4USLA

The x-ray structure of calcium bound human sorcin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
AFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORCIN
publication title Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 63
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4uslA00
1OZSA 1YRTB 3F45A 1AHRA 4I5NB 4YI9A 3JTDB 1N2DA 1YVHA 1D1OA 1IJ5A 4GAOA 3VRRA 2KFFA 5PALA 2Y4QA 2F3YA 2BBMA 1AJ4A 1ODBA 2LMVA 2LVIA 2KBIA 3JTDC 1UHHA 3NXAA 1FF1A 1R6PA 1CDNA 1NYAA 2JTZA 1EL4A 1QASA 4BY4A 2IS9A 1RFJA 4YBHB 3EVRA 5J3XA 4YRUA 1YX7A 1SK6D 2DOQA 4MRXA 3DF0B 4MVFA 1FW4A 2MHHA 5KSZA 1CFDA 2JT8A 2KI6D 1C7WA 3OHMB 4WQ2A 3PATA 1SL9A 2CBLA 1DF0B 5JOLA 1CLBA 3BUNB 2KFHA 1PRWA 1NWDA 3BUMB 1TNWA 3LCPC 3SG6A 1MHOA 3MSEB 2SCPA 3PN7C 5D69A 3IQQA 1N0YA 3VROA 1S5GZ 2HPSA 1PSRA 3PLFB 3CZTX 2KYCA 3PALA 5CPVA 5I2LA 1S6CA 2H2KA 5I2OA 3SG5A 1SNLA 2JQ6A 4YGBB 1IH0A 3VRQA 2EHBA 2LP2A 1EXRA 2ZRSA 1J7RA 2KHNA 2CT9A 5IBWA 1M46A 3AKBA 3E3RA 2KFGA 3FWCA 4DRWA 1SCVA 3BUXB 1EG4A 1S1EA 1YR5A 1SYMA 4JQ0D 2NZ0A 1XO5A 1SL8A 1CFCA 3WHTB 2KQ6A 2ZN8A 4MSPA 4CIDA 5KTYA 5JJGA 2LVVA 2LMUA 4MN0A 2BCXA 3LLEA 4OVNF 2LNKA 4ICBA 3GK4X 1EH2A 4XYNA 5HKWA 2GGZA 2K7OA 1YTZC 2HETA 3RM1A 4QJ5B 1V1GA 5HLVA 1OMDA 2K2FA 4I5KA 2QPTA 4I5JA 2RGIA 3BUWB 1IWQA 1JF0A 3M0WA 1JF2A 1L2OB 5AFPA 4MBEA 4QJ4B 4GGNA 1IKUA 1SKTA 2L50A 4QJ3B 1KK7Z 2EC6B 3FS7A 1MF8B 1QJTA 1QV1A 2KAVA 1L2OC 1IRJA 3OX6A 5HKYA 1ZFSA 1SL7A 1DT7B 2EC6C 1XFWO 3ICBA 1F70A 3OX5A 3RLZA 1Q80A 4TNCA 5HKZA 3OP0A 1IQ3A 2KGRA 2D8NA 3I5IB 1F8HA 1GGZA 1LXFC 3EK4A 2F2PA 3A8RA 1SW8A 2M9GA 4L9MA 4ZCVA 3KHEA 5TNCA 4JPZB 1B7TZ 2JT0A 4F0ZB 1A75B 2O5GA 4A4BA 4A4CA 1N65A 1HQVA 1NSHA 1KWOB 1KCYA 1IQ5A 1BG1A 2AAOA 2K7BA 3VRPA 1JC2A 2H61C 2OTGB 3CGAA 4GGFC 4PHKA 4USLA 2M7NA 5ER5A 2ZNDA 4YGAA 1PALA 2NLNA 3BQ3A 2AUCA 2JC2A 4YGDB 1XA5A 1BR1B 2MJWB 2OTGC 1FI5A 1CDLA 1J1DA 5F6TA 2BKHB 1S36A 2BBNA 3WHUB 4CPVA 1RK9A 1TTXA 4OR9B 1BODA 3WNXB 1B4CA 1S6JA 2MRDA 1PVBA 1Y0VH 1AJ5A 2JULA 2F2OA 3KPXA 1BR4B 1UHKA 1KFXS 3DVEA 3I5HB 1PSBA 1U5IB 1J55A 2PVBA 3LK1A 2HQ8A 1NPQA 2Y5IA 4HRHA 1WY9A 1A29A 1E8AA 1WRZA 3LL8B 4N1GA 2L0PA 1Y1XA 4WQ3A 2JWWA 3D0YB 3I5HC 1CMFA 1CKKA 3CS1A 1QLKA 2M3WA 2ZNEA 4HSZA 3CR5X 1HT9A 1ZACA 2JTTA 1UHIA 3EK7A 1BT6A 2L2EA 3DVKA 4ORBB 4BY5A 1J7QA 2NCPA 1B8RA 2JOJA 1TRFA 1FPWA 2Y1NA 3ZNIA 2OPOA 4DUQA 3PN7B 1XFVO 2F8PA 3NSOA 1PVAA 2L5XB 4AOMA 4I5LB 1OMVA 3TS5B 3BOWA 2FJUB 2LHIA 4WRIA 2LLUA 2JXCA 1KQVA 2LM5A 1WRKA 4MRYA 2FCEA 2KI4B 4AQJA 1LVCD 1M39A 3TS5C 2B1UA 2LUXA 1ALWA 2JPTA 3AKAA 1K9PA 1TNQA 2KI4C 1Y1AA 2KQYA 3I5GB 1WRLA 3TDZA 5I8NA 2I7AA 3VGOA 1K96A 3O2PA 1Y1UA 1M63B 3CR4X 4DCKA 1OE9B 2JT3A 4N5XA 1QX7A 1XK4A 3I5GC 3C1VA 4XJKA 1MUXA 4DIRA 1K90D 1XFYO 1SCMB 4MZLA 1K95A 4ZCUA 1KQMB 1KFXL 2ZN9A 5CSIA 3O78A 2NCOA 1OMRA 1TCFA 4PE4A 1M31A 1QLSA 1JBAA 1KSOA 1MR8A 1M45A 4FTGA 2F3ZA 2QACA 1QIWA 1SCMC 4PE1A 2MLEC 1OSAA 1KQMC 2I94A 2K7CA 1QS7A 2K8MB 4YGCB 1MWNA 4NQGA 4C0LA 1YX8A 2L4HA 5AERA 3JVTB 1K93D 1YVLA 4DS7A 1AVSA 1A03A 4U8DA 1DVIA 3HX4A 1G8IA 3IF7A 1JWDA 2BECA 1NIWA 1OOJA 1C7VA 1NUBA 3JVTC 2Q4UA 2JXLA 1PK0D 1R2UA 1F4QA 1H8BA 1NCXA 3GK1A 3BUOB 1MXEA 2KI6C 2BE4A 3D10A 2M8UA 5G08A 3H4SE 1SY9A 3AAJA 1W7IB 2LVKA 1XK4C 4OV2A 2EGDA 4N1FA 1UWOA 1A75A 2GGMA 1QVIZ 1QIVA 1DMOA 3GK2A 2A4JA 2K61A 1TOPA 1CTRA 3FIAA 1BF5A 3CWGA 3SIAA 1CMGA 2G9BA 2LV7A 4ETOA 1LKJA 2M0RA 2R2IA 4IL1A 2KYFA 1UP5A 2PMYA 1FI6A 1IJ6A 4PCWA 5CSFA 3SIBA 1IGVA 4M2QA 1NCZA 1XFXO 4PHNA 4GPLB 3KF9A 2VRGA 2JRFA 1ALVA 2LVJA 2TN4A 1CDMA 2PALA 4CFRA 3CLNA 1L7ZA 1JUOA 3KEVA 3PM8A 4GFTA 1KSMA 1B9AA 1XYDA 4GBAA 1JSAA 2LLSA 2HQWA 2JNXA 3SG3A 1TCOB 5B8IB 3A4UB 3DVJA 1ZUZA 1Y6WA 2P6BB 3I5FC 1JFJA 2KAYA 2E30A 2WCBA 3EK8A 1W7JB 1RTP1 1LA0A 1OQPA 5CSNA 4CFQA 3TZ1A 3DD4A 3DF0A 2BKIB 3VRNA 2LCPA 1CLMA 2KGBC 4P5OE 4FQOA 1NX1A 2KOTA 1UHJA 4Q04A 1DF0A 1VRKA 3DVMA 4R1EA 1DJWA 1XFZO 2WOSA 1SBJA 1J7PA 2KBMA 5K89A 2KNEA 1QV0A 2COLB 1DGUA 4NDCA 2ZRTA 1B47A 1RROA 1QX5B 3BXKA 2L4IA 2CXJA 3ZWHA 3LK0A 2CCMA 2MA2A 1QX2A 2L98A 3FWBA 1CB1A 4UPGA 1TNPA 1NX2A 5CSJA 2FCDA 4PDZA 5ER4X 2I2RE 4OCIA 4ORCB 5DKQA 1G33A 1B8LA 1EG3A 2K0JA 1K9UA 1NX0A 2MLFC 1NP8A 2K2AA 3TDUA 1S6IA 2BCBA 1RECA 2I18A 2M97A 3IQOA 4YGEB 1RJVA 1UHNA 3PSRA 1J1EA 1KFUS 2E6WA 2M1KB 3EVVA 1CFPA 1ZMZA 2LAPA 4C0JA 1S26D 2BE6A 2BL0B 2PSRA 5AANA 4M2OA 2KDHA 2WC8A 1BLQA 1IG5A 1YUUA 2M49B 1K94A 3O4YA 4D1EA 2BL0C 2WCEA 3BOWB 4ORAB 2LP3A 1X02A 1PULA 1GGWA 3K21A 3OB1B 3HCMA 2LUCA 3OB2B 1S5GY 1LA3A 2BCAA 2M7LA 1DJXA 1QXPA 2O60A 3SG2A 4MEWA 4AQIA 1DJZA 1YURA 2OS8B 4YI8A 1CNPA 1LINA 5HYDA 2ZKMX 3CTNA 4PE7A 1TIZA 1UUSA 2GV5A 2Y1MA 4M2PA 5DKRA 1A2XA 1NX3A 2MAZA 2LANA 2ZFDA 1YRUB 2PASA 3AAKA 2OS8C 1BOCA 3PFVA 1WDCB 4GUKA 3TUYB 1DJHA 1KK8B 2L51A 4PE0A 2KSPA 4XJKB 1MQ1A 2MBXA 1K8UA 2PRUA 1EJ3A 1WDCC 4MZKA 1YUTA 2JU0A 3TUYC 1SPYA 1K9KA 1XVJA 1KK8C 2LC5A 1MXLC 5FYXA 2WNDA 1CLLA 5BPJA 1QATA 1SMGA 1DJIA 1SR6B 3NSIA 1GJYA 3SJSA 2V53A 4P2YB 1ZOTB 2LLTA 2NXQA 2H61A 5AXIA 1C07A 3GOFA 3SG7A 2F33A 4GGFA 1DGVA 1J7OA 2JNFA 1FBVA 3CR2A 3EKJA 1JFKA 4E68A 1UURA 1KFUL 1SR6C 1TNXA 1DJYA 3BYAA 5D7FA 1K2HA 1F71A 1BMOA 4C0KA 2G2BA 4MZJA 1B1GA 2LMTA 2SASA 3O6BA 1G4YR 1KK7Y 1OZOA 4OKHA 1AK8A 1V1FA 4PHMA 1A4PA 2KAXA 4HREE 2ISDA 1CDPA 2K7DA 2LHLA 2CTNA 1H4BA 1CFFA 1WLMA 2WORA 4GNKB 2M1UA 5GQQC 1WLZA 1BU3A 2JZIA 1RWYA 3QRXA 2WCFA 4NDDA 3KO0A 5HLOA 2CNPA 2M29A 4NDBA 1QVIY 3I5FB 3NSLA 3I5IC 1NCYA 5AEQA 1U5IA 2AMIA 3EKHA 4JWQA 1B8CA 4PALA 3SG4A 1SRAA 1TN4A 1B7TY 3EVUA 3NSKA 3TDIA 1DTLA 1BJFA 2LE9B 3D0YA 1GQMA 1KWOC 1AUIB 1F54A 4HRGA 3WXAA 4CLNA 1AP4A 1CM4A 1DJGA 1QTXA 2FOTA 2Q91A 5DKNA 4MLWA 4PHJA 2HF5A 1XFUO 1F55A 1CM1A 5I2QA 1F4OA 5KU1A 1S3PA 1YUSA
chains in the Genus database with same CATH superfamily
1OZSA 1YRTB 3F45A 1AHRA 4I5NB 4YI9A 3DYEA 2GTEA 3JTDB 1N2DA 1YVHA 1D1OA 1IJ5A 4GAOA 3VRRA 2KFFA 5PALA 2Y4QA 2F3YA 2BBMA 1AJ4A 1ODBA 2LMVA 2QEVA 2LVIA 2KBIA 3JTDC 1UHHA 3NXAA 1FF1A 1R6PA 1CDNA 1NYAA 2JTZA 1EL4A 2ERBA 1QASA 4BY4A 2IS9A 1RFJA 3D77A 3EVRA 4YBHB 5J3XA 4YRUA 5I94A 1YX7A 1SK6D 2DOQA 4MRXA 3DF0B 4MVFA 1FW4A 2MHHA 5KSZA 1CFDA 2JT8A 2KI6D 1C7WA 3OHMB 4WQ2A 3PATA 1SL9A 2CBLA 1DF0B 5JOLA 1CLBA 3BUNB 2KFHA 1PRWA 1NWDA 3B86A 1TNWA 3BUMB 3LCPC 1MHOA 3SG6A 3MSEB 2SCPA 3PN7C 5D69A 3IQQA 1N0YA 3VROA 2K60A 1S5GZ 2HPSA 2YGUA 1PSRA 3EG5B 3PLFB 3CZTX 2KYCA 3B6XA 3PALA 5CPVA 5I2LA 1S6CA 2H2KA 5I2OA 3SG5A 1SNLA 2JQ6A 4YGBB 3UO9A 1IH0A 3VRQA 2EHBA 3BFBA 2LP2A 1EXRA 2ZRSA 1J7RA 2KHNA 2CT9A 3D73A 5IBWA 1M46A 3AKBA 3E3RA 2KFGA 3FWCA 4DRWA 1SCVA 3BUXB 3NHTA 1EG4A 1S1EA 1YR5A 1SYMA 4JQ0D 2NZ0A 1XO5A 1SL8A 1CFCA 1DEKA 3WHTB 2KQ6A 2ZN8A 4MSPA 4CIDA 5KTYA 3QMEA 5JJGA 2LVVA 2LMUA 1OOIX 4MN0A 2WCJA 2BCXA 3LLEA 4OVNF 2LNKA 4ICBA 3GK4X 1EH2A 4XYNA 5HKWA 1DC1A 3L4LA 2GGZA 2K7OA 1YTZC 2HETA 3NGVA 3RM1A 1V1GA 5HLVA 4QJ5B 1OMDA 2K2FA 4I5KA 2QPTA 4I5JA 2RGIA 3BUWB 3R72A 1IWQA 1JF0A 3M0WA 1JF2A 1L2OB 2L5YA 3DY9A 4MBEA 5AFPA 4QJ4B 4GGNA 1IKUA 1SKTA 2L50A 4QJ3B 1KK7Z 2EC6B 2FJYA 2H8VA 3FS7A 1MF8B 2L2CA 1QJTA 1QV1A 2KAVA 1L2OC 1IRJA 3OX6A 5HKYA 1ZFSA 1SL7A 1DT7B 2EC6C 1XFWO 2QEHA 3ICBA 1F70A 3OX5A 3RLZA 1Q80A 4TNCA 1ORGA 3OP0A 5HKZA 1IQ3A 2KGRA 2D8NA 3I5IB 1DQEA 1F8HA 1GGZA 1LXFC 3EK4A 2F2PA 3A8RA 1SW8A 2M9GA 3B88A 3CZ1A 3KHEA 1OW4A 4L9MA 4JPZB 4ZCVA 1B7TZ 5TNCA 2JT0A 3SS3A 4F0ZB 1A75B 2O5GA 4A4BA 4A4CA 1N65A 1HQVA 1NSHA 1KWOB 1KCYA 1IQ5A 1BG1A 2AAOA 2KLEA 2K7BA 2P70A 1IIOA 3VRPA 1JC2A 2H61C 2OTGB 3CGAA 4GGFC 4PHKA 4USLA 2M7NA 5ER5A 2ZNDA 4YGAA 1PALA 2NLNA 3BQ3A 2AUCA 2JC2A 4YGDB 1XA5A 1BR1B 2MJWB 3VB1A 2OTGC 1FI5A 1CDLA 2QEOA 1J1DA 5F6TA 2BKHB 1S36A 2BBNA 3WHUB 4CPVA 1RK9A 1TTXA 4OR9B 1BODA 3WNXB 1B4CA 1S6JA 1SSEB 2MRDA 1T14A 1PVBA 1Y0VH 3D76A 1AJ5A 2JULA 2F2OA 3KPXA 1BR4B 1UHKA 1KFXS 3DVEA 3S0BA 3I5HB 1PSBA 1U5IB 1J55A 2PVBA 3LK1A 2HQ8A 1NPQA 4IJ7A 1XFRA 2Y5IA 5FI7A 3S0AA 4HRHA 1WY9A 2BAPA 1A29A 1E8AA 1WRZA 3LL8B 4N1GA 1Z2CB 2L0PA 1Y1XA 4WQ3A 2JWWA 3D0YB 3I5HC 1CMFA 1CKKA 3CS1A 1QLKA 2M3WA 2ZNEA 4HSZA 3CR5X 1HT9A 1ZACA 2JTTA 1UHIA 3EK7A 1BT6A 2L2EA 3DVKA 4ORBB 4BY5A 1J7QA 2NCPA 1B8RA 2JOJA 3SS5A 1TRFA 1FPWA 2Y1NA 3ZNIA 2OPOA 4DUQA 3D75A 3PN7B 1XFVO 2F8PA 3NSOA 1PVAA 2L5XB 2PYQA 4I5LB 4AOMA 1OMVA 3TS5B 3BOWA 2FJUB 2LHIA 4WRIA 2LLUA 2JXCA 1KQVA 2LM5A 1WRKA 4MRYA 2FCEA 2KI4B 3FE6A 4AQJA 1LVCD 1M39A 3CABA 3TS5C 2B1UA 2LUXA 1ALWA 2JPTA 3AKAA 1K9PA 1TNQA 2KI4C 1GM0A 1Y1AA 2KQYA 3I5GB 1WRLA 3TDZA 3OBVA 5I8NA 2I7AA 2WCHA 3PJIA 3VGOA 1K96A 3O2PA 1Y1UA 1M63B 3CR4X 4DCKA 2KPHA 1OE9B 2JT3A 4N5XA 1TWOA 5FI2A 1QX7A 1XK4A 3I5GC 3C1VA 4XJKA 1MUXA 4DIRA 1K90D 1XFYO 1SCMB 2JPOA 1K95A 3N7HA 4MZLA 4ZCUA 1KQMB 1KFXL 2P71A 2ZN9A 3OGNA 3O78A 5CSIA 2NCOA 1OMRA 1TCFA 4PE4A 1M31A 1QLSA 1JBAA 1KSOA 1MR8A 1M45A 4FTGA 2F3ZA 2QACA 1QIWA 1SCMC 4PE1A 2MLEC 1OSAA 1KQMC 1TUJA 2I94A 2K7CA 1QS7A 2K8MB 4YGCB 1MWNA 4NQGA 4C0LA 1YX8A 2L4HA 5AERA 3JVTB 1K93D 1YVLA 4DS7A 1AVSA 1A03A 4U8DA 1DVIA 3HX4A 5D3OA 1G8IA 3IF7A 1JWDA 1P28A 2BECA 1NIWA 1OOJA 1C7VA 1NUBA 3JVTC 2Q4UA 2JXLA 1PK0D 1R2UA 3FE9A 1F4QA 3L47A 1H8BA 1NCXA 3GK1A 3FE8A 3BUOB 1MXEA 2KI6C 2BE4A 2WCMA 3D10A 2M8UA 5G08A 3H4SE 1SY9A 3AAJA 1W7IB 2LVKA 1XK4C 4OV2A 2EGDA 4N1FA 1UWOA 1A75A 2GGMA 3S0EA 1QVIZ 1QIVA 1DMOA 3GK2A 3R1VA 3R1PA 2A4JA 2K61A 3CDNA 1TOPA 1CTRA 3FIAA 1BF5A 3CWGA 3SIAA 1CMGA 2G9BA 2LV7A 4ETOA 1LKJA 2M0RA 2R2IA 4IL1A 2KYFA 1UP5A 2PMYA 1FI6A 1IJ6A 3CZ2A 3IVTA 4PCWA 5CSFA 3SIBA 1IGVA 4M2QA 1QWVA 1NCZA 1XFXO 4PHNA 4GPLB 3KF9A 2VRGA 2JRFA 1ALVA 2LVJA 2TN4A 1CDMA 2PALA 5DICA 4CFRA 3CLNA 4INWA 1L7ZA 1JUOA 3KEVA 3PM8A 4GFTA 1KSMA 1B9AA 1XYDA 4GBAA 1JSAA 2LLSA 2HQWA 2JNXA 3SG3A 1TCOB 5B8IB 3A4UB 3DVJA 1ZUZA 1Y6WA 2P6BB 3I5FC 3S0FA 1JFJA 2KAYA 2E30A 2WCBA 3EK8A 5FI6A 1W7JB 1RTP1 1LA0A 1OQPA 5CSNA 4CFQA 3BJHA 3TZ1A 1TUZA 3DD4A 3DF0A 2BKIB 3VRNA 2LCPA 1CLMA 2KGBC 4P5OE 4FQOA 2QEBA 1NX1A 2KOTA 1UHJA 1C3YA 1C3ZA 4Q04A 1DF0A 1VRKA 3DVMA 4R1EA 1DJWA 1XFZO 2WOSA 1SBJA 1J7PA 2KBMA 5K89A 2KNEA 1QV0A 2COLB 1DGUA 4NDCA 2ZRTA 1B47A 4JD9A 1RROA 1QX5B 3BXKA 2L4IA 2CXJA 3ZWHA 3RZSA 3LK0A 1DELA 2CCMA 1QX2A 2L98A 2MA2A 3FWBA 4UPGA 1TNPA 1NX2A 1CB1A 3O4XA 5CSJA 2FCDA 4PDZA 3PM2A 5ER4X 2I2RE 4OCIA 4ORCB 3S0GA 5DKQA 1G33A 1B8LA 1EG3A 2K0JA 1K9UA 4INXA 1NX0A 2KLDA 2MLFC 1NP8A 2K2AA 3TDUA 1S6IA 1RECA 2BCBA 2I18A 2M97A 3IQOA 2WC6A 4YGEB 1RJVA 1UHNA 3PSRA 1J1EA 1KFUS 2E6WA 2M1KB 3EVVA 1CFPA 1ZMZA 2LAPA 4C0JA 1S26D 3CZ0A 2BE6A 2BL0B 2PSRA 5AANA 4M2OA 2KDHA 4KYNA 2WC8A 1BLQA 1IG5A 1YUUA 2M49B 3K1EA 1K94A 3O4YA 4D1EA 3DZTA 2BL0C 2WCEA 3BOWB 4ORAB 2LP3A 1X02A 1PULA 1GGWA 3DXLA 3BFHA 3K21A 3OB1B 3HCMA 2LUCA 3OB2B 1S5GY 1LA3A 2BCAA 2M7LA 1DJXA 1OOGA 1QXPA 2O60A 3SG2A 2WCLA 4MEWA 3V2LA 4AQIA 1DJZA 1YURA 2OS8B 4YI8A 1CNPA 1LINA 3D78A 5HYDA 2ZKMX 3CTNA 4PE7A 1TIZA 1UUSA 2GV5A 2Y1MA 4M2PA 5DKRA 1OOFA 1A2XA 1NX3A 2MAZA 2LANA 2ZFDA 1YRUB 2PASA 3AAKA 2OS8C 1BOCA 3PFVA 1WDCB 4GUKA 3TUYB 1DJHA 2WC5A 1KK8B 2L51A 4PE0A 3B7AA 2KSPA 4XJKB 1MQ1A 2MBXA 1OOHA 1K8UA 2PRUA 1EJ3A 1WDCC 4MZKA 1YUTA 2JU0A 3TUYC 1SPYA 1K9KA 1XVJA 1KK8C 2LC5A 1MXLC 5FYXA 3UNWA 2WNDA 1CLLA 5BPJA 1QATA 1SMGA 1DJIA 1SR6B 3D74A 1GJYA 1W9ZA 2V53A 3NSIA 4P2YB 3B87A 3SJSA 1ZOTB 2LLTA 2NXQA 4FQTA 2H61A 5HL1A 5AXIA 1C07A 3GOFA 3SG7A 2F33A 1LS8A 4GGFA 1DGVA 1J7OA 2JNFA 1FBVA 3CR2A 3EKJA 1JFKA 3Q8IA 1UURA 1KFUL 1SR6C 1TNXA 1DJYA 3BYAA 5D7FA 4E68A 1K2HA 1F71A 1BMOA 4C0KA 2G2BA 4MZJA 1B1GA 2LMTA 2SASA 3O6BA 1G4YR 2PQLA 1KK7Y 1OZOA 4OKHA 1AK8A 1V1FA 4PHMA 1A4PA 2KAXA 3S0DA 4JKTA 4HREE 2ISDA 1CDPA 2K7DA 2LHLA 3BFAA 2CTNA 2WCKA 1CFFA 1H4BA 3SS4A 1WLMA 2WORA 4GNKB 2QDIA 2M1UA 4PT1A 5GQQC 1WLZA 1BU3A 2JZIA 1RWYA 3QRXA 2WCFA 4NDDA 3KO0A 5HLOA 2CNPA 2M29A 4NDBA 1QVIY 3I5FB 3NSLA 3I5IC 1NCYA 5AEQA 1U5IA 2BNXA 2AMIA 3EKHA 4JWQA 1B8CA 3CYZA 4PALA 3SG4A 1SRAA 1TN4A 1B7TY 4F7FA 3EVUA 3NSKA 4OZDA 3L4AA 3TDIA 1DTLA 1BJFA 2LE9B 3D0YA 1GQMA 1KWOC 1AUIB 1F54A 3R1OA 4HRGA 3WXAA 4CLNA 1AP4A 1CM4A 1DJGA 1QTXA 2FOTA 2Q91A 3NHIA 5EL2A 5DKNA 4MLWA 4PHJA 1Z4HA 2HF5A 1XFUO 1F55A 1CM1A 5I2QA 1F4OA 5KU1A 1S3PA 1YUSA
chains in the Genus database with same CATH topology
1OZSA 1YRTB 3F45A 1AHRA 4I5NB 4YI9A 3JTDB 1N2DA 1YVHA 1D1OA 1IJ5A 4GAOA 3VRRA 2KFFA 5PALA 2Y4QA 2F3YA 2BBMA 1AJ4A 1ODBA 2LMVA 2LVIA 2KBIA 3JTDC 1UHHA 3NXAA 1FF1A 1R6PA 1CDNA 1NYAA 2JTZA 1EL4A 1QASA 4BY4A 2IS9A 1RFJA 4YBHB 3EVRA 5J3XA 4YRUA 1YX7A 1SK6D 2DOQA 4MRXA 3DF0B 4MVFA 1FW4A 2MHHA 5KSZA 1CFDA 2JT8A 2KI6D 1C7WA 3OHMB 4WQ2A 3PATA 1SL9A 2CBLA 1DF0B 5JOLA 1CLBA 3BUNB 2KFHA 1PRWA 1NWDA 3BUMB 1TNWA 3LCPC 3SG6A 1MHOA 3MSEB 2SCPA 3PN7C 5D69A 3IQQA 1N0YA 3VROA 1S5GZ 2HPSA 1PSRA 3PLFB 3CZTX 2KYCA 3PALA 5CPVA 5I2LA 1S6CA 2H2KA 5I2OA 3SG5A 1SNLA 2JQ6A 4YGBB 1IH0A 3VRQA 2EHBA 2LP2A 1EXRA 2ZRSA 1J7RA 2KHNA 2CT9A 5IBWA 1M46A 3AKBA 3E3RA 2KFGA 3FWCA 4DRWA 1SCVA 3BUXB 1EG4A 1S1EA 1YR5A 1SYMA 4JQ0D 2NZ0A 1XO5A 1SL8A 1CFCA 3WHTB 2KQ6A 2ZN8A 4MSPA 4CIDA 5KTYA 5JJGA 2LVVA 2LMUA 4MN0A 2BCXA 3LLEA 4OVNF 2LNKA 4ICBA 3GK4X 1EH2A 4XYNA 5HKWA 2GGZA 2K7OA 1YTZC 2HETA 3RM1A 4QJ5B 1V1GA 5HLVA 1OMDA 2K2FA 4I5KA 2QPTA 4I5JA 2RGIA 3BUWB 1IWQA 1JF0A 3M0WA 1JF2A 1L2OB 5AFPA 4MBEA 4QJ4B 4GGNA 1IKUA 1SKTA 2L50A 4QJ3B 1KK7Z 2EC6B 3FS7A 1MF8B 1QJTA 1QV1A 2KAVA 1L2OC 1IRJA 3OX6A 5HKYA 1ZFSA 1SL7A 1DT7B 2EC6C 1XFWO 3ICBA 1F70A 3OX5A 3RLZA 1Q80A 4TNCA 5HKZA 3OP0A 1IQ3A 2KGRA 2D8NA 3I5IB 1F8HA 1GGZA 1LXFC 3EK4A 2F2PA 3A8RA 1SW8A 2M9GA 4L9MA 4ZCVA 3KHEA 5TNCA 4JPZB 1B7TZ 2JT0A 4F0ZB 1A75B 2O5GA 4A4BA 4A4CA 1N65A 1HQVA 1NSHA 1KWOB 1KCYA 1IQ5A 1BG1A 2AAOA 2K7BA 3VRPA 1JC2A 2H61C 2OTGB 3CGAA 4GGFC 4PHKA 4USLA 2M7NA 5ER5A 2ZNDA 4YGAA 1PALA 2NLNA 3BQ3A 2AUCA 2JC2A 4YGDB 1XA5A 1BR1B 2MJWB 2OTGC 1FI5A 1CDLA 1J1DA 5F6TA 2BKHB 1S36A 2BBNA 3WHUB 4CPVA 1RK9A 1TTXA 4OR9B 1BODA 3WNXB 1B4CA 1S6JA 2MRDA 1PVBA 1Y0VH 1AJ5A 2JULA 2F2OA 3KPXA 1BR4B 1UHKA 1KFXS 3DVEA 3I5HB 1PSBA 1U5IB 1J55A 2PVBA 3LK1A 2HQ8A 1NPQA 2Y5IA 4HRHA 1WY9A 1A29A 1E8AA 1WRZA 3LL8B 4N1GA 2L0PA 1Y1XA 4WQ3A 2JWWA 3D0YB 3I5HC 1CMFA 1CKKA 3CS1A 1QLKA 2M3WA 2ZNEA 4HSZA 3CR5X 1HT9A 1ZACA 2JTTA 1UHIA 3EK7A 1BT6A 2L2EA 3DVKA 4ORBB 4BY5A 1J7QA 2NCPA 1B8RA 2JOJA 1TRFA 1FPWA 2Y1NA 3ZNIA 2OPOA 4DUQA 3PN7B 1XFVO 2F8PA 3NSOA 1PVAA 2L5XB 4AOMA 4I5LB 1OMVA 3TS5B 3BOWA 2FJUB 2LHIA 4WRIA 2LLUA 2JXCA 1KQVA 2LM5A 1WRKA 4MRYA 2FCEA 2KI4B 4AQJA 1LVCD 1M39A 3TS5C 2B1UA 2LUXA 1ALWA 2JPTA 3AKAA 1K9PA 1TNQA 2KI4C 1Y1AA 2KQYA 3I5GB 1WRLA 3TDZA 5I8NA 2I7AA 3VGOA 1K96A 3O2PA 1Y1UA 1M63B 3CR4X 4DCKA 1OE9B 2JT3A 4N5XA 1QX7A 1XK4A 3I5GC 3C1VA 4XJKA 1MUXA 4DIRA 1K90D 1XFYO 1SCMB 4MZLA 1K95A 4ZCUA 1KQMB 1KFXL 2ZN9A 5CSIA 3O78A 2NCOA 1OMRA 1TCFA 4PE4A 1M31A 1QLSA 1JBAA 1KSOA 1MR8A 1M45A 4FTGA 2F3ZA 2QACA 1QIWA 1SCMC 4PE1A 2MLEC 1OSAA 1KQMC 2I94A 2K7CA 1QS7A 2K8MB 4YGCB 1MWNA 4NQGA 4C0LA 1YX8A 2L4HA 5AERA 3JVTB 1K93D 1YVLA 4DS7A 1AVSA 1A03A 4U8DA 1DVIA 3HX4A 1G8IA 3IF7A 1JWDA 2BECA 1NIWA 1OOJA 1C7VA 1NUBA 3JVTC 2Q4UA 2JXLA 1PK0D 1R2UA 1F4QA 1H8BA 1NCXA 3GK1A 3BUOB 1MXEA 2KI6C 2BE4A 3D10A 2M8UA 5G08A 3H4SE 1SY9A 3AAJA 1W7IB 2LVKA 1XK4C 4OV2A 2EGDA 4N1FA 1UWOA 1A75A 2GGMA 1QVIZ 1QIVA 1DMOA 3GK2A 2A4JA 2K61A 1TOPA 1CTRA 3FIAA 1BF5A 3CWGA 3SIAA 1CMGA 2G9BA 2LV7A 4ETOA 1LKJA 2M0RA 2R2IA 4IL1A 2KYFA 1UP5A 2PMYA 1FI6A 1IJ6A 4PCWA 5CSFA 3SIBA 1IGVA 4M2QA 1NCZA 1XFXO 4PHNA 4GPLB 3KF9A 2VRGA 2JRFA 1ALVA 2LVJA 2TN4A 1CDMA 2PALA 4CFRA 3CLNA 1L7ZA 1JUOA 3KEVA 3PM8A 4GFTA 1KSMA 1B9AA 1XYDA 4GBAA 1JSAA 2LLSA 2HQWA 2JNXA 3SG3A 1TCOB 5B8IB 3A4UB 3DVJA 1ZUZA 1Y6WA 2P6BB 3I5FC 1JFJA 2KAYA 2E30A 2WCBA 3EK8A 1W7JB 1RTP1 1LA0A 1OQPA 5CSNA 4CFQA 3TZ1A 3DD4A 3DF0A 2BKIB 3VRNA 2LCPA 1CLMA 2KGBC 4P5OE 4FQOA 1NX1A 2KOTA 1UHJA 4Q04A 1DF0A 1VRKA 3DVMA 4R1EA 1DJWA 1XFZO 2WOSA 1SBJA 1J7PA 2KBMA 5K89A 2KNEA 1QV0A 2COLB 1DGUA 4NDCA 2ZRTA 1B47A 1RROA 1QX5B 3BXKA 2L4IA 2CXJA 3ZWHA 3LK0A 2CCMA 2MA2A 1QX2A 2L98A 3FWBA 1CB1A 4UPGA 1TNPA 1NX2A 5CSJA 2FCDA 4PDZA 5ER4X 2I2RE 4OCIA 4ORCB 5DKQA 1G33A 1B8LA 1EG3A 2K0JA 1K9UA 1NX0A 2MLFC 1NP8A 2K2AA 3TDUA 1S6IA 2BCBA 1RECA 2I18A 2M97A 3IQOA 4YGEB 1RJVA 1UHNA 3PSRA 1J1EA 1KFUS 2E6WA 2M1KB 3EVVA 1CFPA 1ZMZA 2LAPA 4C0JA 1S26D 2BE6A 2BL0B 2PSRA 5AANA 4M2OA 2KDHA 2WC8A 1BLQA 1IG5A 1YUUA 2M49B 1K94A 3O4YA 4D1EA 2BL0C 2WCEA 3BOWB 4ORAB 2LP3A 1X02A 1PULA 1GGWA 3K21A 3OB1B 3HCMA 2LUCA 3OB2B 1S5GY 1LA3A 2BCAA 2M7LA 1DJXA 1QXPA 2O60A 3SG2A 4MEWA 4AQIA 1DJZA 1YURA 2OS8B 4YI8A 1CNPA 1LINA 5HYDA 2ZKMX 3CTNA 4PE7A 1TIZA 1UUSA 2GV5A 2Y1MA 4M2PA 5DKRA 1A2XA 1NX3A 2MAZA 2LANA 2ZFDA 1YRUB 2PASA 3AAKA 2OS8C 1BOCA 3PFVA 1WDCB 4GUKA 3TUYB 1DJHA 1KK8B 2L51A 4PE0A 2KSPA 4XJKB 1MQ1A 2MBXA 1K8UA 2PRUA 1EJ3A 1WDCC 4MZKA 1YUTA 2JU0A 3TUYC 1SPYA 1K9KA 1XVJA 1KK8C 2LC5A 1MXLC 5FYXA 2WNDA 1CLLA 5BPJA 1QATA 1SMGA 1DJIA 1SR6B 3NSIA 1GJYA 3SJSA 2V53A 4P2YB 1ZOTB 2LLTA 2NXQA 2H61A 5AXIA 1C07A 3GOFA 3SG7A 2F33A 4GGFA 1DGVA 1J7OA 2JNFA 1FBVA 3CR2A 3EKJA 1JFKA 4E68A 1UURA 1KFUL 1SR6C 1TNXA 1DJYA 3BYAA 5D7FA 1K2HA 1F71A 1BMOA 4C0KA 2G2BA 4MZJA 1B1GA 2LMTA 2SASA 3O6BA 1G4YR 1KK7Y 1OZOA 4OKHA 1AK8A 1V1FA 4PHMA 1A4PA 2KAXA 4HREE 2ISDA 1CDPA 2K7DA 2LHLA 2CTNA 1H4BA 1CFFA 1WLMA 2WORA 4GNKB 2M1UA 5GQQC 1WLZA 1BU3A 2JZIA 1RWYA 3QRXA 2WCFA 4NDDA 3KO0A 5HLOA 2CNPA 2M29A 4NDBA 1QVIY 3I5FB 3NSLA 3I5IC 1NCYA 5AEQA 1U5IA 2AMIA 3EKHA 4JWQA 1B8CA 4PALA 3SG4A 1SRAA 1TN4A 1B7TY 3EVUA 3NSKA 3TDIA 1DTLA 1BJFA 2LE9B 3D0YA 1GQMA 1KWOC 1AUIB 1F54A 4HRGA 3WXAA 4CLNA 1AP4A 1CM4A 1DJGA 1QTXA 2FOTA 2Q91A 5DKNA 4MLWA 4PHJA 2HF5A 1XFUO 1F55A 1CM1A 5I2QA 1F4OA 5KU1A 1S3PA 1YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZS A;  1YRT B;  3F45 A;  1AHR A;  4I5N B;  4YI9 A;  3JTD B;  1N2D A;  1YVH A;  1D1O A;  1IJ5 A;  4GAO A;  3VRR A;  2KFF A;  5PAL A;  2Y4Q A;  2F3Y A;  2BBM A;  1AJ4 A;  1ODB A;  2LMV A;  2LVI A;  2KBI A;  3JTD C;  1UHH A;  3NXA A;  1FF1 A;  1R6P A;  1CDN A;  1NYA A;  2JTZ A;  1EL4 A;  1QAS A;  4BY4 A;  2IS9 A;  1RFJ A;  4YBH B;  3EVR A;  5J3X A;  4YRU A;  1YX7 A;  1SK6 D;  2DOQ A;  4MRX A;  3DF0 B;  4MVF A;  1FW4 A;  2MHH A;  5KSZ A;  1CFD A;  2JT8 A;  2KI6 D;  1C7W A;  3OHM B;  4WQ2 A;  3PAT A;  1SL9 A;  2CBL A;  1DF0 B;  5JOL A;  1CLB A;  3BUN B;  2KFH A;  1PRW A;  1NWD A;  3BUM B;  1TNW A;  3LCP C;  3SG6 A;  1MHO A;  3MSE B;  2SCP A;  3PN7 C;  5D69 A;  3IQQ A;  1N0Y A;  3VRO A;  1S5G Z;  2HPS A;  1PSR A;  3PLF B;  3CZT X;  2KYC A;  3PAL A;  5CPV A;  5I2L A;  1S6C A;  2H2K A;  5I2O A;  3SG5 A;  1SNL A;  2JQ6 A;  4YGB B;  1IH0 A;  3VRQ A;  2EHB A;  2LP2 A;  1EXR A;  2ZRS A;  1J7R A;  2KHN A;  2CT9 A;  5IBW A;  1M46 A;  3AKB A;  3E3R A;  2KFG A;  3FWC A;  4DRW A;  1SCV A;  3BUX B;  1EG4 A;  1S1E A;  1YR5 A;  1SYM A;  4JQ0 D;  2NZ0 A;  1XO5 A;  1SL8 A;  1CFC A;  3WHT B;  2KQ6 A;  2ZN8 A;  4MSP A;  4CID A;  5KTY A;  5JJG A;  2LVV A;  2LMU A;  4MN0 A;  2BCX A;  3LLE A;  4OVN F;  2LNK A;  4ICB A;  3GK4 X;  1EH2 A;  4XYN A;  5HKW A;  2GGZ A;  2K7O A;  1YTZ C;  2HET A;  3RM1 A;  4QJ5 B;  1V1G A;  5HLV A;  1OMD A;  2K2F A;  4I5K A;  2QPT A;  4I5J A;  2RGI A;  3BUW B;  1IWQ A;  1JF0 A;  3M0W A;  1JF2 A;  1L2O B;  5AFP A;  4MBE A;  4QJ4 B;  4GGN A;  1IKU A;  1SKT A;  2L50 A;  4QJ3 B;  1KK7 Z;  2EC6 B;  3FS7 A;  1MF8 B;  1QJT A;  1QV1 A;  2KAV A;  1L2O C;  1IRJ A;  3OX6 A;  5HKY A;  1ZFS A;  1SL7 A;  1DT7 B;  2EC6 C;  1XFW O;  3ICB A;  1F70 A;  3OX5 A;  3RLZ A;  1Q80 A;  4TNC A;  5HKZ A;  3OP0 A;  1IQ3 A;  2KGR A;  2D8N A;  3I5I B;  1F8H A;  1GGZ A;  1LXF C;  3EK4 A;  2F2P A;  3A8R A;  1SW8 A;  2M9G A;  4L9M A;  4ZCV A;  3KHE A;  5TNC A;  4JPZ B;  1B7T Z;  2JT0 A;  4F0Z B;  1A75 B;  2O5G A;  4A4B A;  4A4C A;  1N65 A;  1HQV A;  1NSH A;  1KWO B;  1KCY A;  1IQ5 A;  1BG1 A;  2AAO A;  2K7B A;  3VRP A;  1JC2 A;  2H61 C;  2OTG B;  3CGA A;  4GGF C;  4PHK A;  4USL A;  2M7N A;  5ER5 A;  2ZND A;  4YGA A;  1PAL A;  2NLN A;  3BQ3 A;  2AUC A;  2JC2 A;  4YGD B;  1XA5 A;  1BR1 B;  2MJW B;  2OTG C;  1FI5 A;  1CDL A;  1J1D A;  5F6T A;  2BKH B;  1S36 A;  2BBN A;  3WHU B;  4CPV A;  1RK9 A;  1TTX A;  4OR9 B;  1BOD A;  3WNX B;  1B4C A;  1S6J A;  2MRD A;  1PVB A;  1Y0V H;  1AJ5 A;  2JUL A;  2F2O A;  3KPX A;  1BR4 B;  1UHK A;  1KFX S;  3DVE A;  3I5H B;  1PSB A;  1U5I B;  1J55 A;  2PVB A;  3LK1 A;  2HQ8 A;  1NPQ A;  2Y5I A;  4HRH A;  1WY9 A;  1A29 A;  1E8A A;  1WRZ A;  3LL8 B;  4N1G A;  2L0P A;  1Y1X A;  4WQ3 A;  2JWW A;  3D0Y B;  3I5H C;  1CMF A;  1CKK A;  3CS1 A;  1QLK A;  2M3W A;  2ZNE A;  4HSZ A;  3CR5 X;  1HT9 A;  1ZAC A;  2JTT A;  1UHI A;  3EK7 A;  1BT6 A;  2L2E A;  3DVK A;  4ORB B;  4BY5 A;  1J7Q A;  2NCP A;  1B8R A;  2JOJ A;  1TRF A;  1FPW A;  2Y1N A;  3ZNI A;  2OPO A;  4DUQ A;  3PN7 B;  1XFV O;  2F8P A;  3NSO A;  1PVA A;  2L5X B;  4AOM A;  4I5L B;  1OMV A;  3TS5 B;  3BOW A;  2FJU B;  2LHI A;  4WRI A;  2LLU A;  2JXC A;  1KQV A;  2LM5 A;  1WRK A;  4MRY A;  2FCE A;  2KI4 B;  4AQJ A;  1LVC D;  1M39 A;  3TS5 C;  2B1U A;  2LUX A;  1ALW A;  2JPT A;  3AKA A;  1K9P A;  1TNQ A;  2KI4 C;  1Y1A A;  2KQY A;  3I5G B;  1WRL A;  3TDZ A;  5I8N A;  2I7A A;  3VGO A;  1K96 A;  3O2P A;  1Y1U A;  1M63 B;  3CR4 X;  4DCK A;  1OE9 B;  2JT3 A;  4N5X A;  1QX7 A;  1XK4 A;  3I5G C;  3C1V A;  4XJK A;  1MUX A;  4DIR A;  1K90 D;  1XFY O;  1SCM B;  4MZL A;  1K95 A;  4ZCU A;  1KQM B;  1KFX L;  2ZN9 A;  5CSI A;  3O78 A;  2NCO A;  1OMR A;  1TCF A;  4PE4 A;  1M31 A;  1QLS A;  1JBA A;  1KSO A;  1MR8 A;  1M45 A;  4FTG A;  2F3Z A;  2QAC A;  1QIW A;  1SCM C;  4PE1 A;  2MLE C;  1OSA A;  1KQM C;  2I94 A;  2K7C A;  1QS7 A;  2K8M B;  4YGC B;  1MWN A;  4NQG A;  4C0L A;  1YX8 A;  2L4H A;  5AER A;  3JVT B;  1K93 D;  1YVL A;  4DS7 A;  1AVS A;  1A03 A;  4U8D A;  1DVI A;  3HX4 A;  1G8I A;  3IF7 A;  1JWD A;  2BEC A;  1NIW A;  1OOJ A;  1C7V A;  1NUB A;  3JVT C;  2Q4U A;  2JXL A;  1PK0 D;  1R2U A;  1F4Q A;  1H8B A;  1NCX A;  3GK1 A;  3BUO B;  1MXE A;  2KI6 C;  2BE4 A;  3D10 A;  2M8U A;  5G08 A;  3H4S E;  1SY9 A;  3AAJ A;  1W7I B;  2LVK A;  1XK4 C;  4OV2 A;  2EGD A;  4N1F A;  1UWO A;  1A75 A;  2GGM A;  1QVI Z;  1QIV A;  1DMO A;  3GK2 A;  2A4J A;  2K61 A;  1TOP A;  1CTR A;  3FIA A;  1BF5 A;  3CWG A;  3SIA A;  1CMG A;  2G9B A;  2LV7 A;  4ETO A;  1LKJ A;  2M0R A;  2R2I A;  4IL1 A;  2KYF A;  1UP5 A;  2PMY A;  1FI6 A;  1IJ6 A;  4PCW A;  5CSF A;  3SIB A;  1IGV A;  4M2Q A;  1NCZ A;  1XFX O;  4PHN A;  4GPL B;  3KF9 A;  2VRG A;  2JRF A;  1ALV A;  2LVJ A;  2TN4 A;  1CDM A;  2PAL A;  4CFR A;  3CLN A;  1L7Z A;  1JUO A;  3KEV A;  3PM8 A;  4GFT A;  1KSM A;  1B9A A;  1XYD A;  4GBA A;  1JSA A;  2LLS A;  2HQW A;  2JNX A;  3SG3 A;  1TCO B;  5B8I B;  3A4U B;  3DVJ A;  1ZUZ A;  1Y6W A;  2P6B B;  3I5F C;  1JFJ A;  2KAY A;  2E30 A;  2WCB A;  3EK8 A;  1W7J B;  1RTP 1;  1LA0 A;  1OQP A;  5CSN A;  4CFQ A;  3TZ1 A;  3DD4 A;  3DF0 A;  2BKI B;  3VRN A;  2LCP A;  1CLM A;  2KGB C;  4P5O E;  4FQO A;  1NX1 A;  2KOT A;  1UHJ A;  4Q04 A;  1DF0 A;  1VRK A;  3DVM A;  4R1E A;  1DJW A;  1XFZ O;  2WOS A;  1SBJ A;  1J7P A;  2KBM A;  5K89 A;  2KNE A;  1QV0 A;  2COL B;  1DGU A;  4NDC A;  2ZRT A;  1B47 A;  1RRO A;  1QX5 B;  3BXK A;  2L4I A;  2CXJ A;  3ZWH A;  3LK0 A;  2CCM A;  2MA2 A;  1QX2 A;  2L98 A;  3FWB A;  1CB1 A;  4UPG A;  1TNP A;  1NX2 A;  5CSJ A;  2FCD A;  4PDZ A;  5ER4 X;  2I2R E;  4OCI A;  4ORC B;  5DKQ A;  1G33 A;  1B8L A;  1EG3 A;  2K0J A;  1K9U A;  1NX0 A;  2MLF C;  1NP8 A;  2K2A A;  3TDU A;  1S6I A;  2BCB A;  1REC A;  2I18 A;  2M97 A;  3IQO A;  4YGE B;  1RJV A;  1UHN A;  3PSR A;  1J1E A;  1KFU S;  2E6W A;  2M1K B;  3EVV A;  1CFP A;  1ZMZ A;  2LAP A;  4C0J A;  1S26 D;  2BE6 A;  2BL0 B;  2PSR A;  5AAN A;  4M2O A;  2KDH A;  2WC8 A;  1BLQ A;  1IG5 A;  1YUU A;  2M49 B;  1K94 A;  3O4Y A;  4D1E A;  2BL0 C;  2WCE A;  3BOW B;  4ORA B;  2LP3 A;  1X02 A;  1PUL A;  1GGW A;  3K21 A;  3OB1 B;  3HCM A;  2LUC A;  3OB2 B;  1S5G Y;  1LA3 A;  2BCA A;  2M7L A;  1DJX A;  1QXP A;  2O60 A;  3SG2 A;  4MEW A;  4AQI A;  1DJZ A;  1YUR A;  2OS8 B;  4YI8 A;  1CNP A;  1LIN A;  5HYD A;  2ZKM X;  3CTN A;  4PE7 A;  1TIZ A;  1UUS A;  2GV5 A;  2Y1M A;  4M2P A;  5DKR A;  1A2X A;  1NX3 A;  2MAZ A;  2LAN A;  2ZFD A;  1YRU B;  2PAS A;  3AAK A;  2OS8 C;  1BOC A;  3PFV A;  1WDC B;  4GUK A;  3TUY B;  1DJH A;  1KK8 B;  2L51 A;  4PE0 A;  2KSP A;  4XJK B;  1MQ1 A;  2MBX A;  1K8U A;  2PRU A;  1EJ3 A;  1WDC C;  4MZK A;  1YUT A;  2JU0 A;  3TUY C;  1SPY A;  1K9K A;  1XVJ A;  1KK8 C;  2LC5 A;  1MXL C;  5FYX A;  2WND A;  1CLL A;  5BPJ A;  1QAT A;  1SMG A;  1DJI A;  1SR6 B;  3NSI A;  1GJY A;  3SJS A;  2V53 A;  4P2Y B;  1ZOT B;  2LLT A;  2NXQ A;  2H61 A;  5AXI A;  1C07 A;  3GOF A;  3SG7 A;  2F33 A;  4GGF A;  1DGV A;  1J7O A;  2JNF A;  1FBV A;  3CR2 A;  3EKJ A;  1JFK A;  4E68 A;  1UUR A;  1KFU L;  1SR6 C;  1TNX A;  1DJY A;  3BYA A;  5D7F A;  1K2H A;  1F71 A;  1BMO A;  4C0K A;  2G2B A;  4MZJ A;  1B1G A;  2LMT A;  2SAS A;  3O6B A;  1G4Y R;  1KK7 Y;  1OZO A;  4OKH A;  1AK8 A;  1V1F A;  4PHM A;  1A4P A;  2KAX A;  4HRE E;  2ISD A;  1CDP A;  2K7D A;  2LHL A;  2CTN A;  1H4B A;  1CFF A;  1WLM A;  2WOR A;  4GNK B;  2M1U A;  5GQQ C;  1WLZ A;  1BU3 A;  2JZI A;  1RWY A;  3QRX A;  2WCF A;  4NDD A;  3KO0 A;  5HLO A;  2CNP A;  2M29 A;  4NDB A;  1QVI Y;  3I5F B;  3NSL A;  3I5I C;  1NCY A;  5AEQ A;  1U5I A;  2AMI A;  3EKH A;  4JWQ A;  1B8C A;  4PAL A;  3SG4 A;  1SRA A;  1TN4 A;  1B7T Y;  3EVU A;  3NSK A;  3TDI A;  1DTL A;  1BJF A;  2LE9 B;  3D0Y A;  1GQM A;  1KWO C;  1AUI B;  1F54 A;  4HRG A;  3WXA A;  4CLN A;  1AP4 A;  1CM4 A;  1DJG A;  1QTX A;  2FOT A;  2Q91 A;  5DKN A;  4MLW A;  4PHJ A;  2HF5 A;  1XFU O;  1F55 A;  1CM1 A;  5I2Q A;  1F4O A;  5KU1 A;  1S3P A;  1YUS A; 
#chains in the Genus database with same CATH topology
 1OZS A;  1YRT B;  3F45 A;  1AHR A;  4I5N B;  4YI9 A;  3DYE A;  2GTE A;  3JTD B;  1N2D A;  1YVH A;  1D1O A;  1IJ5 A;  4GAO A;  3VRR A;  2KFF A;  5PAL A;  2Y4Q A;  2F3Y A;  2BBM A;  1AJ4 A;  1ODB A;  2LMV A;  2QEV A;  2LVI A;  2KBI A;  3JTD C;  1UHH A;  3NXA A;  1FF1 A;  1R6P A;  1CDN A;  1NYA A;  2JTZ A;  1EL4 A;  2ERB A;  1QAS A;  4BY4 A;  2IS9 A;  1RFJ A;  3D77 A;  3EVR A;  4YBH B;  5J3X A;  4YRU A;  5I94 A;  1YX7 A;  1SK6 D;  2DOQ A;  4MRX A;  3DF0 B;  4MVF A;  1FW4 A;  2MHH A;  5KSZ A;  1CFD A;  2JT8 A;  2KI6 D;  1C7W A;  3OHM B;  4WQ2 A;  3PAT A;  1SL9 A;  2CBL A;  1DF0 B;  5JOL A;  1CLB A;  3BUN B;  2KFH A;  1PRW A;  1NWD A;  3B86 A;  1TNW A;  3BUM B;  3LCP C;  1MHO A;  3SG6 A;  3MSE B;  2SCP A;  3PN7 C;  5D69 A;  3IQQ A;  1N0Y A;  3VRO A;  2K60 A;  1S5G Z;  2HPS A;  2YGU A;  1PSR A;  3EG5 B;  3PLF B;  3CZT X;  2KYC A;  3B6X A;  3PAL A;  5CPV A;  5I2L A;  1S6C A;  2H2K A;  5I2O A;  3SG5 A;  1SNL A;  2JQ6 A;  4YGB B;  3UO9 A;  1IH0 A;  3VRQ A;  2EHB A;  3BFB A;  2LP2 A;  1EXR A;  2ZRS A;  1J7R A;  2KHN A;  2CT9 A;  3D73 A;  5IBW A;  1M46 A;  3AKB A;  3E3R A;  2KFG A;  3FWC A;  4DRW A;  1SCV A;  3BUX B;  3NHT A;  1EG4 A;  1S1E A;  1YR5 A;  1SYM A;  4JQ0 D;  2NZ0 A;  1XO5 A;  1SL8 A;  1CFC A;  1DEK A;  3WHT B;  2KQ6 A;  2ZN8 A;  4MSP A;  4CID A;  5KTY A;  3QME A;  5JJG A;  2LVV A;  2LMU A;  1OOI X;  4MN0 A;  2WCJ A;  2BCX A;  3LLE A;  4OVN F;  2LNK A;  4ICB A;  3GK4 X;  1EH2 A;  4XYN A;  5HKW A;  1DC1 A;  3L4L A;  2GGZ A;  2K7O A;  1YTZ C;  2HET A;  3NGV A;  3RM1 A;  1V1G A;  5HLV A;  4QJ5 B;  1OMD A;  2K2F A;  4I5K A;  2QPT A;  4I5J A;  2RGI A;  3BUW B;  3R72 A;  1IWQ A;  1JF0 A;  3M0W A;  1JF2 A;  1L2O B;  2L5Y A;  3DY9 A;  4MBE A;  5AFP A;  4QJ4 B;  4GGN A;  1IKU A;  1SKT A;  2L50 A;  4QJ3 B;  1KK7 Z;  2EC6 B;  2FJY A;  2H8V A;  3FS7 A;  1MF8 B;  2L2C A;  1QJT A;  1QV1 A;  2KAV A;  1L2O C;  1IRJ A;  3OX6 A;  5HKY A;  1ZFS A;  1SL7 A;  1DT7 B;  2EC6 C;  1XFW O;  2QEH A;  3ICB A;  1F70 A;  3OX5 A;  3RLZ A;  1Q80 A;  4TNC A;  1ORG A;  3OP0 A;  5HKZ A;  1IQ3 A;  2KGR A;  2D8N A;  3I5I B;  1DQE A;  1F8H A;  1GGZ A;  1LXF C;  3EK4 A;  2F2P A;  3A8R A;  1SW8 A;  2M9G A;  3B88 A;  3CZ1 A;  3KHE A;  1OW4 A;  4L9M A;  4JPZ B;  4ZCV A;  1B7T Z;  5TNC A;  2JT0 A;  3SS3 A;  4F0Z B;  1A75 B;  2O5G A;  4A4B A;  4A4C A;  1N65 A;  1HQV A;  1NSH A;  1KWO B;  1KCY A;  1IQ5 A;  1BG1 A;  2AAO A;  2KLE A;  2K7B A;  2P70 A;  1IIO A;  3VRP A;  1JC2 A;  2H61 C;  2OTG B;  3CGA A;  4GGF C;  4PHK A;  4USL A;  2M7N A;  5ER5 A;  2ZND A;  4YGA A;  1PAL A;  2NLN A;  3BQ3 A;  2AUC A;  2JC2 A;  4YGD B;  1XA5 A;  1BR1 B;  2MJW B;  3VB1 A;  2OTG C;  1FI5 A;  1CDL A;  2QEO A;  1J1D A;  5F6T A;  2BKH B;  1S36 A;  2BBN A;  3WHU B;  4CPV A;  1RK9 A;  1TTX A;  4OR9 B;  1BOD A;  3WNX B;  1B4C A;  1S6J A;  1SSE B;  2MRD A;  1T14 A;  1PVB A;  1Y0V H;  3D76 A;  1AJ5 A;  2JUL A;  2F2O A;  3KPX A;  1BR4 B;  1UHK A;  1KFX S;  3DVE A;  3S0B A;  3I5H B;  1PSB A;  1U5I B;  1J55 A;  2PVB A;  3LK1 A;  2HQ8 A;  1NPQ A;  4IJ7 A;  1XFR A;  2Y5I A;  5FI7 A;  3S0A A;  4HRH A;  1WY9 A;  2BAP A;  1A29 A;  1E8A A;  1WRZ A;  3LL8 B;  4N1G A;  1Z2C B;  2L0P A;  1Y1X A;  4WQ3 A;  2JWW A;  3D0Y B;  3I5H C;  1CMF A;  1CKK A;  3CS1 A;  1QLK A;  2M3W A;  2ZNE A;  4HSZ A;  3CR5 X;  1HT9 A;  1ZAC A;  2JTT A;  1UHI A;  3EK7 A;  1BT6 A;  2L2E A;  3DVK A;  4ORB B;  4BY5 A;  1J7Q A;  2NCP A;  1B8R A;  2JOJ A;  3SS5 A;  1TRF A;  1FPW A;  2Y1N A;  3ZNI A;  2OPO A;  4DUQ A;  3D75 A;  3PN7 B;  1XFV O;  2F8P A;  3NSO A;  1PVA A;  2L5X B;  2PYQ A;  4I5L B;  4AOM A;  1OMV A;  3TS5 B;  3BOW A;  2FJU B;  2LHI A;  4WRI A;  2LLU A;  2JXC A;  1KQV A;  2LM5 A;  1WRK A;  4MRY A;  2FCE A;  2KI4 B;  3FE6 A;  4AQJ A;  1LVC D;  1M39 A;  3CAB A;  3TS5 C;  2B1U A;  2LUX A;  1ALW A;  2JPT A;  3AKA A;  1K9P A;  1TNQ A;  2KI4 C;  1GM0 A;  1Y1A A;  2KQY A;  3I5G B;  1WRL A;  3TDZ A;  3OBV A;  5I8N A;  2I7A A;  2WCH A;  3PJI A;  3VGO A;  1K96 A;  3O2P A;  1Y1U A;  1M63 B;  3CR4 X;  4DCK A;  2KPH A;  1OE9 B;  2JT3 A;  4N5X A;  1TWO A;  5FI2 A;  1QX7 A;  1XK4 A;  3I5G C;  3C1V A;  4XJK A;  1MUX A;  4DIR A;  1K90 D;  1XFY O;  1SCM B;  2JPO A;  1K95 A;  3N7H A;  4MZL A;  4ZCU A;  1KQM B;  1KFX L;  2P71 A;  2ZN9 A;  3OGN A;  3O78 A;  5CSI A;  2NCO A;  1OMR A;  1TCF A;  4PE4 A;  1M31 A;  1QLS A;  1JBA A;  1KSO A;  1MR8 A;  1M45 A;  4FTG A;  2F3Z A;  2QAC A;  1QIW A;  1SCM C;  4PE1 A;  2MLE C;  1OSA A;  1KQM C;  1TUJ A;  2I94 A;  2K7C A;  1QS7 A;  2K8M B;  4YGC B;  1MWN A;  4NQG A;  4C0L A;  1YX8 A;  2L4H A;  5AER A;  3JVT B;  1K93 D;  1YVL A;  4DS7 A;  1AVS A;  1A03 A;  4U8D A;  1DVI A;  3HX4 A;  5D3O A;  1G8I A;  3IF7 A;  1JWD A;  1P28 A;  2BEC A;  1NIW A;  1OOJ A;  1C7V A;  1NUB A;  3JVT C;  2Q4U A;  2JXL A;  1PK0 D;  1R2U A;  3FE9 A;  1F4Q A;  3L47 A;  1H8B A;  1NCX A;  3GK1 A;  3FE8 A;  3BUO B;  1MXE A;  2KI6 C;  2BE4 A;  2WCM A;  3D10 A;  2M8U A;  5G08 A;  3H4S E;  1SY9 A;  3AAJ A;  1W7I B;  2LVK A;  1XK4 C;  4OV2 A;  2EGD A;  4N1F A;  1UWO A;  1A75 A;  2GGM A;  3S0E A;  1QVI Z;  1QIV A;  1DMO A;  3GK2 A;  3R1V A;  3R1P A;  2A4J A;  2K61 A;  3CDN A;  1TOP A;  1CTR A;  3FIA A;  1BF5 A;  3CWG A;  3SIA A;  1CMG A;  2G9B A;  2LV7 A;  4ETO A;  1LKJ A;  2M0R A;  2R2I A;  4IL1 A;  2KYF A;  1UP5 A;  2PMY A;  1FI6 A;  1IJ6 A;  3CZ2 A;  3IVT A;  4PCW A;  5CSF A;  3SIB A;  1IGV A;  4M2Q A;  1QWV A;  1NCZ A;  1XFX O;  4PHN A;  4GPL B;  3KF9 A;  2VRG A;  2JRF A;  1ALV A;  2LVJ A;  2TN4 A;  1CDM A;  2PAL A;  5DIC A;  4CFR A;  3CLN A;  4INW A;  1L7Z A;  1JUO A;  3KEV A;  3PM8 A;  4GFT A;  1KSM A;  1B9A A;  1XYD A;  4GBA A;  1JSA A;  2LLS A;  2HQW A;  2JNX A;  3SG3 A;  1TCO B;  5B8I B;  3A4U B;  3DVJ A;  1ZUZ A;  1Y6W A;  2P6B B;  3I5F C;  3S0F A;  1JFJ A;  2KAY A;  2E30 A;  2WCB A;  3EK8 A;  5FI6 A;  1W7J B;  1RTP 1;  1LA0 A;  1OQP A;  5CSN A;  4CFQ A;  3BJH A;  3TZ1 A;  1TUZ A;  3DD4 A;  3DF0 A;  2BKI B;  3VRN A;  2LCP A;  1CLM A;  2KGB C;  4P5O E;  4FQO A;  2QEB A;  1NX1 A;  2KOT A;  1UHJ A;  1C3Y A;  1C3Z A;  4Q04 A;  1DF0 A;  1VRK A;  3DVM A;  4R1E A;  1DJW A;  1XFZ O;  2WOS A;  1SBJ A;  1J7P A;  2KBM A;  5K89 A;  2KNE A;  1QV0 A;  2COL B;  1DGU A;  4NDC A;  2ZRT A;  1B47 A;  4JD9 A;  1RRO A;  1QX5 B;  3BXK A;  2L4I A;  2CXJ A;  3ZWH A;  3RZS A;  3LK0 A;  1DEL A;  2CCM A;  1QX2 A;  2L98 A;  2MA2 A;  3FWB A;  4UPG A;  1TNP A;  1NX2 A;  1CB1 A;  3O4X A;  5CSJ A;  2FCD A;  4PDZ A;  3PM2 A;  5ER4 X;  2I2R E;  4OCI A;  4ORC B;  3S0G A;  5DKQ A;  1G33 A;  1B8L A;  1EG3 A;  2K0J A;  1K9U A;  4INX A;  1NX0 A;  2KLD A;  2MLF C;  1NP8 A;  2K2A A;  3TDU A;  1S6I A;  1REC A;  2BCB A;  2I18 A;  2M97 A;  3IQO A;  2WC6 A;  4YGE B;  1RJV A;  1UHN A;  3PSR A;  1J1E A;  1KFU S;  2E6W A;  2M1K B;  3EVV A;  1CFP A;  1ZMZ A;  2LAP A;  4C0J A;  1S26 D;  3CZ0 A;  2BE6 A;  2BL0 B;  2PSR A;  5AAN A;  4M2O A;  2KDH A;  4KYN A;  2WC8 A;  1BLQ A;  1IG5 A;  1YUU A;  2M49 B;  3K1E A;  1K94 A;  3O4Y A;  4D1E A;  3DZT A;  2BL0 C;  2WCE A;  3BOW B;  4ORA B;  2LP3 A;  1X02 A;  1PUL A;  1GGW A;  3DXL A;  3BFH A;  3K21 A;  3OB1 B;  3HCM A;  2LUC A;  3OB2 B;  1S5G Y;  1LA3 A;  2BCA A;  2M7L A;  1DJX A;  1OOG A;  1QXP A;  2O60 A;  3SG2 A;  2WCL A;  4MEW A;  3V2L A;  4AQI A;  1DJZ A;  1YUR A;  2OS8 B;  4YI8 A;  1CNP A;  1LIN A;  3D78 A;  5HYD A;  2ZKM X;  3CTN A;  4PE7 A;  1TIZ A;  1UUS A;  2GV5 A;  2Y1M A;  4M2P A;  5DKR A;  1OOF A;  1A2X A;  1NX3 A;  2MAZ A;  2LAN A;  2ZFD A;  1YRU B;  2PAS A;  3AAK A;  2OS8 C;  1BOC A;  3PFV A;  1WDC B;  4GUK A;  3TUY B;  1DJH A;  2WC5 A;  1KK8 B;  2L51 A;  4PE0 A;  3B7A A;  2KSP A;  4XJK B;  1MQ1 A;  2MBX A;  1OOH A;  1K8U A;  2PRU A;  1EJ3 A;  1WDC C;  4MZK A;  1YUT A;  2JU0 A;  3TUY C;  1SPY A;  1K9K A;  1XVJ A;  1KK8 C;  2LC5 A;  1MXL C;  5FYX A;  3UNW A;  2WND A;  1CLL A;  5BPJ A;  1QAT A;  1SMG A;  1DJI A;  1SR6 B;  3D74 A;  1GJY A;  1W9Z A;  2V53 A;  3NSI A;  4P2Y B;  3B87 A;  3SJS A;  1ZOT B;  2LLT A;  2NXQ A;  4FQT A;  2H61 A;  5HL1 A;  5AXI A;  1C07 A;  3GOF A;  3SG7 A;  2F33 A;  1LS8 A;  4GGF A;  1DGV A;  1J7O A;  2JNF A;  1FBV A;  3CR2 A;  3EKJ A;  1JFK A;  3Q8I A;  1UUR A;  1KFU L;  1SR6 C;  1TNX A;  1DJY A;  3BYA A;  5D7F A;  4E68 A;  1K2H A;  1F71 A;  1BMO A;  4C0K A;  2G2B A;  4MZJ A;  1B1G A;  2LMT A;  2SAS A;  3O6B A;  1G4Y R;  2PQL A;  1KK7 Y;  1OZO A;  4OKH A;  1AK8 A;  1V1F A;  4PHM A;  1A4P A;  2KAX A;  3S0D A;  4JKT A;  4HRE E;  2ISD A;  1CDP A;  2K7D A;  2LHL A;  3BFA A;  2CTN A;  2WCK A;  1CFF A;  1H4B A;  3SS4 A;  1WLM A;  2WOR A;  4GNK B;  2QDI A;  2M1U A;  4PT1 A;  5GQQ C;  1WLZ A;  1BU3 A;  2JZI A;  1RWY A;  3QRX A;  2WCF A;  4NDD A;  3KO0 A;  5HLO A;  2CNP A;  2M29 A;  4NDB A;  1QVI Y;  3I5F B;  3NSL A;  3I5I C;  1NCY A;  5AEQ A;  1U5I A;  2BNX A;  2AMI A;  3EKH A;  4JWQ A;  1B8C A;  3CYZ A;  4PAL A;  3SG4 A;  1SRA A;  1TN4 A;  1B7T Y;  4F7F A;  3EVU A;  3NSK A;  4OZD A;  3L4A A;  3TDI A;  1DTL A;  1BJF A;  2LE9 B;  3D0Y A;  1GQM A;  1KWO C;  1AUI B;  1F54 A;  3R1O A;  4HRG A;  3WXA A;  4CLN A;  1AP4 A;  1CM4 A;  1DJG A;  1QTX A;  2FOT A;  2Q91 A;  3NHI A;  5EL2 A;  5DKN A;  4MLW A;  4PHJ A;  1Z4H A;  2HF5 A;  1XFU O;  1F55 A;  1CM1 A;  5I2Q A;  1F4O A;  5KU1 A;  1S3P A;  1YUS A; 
#chains in the Genus database with same CATH homology
 1OZS A;  1YRT B;  3F45 A;  1AHR A;  4I5N B;  4YI9 A;  3JTD B;  1N2D A;  1YVH A;  1D1O A;  1IJ5 A;  4GAO A;  3VRR A;  2KFF A;  5PAL A;  2Y4Q A;  2F3Y A;  2BBM A;  1AJ4 A;  1ODB A;  2LMV A;  2LVI A;  2KBI A;  3JTD C;  1UHH A;  3NXA A;  1FF1 A;  1R6P A;  1CDN A;  1NYA A;  2JTZ A;  1EL4 A;  1QAS A;  4BY4 A;  2IS9 A;  1RFJ A;  4YBH B;  3EVR A;  5J3X A;  4YRU A;  1YX7 A;  1SK6 D;  2DOQ A;  4MRX A;  3DF0 B;  4MVF A;  1FW4 A;  2MHH A;  5KSZ A;  1CFD A;  2JT8 A;  2KI6 D;  1C7W A;  3OHM B;  4WQ2 A;  3PAT A;  1SL9 A;  2CBL A;  1DF0 B;  5JOL A;  1CLB A;  3BUN B;  2KFH A;  1PRW A;  1NWD A;  3BUM B;  1TNW A;  3LCP C;  3SG6 A;  1MHO A;  3MSE B;  2SCP A;  3PN7 C;  5D69 A;  3IQQ A;  1N0Y A;  3VRO A;  1S5G Z;  2HPS A;  1PSR A;  3PLF B;  3CZT X;  2KYC A;  3PAL A;  5CPV A;  5I2L A;  1S6C A;  2H2K A;  5I2O A;  3SG5 A;  1SNL A;  2JQ6 A;  4YGB B;  1IH0 A;  3VRQ A;  2EHB A;  2LP2 A;  1EXR A;  2ZRS A;  1J7R A;  2KHN A;  2CT9 A;  5IBW A;  1M46 A;  3AKB A;  3E3R A;  2KFG A;  3FWC A;  4DRW A;  1SCV A;  3BUX B;  1EG4 A;  1S1E A;  1YR5 A;  1SYM A;  4JQ0 D;  2NZ0 A;  1XO5 A;  1SL8 A;  1CFC A;  3WHT B;  2KQ6 A;  2ZN8 A;  4MSP A;  4CID A;  5KTY A;  5JJG A;  2LVV A;  2LMU A;  4MN0 A;  2BCX A;  3LLE A;  4OVN F;  2LNK A;  4ICB A;  3GK4 X;  1EH2 A;  4XYN A;  5HKW A;  2GGZ A;  2K7O A;  1YTZ C;  2HET A;  3RM1 A;  4QJ5 B;  1V1G A;  5HLV A;  1OMD A;  2K2F A;  4I5K A;  2QPT A;  4I5J A;  2RGI A;  3BUW B;  1IWQ A;  1JF0 A;  3M0W A;  1JF2 A;  1L2O B;  5AFP A;  4MBE A;  4QJ4 B;  4GGN A;  1IKU A;  1SKT A;  2L50 A;  4QJ3 B;  1KK7 Z;  2EC6 B;  3FS7 A;  1MF8 B;  1QJT A;  1QV1 A;  2KAV A;  1L2O C;  1IRJ A;  3OX6 A;  5HKY A;  1ZFS A;  1SL7 A;  1DT7 B;  2EC6 C;  1XFW O;  3ICB A;  1F70 A;  3OX5 A;  3RLZ A;  1Q80 A;  4TNC A;  5HKZ A;  3OP0 A;  1IQ3 A;  2KGR A;  2D8N A;  3I5I B;  1F8H A;  1GGZ A;  1LXF C;  3EK4 A;  2F2P A;  3A8R A;  1SW8 A;  2M9G A;  4L9M A;  4ZCV A;  3KHE A;  5TNC A;  4JPZ B;  1B7T Z;  2JT0 A;  4F0Z B;  1A75 B;  2O5G A;  4A4B A;  4A4C A;  1N65 A;  1HQV A;  1NSH A;  1KWO B;  1KCY A;  1IQ5 A;  1BG1 A;  2AAO A;  2K7B A;  3VRP A;  1JC2 A;  2H61 C;  2OTG B;  3CGA A;  4GGF C;  4PHK A;  4USL A;  2M7N A;  5ER5 A;  2ZND A;  4YGA A;  1PAL A;  2NLN A;  3BQ3 A;  2AUC A;  2JC2 A;  4YGD B;  1XA5 A;  1BR1 B;  2MJW B;  2OTG C;  1FI5 A;  1CDL A;  1J1D A;  5F6T A;  2BKH B;  1S36 A;  2BBN A;  3WHU B;  4CPV A;  1RK9 A;  1TTX A;  4OR9 B;  1BOD A;  3WNX B;  1B4C A;  1S6J A;  2MRD A;  1PVB A;  1Y0V H;  1AJ5 A;  2JUL A;  2F2O A;  3KPX A;  1BR4 B;  1UHK A;  1KFX S;  3DVE A;  3I5H B;  1PSB A;  1U5I B;  1J55 A;  2PVB A;  3LK1 A;  2HQ8 A;  1NPQ A;  2Y5I A;  4HRH A;  1WY9 A;  1A29 A;  1E8A A;  1WRZ A;  3LL8 B;  4N1G A;  2L0P A;  1Y1X A;  4WQ3 A;  2JWW A;  3D0Y B;  3I5H C;  1CMF A;  1CKK A;  3CS1 A;  1QLK A;  2M3W A;  2ZNE A;  4HSZ A;  3CR5 X;  1HT9 A;  1ZAC A;  2JTT A;  1UHI A;  3EK7 A;  1BT6 A;  2L2E A;  3DVK A;  4ORB B;  4BY5 A;  1J7Q A;  2NCP A;  1B8R A;  2JOJ A;  1TRF A;  1FPW A;  2Y1N A;  3ZNI A;  2OPO A;  4DUQ A;  3PN7 B;  1XFV O;  2F8P A;  3NSO A;  1PVA A;  2L5X B;  4AOM A;  4I5L B;  1OMV A;  3TS5 B;  3BOW A;  2FJU B;  2LHI A;  4WRI A;  2LLU A;  2JXC A;  1KQV A;  2LM5 A;  1WRK A;  4MRY A;  2FCE A;  2KI4 B;  4AQJ A;  1LVC D;  1M39 A;  3TS5 C;  2B1U A;  2LUX A;  1ALW A;  2JPT A;  3AKA A;  1K9P A;  1TNQ A;  2KI4 C;  1Y1A A;  2KQY A;  3I5G B;  1WRL A;  3TDZ A;  5I8N A;  2I7A A;  3VGO A;  1K96 A;  3O2P A;  1Y1U A;  1M63 B;  3CR4 X;  4DCK A;  1OE9 B;  2JT3 A;  4N5X A;  1QX7 A;  1XK4 A;  3I5G C;  3C1V A;  4XJK A;  1MUX A;  4DIR A;  1K90 D;  1XFY O;  1SCM B;  4MZL A;  1K95 A;  4ZCU A;  1KQM B;  1KFX L;  2ZN9 A;  5CSI A;  3O78 A;  2NCO A;  1OMR A;  1TCF A;  4PE4 A;  1M31 A;  1QLS A;  1JBA A;  1KSO A;  1MR8 A;  1M45 A;  4FTG A;  2F3Z A;  2QAC A;  1QIW A;  1SCM C;  4PE1 A;  2MLE C;  1OSA A;  1KQM C;  2I94 A;  2K7C A;  1QS7 A;  2K8M B;  4YGC B;  1MWN A;  4NQG A;  4C0L A;  1YX8 A;  2L4H A;  5AER A;  3JVT B;  1K93 D;  1YVL A;  4DS7 A;  1AVS A;  1A03 A;  4U8D A;  1DVI A;  3HX4 A;  1G8I A;  3IF7 A;  1JWD A;  2BEC A;  1NIW A;  1OOJ A;  1C7V A;  1NUB A;  3JVT C;  2Q4U A;  2JXL A;  1PK0 D;  1R2U A;  1F4Q A;  1H8B A;  1NCX A;  3GK1 A;  3BUO B;  1MXE A;  2KI6 C;  2BE4 A;  3D10 A;  2M8U A;  5G08 A;  3H4S E;  1SY9 A;  3AAJ A;  1W7I B;  2LVK A;  1XK4 C;  4OV2 A;  2EGD A;  4N1F A;  1UWO A;  1A75 A;  2GGM A;  1QVI Z;  1QIV A;  1DMO A;  3GK2 A;  2A4J A;  2K61 A;  1TOP A;  1CTR A;  3FIA A;  1BF5 A;  3CWG A;  3SIA A;  1CMG A;  2G9B A;  2LV7 A;  4ETO A;  1LKJ A;  2M0R A;  2R2I A;  4IL1 A;  2KYF A;  1UP5 A;  2PMY A;  1FI6 A;  1IJ6 A;  4PCW A;  5CSF A;  3SIB A;  1IGV A;  4M2Q A;  1NCZ A;  1XFX O;  4PHN A;  4GPL B;  3KF9 A;  2VRG A;  2JRF A;  1ALV A;  2LVJ A;  2TN4 A;  1CDM A;  2PAL A;  4CFR A;  3CLN A;  1L7Z A;  1JUO A;  3KEV A;  3PM8 A;  4GFT A;  1KSM A;  1B9A A;  1XYD A;  4GBA A;  1JSA A;  2LLS A;  2HQW A;  2JNX A;  3SG3 A;  1TCO B;  5B8I B;  3A4U B;  3DVJ A;  1ZUZ A;  1Y6W A;  2P6B B;  3I5F C;  1JFJ A;  2KAY A;  2E30 A;  2WCB A;  3EK8 A;  1W7J B;  1RTP 1;  1LA0 A;  1OQP A;  5CSN A;  4CFQ A;  3TZ1 A;  3DD4 A;  3DF0 A;  2BKI B;  3VRN A;  2LCP A;  1CLM A;  2KGB C;  4P5O E;  4FQO A;  1NX1 A;  2KOT A;  1UHJ A;  4Q04 A;  1DF0 A;  1VRK A;  3DVM A;  4R1E A;  1DJW A;  1XFZ O;  2WOS A;  1SBJ A;  1J7P A;  2KBM A;  5K89 A;  2KNE A;  1QV0 A;  2COL B;  1DGU A;  4NDC A;  2ZRT A;  1B47 A;  1RRO A;  1QX5 B;  3BXK A;  2L4I A;  2CXJ A;  3ZWH A;  3LK0 A;  2CCM A;  2MA2 A;  1QX2 A;  2L98 A;  3FWB A;  1CB1 A;  4UPG A;  1TNP A;  1NX2 A;  5CSJ A;  2FCD A;  4PDZ A;  5ER4 X;  2I2R E;  4OCI A;  4ORC B;  5DKQ A;  1G33 A;  1B8L A;  1EG3 A;  2K0J A;  1K9U A;  1NX0 A;  2MLF C;  1NP8 A;  2K2A A;  3TDU A;  1S6I A;  2BCB A;  1REC A;  2I18 A;  2M97 A;  3IQO A;  4YGE B;  1RJV A;  1UHN A;  3PSR A;  1J1E A;  1KFU S;  2E6W A;  2M1K B;  3EVV A;  1CFP A;  1ZMZ A;  2LAP A;  4C0J A;  1S26 D;  2BE6 A;  2BL0 B;  2PSR A;  5AAN A;  4M2O A;  2KDH A;  2WC8 A;  1BLQ A;  1IG5 A;  1YUU A;  2M49 B;  1K94 A;  3O4Y A;  4D1E A;  2BL0 C;  2WCE A;  3BOW B;  4ORA B;  2LP3 A;  1X02 A;  1PUL A;  1GGW A;  3K21 A;  3OB1 B;  3HCM A;  2LUC A;  3OB2 B;  1S5G Y;  1LA3 A;  2BCA A;  2M7L A;  1DJX A;  1QXP A;  2O60 A;  3SG2 A;  4MEW A;  4AQI A;  1DJZ A;  1YUR A;  2OS8 B;  4YI8 A;  1CNP A;  1LIN A;  5HYD A;  2ZKM X;  3CTN A;  4PE7 A;  1TIZ A;  1UUS A;  2GV5 A;  2Y1M A;  4M2P A;  5DKR A;  1A2X A;  1NX3 A;  2MAZ A;  2LAN A;  2ZFD A;  1YRU B;  2PAS A;  3AAK A;  2OS8 C;  1BOC A;  3PFV A;  1WDC B;  4GUK A;  3TUY B;  1DJH A;  1KK8 B;  2L51 A;  4PE0 A;  2KSP A;  4XJK B;  1MQ1 A;  2MBX A;  1K8U A;  2PRU A;  1EJ3 A;  1WDC C;  4MZK A;  1YUT A;  2JU0 A;  3TUY C;  1SPY A;  1K9K A;  1XVJ A;  1KK8 C;  2LC5 A;  1MXL C;  5FYX A;  2WND A;  1CLL A;  5BPJ A;  1QAT A;  1SMG A;  1DJI A;  1SR6 B;  3NSI A;  1GJY A;  3SJS A;  2V53 A;  4P2Y B;  1ZOT B;  2LLT A;  2NXQ A;  2H61 A;  5AXI A;  1C07 A;  3GOF A;  3SG7 A;  2F33 A;  4GGF A;  1DGV A;  1J7O A;  2JNF A;  1FBV A;  3CR2 A;  3EKJ A;  1JFK A;  4E68 A;  1UUR A;  1KFU L;  1SR6 C;  1TNX A;  1DJY A;  3BYA A;  5D7F A;  1K2H A;  1F71 A;  1BMO A;  4C0K A;  2G2B A;  4MZJ A;  1B1G A;  2LMT A;  2SAS A;  3O6B A;  1G4Y R;  1KK7 Y;  1OZO A;  4OKH A;  1AK8 A;  1V1F A;  4PHM A;  1A4P A;  2KAX A;  4HRE E;  2ISD A;  1CDP A;  2K7D A;  2LHL A;  2CTN A;  1H4B A;  1CFF A;  1WLM A;  2WOR A;  4GNK B;  2M1U A;  5GQQ C;  1WLZ A;  1BU3 A;  2JZI A;  1RWY A;  3QRX A;  2WCF A;  4NDD A;  3KO0 A;  5HLO A;  2CNP A;  2M29 A;  4NDB A;  1QVI Y;  3I5F B;  3NSL A;  3I5I C;  1NCY A;  5AEQ A;  1U5I A;  2AMI A;  3EKH A;  4JWQ A;  1B8C A;  4PAL A;  3SG4 A;  1SRA A;  1TN4 A;  1B7T Y;  3EVU A;  3NSK A;  3TDI A;  1DTL A;  1BJF A;  2LE9 B;  3D0Y A;  1GQM A;  1KWO C;  1AUI B;  1F54 A;  4HRG A;  3WXA A;  4CLN A;  1AP4 A;  1CM4 A;  1DJG A;  1QTX A;  2FOT A;  2Q91 A;  5DKN A;  4MLW A;  4PHJ A;  2HF5 A;  1XFU O;  1F55 A;  1CM1 A;  5I2Q A;  1F4O A;  5KU1 A;  1S3P A;  1YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...