ZOT B;  3CTN A;  3OBV A;  4PT1 A;  1AJ5 A;  2CTN A;  4M2O A;  1EG3 A;  4XJK A;  5I2Q A;  1BR1 B;  5CSJ A;  1DMO A;  2LMV A;  3CDN A;  4PHJ A;  1F8H A;  1TRF A;  4C0K A;  1PSB A;  1F71 A;  4JKT A;  4MEW A;  1K95 A;  2SCP A;  1TNX A;  1S6J A;  4IL1 A;  1NSH A;  1T14 A;  5B8I B;  3KHE A;  2O60 A;  2Q91 A;  1AJ4 A;  4XJK B;  3K21 A;  1KK8 B;  3A8R A;  2WCF A;  1WRZ A;  1BF5 A;  2HQW A;  1DGU A;  5ER4 X;  1HT9 A;  3NHI A;  3SG2 A;  2ISD A;  1YUS A;  1RK9 A;  1S5G Y;  2HQ8 A;  1UUS A;  1WRL A;  4R1E A;  3FS7 A;  2H8V A;  2GGM A;  2LAN A;  3VRR A;  3BOW A;  1TUJ A;  2O5G A;  2KDH A;  2NCO A;  3EK4 A;  1NPQ A;  2K2F A;  3CR5 X;  3S0E A;  1DJG A;  2AAO A;  3OB1 B;  1F4Q A;  1F54 A;  3EKH A;  1Y0V H;  1ALV A;  1IGV A;  3TDI A;  1DJX A;  1XFR A;  3DVM A;  4INX A;  1DJH A;  4DS7 A;  1MQ1 A;  1JBA A;  3BOW B;  3WHT B;  1LKJ A;  2KI4 C;  1LA3 A;  1WY9 A;  2JT8 A;  4F0Z B;  3ICB A;  2BEC A;  3SS5 A;  1D1O A;  1TNW A;  2KI4 B;  4BY4 A;  1WDC C;  1DF0 A;  4GNK B;  1QAT A;  3HX4 A;  4OV2 A;  2M29 A;  3O4Y A;  4PCW A;  2JNX A;  2MBX A;  1BR4 B;  4PE1 A;  1SYM A;  1AK8 A;  2LP3 A;  5JOL A;  1NX1 A;  2Y1M A;  5AAN A;  1EL4 A;  2Q4U A;  1AP4 A;  1QV1 A;  1DF0 B;  1Y1X A;  1S36 A;  3IF7 A;  2LE9 B;  3R1V A;  3E3R A;  3L47 A;  3FE8 A;  3NHT A;  1V1F A;  3BJH A;  1B8R A;  1G33 A;  4HRE E;  1QX2 A;  1LVC D;  2NLN A;  2L4H A;  2COL B;  1NCZ A;  2ZN9 A;  4PE0 A;  1KSO A;  3N7H A;  1OOI X;  1Z2C B;  4M2P A;  2MHH A;  1RJV A;  2TN4 A;  1PVA A;  1GQM A;  2LUX A;  2LLU A;  4ICB A;  3F45 A;  2KFF A;  4A4C A;  1J55 A;  4PHK A;  4MRX A;  2CBL A;  4HRH A;  3ZWH A;  1MHO A;  1NX2 A;  1BLQ A;  4I5N B;  3AAJ A;  1KQM B;  1JF0 A;  3OHM B;  1H4B A;  1OMR A;  1QAS A;  3I5G C;  4QJ3 B;  1IKU A;  2ZNE A;  3BFH A;  3D73 A;  3R1P A;  4OVN F;  3SG4 A;  1K2H A;  1C7V A;  4MRY A;  3CZ0 A;  2K7C A;  3TUY C;  1FF1 A;  2MLE C;  5AFP A;  3D75 A;  1OMV A;  4TNC A;  2KOT A;  2I18 A;  2NCP A;  1XFZ O;  3GK2 A;  5HYD A;  5D7F A;  1CLM A;  1B4C A;  2KI6 D;  2FJU B;  3NSL A;  2M1K B;  2OS8 C;  2LHI A;  4MZL A;  5AER A;  2WND A;  2GTE A;  4AQJ A;  2WCM A;  3DD4 A;  1UHH A;  2D8N A;  1B7T Z;  5BPJ A;  2KAV A;  1YX7 A;  3JTD C;  3S0F A;  2IS9 A;  2FOT A;  2WCB A;  2KHN A;  3SG3 A;  1OW4 A;  2HET A;  3GOF A;  5PAL A;  1CDP A;  3JTD B;  5J3X A;  4M2Q A;  2OTG C;  1YUR A;  1IG5 A;  3LCP C;  2KFH A;  2L4I A;  1DGV A;  1P28 A;  2FCE A;  2LLT A;  4L9M A;  2AUC A;  4YI8 A;  2NZ0 A;  1RRO A;  2K8M B;  4HRG A;  1CKK A;  2KFG A;  2M7N A;  3PN7 C;  1NYA A;  3AAK A;  3RM1 A;  1S26 D;  4CID A;  4YGA A;  1SR6 B;  2LVI A;  3PN7 B;  2JWW A;  4PHN A;  5KSZ A;  5HKY A;  4A4B A;  3I5I C;  1G4Y R;  3D74 A;  1KQV A;  4YGD B;  1BOD A;  3EVR A;  2P70 A;  1XFU O;  2KBI A;  3D77 A;  1SCM C;  2BNX A;  3C1V A;  3EK8 A;  1TCO B;  2EC6 C;  1VRK A;  1ZFS A;  3CZ1 A;  1B7T Y;  1UHN A;  2M1U A;  3TZ1 A;  2BBN A;  1V1G A;  1MXE A;  3DVE A;  3EG5 B;  1A4P A;  1KWO C;  1UHI A;  2LVV A;  4YI9 A;  1GGZ A;  2KGB C;  3PM8 A;  1BG1 A;  1CDL A;  2KYF A;  3RZS A;  1J7Q A;  1YVH A;  1CLL A;  1XFX O;  2NXQ A;  4N5X A;  1M39 A;  2JXC A;  2PMY A;  4USL A;  3BQ3 A;  3H4S E;  1EJ3 A;  4WQ3 A;  1DC1 A;  2ZND A;  1TIZ A;  1BMO A;  1LIN A;  4JPZ B;  2PRU A;  2E6W A;  5TNC A;  4MZJ A;  2SAS A;  4PAL A;  1XK4 C;  5KTY A;  2M8U A;  1K90 D;  4IJ7 A;  1NWD A;  2JNF A;  4XYN A;  2H61 C;  1ODB A;  1JC2 A;  1W9Z A;  3OP0 A;  4OCI A;  1KFU S;  3KO0 A;  2M49 B;  3OGN A;  2QEB A;  1C7W A;  1PAL A;  1AHR A;  2GGZ A;  2JTZ A;  4GGF C;  1IRJ A;  1SL7 A;  3UNW A;  3IQO A;  1XO5 A;  1Y6W A;  1F55 A;  1QX7 A;  3PAT A;  2WCE A;  3QME A;  3CZT X;  2ERB A;  1OMD A;  1SPY A;  4AOM A;  3O78 A;  1CM4 A;  1OOH A;  1OZO A;  2FCD A;  5HL1 A;  1X02 A;  2Y1N A;  2PVB A;  1IQ3 A;  5CSI A;  2M7L A;  1QS7 A;  4P5O E;  4GUK A;  2QEV A;  2M9G A;  2MAZ A;  2JOJ A;  3VRO A;  2QEO A;  3SIB A;  1WDC B;  2QEH A;  1TWO A;  4JWQ A;  1J7R A;  4NDB A;  2JZI A;  2QAC A;  3DYE A;  1PRW A;  1QLK A;  1DVI A;  1M31 A;  1TN4 A;  2KNE A;  1UHK A;  5AEQ A;  1FW4 A;  3AKB A;  1M63 B;  2ZN8 A;  3EVV A;  1IH0 A;  2BKH B;  4GPL B;  2KPH A;  3B87 A;  3VRN A;  1AUI B;  1R2U A;  2G9B A;  2F3Z A;  2JT0 A;  2QDI A;  1PK0 D;  1BOC A;  2JC2 A;  2PYQ A;  1BU3 A;  3CS1 A;  3DXL A;  3VRQ A;  2JUL A;  3B86 A;  1GGW A;  1CNP A;  3IVT A;  4GGN A;  1SCV A;  1CMF A;  1EG4 A;  3DZT A;  3BUM B;  3B88 A;  1HQV A;  1BT6 A;  2HF5 A;  2Y5I A;  3BUW B;  4GFT A;  1YVL A;  4QJ5 B;  3LL8 B;  1LS8 A;  4ZCV A;  1DJZ A;  4DIR A;  1K9K A;  2CXJ A;  2K7O A;  4C0L A;  1JFJ A;  2K7D A;  1IJ5 A;  1XYD A;  2L2C A;  3S0B A;  3CAB A;  5FI6 A;  3S0D A;  2BCA A;  3DVK A;  3I5G B;  1FPW A;  4YGC B;  2FJY A;  2PSR A;  1ZUZ A;  3SS4 A;  1K9U A;  4OZD A;  3FE6 A;  2I2R E;  3TUY B;  1GJY A;  1QVI Z;  1KK7 Z;  1JFK A;  4NDC A;  1JSA A;  1ORG A;  3BUN B;  1YX8 A;  2L2E A;  3KF9 A;  4YRU A;  3L4A A;  2K60 A;  3V2L A;  3M0W A;  5HLV A;  1F4O A;  1XFY O;  1R6P A;  2EHB A;  5ER5 A;  2OS8 B;  1KFX S;  1KFU L;  5HKZ A;  1IIO A;  2KYC A;  3PFV A;  1LXF C;  3TDU A;  3FWC A;  1CDN A;  3SG7 A;  4JQ0 D;  3OX5 A;  1B47 A;  1U5I A;  4C0J A;  1PVB A;  4UPG A;  1RTP 1;  1TCF A;  3GK4 X;  3SS3 A;  3PLF B;  1OSA A;  5G08 A;  3TDZ A;  2KAX A;  4YGB B;  2OTG B;  2BCB A;  2HPS A;  2LCP A;  3SG6 A;  5I94 A;  1OQP A;  3PSR A;  3EKJ A;  1IJ6 A;  3JVT C;  1C3Z A;  1U5I B;  3WNX B;  2K61 A;  3B6X A;  3O2P A;  4WQ2 A;  2EGD A;  2BL0 C;  1NX0 A;  1QVI Y;  2BAP A;  1KK7 Y;  1A75 B;  1K94 A;  2V53 A;  2P6B B;  2BL0 B;  3R72 A;  2KLD A;  5HLO A;  4D1E A;  1CMG A;  1SW8 A;  2VRG A;  1JUO A;  4U8D A;  1CM1 A;  3S0G A;  2E30 A;  1SL8 A;  3I5I B;  1OZS A;  2GV5 A;  1CDM A;  2Y4Q A;  1DEL A;  1SCM B;  5DKR A;  1H8B A;  2EC6 B;  3TS5 C;  5F6T A;  4BY5 A;  4I5L B;  3K1E A;  2I7A A;  1KWO B;  3BUO B;  3EVU A;  3I5F C;  5KU1 A;  1JWD A;  1Q80 A;  1UUR A;  4OR9 B;  5GQQ C;  1XK4 A;  4GAO A;  1OOF A;  5CSF A;  4ZCU A;  1MWN A;  2H61 A;  1QJT A;  3I5H C;  1NCY A;  1N65 A;  2ZRT A;  3R1O A;  5DKN A;  5JJG A;  4YBH B;  1W7I B;  4GGF A;  1SKT A;  2AMI A;  3FWB A;  5DIC A;  2K2A A;  1C07 A;  1F70 A;  1B8L A;  4N1F A;  2JPT A;  3PAL A;  2K7B A;  5CSN A;  4MLW A;  3OX6 A;  1NX3 A;  1B8C A;  3NSK A;  1S3P A;  3BUX B;  3VB1 A;  3VRP A;  1A2X A;  1OOJ A;  2BCX A;  2MJW B;  1J7P A;  1MF8 B;  4AQI A;  1K93 D;  2LC5 A;  2F3Y A;  1MXL C;  2L5Y A;  1KK8 C;  5IBW A;  1SK6 D;  1ZAC A;  1J1D A;  1DQE A;  5I8N A;  4PDZ A;  3OB2 B;  1QLS A;  1ALW A;  3NSO A;  2BE6 A;  1CFF A;  1XVJ A;  1KFX L;  4I5J A;  4FQO A;  1QTX A;  5CPV A;  3QRX A;  1EH2 A;  1RFJ A;  1DJI A;  3NSI A;  5FI7 A;  1YTZ C;  4INW A;  1E8A A;  1MR8 A;  2WOS A;  1NIW A;  2KI6 C;  1Z4H A;  2I94 A;  1DJW A;  4OKH A;  2DOQ A;  3O6B A;  2CCM A;  2LHL A;  3MSE B;  1TUZ A;  2G2B A;  2WC6 A;  1NUB A;  2KGR A;  2PAL A;  1JF2 A;  3AKA A;  4MZK A;  3VGO A;  2L51 A;  4ORC B;  3BXK A;  3DY9 A;  1M45 A;  2F2O A;  1BJF A;  1CFP A;  4I5K A;  2JTT A;  2M0R A;  1CB1 A;  1TNQ A;  2KSP A;  3LK0 A;  3IQQ A;  2YGU A;  5FYX A;  1PSR A;  2QPT A;  4ORA B;  2LVK A;  5I2O A;  2CNP A;  4MSP A;  3DVJ A;  2WCJ A;  2KLE A;  2LMU A; 
#chains in the Genus database with same CATH homology
 1L7Z A;  2BBM A;  3SIA A;  4NQG A;  2L5X B;  1YUT A;  1FI6 A;  3SJS A;  2WC8 A;  1MUX A;  1YUU A;  1KSM A;  2LP2 A;  1XFW O;  3RLZ A;  1SL9 A;  1KCY A;  2B1U A;  4MN0 A;  4DCK A;  4P2Y B;  5AXI A;  5HKW A;  3LK1 A;  3GK1 A;  4GBA A;  1K9P A;  2A4J A;  2R2I A;  3D0Y A;  2LV7 A;  1WLZ A;  2JT3 A;  1SBJ A;  3CR4 X;  4CLN A;  1UP5 A;  2LUC A;  4NDD A;  2BE4 A;  2L50 A;  1OE9 B;  4Q04 A;  1B9A A;  3DF0 A;  5I2L A;  1Y1A A;  1A29 A;  1S6I A;  2JU0 A;  1W7J B;  1S6C A;  1CFC A;  1TOP A;  1L2O C;  4WRI A;  5K89 A;  1DT7 B;  1KQM C;  1FI5 A;  3KEV A;  2H2K A;  4MBE A;  3D0Y B;  1L2O B;  3A4U B;  1K96 A;  1TNP A;  3NXA A;  2KBM A;  2KAY A;  1EXR A;  2KQY A;  1IQ5 A;  1A03 A;  3HCM A;  4ORB B;  3DF0 B;  1N2D A;  3FIA A;  3LLE A;  2MA2 A;  4YGE B;  5DKQ A;  1YRT B;  2LAP A;  3CGA A;  4PE7 A;  1DJY A;  1A75 A;  1CFD A;  1UWO A;  1QX5 B;  2L98 A;  2MLF C;  2ZFD A;  4HSZ A;  1FBV A;  4PE4 A;  1QXP A;  2WOR A;  4CFR A;  1ZMZ A;  1YRU B;  1Y1U A;  2M97 A;  2PAS A;  4DRW A;  1J7O A;  3ZNI A;  1TTX A;  3KPX A;  3JVT B;  4CFQ A;  2LMT A;  1IWQ A;  2CT9 A;  4ORA B;  2JXL A;  5PAL A;  1XA5 A;  1K8U A;  1WRK A;  1PUL A;  2LM5 A;  3CR2 A;  1SRA A;  2ZRS A;  3WHU B;  2F2P A;  2RGI A;  1S1E A;  3BYA A;  1SY9 A;  1G8I A;  1J1E A;  1NP8 A;  4E68 A;  2LVJ A;  4DUQ A;  1NCX A;  2K0J A;  1WLM A;  1QIV A;  1AVS A;  5D69 A;  2ZKM X;  2M3W A;  1CLB A;  3D10 A;  1DTL A;  2KQ6 A;  3TS5 B;  3WXA A;  1SMG A;  4MVF A;  1LA0 A;  2MRD A;  2L0P A;  1SR6 C;  1RWY A;  2JQ6 A;  1S5G Z;  1QIW A;  2JRF A;  2OPO A;  4QJ4 B;  3EK7 A;  1CTR A;  1UHJ A;  4FTG A;  1QV0 A;  3I5F B;  1M46 A;  1N0Y A;  4N1G A;  4ETO A;  1YR5 A;  2LNK A;  3CWG A;  1REC A;  3SG5 A;  4PHM A;  2F8P A;  3I5H B;  2LLS A;  2F33 A;  1SNL A;  3CLN A;  1B1G A;  2BKI B;  4CPV A;  1XFV O;  1ZOT B;  3CTN A;  4XJK A;  5I2Q A;  1AJ5 A;  2CTN A;  4M2O A;  1EG3 A;  1BR1 B;  5CSJ A;  1DMO A;  2LMV A;  4PHJ A;  1F8H A;  1TRF A;  4C0K A;  1PSB A;  1F71 A;  4MEW A;  1K95 A;  2SCP A;  1TNX A;  1S6J A;  4IL1 A;  1NSH A;  5B8I B;  3KHE A;  2O60 A;  2Q91 A;  1AJ4 A;  4XJK B;  3K21 A;  1KK8 B;  3A8R A;  2WCF A;  1WRZ A;  1BF5 A;  2HQW A;  1DGU A;  5ER4 X;  1HT9 A;  3SG2 A;  2ISD A;  1YUS A;  1RK9 A;  1S5G Y;  2HQ8 A;  1UUS A;  1WRL A;  4R1E A;  3FS7 A;  2GGM A;  2LAN A;  3VRR A;  3BOW A;  2O5G A;  2KDH A;  2NCO A;  3EK4 A;  1NPQ A;  2K2F A;  3CR5 X;  1DJG A;  2AAO A;  3OB1 B;  1F4Q A;  1F54 A;  3EKH A;  1Y0V H;  1ALV A;  1IGV A;  3TDI A;  1DJX A;  3DVM A;  1DJH A;  4DS7 A;  1MQ1 A;  1JBA A;  3BOW B;  3WHT B;  1LKJ A;  2KI4 C;  1LA3 A;  1WY9 A;  2JT8 A;  4F0Z B;  3ICB A;  2BEC A;  1D1O A;  1TNW A;  2KI4 B;  4BY4 A;  1WDC C;  1DF0 A;  4GNK B;  1QAT A;  3HX4 A;  4OV2 A;  2M29 A;  3O4Y A;  4PCW A;  2JNX A;  2MBX A;  1BR4 B;  4PE1 A;  1SYM A;  1AK8 A;  2LP3 A;  5JOL A;  1NX1 A;  2Y1M A;  5AAN A;  1EL4 A;  2Q4U A;  1AP4 A;  1QV1 A;  1DF0 B;  1Y1X A;  1S36 A;  3IF7 A;  2LE9 B;  3E3R A;  1V1F A;  1B8R A;  1G33 A;  4HRE E;  1QX2 A;  1LVC D;  2NLN A;  2L4H A;  2COL B;  1NCZ A;  2ZN9 A;  4PE0 A;  1KSO A;  4M2P A;  2MHH A;  1RJV A;  2TN4 A;  1PVA A;  1GQM A;  2LUX A;  2LLU A;  4ICB A;  3F45 A;  2KFF A;  4A4C A;  1J55 A;  4PHK A;  4MRX A;  2CBL A;  4HRH A;  3ZWH A;  1MHO A;  1NX2 A;  1BLQ A;  4I5N B;  3AAJ A;  1KQM B;  1JF0 A;  3OHM B;  1H4B A;  1OMR A;  1QAS A;  3I5G C;  4QJ3 B;  1IKU A;  2ZNE A;  3SG4 A;  4OVN F;  1K2H A;  1C7V A;  4MRY A;  3TUY C;  2K7C A;  1FF1 A;  2MLE C;  5AFP A;  4TNC A;  1OMV A;  2KOT A;  2I18 A;  2NCP A;  1XFZ O;  3GK2 A;  5HYD A;  5D7F A;  1CLM A;  1B4C A;  2KI6 D;  2FJU B;  3NSL A;  2M1K B;  2OS8 C;  2LHI A;  4MZL A;  5AER A;  2WND A;  4AQJ A;  3DD4 A;  1UHH A;  2D8N A;  1B7T Z;  5BPJ A;  2KAV A;  1YX7 A;  3JTD C;  2IS9 A;  2FOT A;  2WCB A;  2KHN A;  3SG3 A;  2HET A;  3GOF A;  1CDP A;  3JTD B;  5J3X A;  4M2Q A;  2OTG C;  1YUR A;  1IG5 A;  3LCP C;  2KFH A;  2L4I A;  1DGV A;  2FCE A;  2LLT A;  4L9M A;  2AUC A;  4YI8 A;  2NZ0 A;  1RRO A;  2K8M B;  4HRG A;  1CKK A;  2KFG A;  2M7N A;  3PN7 C;  1NYA A;  3AAK A;  3RM1 A;  1S26 D;  4CID A;  4YGA A;  1SR6 B;  2LVI A;  3PN7 B;  2JWW A;  4PHN A;  5KSZ A;  5HKY A;  4A4B A;  3I5I C;  1G4Y R;  1KQV A;  4YGD B;  1BOD A;  3EVR A;  1XFU O;  2KBI A;  3EK8 A;  1SCM C;  3C1V A;  1TCO B;  2EC6 C;  1VRK A;  1ZFS A;  1B7T Y;  1UHN A;  2M1U A;  3TZ1 A;  2BBN A;  1V1G A;  1MXE A;  3DVE A;  1A4P A;  1KWO C;  1UHI A;  2LVV A;  4YI9 A;  1GGZ A;  2KGB C;  3PM8 A;  1BG1 A;  1CDL A;  2KYF A;  1J7Q A;  1YVH A;  1CLL A;  1XFX O;  2NXQ A;  4N5X A;  1M39 A;  2JXC A;  2PMY A;  4USL A;  3BQ3 A;  3H4S E;  1EJ3 A;  4WQ3 A;  2ZND A;  1TIZ A;  1BMO A;  1LIN A;  4JPZ B;  2PRU A;  2E6W A;  5TNC A;  4MZJ A;  2SAS A;  4PAL A;  1XK4 C;  5KTY A;  2M8U A;  1K90 D;  1NWD A;  2JNF A;  4XYN A;  2H61 C;  1ODB A;  1JC2 A;  3OP0 A;  4OCI A;  1KFU S;  3KO0 A;  2M49 B;  1C7W A;  1PAL A;  1AHR A;  2GGZ A;  2JTZ A;  4GGF C;  1IRJ A;  1SL7 A;  3IQO A;  1XO5 A;  1Y6W A;  1F55 A;  1QX7 A;  3PAT A;  2WCE A;  3CZT X;  1OMD A;  1SPY A;  4AOM A;  3O78 A;  1CM4 A;  2FCD A;  1OZO A;  1X02 A;  2Y1N A;  2PVB A;  1IQ3 A;  5CSI A;  2M7L A;  1QS7 A;  4P5O E;  4GUK A;  2M9G A;  2MAZ A;  2JOJ A;  3VRO A;  3SIB A;  1WDC B;  4JWQ A;  1J7R A;  4NDB A;  2JZI A;  2QAC A;  1PRW A;  1QLK A;  1DVI A;  1M31 A;  1TN4 A;  2KNE A;  1UHK A;  5AEQ A;  1FW4 A;  3AKB A;  1M63 B;  2ZN8 A;  3EVV A;  1IH0 A;  2BKH B;  4GPL B;  3VRN A;  1AUI B;  1R2U A;  2G9B A;  2F3Z A;  2JT0 A;  1PK0 D;  1BOC A;  2JC2 A;  1BU3 A;  3CS1 A;  3VRQ A;  2JUL A;  1GGW A;  1CNP A;  4GGN A;  1SCV A;  1CMF A;  1EG4 A;  3BUM B;  1HQV A;  1BT6 A;  2HF5 A;  2Y5I A;  3BUW B;  4GFT A;  1YVL A;  4QJ5 B;  3LL8 B;  4ZCV A;  4DIR A;  1DJZ A;  1K9K A;  2CXJ A;  2K7O A;  4C0L A;  1JFJ A;  2K7D A;  1IJ5 A;  1XYD A;  2BCA A;  3DVK A;  3I5G B;  1FPW A;  4YGC B;  2PSR A;  1ZUZ A;  1K9U A;  2I2R E;  3TUY B;  1GJY A;  1QVI Z;  1KK7 Z;  1JFK A;  4NDC A;  1JSA A;  3BUN B;  1YX8 A;  2L2E A;  3KF9 A;  4YRU A;  3M0W A;  5HLV A;  1F4O A;  1XFY O;  1R6P A;  2EHB A;  5ER5 A;  2OS8 B;  1KFX S;  1KFU L;  5HKZ A;  2KYC A;  3PFV A;  1LXF C;  3TDU A;  3FWC A;  1CDN A;  3SG7 A;  4JQ0 D;  3OX5 A;  1B47 A;  1U5I A;  4C0J A;  1PVB A;  4UPG A;  1RTP 1;  1TCF A;  3GK4 X;  3PLF B;  1OSA A;  5G08 A;  3TDZ A;  2KAX A;  4YGB B;  2OTG B;  2BCB A;  2HPS A;  2LCP A;  3SG6 A;  1OQP A;  3PSR A;  3EKJ A;  1IJ6 A;  3JVT C;  1U5I B;  3WNX B;  2K61 A;  3O2P A;  4WQ2 A;  2EGD A;  2BL0 C;  1NX0 A;  1QVI Y;  1KK7 Y;  1A75 B;  1K94 A;  2V53 A;  2P6B B;  2BL0 B;  5HLO A;  4D1E A;  1CMG A;  1SW8 A;  2VRG A;  1JUO A;  4U8D A;  1CM1 A;  2E30 A;  1SL8 A;  3I5I B;  1OZS A;  2GV5 A;  1CDM A;  2Y4Q A;  1SCM B;  5DKR A;  1H8B A;  2EC6 B;  3TS5 C;  5F6T A;  4BY5 A;  4I5L B;  2I7A A;  1KWO B;  3BUO B;  3EVU A;  3I5F C;  5KU1 A;  1JWD A;  1Q80 A;  1UUR A;  4OR9 B;  5GQQ C;  1XK4 A;  4GAO A;  4ZCU A;  5CSF A;  1MWN A;  2H61 A;  1QJT A;  3I5H C;  1NCY A;  1N65 A;  2ZRT A;  5DKN A;  5JJG A;  4YBH B;  1W7I B;  4GGF A;  1SKT A;  2AMI A;  3FWB A;  2K2A A;  1C07 A;  1F70 A;  1B8L A;  4N1F A;  2JPT A;  3PAL A;  2K7B A;  5CSN A;  4MLW A;  3OX6 A;  1NX3 A;  1B8C A;  3NSK A;  1S3P A;  3BUX B;  3VRP A;  1A2X A;  1OOJ A;  2BCX A;  2MJW B;  1J7P A;  1MF8 B;  4AQI A;  1K93 D;  2LC5 A;  2F3Y A;  1MXL C;  1KK8 C;  5IBW A;  1SK6 D;  1ZAC A;  1J1D A;  5I8N A;  4PDZ A;  3OB2 B;  1QLS A;  1ALW A;  3NSO A;  2BE6 A;  1CFF A;  1XVJ A;  1KFX L;  4I5J A;  4FQO A;  1QTX A;  5CPV A;  3QRX A;  1EH2 A;  1RFJ A;  1DJI A;  3NSI A;  1YTZ C;  1E8A A;  1MR8 A;  2WOS A;  1NIW A;  2KI6 C;  2I94 A;  1DJW A;  4OKH A;  2DOQ A;  3O6B A;  2CCM A;  2LHL A;  3MSE B;  2G2B A;  1NUB A;  2KGR A;  2PAL A;  1JF2 A;  3AKA A;  4MZK A;  3VGO A;  2L51 A;  4ORC B;  3BXK A;  1M45 A;  2F2O A;  1BJF A;  1CFP A;  4I5K A;  2JTT A;  2M0R A;  1CB1 A;  1TNQ A;  2KSP A;  3LK0 A;  3IQQ A;  5FYX A;  1PSR A;  2QPT A;  5I2O A;  2LVK A;  2CNP A;  4MSP A;  3DVJ A;  2LMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...