4USLA

The x-ray structure of calcium bound human sorcin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
AFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
pubmed doi rcsb
molecule keywords SORCIN
source organism Homo sapiens
molecule tags Metal binding protein
total genus 63
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4uslA00
2M1KB 1R6PA 4WRIA 1W7IB 2F3ZA 1N2DA 2ZRTA 2H2KA 3KO0A 1IRJA 1QJTA 4AQJA 3O78A 1AP4A 4MZJA 1EL4A 4FTGA 4MLWA 2K7CA 1J1DA 4GFTA 5HLOA 1H8BA 4I5JA 3LCPC 3VGOA 1M63B 1S5GY 1MF8B 1B9AA 2LM5A 1NCXA 3F45A 2OTGB 2FOTA 3I5FB 3NSOA 4U8DA 1MHOA 4NDBA 1CB1A 2IS9A 2F2OA 1YRTB 1U5IA 3SIBA 3VROA 2EC6B 1LXFC 2KGBC 5CSJA 2L2EA 1JC2A 2JTTA 1F71A 2KI4C 2LV7A 1WRKA 2CCMA 4ICBA 2K0JA 4N1FA 1OMDA 2Y5IA 4A4CA 1TRFA 1OSAA 1RECA 1A29A 3BUXB 1S36A 2LVVA 4JQ0D 1IJ6A 4OV2A 3DVKA 2EHBA 4XJKA 5I8NA 1EG4A 2JXLA 2K8MB 3MSEB 2KDHA 3SG4A 3EKJA 1BOCA 5J3XA 2BL0C 1G8IA 1KQMB 4P5OE 1WY9A 1FI5A 2BE4A 2KFGA 2JZIA 2MLEC 2JOJA 4MRXA 1XO5A 2JTZA 1A4PA 2KGRA 5HKYA 5I2LA 1J7QA 2WC8A 5CPVA 1KQVA 3JVTC 1K95A 4CPVA 2M9GA 2KI6C 1B7TY 2M1UA 1YR5A 1IH0A 1S3PA 1DJHA 1KWOC 1KK8C 2JPTA 2P6BB 1DT7B 1QX7A 1IQ3A 3I5HC 1AUIB 4Q04A 1XFYO 3CTNA 1U5IB 3EK7A 5HLVA 3VRRA 2B1UA 1SR6C 1TIZA 3ZWHA 3LK1A 4GBAA 1QIVA 1DJYA 3TS5B 2I94A 1WLZA 1SW8A 2CT9A 5TNCA 3K21A 1ZACA 1N0YA 1DJXA 2BCBA 2NLNA 4XJKB 1DGVA 2CXJA 2KHNA 2MA2A 1FW4A 4N5XA 1KFXS 1RJVA 4I5KA 4PHJA 2JQ6A 1CFDA 2LCPA 5F6TA 4C0KA 1NCZA 1CLLA 3TUYB 1DJZA 3NSIA 3D10A 4M2OA 1UWOA 4MRYA 5HKWA 3BUOB 2Q4UA 2O60A 3CLNA 1FBVA 2WCEA 3SG6A 3O2PA 1BODA 1DGUA 5AANA 2BCXA 1BG1A 4OCIA 2LMTA 2I18A 4YRUA 1RK9A 3TDZA 4A4BA 2ZNDA 5AFPA 1KK7Y 1SCMC 2I7AA 1EJ3A 2WOSA 1CDLA 3PN7C 1KFUL 2LVJA 2PSRA 1CKKA 1XYDA 2LP3A 2LHLA 2LLSA 2K2AA 1SNLA 1NCYA 3SIAA 4D1EA 5KU1A 4CFQA 2LMVA 2JU0A 4MBEA 4MVFA 4AQIA 2WNDA 1A03A 3O4YA 5AXIA 1ODBA 2AMIA 2Y4QA 4DIRA 1CFPA 2ISDA 3GK2A 2KBIA 2M97A 1NSHA 2JT3A 3PSRA 2VRGA 3NSLA 1XK4C 1S6IA 2L0PA 5FYXA 3TZ1A 5I2QA 1F4OA 1XA5A 2K61A 4MSPA 4M2QA 1V1GA 3FWCA 1S26D 2LC5A 3BUMB 1DJIA 1WRLA 1CTRA 3IF7A 1MUXA 3OX5A 1K93D 2QPTA 1UP5A 1GGZA 1G4YR 3FS7A 1F8HA 1CDMA 2JNXA 1FI6A 1XFWO 1GQMA 1KFXL 2BCAA 2KI4B 1TNXA 3EK4A 3OX6A 3SG3A 1SBJA 1H4BA 3OB2B 2KI6D 2OPOA 4L9MA 1MWNA 4USLA 3CS1A 1W7JB 4QJ3B 2ZFDA 2BBNA 2MAZA 1S5GZ 3AAJA 1OOJA 2BL0B 1B8LA 1VRKA 3OHMB 4PHMA 1IQ5A 1NX2A 1GJYA 2NCOA 5CSFA 1AJ5A 1SYMA 1NP8A 1V1FA 3LK0A 5CSIA 1TNWA 1LKJA 2M8UA 2HF5A 3D0YB 4AOMA 1Y1AA 4I5LB 4YGBB 4YGEB 2LNKA 3JVTB 1QIWA 1TTXA 1TNPA 3WHTB 3HX4A 1YURA 3SJSA 3QRXA 3PALA 2TN4A 1KWOB 1ZFSA 2L4HA 1KK8B 1JBAA 2GV5A 1SK6D 1WDCC 3ZNIA 2O5GA 2F2PA 3EKHA 3I5HB 1K90D 2L98A 1CFCA 4F0ZB 1N65A 4TNCA 5KSZA 1CFFA 3E3RA 1M39A 3CZTX 1XFZO 3EK8A 4PE7A 3LLEA 1SR6B 3CGAA 3H4SE 1KFUS 1K9UA 1S1EA 1TCFA 1NX0A 2LMUA 4YGDB 3M0WA 1HQVA 4YI8A 1UHKA 4YGCB 2L51A 2E30A 5D7FA 4PCWA 1NYAA 2NZ0A 2R2IA 1SPYA 4ORAB 4ZCUA 1CMGA 3AKAA 1J7RA 1Y0VH 5JOLA 4CIDA 1XK4A 1B7TZ 1AJ4A 2MBXA 1M31A 4ORCB 4YI9A 3KHEA 1QS7A 2NCPA 1B8CA 1SY9A 3WXAA 4P2YB 2BKIB 1TOPA 2JWWA 4NDDA 2LANA 5KTYA 1K96A 2LVIA 3KPXA 2V53A 4JPZB 1SL8A 5GQQC 5AERA 2F8PA 1JF0A 5BPJA 1MXEA 4BY5A 4DS7A 4WQ3A 1YTZC 1BR4B 1B4CA 1B8RA 2PALA 2ZNEA 2M49B 2M7NA 1HT9A 2M29A 1QX5B 3JTDC 1SCMB 4ETOA 3PN7B 5CSNA 5G08A 4GGFC 1K2HA 5B8IB 4HRGA 2KYCA 1CDNA 2KNEA 1B47A 2F3YA 2MRDA 1JFJA 3OP0A 1OZOA 1QTXA 3CR4X 2WCFA 4MN0A 4OKHA 2G9BA 1L7ZA 1QVIY 2SASA 2OS8C 1B1GA 2HQ8A 2SCPA 2KFHA 2HPSA 1EXRA 2BECA 2PVBA 1DF0A 1BU3A 1QV0A 1Y1XA 2KAYA 4IL1A 4XYNA 1BT6A 5JJGA 2MHHA 1J7PA 4MZLA 4WQ2A 1IG5A 1XFXO 4M2PA 2LUXA 4NQGA 3TDUA 3PFVA 1BF5A 5PALA 4FQOA 1YUTA 3I5IC 2KQYA 2L5XB 4PE0A 1NUBA 2K2FA 2ZN9A 5HKZA 2K7OA 3FWBA 1CLMA 3BOWA 1SCVA 1AVSA 3NXAA 3OB1B 1PSRA 2CBLA 1M45A 1AHRA 1BMOA 2MJWB 2NXQA 2MLFC 1NWDA 2M7LA 1SRAA 1BR1B 3EVRA 1UHJA 4N1GA 2ZKMX 4ZCVA 3EVVA 1YVLA 2G2BA 2JRFA 3A8RA 3DF0A 1JSAA 3CR2A 1YRUB 3I5GC 2FCEA 4DUQA 3HCMA 1KCYA 1CNPA 2KSPA 4GNKB 5DKRA 1F4QA 2D8NA 3O6BA 1DTLA 1SKTA 4PE4A 2BKHB 1J55A 1S6CA 2KAVA 2PRUA 1DJGA 1NX3A 4E68A 1CMFA 3EVUA 1DF0B 4HREE 3IQOA 1SL9A 1A75A 2EGDA 4OVNF 2L4IA 1IJ5A 2Y1NA 3DVEA 1WDCB 4I5NB 1L2OC 1QXPA 4OR9B 4C0LA 4UPGA 1Y6WA 2A4JA 4DCKA 4GGFA 5ER5A 1MXLC 2LP2A 1J7OA 1OMRA 4YGAA 1WRZA 1BLQA 1XFVO 3BUNB 1FF1A 1KSOA 5IBWA 3ICBA 2KQ6A 3DD4A 1A2XA 2KOTA 1DMOA 1CLBA 4MEWA 1SL7A 3BOWB 2LVKA 2M3WA 2KFFA 1NPQA 1YX8A 2JXCA 1YVHA 2BE6A 5K89A 1SMGA 2KYFA 2JT8A 1CM1A 1PSBA 4QJ5B 1TNQA 1K94A 1XVJA 1Q80A 3DF0B 4ORBB 4YBHB 3KF9A 1QX2A 4DRWA 3WHUB 1LA3A 3IQQA 3TDIA 1E8AA 1EG3A 1ZOTB 2LLUA 2OTGC 1X02A 3I5FC 2LAPA 1JFKA 2GGMA 4PDZA 1ALWA 3PATA 5DKNA 2Y1MA 1UHNA 1A75B 2JC2A 1C07A 1GGWA 2GGZA 2EC6C 3JTDB 2KBMA 2CTNA 1UUSA 1JUOA 2K7DA 1YUSA 2M0RA 4MZKA 1CDPA 1RTP1 2LE9B 4BY4A 1XFUO 2LUCA 2H61C 4GPLB 2LLTA 3CR5X 4PHNA 3LL8B 3NSKA 1RFJA 1M46A 1PVAA 1QATA 4HSZA 4HRHA 2OS8B 3VRQA 3SG5A 1KQMC 1YX7A 4NDCA 2BBMA 1C7WA 2AAOA 1NX1A 3DVJA 3BXKA 3GK1A 3SG2A 2DOQA 2K7BA 4QJ4B 1R2UA 1TN4A 1WLMA 4GAOA 3PM8A 1PULA 5AEQA 3DVMA 3SG7A 1PVBA 2FJUB 1F54A 1FPWA 1DJWA 3PLFB 1ZUZA 1PK0D 3AKBA 5ER4X 2PASA 3AAKA 3BUWB 3I5IB 4GUKA 2JNFA 2COLB 1K8UA 1PRWA 5HYDA 1KSMA 1AK8A 2LHIA 4CFRA 1QLKA 1F55A 1JF2A 3RLZA 1S6JA 1IKUA 3GOFA 1RWYA 1LINA 5DKQA 1MR8A 1QASA 1QVIZ 3C1VA 1NIWA 4PHKA 4PE1A 3WNXB 1LVCD 2WORA 2QACA 1IGVA 1TCOB 1ALVA 1KK7Z 4JWQA 3VRPA 2CNPA 2L50A 4CLNA 1IWQA 4PALA 3TS5C 3I5GB 2ZRSA 1C7VA 1G33A 1PALA 1CM4A 2F33A 1UURA 2E6WA 3BYAA 3GK4X 5I2OA 1OZSA 2KAXA 4R1EA 1MQ1A 2ZN8A 1RROA 5D69A 3A4UB 1EH2A 1F70A 1UHIA 1J1EA 2I2RE 2FCDA 2Q91A 3TUYC 3RM1A 2RGIA 2PMYA 2AUCA 1YUUA 1OE9B 2JULA 3BQ3A 3CWGA 3FIAA 1UHHA 3KEVA 1L2OB 1Y1UA 1D1OA 2HQWA 2HETA 1JWDA 4GGNA 1ZMZA 3D0YA 2JT0A 3VRNA 1QLSA 1OMVA 2WCBA 1QV1A 1DVIA 1K9KA 4C0JA 2H61A 1LA0A 1K9PA 1OQPA 1BJFA
chains in the Genus database with same CATH superfamily
2M1KB 2H8VA 1R6PA 4WRIA 1W7IB 2F3ZA 1N2DA 2ZRTA 2H2KA 3KO0A 3D78A 1IRJA 1QJTA 2WCLA 4AQJA 3O78A 1AP4A 4MZJA 1EL4A 4FTGA 4MLWA 2K7CA 1J1DA 4GFTA 5HLOA 1H8BA 4I5JA 4INXA 3LCPC 3VGOA 5EL2A 1M63B 1S5GY 1MF8B 1GM0A 1B9AA 2LM5A 1NCXA 3F45A 1IIOA 2OTGB 2FOTA 3CDNA 3I5FB 3NSOA 3CYZA 4U8DA 1MHOA 3R1VA 4NDBA 2IS9A 1CB1A 2F2OA 1YRTB 1U5IA 3SIBA 3D76A 3VROA 2EC6B 1C3YA 1LXFC 2KGBC 5CSJA 2L2EA 1JC2A 2JTTA 1F71A 2KI4C 2LV7A 1WRKA 2CCMA 4ICBA 4KYNA 2K0JA 2YGUA 4N1FA 1OMDA 2Y5IA 2BNXA 4A4CA 1TRFA 1OSAA 1RECA 1A29A 3BUXB 1S36A 2LVVA 4JQ0D 1IJ6A 4OV2A 3DVKA 2EHBA 4XJKA 5I8NA 1EG4A 2JXLA 2K8MB 3MSEB 2KDHA 3SS5A 3SG4A 3EKJA 1BOCA 5J3XA 2BL0C 3CZ1A 1G8IA 3UNWA 1KQMB 4P5OE 1WY9A 1FI5A 2BE4A 2KFGA 2JZIA 2MLEC 2JOJA 4MRXA 1XO5A 2JTZA 1A4PA 3PJIA 2KGRA 5HKYA 5I2LA 1J7QA 2WC8A 1C3ZA 2WC6A 5CPVA 1KQVA 3JVTC 1K95A 1Z4HA 4CPVA 2M9GA 2KI6C 1B7TY 2M1UA 1YR5A 1IH0A 1S3PA 1DJHA 1KWOC 4FQTA 1KK8C 2JPTA 2P6BB 1DT7B 1QX7A 1IQ3A 3I5HC 1AUIB 4Q04A 1XFYO 3CTNA 1U5IB 3EK7A 5HLVA 3VRRA 2B1UA 1XFRA 1SR6C 1TIZA 3ZWHA 1OOHA 3UO9A 3LK1A 4GBAA 1QIVA 1DJYA 3TS5B 2I94A 1WLZA 5FI2A 3B86A 1SW8A 2CT9A 5TNCA 3B87A 3K21A 1ZACA 1N0YA 1DJXA 2BCBA 2NLNA 2PQLA 1DGVA 2CXJA 1TWOA 2KHNA 1FW4A 2MA2A 2WCKA 2WCHA 4N5XA 1KFXS 1RJVA 4I5KA 4PHJA 2JQ6A 1CFDA 2LCPA 5F6TA 4C0KA 1NCZA 1CLLA 3TUYB 1DJZA 3NSIA 3D10A 4M2OA 1UWOA 4MRYA 5HKWA 3D75A 3BUOB 2Q4UA 4F7FA 2O60A 3CLNA 1FBVA 2WCEA 3SG6A 3O2PA 1BODA 1DGUA 5AANA 2BCXA 1BG1A 4OCIA 2LMTA 2I18A 4YRUA 1ORGA 1RK9A 3TDZA 4A4BA 2ZNDA 5AFPA 3S0AA 1KK7Y 1SCMC 2I7AA 1EJ3A 2WOSA 1CDLA 3PN7C 1KFUL 2LVJA 2PSRA 3NHTA 1XYDA 1CKKA 2LP3A 1TUJA 2LHLA 1DC1A 2LLSA 2K2AA 1SNLA 1NCYA 3SIAA 4D1EA 5KU1A 4CFQA 2LMVA 2JU0A 5FI6A 4MBEA 4MVFA 1SSEB 4AQIA 2WNDA 2QEVA 1OW4A 1A03A 3O4YA 5AXIA 1ODBA 2AMIA 2Y4QA 4DIRA 5HL1A 1CFPA 2ISDA 3GK2A 2KBIA 2M97A 1NSHA 3SS4A 2JT3A 3PSRA 2VRGA 2KPHA 1LS8A 1XK4C 1S6IA 2L0PA 3NSLA 5FYXA 3D74A 1F4OA 1XA5A 2K61A 3L4LA 4MSPA 3TZ1A 2ERBA 1V1GA 3FWCA 1S26D 3NGVA 2LC5A 1OOGA 4M2QA 3BUMB 1DJIA 1WRLA 3IVTA 1CTRA 2QEOA 3IF7A 1MUXA 3OX5A 1K93D 3B6XA 2QPTA 1UP5A 1GGZA 1G4YR 3FS7A 1F8HA 1CDMA 2JNXA 2L5YA 3DY9A 1OOFA 1FI6A 1XFWO 1GQMA 1KFXL 2BCAA 2KI4B 3OGNA 4INWA 1TNXA 3EK4A 3OX6A 3SG3A 1SBJA 1H4BA 3OB2B 2KI6D 2OPOA 3FE6A 4L9MA 4IJ7A 1MWNA 4USLA 3CS1A 1DEKA 1W7JB 4QJ3B 2L2CA 3FE9A 2ZFDA 4JD9A 3S0BA 2BBNA 2MAZA 1S5GZ 3AAJA 1OOJA 2BL0B 1B8LA 1VRKA 3OHMB 4PHMA 1IQ5A 1NX2A 1GJYA 2NCOA 5CSFA 1AJ5A 1SYMA 1NP8A 1V1FA 3LK0A 5CSIA 1TNWA 3D73A 1LKJA 2M8UA 2HF5A 3D0YB 4AOMA 1Y1AA 4I5LB 4YGBB 4YGEB 4OZDA 2LNKA 3JVTB 4PT1A 1QIWA 1TTXA 1TNPA 3WHTB 3HX4A 3BJHA 1YURA 3SJSA 3QRXA 3PALA 2TN4A 3NHIA 4XJKB 1KWOB 1Z2CB 1ZFSA 2L4HA 3L4AA 1KK8B 1DELA 1JBAA 2GV5A 1SK6D 1WDCC 3ZNIA 2O5GA 2F2PA 3EKHA 3I5HB 1K90D 2L98A 3R1OA 4F0ZB 1CFCA 1N65A 4TNCA 5KSZA 1CFFA 3E3RA 1M39A 3CZTX 1XFZO 3EK8A 4PE7A 3LLEA 1SR6B 3CGAA 3H4SE 1KFUS 1K9UA 1S1EA 1TCFA 3BFAA 1NX0A 2LMUA 4YGDB 3S0DA 3V2LA 3M0WA 1HQVA 4YI8A 1UHKA 4YGCB 2L51A 2E30A 5D7FA 3DZTA 4PCWA 1NYAA 2NZ0A 2R2IA 1SPYA 4ORAB 4ZCUA 1CMGA 3AKAA 1J7RA 1Y0VH 5JOLA 4CIDA 1XK4A 1B7TZ 1AJ4A 2MBXA 1M31A 4ORCB 4YI9A 3KHEA 1QS7A 2NCPA 1B8CA 1SY9A 3WXAA 4P2YB 2BKIB 1TOPA 2JWWA 4NDDA 2LANA 5KTYA 5FI7A 1K96A 2LVIA 3KPXA 2V53A 4JPZB 1SL8A 5GQQC 5AERA 2F8PA 1JF0A 5BPJA 1MXEA 4BY5A 4DS7A 4WQ3A 1YTZC 1BR4B 1B4CA 1B8RA 2PALA 2ZNEA 2M49B 2M7NA 1HT9A 2M29A 1QX5B 3B88A 3JTDC 1SCMB 4ETOA 3PN7B 3DXLA 5CSNA 5G08A 4GGFC 1K2HA 5B8IB 4HRGA 2KYCA 1CDNA 2KNEA 1B47A 3CZ0A 2F3YA 2MRDA 1JFJA 3OP0A 1OZOA 1QTXA 3CR4X 2WCFA 4MN0A 4OKHA 3SS3A 2G9BA 1L7ZA 1QVIY 2SASA 2OS8C 1B1GA 3D77A 2HQ8A 2SCPA 2KFHA 2HPSA 1EXRA 2BECA 2PVBA 1DF0A 2QEHA 3S0FA 1BU3A 1QV0A 1Y1XA 2KAYA 4IL1A 4XYNA 1BT6A 5JJGA 2MHHA 1J7PA 4MZLA 4WQ2A 1IG5A 1XFXO 2QDIA 2GTEA 2LUXA 4M2PA 3PFVA 4NQGA 3TDUA 1BF5A 3S0EA 5PALA 3N7HA 4FQOA 3BFHA 2WC5A 1YUTA 3I5IC 5DICA 2KQYA 2L5XB 4PE0A 1NUBA 2K2FA 2PYQA 2ZN9A 3OBVA 5HKZA 2K7OA 3BFBA 3FWBA 1CLMA 5D3OA 3BOWA 1SCVA 1AVSA 3NXAA 3OB1B 1PSRA 2CBLA 1M45A 1AHRA 1BMOA 2MJWB 2NXQA 2MLFC 1NWDA 2M7LA 1SRAA 1BR1B 3EVRA 1UHJA 4N1GA 2ZKMX 3FE8A 3EVVA 1YVLA 2G2BA 2JRFA 3A8RA 2FJYA 4ZCVA 3DF0A 1JSAA 3CR2A 4JKTA 1YRUB 3I5GC 2FCEA 4DUQA 3HCMA 5I2QA 1KCYA 3EG5B 2KSPA 1CNPA 4GNKB 3R72A 5DKRA 1F4QA 2D8NA 3O6BA 1TUZA 1DTLA 1SKTA 4PE4A 2BKHB 3PM2A 1J55A 1S6CA 2KAVA 2PRUA 1DJGA 1NX3A 4E68A 1CMFA 3EVUA 1DF0B 4HREE 3IQOA 1SL9A 1A75A 2EGDA 4OVNF 2L4IA 1IJ5A 2Y1NA 3DVEA 1WDCB 4I5NB 1L2OC 1QXPA 4OR9B 4C0LA 4UPGA 1Y6WA 2A4JA 4DCKA 4GGFA 5ER5A 1MXLC 2LP2A 1J7OA 1OMRA 4YGAA 1WRZA 3RZSA 1XFVO 3BUNB 1BLQA 1FF1A 1KSOA 5IBWA 1P28A 2KQ6A 3DD4A 1A2XA 2KOTA 3ICBA 1DMOA 1CLBA 4MEWA 1SL7A 3BOWB 2LVKA 2M3WA 2KFFA 1NPQA 1YX8A 2JXCA 1YVHA 3CABA 2BE6A 5K89A 1SMGA 2KYFA 2JT8A 3S0GA 2QEBA 1CM1A 3VB1A 1PSBA 4QJ5B 1TNQA 1K94A 1XVJA 1Q80A 3DF0B 4ORBB 4YBHB 2KLDA 3KF9A 1QX2A 4DRWA 3WHUB 1LA3A 3IQQA 3TDIA 1E8AA 3R1PA 1EG3A 1ZOTB 2LLUA 2OTGC 1X02A 2WCMA 3I5FC 2LAPA 1JFKA 2GGMA 4PDZA 1ALWA 3PATA 5DKNA 2Y1MA 1UHNA 1A75B 2JC2A 1C07A 1GGWA 2GGZA 2EC6C 3JTDB 2KBMA 2CTNA 1UUSA 1JUOA 2K7DA 1YUSA 2M0RA 4MZKA 1CDPA 1RTP1 2WCJA 2LE9B 4BY4A 2JPOA 1XFUO 3K1EA 2LUCA 2H61C 4GPLB 2LLTA 3CR5X 4PHNA 3LL8B 3NSKA 1RFJA 5I94A 1M46A 1PVAA 1QATA 4HSZA 4HRHA 2OS8B 3VRQA 3SG5A 1KQMC 1YX7A 4NDCA 2BBMA 1C7WA 2AAOA 1NX1A 3DVJA 3BXKA 3GK1A 3SG2A 2DOQA 2K7BA 4QJ4B 1R2UA 1TN4A 1WLMA 4GAOA 1QWVA 1OOIX 1PULA 3DVMA 3PM8A 1PVBA 2FJUB 5AEQA 3SG7A 1F54A 1FPWA 1DJWA 3PLFB 1ZUZA 1PK0D 2BAPA 3AKBA 2PASA 3AAKA 3BUWB 3DYEA 3I5IB 5ER4X 4GUKA 2JNFA 2COLB 2P70A 1K8UA 1PRWA 5HYDA 1KSMA 1AK8A 2LHIA 4CFRA 1QLKA 1F55A 1JF2A 1W9ZA 3L47A 3RLZA 1S6JA 1IKUA 3CZ2A 3GOFA 1RWYA 1LINA 5DKQA 1MR8A 1QASA 1QVIZ 3C1VA 1NIWA 4PHKA 4PE1A 3WNXB 1LVCD 2WORA 2QACA 1IGVA 1TCOB 1ALVA 1KK7Z 3O4XA 4JWQA 3VRPA 2CNPA 2L50A 4CLNA 1IWQA 1DQEA 4PALA 3TS5C 3I5GB 2ZRSA 1C7VA 1G33A 1PALA 1CM4A 2F33A 1UURA 2E6WA 3BYAA 3GK4X 5I2OA 1OZSA 2KLEA 2KAXA 3B7AA 4R1EA 1MQ1A 2ZN8A 1RROA 5D69A 3A4UB 1EH2A 1F70A 1UHIA 1J1EA 2I2RE 2FCDA 2P71A 2Q91A 1T14A 3TUYC 3RM1A 2RGIA 2PMYA 2AUCA 1YUUA 1OE9B 2JULA 3BQ3A 3CWGA 3FIAA 2K60A 1UHHA 3KEVA 1L2OB 1Y1UA 1D1OA 2HQWA 2HETA 1JWDA 4GGNA 1ZMZA 3D0YA 2JT0A 3VRNA 1QLSA 1OMVA 2WCBA 1QV1A 1DVIA 1K9KA 3Q8IA 4C0JA 3QMEA 2H61A 1LA0A 1K9PA 1OQPA 1BJFA
chains in the Genus database with same CATH topology
2M1KB 1R6PA 4WRIA 1W7IB 2F3ZA 1N2DA 2ZRTA 2H2KA 3KO0A 1IRJA 1QJTA 4AQJA 3O78A 1AP4A 4MZJA 1EL4A 4FTGA 4MLWA 2K7CA 1J1DA 4GFTA 5HLOA 1H8BA 4I5JA 3LCPC 3VGOA 1M63B 1S5GY 1MF8B 1B9AA 2LM5A 1NCXA 3F45A 2OTGB 2FOTA 3I5FB 3NSOA 4U8DA 1MHOA 4NDBA 1CB1A 2IS9A 2F2OA 1YRTB 1U5IA 3SIBA 3VROA 2EC6B 1LXFC 2KGBC 5CSJA 2L2EA 1JC2A 2JTTA 1F71A 2KI4C 2LV7A 1WRKA 2CCMA 4ICBA 2K0JA 4N1FA 1OMDA 2Y5IA 4A4CA 1TRFA 1OSAA 1RECA 1A29A 3BUXB 1S36A 2LVVA 4JQ0D 1IJ6A 4OV2A 3DVKA 2EHBA 4XJKA 5I8NA 1EG4A 2JXLA 2K8MB 3MSEB 2KDHA 3SG4A 3EKJA 1BOCA 5J3XA 2BL0C 1G8IA 1KQMB 4P5OE 1WY9A 1FI5A 2BE4A 2KFGA 2JZIA 2MLEC 2JOJA 4MRXA 1XO5A 2JTZA 1A4PA 2KGRA 5HKYA 5I2LA 1J7QA 2WC8A 5CPVA 1KQVA 3JVTC 1K95A 4CPVA 2M9GA 2KI6C 1B7TY 2M1UA 1YR5A 1IH0A 1S3PA 1DJHA 1KWOC 1KK8C 2JPTA 2P6BB 1DT7B 1QX7A 1IQ3A 3I5HC 1AUIB 4Q04A 1XFYO 3CTNA 1U5IB 3EK7A 5HLVA 3VRRA 2B1UA 1SR6C 1TIZA 3ZWHA 3LK1A 4GBAA 1QIVA 1DJYA 3TS5B 2I94A 1WLZA 1SW8A 2CT9A 5TNCA 3K21A 1ZACA 1N0YA 1DJXA 2BCBA 2NLNA 4XJKB 1DGVA 2CXJA 2KHNA 2MA2A 1FW4A 4N5XA 1KFXS 1RJVA 4I5KA 4PHJA 2JQ6A 1CFDA 2LCPA 5F6TA 4C0KA 1NCZA 1CLLA 3TUYB 1DJZA 3NSIA 3D10A 4M2OA 1UWOA 4MRYA 5HKWA 3BUOB 2Q4UA 2O60A 3CLNA 1FBVA 2WCEA 3SG6A 3O2PA 1BODA 1DGUA 5AANA 2BCXA 1BG1A 4OCIA 2LMTA 2I18A 4YRUA 1RK9A 3TDZA 4A4BA 2ZNDA 5AFPA 1KK7Y 1SCMC 2I7AA 1EJ3A 2WOSA 1CDLA 3PN7C 1KFUL 2LVJA 2PSRA 1CKKA 1XYDA 2LP3A 2LHLA 2LLSA 2K2AA 1SNLA 1NCYA 3SIAA 4D1EA 5KU1A 4CFQA 2LMVA 2JU0A 4MBEA 4MVFA 4AQIA 2WNDA 1A03A 3O4YA 5AXIA 1ODBA 2AMIA 2Y4QA 4DIRA 1CFPA 2ISDA 3GK2A 2KBIA 2M97A 1NSHA 2JT3A 3PSRA 2VRGA 3NSLA 1XK4C 1S6IA 2L0PA 5FYXA 3TZ1A 5I2QA 1F4OA 1XA5A 2K61A 4MSPA 4M2QA 1V1GA 3FWCA 1S26D 2LC5A 3BUMB 1DJIA 1WRLA 1CTRA 3IF7A 1MUXA 3OX5A 1K93D 2QPTA 1UP5A 1GGZA 1G4YR 3FS7A 1F8HA 1CDMA 2JNXA 1FI6A 1XFWO 1GQMA 1KFXL 2BCAA 2KI4B 1TNXA 3EK4A 3OX6A 3SG3A 1SBJA 1H4BA 3OB2B 2KI6D 2OPOA 4L9MA 1MWNA 4USLA 3CS1A 1W7JB 4QJ3B 2ZFDA 2BBNA 2MAZA 1S5GZ 3AAJA 1OOJA 2BL0B 1B8LA 1VRKA 3OHMB 4PHMA 1IQ5A 1NX2A 1GJYA 2NCOA 5CSFA 1AJ5A 1SYMA 1NP8A 1V1FA 3LK0A 5CSIA 1TNWA 1LKJA 2M8UA 2HF5A 3D0YB 4AOMA 1Y1AA 4I5LB 4YGBB 4YGEB 2LNKA 3JVTB 1QIWA 1TTXA 1TNPA 3WHTB 3HX4A 1YURA 3SJSA 3QRXA 3PALA 2TN4A 1KWOB 1ZFSA 2L4HA 1KK8B 1JBAA 2GV5A 1SK6D 1WDCC 3ZNIA 2O5GA 2F2PA 3EKHA 3I5HB 1K90D 2L98A 1CFCA 4F0ZB 1N65A 4TNCA 5KSZA 1CFFA 3E3RA 1M39A 3CZTX 1XFZO 3EK8A 4PE7A 3LLEA 1SR6B 3CGAA 3H4SE 1KFUS 1K9UA 1S1EA 1TCFA 1NX0A 2LMUA 4YGDB 3M0WA 1HQVA 4YI8A 1UHKA 4YGCB 2L51A 2E30A 5D7FA 4PCWA 1NYAA 2NZ0A 2R2IA 1SPYA 4ORAB 4ZCUA 1CMGA 3AKAA 1J7RA 1Y0VH 5JOLA 4CIDA 1XK4A 1B7TZ 1AJ4A 2MBXA 1M31A 4ORCB 4YI9A 3KHEA 1QS7A 2NCPA 1B8CA 1SY9A 3WXAA 4P2YB 2BKIB 1TOPA 2JWWA 4NDDA 2LANA 5KTYA 1K96A 2LVIA 3KPXA 2V53A 4JPZB 1SL8A 5GQQC 5AERA 2F8PA 1JF0A 5BPJA 1MXEA 4BY5A 4DS7A 4WQ3A 1YTZC 1BR4B 1B4CA 1B8RA 2PALA 2ZNEA 2M49B 2M7NA 1HT9A 2M29A 1QX5B 3JTDC 1SCMB 4ETOA 3PN7B 5CSNA 5G08A 4GGFC 1K2HA 5B8IB 4HRGA 2KYCA 1CDNA 2KNEA 1B47A 2F3YA 2MRDA 1JFJA 3OP0A 1OZOA 1QTXA 3CR4X 2WCFA 4MN0A 4OKHA 2G9BA 1L7ZA 1QVIY 2SASA 2OS8C 1B1GA 2HQ8A 2SCPA 2KFHA 2HPSA 1EXRA 2BECA 2PVBA 1DF0A 1BU3A 1QV0A 1Y1XA 2KAYA 4IL1A 4XYNA 1BT6A 5JJGA 2MHHA 1J7PA 4MZLA 4WQ2A 1IG5A 1XFXO 4M2PA 2LUXA 4NQGA 3TDUA 3PFVA 1BF5A 5PALA 4FQOA 1YUTA 3I5IC 2KQYA 2L5XB 4PE0A 1NUBA 2K2FA 2ZN9A 5HKZA 2K7OA 3FWBA 1CLMA 3BOWA 1SCVA 1AVSA 3NXAA 3OB1B 1PSRA 2CBLA 1M45A 1AHRA 1BMOA 2MJWB 2NXQA 2MLFC 1NWDA 2M7LA 1SRAA 1BR1B 3EVRA 1UHJA 4N1GA 2ZKMX 4ZCVA 3EVVA 1YVLA 2G2BA 2JRFA 3A8RA 3DF0A 1JSAA 3CR2A 1YRUB 3I5GC 2FCEA 4DUQA 3HCMA 1KCYA 1CNPA 2KSPA 4GNKB 5DKRA 1F4QA 2D8NA 3O6BA 1DTLA 1SKTA 4PE4A 2BKHB 1J55A 1S6CA 2KAVA 2PRUA 1DJGA 1NX3A 4E68A 1CMFA 3EVUA 1DF0B 4HREE 3IQOA 1SL9A 1A75A 2EGDA 4OVNF 2L4IA 1IJ5A 2Y1NA 3DVEA 1WDCB 4I5NB 1L2OC 1QXPA 4OR9B 4C0LA 4UPGA 1Y6WA 2A4JA 4DCKA 4GGFA 5ER5A 1MXLC 2LP2A 1J7OA 1OMRA 4YGAA 1WRZA 1BLQA 1XFVO 3BUNB 1FF1A 1KSOA 5IBWA 3ICBA 2KQ6A 3DD4A 1A2XA 2KOTA 1DMOA 1CLBA 4MEWA 1SL7A 3BOWB 2LVKA 2M3WA 2KFFA 1NPQA 1YX8A 2JXCA 1YVHA 2BE6A 5K89A 1SMGA 2KYFA 2JT8A 1CM1A 1PSBA 4QJ5B 1TNQA 1K94A 1XVJA 1Q80A 3DF0B 4ORBB 4YBHB 3KF9A 1QX2A 4DRWA 3WHUB 1LA3A 3IQQA 3TDIA 1E8AA 1EG3A 1ZOTB 2LLUA 2OTGC 1X02A 3I5FC 2LAPA 1JFKA 2GGMA 4PDZA 1ALWA 3PATA 5DKNA 2Y1MA 1UHNA 1A75B 2JC2A 1C07A 1GGWA 2GGZA 2EC6C 3JTDB 2KBMA 2CTNA 1UUSA 1JUOA 2K7DA 1YUSA 2M0RA 4MZKA 1CDPA 1RTP1 2LE9B 4BY4A 1XFUO 2LUCA 2H61C 4GPLB 2LLTA 3CR5X 4PHNA 3LL8B 3NSKA 1RFJA 1M46A 1PVAA 1QATA 4HSZA 4HRHA 2OS8B 3VRQA 3SG5A 1KQMC 1YX7A 4NDCA 2BBMA 1C7WA 2AAOA 1NX1A 3DVJA 3BXKA 3GK1A 3SG2A 2DOQA 2K7BA 4QJ4B 1R2UA 1TN4A 1WLMA 4GAOA 3PM8A 1PULA 5AEQA 3DVMA 3SG7A 1PVBA 2FJUB 1F54A 1FPWA 1DJWA 3PLFB 1ZUZA 1PK0D 3AKBA 5ER4X 2PASA 3AAKA 3BUWB 3I5IB 4GUKA 2JNFA 2COLB 1K8UA 1PRWA 5HYDA 1KSMA 1AK8A 2LHIA 4CFRA 1QLKA 1F55A 1JF2A 3RLZA 1S6JA 1IKUA 3GOFA 1RWYA 1LINA 5DKQA 1MR8A 1QASA 1QVIZ 3C1VA 1NIWA 4PHKA 4PE1A 3WNXB 1LVCD 2WORA 2QACA 1IGVA 1TCOB 1ALVA 1KK7Z 4JWQA 3VRPA 2CNPA 2L50A 4CLNA 1IWQA 4PALA 3TS5C 3I5GB 2ZRSA 1C7VA 1G33A 1PALA 1CM4A 2F33A 1UURA 2E6WA 3BYAA 3GK4X 5I2OA 1OZSA 2KAXA 4R1EA 1MQ1A 2ZN8A 1RROA 5D69A 3A4UB 1EH2A 1F70A 1UHIA 1J1EA 2I2RE 2FCDA 2Q91A 3TUYC 3RM1A 2RGIA 2PMYA 2AUCA 1YUUA 1OE9B 2JULA 3BQ3A 3CWGA 3FIAA 1UHHA 3KEVA 1L2OB 1Y1UA 1D1OA 2HQWA 2HETA 1JWDA 4GGNA 1ZMZA 3D0YA 2JT0A 3VRNA 1QLSA 1OMVA 2WCBA 1QV1A 1DVIA 1K9KA 4C0JA 2H61A 1LA0A 1K9PA 1OQPA 1BJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1K B;  1R6P A;  4WRI A;  1W7I B;  2F3Z A;  1N2D A;  2ZRT A;  2H2K A;  3KO0 A;  1IRJ A;  1QJT A;  4AQJ A;  3O78 A;  1AP4 A;  4MZJ A;  1EL4 A;  4FTG A;  4MLW A;  2K7C A;  1J1D A;  4GFT A;  5HLO A;  1H8B A;  4I5J A;  3LCP C;  3VGO A;  1M63 B;  1S5G Y;  1MF8 B;  1B9A A;  2LM5 A;  1NCX A;  3F45 A;  2OTG B;  2FOT A;  3I5F B;  3NSO A;  4U8D A;  1MHO A;  4NDB A;  1CB1 A;  2IS9 A;  2F2O A;  1YRT B;  1U5I A;  3SIB A;  3VRO A;  2EC6 B;  1LXF C;  2KGB C;  5CSJ A;  2L2E A;  1JC2 A;  2JTT A;  1F71 A;  2KI4 C;  2LV7 A;  1WRK A;  2CCM A;  4ICB A;  2K0J A;  4N1F A;  1OMD A;  2Y5I A;  4A4C A;  1TRF A;  1OSA A;  1REC A;  1A29 A;  3BUX B;  1S36 A;  2LVV A;  4JQ0 D;  1IJ6 A;  4OV2 A;  3DVK A;  2EHB A;  4XJK A;  5I8N A;  1EG4 A;  2JXL A;  2K8M B;  3MSE B;  2KDH A;  3SG4 A;  3EKJ A;  1BOC A;  5J3X A;  2BL0 C;  1G8I A;  1KQM B;  4P5O E;  1WY9 A;  1FI5 A;  2BE4 A;  2KFG A;  2JZI A;  2MLE C;  2JOJ A;  4MRX A;  1XO5 A;  2JTZ A;  1A4P A;  2KGR A;  5HKY A;  5I2L A;  1J7Q A;  2WC8 A;  5CPV A;  1KQV A;  3JVT C;  1K95 A;  4CPV A;  2M9G A;  2KI6 C;  1B7T Y;  2M1U A;  1YR5 A;  1IH0 A;  1S3P A;  1DJH A;  1KWO C;  1KK8 C;  2JPT A;  2P6B B;  1DT7 B;  1QX7 A;  1IQ3 A;  3I5H C;  1AUI B;  4Q04 A;  1XFY O;  3CTN A;  1U5I B;  3EK7 A;  5HLV A;  3VRR A;  2B1U A;  1SR6 C;  1TIZ A;  3ZWH A;  3LK1 A;  4GBA A;  1QIV A;  1DJY A;  3TS5 B;  2I94 A;  1WLZ A;  1SW8 A;  2CT9 A;  5TNC A;  3K21 A;  1ZAC A;  1N0Y A;  1DJX A;  2BCB A;  2NLN A;  4XJK B;  1DGV A;  2CXJ A;  2KHN A;  2MA2 A;  1FW4 A;  4N5X A;  1KFX S;  1RJV A;  4I5K A;  4PHJ A;  2JQ6 A;  1CFD A;  2LCP A;  5F6T A;  4C0K A;  1NCZ A;  1CLL A;  3TUY B;  1DJZ A;  3NSI A;  3D10 A;  4M2O A;  1UWO A;  4MRY A;  5HKW A;  3BUO B;  2Q4U A;  2O60 A;  3CLN A;  1FBV A;  2WCE A;  3SG6 A;  3O2P A;  1BOD A;  1DGU A;  5AAN A;  2BCX A;  1BG1 A;  4OCI A;  2LMT A;  2I18 A;  4YRU A;  1RK9 A;  3TDZ A;  4A4B A;  2ZND A;  5AFP A;  1KK7 Y;  1SCM C;  2I7A A;  1EJ3 A;  2WOS A;  1CDL A;  3PN7 C;  1KFU L;  2LVJ A;  2PSR A;  1CKK A;  1XYD A;  2LP3 A;  2LHL A;  2LLS A;  2K2A A;  1SNL A;  1NCY A;  3SIA A;  4D1E A;  5KU1 A;  4CFQ A;  2LMV A;  2JU0 A;  4MBE A;  4MVF A;  4AQI A;  2WND A;  1A03 A;  3O4Y A;  5AXI A;  1ODB A;  2AMI A;  2Y4Q A;  4DIR A;  1CFP A;  2ISD A;  3GK2 A;  2KBI A;  2M97 A;  1NSH A;  2JT3 A;  3PSR A;  2VRG A;  3NSL A;  1XK4 C;  1S6I A;  2L0P A;  5FYX A;  3TZ1 A;  5I2Q A;  1F4O A;  1XA5 A;  2K61 A;  4MSP A;  4M2Q A;  1V1G A;  3FWC A;  1S26 D;  2LC5 A;  3BUM B;  1DJI A;  1WRL A;  1CTR A;  3IF7 A;  1MUX A;  3OX5 A;  1K93 D;  2QPT A;  1UP5 A;  1GGZ A;  1G4Y R;  3FS7 A;  1F8H A;  1CDM A;  2JNX A;  1FI6 A;  1XFW O;  1GQM A;  1KFX L;  2BCA A;  2KI4 B;  1TNX A;  3EK4 A;  3OX6 A;  3SG3 A;  1SBJ A;  1H4B A;  3OB2 B;  2KI6 D;  2OPO A;  4L9M A;  1MWN A;  4USL A;  3CS1 A;  1W7J B;  4QJ3 B;  2ZFD A;  2BBN A;  2MAZ A;  1S5G Z;  3AAJ A;  1OOJ A;  2BL0 B;  1B8L A;  1VRK A;  3OHM B;  4PHM A;  1IQ5 A;  1NX2 A;  1GJY A;  2NCO A;  5CSF A;  1AJ5 A;  1SYM A;  1NP8 A;  1V1F A;  3LK0 A;  5CSI A;  1TNW A;  1LKJ A;  2M8U A;  2HF5 A;  3D0Y B;  4AOM A;  1Y1A A;  4I5L B;  4YGB B;  4YGE B;  2LNK A;  3JVT B;  1QIW A;  1TTX A;  1TNP A;  3WHT B;  3HX4 A;  1YUR A;  3SJS A;  3QRX A;  3PAL A;  2TN4 A;  1KWO B;  1ZFS A;  2L4H A;  1KK8 B;  1JBA A;  2GV5 A;  1SK6 D;  1WDC C;  3ZNI A;  2O5G A;  2F2P A;  3EKH A;  3I5H B;  1K90 D;  2L98 A;  1CFC A;  4F0Z B;  1N65 A;  4TNC A;  5KSZ A;  1CFF A;  3E3R A;  1M39 A;  3CZT X;  1XFZ O;  3EK8 A;  4PE7 A;  3LLE A;  1SR6 B;  3CGA A;  3H4S E;  1KFU S;  1K9U A;  1S1E A;  1TCF A;  1NX0 A;  2LMU A;  4YGD B;  3M0W A;  1HQV A;  4YI8 A;  1UHK A;  4YGC B;  2L51 A;  2E30 A;  5D7F A;  4PCW A;  1NYA A;  2NZ0 A;  2R2I A;  1SPY A;  4ORA B;  4ZCU A;  1CMG A;  3AKA A;  1J7R A;  1Y0V H;  5JOL A;  4CID A;  1XK4 A;  1B7T Z;  1AJ4 A;  2MBX A;  1M31 A;  4ORC B;  4YI9 A;  3KHE A;  1QS7 A;  2NCP A;  1B8C A;  1SY9 A;  3WXA A;  4P2Y B;  2BKI B;  1TOP A;  2JWW A;  4NDD A;  2LAN A;  5KTY A;  1K96 A;  2LVI A;  3KPX A;  2V53 A;  4JPZ B;  1SL8 A;  5GQQ C;  5AER A;  2F8P A;  1JF0 A;  5BPJ A;  1MXE A;  4BY5 A;  4DS7 A;  4WQ3 A;  1YTZ C;  1BR4 B;  1B4C A;  1B8R A;  2PAL A;  2ZNE A;  2M49 B;  2M7N A;  1HT9 A;  2M29 A;  1QX5 B;  3JTD C;  1SCM B;  4ETO A;  3PN7 B;  5CSN A;  5G08 A;  4GGF C;  1K2H A;  5B8I B;  4HRG A;  2KYC A;  1CDN A;  2KNE A;  1B47 A;  2F3Y A;  2MRD A;  1JFJ A;  3OP0 A;  1OZO A;  1QTX A;  3CR4 X;  2WCF A;  4MN0 A;  4OKH A;  2G9B A;  1L7Z A;  1QVI Y;  2SAS A;  2OS8 C;  1B1G A;  2HQ8 A;  2SCP A;  2KFH A;  2HPS A;  1EXR A;  2BEC A;  2PVB A;  1DF0 A;  1BU3 A;  1QV0 A;  1Y1X A;  2KAY A;  4IL1 A;  4XYN A;  1BT6 A;  5JJG A;  2MHH A;  1J7P A;  4MZL A;  4WQ2 A;  1IG5 A;  1XFX O;  4M2P A;  2LUX A;  4NQG A;  3TDU A;  3PFV A;  1BF5 A;  5PAL A;  4FQO A;  1YUT A;  3I5I C;  2KQY A;  2L5X B;  4PE0 A;  1NUB A;  2K2F A;  2ZN9 A;  5HKZ A;  2K7O A;  3FWB A;  1CLM A;  3BOW A;  1SCV A;  1AVS A;  3NXA A;  3OB1 B;  1PSR A;  2CBL A;  1M45 A;  1AHR A;  1BMO A;  2MJW B;  2NXQ A;  2MLF C;  1NWD A;  2M7L A;  1SRA A;  1BR1 B;  3EVR A;  1UHJ A;  4N1G A;  2ZKM X;  4ZCV A;  3EVV A;  1YVL A;  2G2B A;  2JRF A;  3A8R A;  3DF0 A;  1JSA A;  3CR2 A;  1YRU B;  3I5G C;  2FCE A;  4DUQ A;  3HCM A;  1KCY A;  1CNP A;  2KSP A;  4GNK B;  5DKR A;  1F4Q A;  2D8N A;  3O6B A;  1DTL A;  1SKT A;  4PE4 A;  2BKH B;  1J55 A;  1S6C A;  2KAV A;  2PRU A;  1DJG A;  1NX3 A;  4E68 A;  1CMF A;  3EVU A;  1DF0 B;  4HRE E;  3IQO A;  1SL9 A;  1A75 A;  2EGD A;  4OVN F;  2L4I A;  1IJ5 A;  2Y1N A;  3DVE A;  1WDC B;  4I5N B;  1L2O C;  1QXP A;  4OR9 B;  4C0L A;  4UPG A;  1Y6W A;  2A4J A;  4DCK A;  4GGF A;  5ER5 A;  1MXL C;  2LP2 A;  1J7O A;  1OMR A;  4YGA A;  1WRZ A;  1BLQ A;  1XFV O;  3BUN B;  1FF1 A;  1KSO A;  5IBW A;  3ICB A;  2KQ6 A;  3DD4 A;  1A2X A;  2KOT A;  1DMO A;  1CLB A;  4MEW A;  1SL7 A;  3BOW B;  2LVK A;  2M3W A;  2KFF A;  1NPQ A;  1YX8 A;  2JXC A;  1YVH A;  2BE6 A;  5K89 A;  1SMG A;  2KYF A;  2JT8 A;  1CM1 A;  1PSB A;  4QJ5 B;  1TNQ A;  1K94 A;  1XVJ A;  1Q80 A;  3DF0 B;  4ORB B;  4YBH B;  3KF9 A;  1QX2 A;  4DRW A;  3WHU B;  1LA3 A;  3IQQ A;  3TDI A;  1E8A A;  1EG3 A;  1ZOT B;  2LLU A;  2OTG C;  1X02 A;  3I5F C;  2LAP A;  1JFK A;  2GGM A;  4PDZ A;  1ALW A;  3PAT A;  5DKN A;  2Y1M A;  1UHN A;  1A75 B;  2JC2 A;  1C07 A;  1GGW A;  2GGZ A;  2EC6 C;  3JTD B;  2KBM A;  2CTN A;  1UUS A;  1JUO A;  2K7D A;  1YUS A;  2M0R A;  4MZK A;  1CDP A;  1RTP 1;  2LE9 B;  4BY4 A;  1XFU O;  2LUC A;  2H61 C;  4GPL B;  2LLT A;  3CR5 X;  4PHN A;  3LL8 B;  3NSK A;  1RFJ A;  1M46 A;  1PVA A;  1QAT A;  4HSZ A;  4HRH A;  2OS8 B;  3VRQ A;  3SG5 A;  1KQM C;  1YX7 A;  4NDC A;  2BBM A;  1C7W A;  2AAO A;  1NX1 A;  3DVJ A;  3BXK A;  3GK1 A;  3SG2 A;  2DOQ A;  2K7B A;  4QJ4 B;  1R2U A;  1TN4 A;  1WLM A;  4GAO A;  3PM8 A;  1PUL A;  5AEQ A;  3DVM A;  3SG7 A;  1PVB A;  2FJU B;  1F54 A;  1FPW A;  1DJW A;  3PLF B;  1ZUZ A;  1PK0 D;  3AKB A;  5ER4 X;  2PAS A;  3AAK A;  3BUW B;  3I5I B;  4GUK A;  2JNF A;  2COL B;  1K8U A;  1PRW A;  5HYD A;  1KSM A;  1AK8 A;  2LHI A;  4CFR A;  1QLK A;  1F55 A;  1JF2 A;  3RLZ A;  1S6J A;  1IKU A;  3GOF A;  1RWY A;  1LIN A;  5DKQ A;  1MR8 A;  1QAS A;  1QVI Z;  3C1V A;  1NIW A;  4PHK A;  4PE1 A;  3WNX B;  1LVC D;  2WOR A;  2QAC A;  1IGV A;  1TCO B;  1ALV A;  1KK7 Z;  4JWQ A;  3VRP A;  2CNP A;  2L50 A;  4CLN A;  1IWQ A;  4PAL A;  3TS5 C;  3I5G B;  2ZRS A;  1C7V A;  1G33 A;  1PAL A;  1CM4 A;  2F33 A;  1UUR A;  2E6W A;  3BYA A;  3GK4 X;  5I2O A;  1OZS A;  2KAX A;  4R1E A;  1MQ1 A;  2ZN8 A;  1RRO A;  5D69 A;  3A4U B;  1EH2 A;  1F70 A;  1UHI A;  1J1E A;  2I2R E;  2FCD A;  2Q91 A;  3TUY C;  3RM1 A;  2RGI A;  2PMY A;  2AUC A;  1YUU A;  1OE9 B;  2JUL A;  3BQ3 A;  3CWG A;  3FIA A;  1UHH A;  3KEV A;  1L2O B;  1Y1U A;  1D1O A;  2HQW A;  2HET A;  1JWD A;  4GGN A;  1ZMZ A;  3D0Y A;  2JT0 A;  3VRN A;  1QLS A;  1OMV A;  2WCB A;  1QV1 A;  1DVI A;  1K9K A;  4C0J A;  2H61 A;  1LA0 A;  1K9P A;  1OQP A;  1BJF A; 
#chains in the Genus database with same CATH topology
 2M1K B;  2H8V A;  1R6P A;  4WRI A;  1W7I B;  2F3Z A;  1N2D A;  2ZRT A;  2H2K A;  3KO0 A;  3D78 A;  1IRJ A;  1QJT A;  2WCL A;  4AQJ A;  3O78 A;  1AP4 A;  4MZJ A;  1EL4 A;  4FTG A;  4MLW A;  2K7C A;  1J1D A;  4GFT A;  5HLO A;  1H8B A;  4I5J A;  4INX A;  3LCP C;  3VGO A;  5EL2 A;  1M63 B;  1S5G Y;  1MF8 B;  1GM0 A;  1B9A A;  2LM5 A;  1NCX A;  3F45 A;  1IIO A;  2OTG B;  2FOT A;  3CDN A;  3I5F B;  3NSO A;  3CYZ A;  4U8D A;  1MHO A;  3R1V A;  4NDB A;  2IS9 A;  1CB1 A;  2F2O A;  1YRT B;  1U5I A;  3SIB A;  3D76 A;  3VRO A;  2EC6 B;  1C3Y A;  1LXF C;  2KGB C;  5CSJ A;  2L2E A;  1JC2 A;  2JTT A;  1F71 A;  2KI4 C;  2LV7 A;  1WRK A;  2CCM A;  4ICB A;  4KYN A;  2K0J A;  2YGU A;  4N1F A;  1OMD A;  2Y5I A;  2BNX A;  4A4C A;  1TRF A;  1OSA A;  1REC A;  1A29 A;  3BUX B;  1S36 A;  2LVV A;  4JQ0 D;  1IJ6 A;  4OV2 A;  3DVK A;  2EHB A;  4XJK A;  5I8N A;  1EG4 A;  2JXL A;  2K8M B;  3MSE B;  2KDH A;  3SS5 A;  3SG4 A;  3EKJ A;  1BOC A;  5J3X A;  2BL0 C;  3CZ1 A;  1G8I A;  3UNW A;  1KQM B;  4P5O E;  1WY9 A;  1FI5 A;  2BE4 A;  2KFG A;  2JZI A;  2MLE C;  2JOJ A;  4MRX A;  1XO5 A;  2JTZ A;  1A4P A;  3PJI A;  2KGR A;  5HKY A;  5I2L A;  1J7Q A;  2WC8 A;  1C3Z A;  2WC6 A;  5CPV A;  1KQV A;  3JVT C;  1K95 A;  1Z4H A;  4CPV A;  2M9G A;  2KI6 C;  1B7T Y;  2M1U A;  1YR5 A;  1IH0 A;  1S3P A;  1DJH A;  1KWO C;  4FQT A;  1KK8 C;  2JPT A;  2P6B B;  1DT7 B;  1QX7 A;  1IQ3 A;  3I5H C;  1AUI B;  4Q04 A;  1XFY O;  3CTN A;  1U5I B;  3EK7 A;  5HLV A;  3VRR A;  2B1U A;  1XFR A;  1SR6 C;  1TIZ A;  3ZWH A;  1OOH A;  3UO9 A;  3LK1 A;  4GBA A;  1QIV A;  1DJY A;  3TS5 B;  2I94 A;  1WLZ A;  5FI2 A;  3B86 A;  1SW8 A;  2CT9 A;  5TNC A;  3B87 A;  3K21 A;  1ZAC A;  1N0Y A;  1DJX A;  2BCB A;  2NLN A;  2PQL A;  1DGV A;  2CXJ A;  1TWO A;  2KHN A;  1FW4 A;  2MA2 A;  2WCK A;  2WCH A;  4N5X A;  1KFX S;  1RJV A;  4I5K A;  4PHJ A;  2JQ6 A;  1CFD A;  2LCP A;  5F6T A;  4C0K A;  1NCZ A;  1CLL A;  3TUY B;  1DJZ A;  3NSI A;  3D10 A;  4M2O A;  1UWO A;  4MRY A;  5HKW A;  3D75 A;  3BUO B;  2Q4U A;  4F7F A;  2O60 A;  3CLN A;  1FBV A;  2WCE A;  3SG6 A;  3O2P A;  1BOD A;  1DGU A;  5AAN A;  2BCX A;  1BG1 A;  4OCI A;  2LMT A;  2I18 A;  4YRU A;  1ORG A;  1RK9 A;  3TDZ A;  4A4B A;  2ZND A;  5AFP A;  3S0A A;  1KK7 Y;  1SCM C;  2I7A A;  1EJ3 A;  2WOS A;  1CDL A;  3PN7 C;  1KFU L;  2LVJ A;  2PSR A;  3NHT A;  1XYD A;  1CKK A;  2LP3 A;  1TUJ A;  2LHL A;  1DC1 A;  2LLS A;  2K2A A;  1SNL A;  1NCY A;  3SIA A;  4D1E A;  5KU1 A;  4CFQ A;  2LMV A;  2JU0 A;  5FI6 A;  4MBE A;  4MVF A;  1SSE B;  4AQI A;  2WND A;  2QEV A;  1OW4 A;  1A03 A;  3O4Y A;  5AXI A;  1ODB A;  2AMI A;  2Y4Q A;  4DIR A;  5HL1 A;  1CFP A;  2ISD A;  3GK2 A;  2KBI A;  2M97 A;  1NSH A;  3SS4 A;  2JT3 A;  3PSR A;  2VRG A;  2KPH A;  1LS8 A;  1XK4 C;  1S6I A;  2L0P A;  3NSL A;  5FYX A;  3D74 A;  1F4O A;  1XA5 A;  2K61 A;  3L4L A;  4MSP A;  3TZ1 A;  2ERB A;  1V1G A;  3FWC A;  1S26 D;  3NGV A;  2LC5 A;  1OOG A;  4M2Q A;  3BUM B;  1DJI A;  1WRL A;  3IVT A;  1CTR A;  2QEO A;  3IF7 A;  1MUX A;  3OX5 A;  1K93 D;  3B6X A;  2QPT A;  1UP5 A;  1GGZ A;  1G4Y R;  3FS7 A;  1F8H A;  1CDM A;  2JNX A;  2L5Y A;  3DY9 A;  1OOF A;  1FI6 A;  1XFW O;  1GQM A;  1KFX L;  2BCA A;  2KI4 B;  3OGN A;  4INW A;  1TNX A;  3EK4 A;  3OX6 A;  3SG3 A;  1SBJ A;  1H4B A;  3OB2 B;  2KI6 D;  2OPO A;  3FE6 A;  4L9M A;  4IJ7 A;  1MWN A;  4USL A;  3CS1 A;  1DEK A;  1W7J B;  4QJ3 B;  2L2C A;  3FE9 A;  2ZFD A;  4JD9 A;  3S0B A;  2BBN A;  2MAZ A;  1S5G Z;  3AAJ A;  1OOJ A;  2BL0 B;  1B8L A;  1VRK A;  3OHM B;  4PHM A;  1IQ5 A;  1NX2 A;  1GJY A;  2NCO A;  5CSF A;  1AJ5 A;  1SYM A;  1NP8 A;  1V1F A;  3LK0 A;  5CSI A;  1TNW A;  3D73 A;  1LKJ A;  2M8U A;  2HF5 A;  3D0Y B;  4AOM A;  1Y1A A;  4I5L B;  4YGB B;  4YGE B;  4OZD A;  2LNK A;  3JVT B;  4PT1 A;  1QIW A;  1TTX A;  1TNP A;  3WHT B;  3HX4 A;  3BJH A;  1YUR A;  3SJS A;  3QRX A;  3PAL A;  2TN4 A;  3NHI A;  4XJK B;  1KWO B;  1Z2C B;  1ZFS A;  2L4H A;  3L4A A;  1KK8 B;  1DEL A;  1JBA A;  2GV5 A;  1SK6 D;  1WDC C;  3ZNI A;  2O5G A;  2F2P A;  3EKH A;  3I5H B;  1K90 D;  2L98 A;  3R1O A;  4F0Z B;  1CFC A;  1N65 A;  4TNC A;  5KSZ A;  1CFF A;  3E3R A;  1M39 A;  3CZT X;  1XFZ O;  3EK8 A;  4PE7 A;  3LLE A;  1SR6 B;  3CGA A;  3H4S E;  1KFU S;  1K9U A;  1S1E A;  1TCF A;  3BFA A;  1NX0 A;  2LMU A;  4YGD B;  3S0D A;  3V2L A;  3M0W A;  1HQV A;  4YI8 A;  1UHK A;  4YGC B;  2L51 A;  2E30 A;  5D7F A;  3DZT A;  4PCW A;  1NYA A;  2NZ0 A;  2R2I A;  1SPY A;  4ORA B;  4ZCU A;  1CMG A;  3AKA A;  1J7R A;  1Y0V H;  5JOL A;  4CID A;  1XK4 A;  1B7T Z;  1AJ4 A;  2MBX A;  1M31 A;  4ORC B;  4YI9 A;  3KHE A;  1QS7 A;  2NCP A;  1B8C A;  1SY9 A;  3WXA A;  4P2Y B;  2BKI B;  1TOP A;  2JWW A;  4NDD A;  2LAN A;  5KTY A;  5FI7 A;  1K96 A;  2LVI A;  3KPX A;  2V53 A;  4JPZ B;  1SL8 A;  5GQQ C;  5AER A;  2F8P A;  1JF0 A;  5BPJ A;  1MXE A;  4BY5 A;  4DS7 A;  4WQ3 A;  1YTZ C;  1BR4 B;  1B4C A;  1B8R A;  2PAL A;  2ZNE A;  2M49 B;  2M7N A;  1HT9 A;  2M29 A;  1QX5 B;  3B88 A;  3JTD C;  1SCM B;  4ETO A;  3PN7 B;  3DXL A;  5CSN A;  5G08 A;  4GGF C;  1K2H A;  5B8I B;  4HRG A;  2KYC A;  1CDN A;  2KNE A;  1B47 A;  3CZ0 A;  2F3Y A;  2MRD A;  1JFJ A;  3OP0 A;  1OZO A;  1QTX A;  3CR4 X;  2WCF A;  4MN0 A;  4OKH A;  3SS3 A;  2G9B A;  1L7Z A;  1QVI Y;  2SAS A;  2OS8 C;  1B1G A;  3D77 A;  2HQ8 A;  2SCP A;  2KFH A;  2HPS A;  1EXR A;  2BEC A;  2PVB A;  1DF0 A;  2QEH A;  3S0F A;  1BU3 A;  1QV0 A;  1Y1X A;  2KAY A;  4IL1 A;  4XYN A;  1BT6 A;  5JJG A;  2MHH A;  1J7P A;  4MZL A;  4WQ2 A;  1IG5 A;  1XFX O;  2QDI A;  2GTE A;  2LUX A;  4M2P A;  3PFV A;  4NQG A;  3TDU A;  1BF5 A;  3S0E A;  5PAL A;  3N7H A;  4FQO A;  3BFH A;  2WC5 A;  1YUT A;  3I5I C;  5DIC A;  2KQY A;  2L5X B;  4PE0 A;  1NUB A;  2K2F A;  2PYQ A;  2ZN9 A;  3OBV A;  5HKZ A;  2K7O A;  3BFB A;  3FWB A;  1CLM A;  5D3O A;  3BOW A;  1SCV A;  1AVS A;  3NXA A;  3OB1 B;  1PSR A;  2CBL A;  1M45 A;  1AHR A;  1BMO A;  2MJW B;  2NXQ A;  2MLF C;  1NWD A;  2M7L A;  1SRA A;  1BR1 B;  3EVR A;  1UHJ A;  4N1G A;  2ZKM X;  3FE8 A;  3EVV A;  1YVL A;  2G2B A;  2JRF A;  3A8R A;  2FJY A;  4ZCV A;  3DF0 A;  1JSA A;  3CR2 A;  4JKT A;  1YRU B;  3I5G C;  2FCE A;  4DUQ A;  3HCM A;  5I2Q A;  1KCY A;  3EG5 B;  2KSP A;  1CNP A;  4GNK B;  3R72 A;  5DKR A;  1F4Q A;  2D8N A;  3O6B A;  1TUZ A;  1DTL A;  1SKT A;  4PE4 A;  2BKH B;  3PM2 A;  1J55 A;  1S6C A;  2KAV A;  2PRU A;  1DJG A;  1NX3 A;  4E68 A;  1CMF A;  3EVU A;  1DF0 B;  4HRE E;  3IQO A;  1SL9 A;  1A75 A;  2EGD A;  4OVN F;  2L4I A;  1IJ5 A;  2Y1N A;  3DVE A;  1WDC B;  4I5N B;  1L2O C;  1QXP A;  4OR9 B;  4C0L A;  4UPG A;  1Y6W A;  2A4J A;  4DCK A;  4GGF A;  5ER5 A;  1MXL C;  2LP2 A;  1J7O A;  1OMR A;  4YGA A;  1WRZ A;  3RZS A;  1XFV O;  3BUN B;  1BLQ A;  1FF1 A;  1KSO A;  5IBW A;  1P28 A;  2KQ6 A;  3DD4 A;  1A2X A;  2KOT A;  3ICB A;  1DMO A;  1CLB A;  4MEW A;  1SL7 A;  3BOW B;  2LVK A;  2M3W A;  2KFF A;  1NPQ A;  1YX8 A;  2JXC A;  1YVH A;  3CAB A;  2BE6 A;  5K89 A;  1SMG A;  2KYF A;  2JT8 A;  3S0G A;  2QEB A;  1CM1 A;  3VB1 A;  1PSB A;  4QJ5 B;  1TNQ A;  1K94 A;  1XVJ A;  1Q80 A;  3DF0 B;  4ORB B;  4YBH B;  2KLD A;  3KF9 A;  1QX2 A;  4DRW A;  3WHU B;  1LA3 A;  3IQQ A;  3TDI A;  1E8A A;  3R1P A;  1EG3 A;  1ZOT B;  2LLU A;  2OTG C;  1X02 A;  2WCM A;  3I5F C;  2LAP A;  1JFK A;  2GGM A;  4PDZ A;  1ALW A;  3PAT A;  5DKN A;  2Y1M A;  1UHN A;  1A75 B;  2JC2 A;  1C07 A;  1GGW A;  2GGZ A;  2EC6 C;  3JTD B;  2KBM A;  2CTN A;  1UUS A;  1JUO A;  2K7D A;  1YUS A;  2M0R A;  4MZK A;  1CDP A;  1RTP 1;  2WCJ A;  2LE9 B;  4BY4 A;  2JPO A;  1XFU O;  3K1E A;  2LUC A;  2H61 C;  4GPL B;  2LLT A;  3CR5 X;  4PHN A;  3LL8 B;  3NSK A;  1RFJ A;  5I94 A;  1M46 A;  1PVA A;  1QAT A;  4HSZ A;  4HRH A;  2OS8 B;  3VRQ A;  3SG5 A;  1KQM C;  1YX7 A;  4NDC A;  2BBM A;  1C7W A;  2AAO A;  1NX1 A;  3DVJ A;  3BXK A;  3GK1 A;  3SG2 A;  2DOQ A;  2K7B A;  4QJ4 B;  1R2U A;  1TN4 A;  1WLM A;  4GAO A;  1QWV A;  1OOI X;  1PUL A;  3DVM A;  3PM8 A;  1PVB A;  2FJU B;  5AEQ A;  3SG7 A;  1F54 A;  1FPW A;  1DJW A;  3PLF B;  1ZUZ A;  1PK0 D;  2BAP A;  3AKB A;  2PAS A;  3AAK A;  3BUW B;  3DYE A;  3I5I B;  5ER4 X;  4GUK A;  2JNF A;  2COL B;  2P70 A;  1K8U A;  1PRW A;  5HYD A;  1KSM A;  1AK8 A;  2LHI A;  4CFR A;  1QLK A;  1F55 A;  1JF2 A;  1W9Z A;  3L47 A;  3RLZ A;  1S6J A;  1IKU A;  3CZ2 A;  3GOF A;  1RWY A;  1LIN A;  5DKQ A;  1MR8 A;  1QAS A;  1QVI Z;  3C1V A;  1NIW A;  4PHK A;  4PE1 A;  3WNX B;  1LVC D;  2WOR A;  2QAC A;  1IGV A;  1TCO B;  1ALV A;  1KK7 Z;  3O4X A;  4JWQ A;  3VRP A;  2CNP A;  2L50 A;  4CLN A;  1IWQ A;  1DQE A;  4PAL A;  3TS5 C;  3I5G B;  2ZRS A;  1C7V A;  1G33 A;  1PAL A;  1CM4 A;  2F33 A;  1UUR A;  2E6W A;  3BYA A;  3GK4 X;  5I2O A;  1OZS A;  2KLE A;  2KAX A;  3B7A A;  4R1E A;  1MQ1 A;  2ZN8 A;  1RRO A;  5D69 A;  3A4U B;  1EH2 A;  1F70 A;  1UHI A;  1J1E A;  2I2R E;  2FCD A;  2P71 A;  2Q91 A;  1T14 A;  3TUY C;  3RM1 A;  2RGI A;  2PMY A;  2AUC A;  1YUU A;  1OE9 B;  2JUL A;  3BQ3 A;  3CWG A;  3FIA A;  2K60 A;  1UHH A;  3KEV A;  1L2O B;  1Y1U A;  1D1O A;  2HQW A;  2HET A;  1JWD A;  4GGN A;  1ZMZ A;  3D0Y A;  2JT0 A;  3VRN A;  1QLS A;  1OMV A;  2WCB A;  1QV1 A;  1DVI A;  1K9K A;  3Q8I A;  4C0J A;  3QME A;  2H61 A;  1LA0 A;  1K9P A;  1OQP A;  1BJF A; 
#chains in the Genus database with same CATH homology
 2M1K B;  1R6P A;  4WRI A;  1W7I B;  2F3Z A;  1N2D A;  2ZRT A;  2H2K A;  3KO0 A;  1IRJ A;  1QJT A;  4AQJ A;  3O78 A;  1AP4 A;  4MZJ A;  1EL4 A;  4FTG A;  4MLW A;  2K7C A;  1J1D A;  4GFT A;  5HLO A;  1H8B A;  4I5J A;  3LCP C;  3VGO A;  1M63 B;  1S5G Y;  1MF8 B;  1B9A A;  2LM5 A;  1NCX A;  3F45 A;  2OTG B;  2FOT A;  3I5F B;  3NSO A;  4U8D A;  1MHO A;  4NDB A;  1CB1 A;  2IS9 A;  2F2O A;  1YRT B;  1U5I A;  3SIB A;  3VRO A;  2EC6 B;  1LXF C;  2KGB C;  5CSJ A;  2L2E A;  1JC2 A;  2JTT A;  1F71 A;  2KI4 C;  2LV7 A;  1WRK A;  2CCM A;  4ICB A;  2K0J A;  4N1F A;  1OMD A;  2Y5I A;  4A4C A;  1TRF A;  1OSA A;  1REC A;  1A29 A;  3BUX B;  1S36 A;  2LVV A;  4JQ0 D;  1IJ6 A;  4OV2 A;  3DVK A;  2EHB A;  4XJK A;  5I8N A;  1EG4 A;  2JXL A;  2K8M B;  3MSE B;  2KDH A;  3SG4 A;  3EKJ A;  1BOC A;  5J3X A;  2BL0 C;  1G8I A;  1KQM B;  4P5O E;  1WY9 A;  1FI5 A;  2BE4 A;  2KFG A;  2JZI A;  2MLE C;  2JOJ A;  4MRX A;  1XO5 A;  2JTZ A;  1A4P A;  2KGR A;  5HKY A;  5I2L A;  1J7Q A;  2WC8 A;  5CPV A;  1KQV A;  3JVT C;  1K95 A;  4CPV A;  2M9G A;  2KI6 C;  1B7T Y;  2M1U A;  1YR5 A;  1IH0 A;  1S3P A;  1DJH A;  1KWO C;  1KK8 C;  2JPT A;  2P6B B;  1DT7 B;  1QX7 A;  1IQ3 A;  3I5H C;  1AUI B;  4Q04 A;  1XFY O;  3CTN A;  1U5I B;  3EK7 A;  5HLV A;  3VRR A;  2B1U A;  1SR6 C;  1TIZ A;  3ZWH A;  3LK1 A;  4GBA A;  1QIV A;  1DJY A;  3TS5 B;  2I94 A;  1WLZ A;  1SW8 A;  2CT9 A;  5TNC A;  3K21 A;  1ZAC A;  1N0Y A;  1DJX A;  2BCB A;  2NLN A;  4XJK B;  1DGV A;  2CXJ A;  2KHN A;  2MA2 A;  1FW4 A;  4N5X A;  1KFX S;  1RJV A;  4I5K A;  4PHJ A;  2JQ6 A;  1CFD A;  2LCP A;  5F6T A;  4C0K A;  1NCZ A;  1CLL A;  3TUY B;  1DJZ A;  3NSI A;  3D10 A;  4M2O A;  1UWO A;  4MRY A;  5HKW A;  3BUO B;  2Q4U A;  2O60 A;  3CLN A;  1FBV A;  2WCE A;  3SG6 A;  3O2P A;  1BOD A;  1DGU A;  5AAN A;  2BCX A;  1BG1 A;  4OCI A;  2LMT A;  2I18 A;  4YRU A;  1RK9 A;  3TDZ A;  4A4B A;  2ZND A;  5AFP A;  1KK7 Y;  1SCM C;  2I7A A;  1EJ3 A;  2WOS A;  1CDL A;  3PN7 C;  1KFU L;  2LVJ A;  2PSR A;  1CKK A;  1XYD A;  2LP3 A;  2LHL A;  2LLS A;  2K2A A;  1SNL A;  1NCY A;  3SIA A;  4D1E A;  5KU1 A;  4CFQ A;  2LMV A;  2JU0 A;  4MBE A;  4MVF A;  4AQI A;  2WND A;  1A03 A;  3O4Y A;  5AXI A;  1ODB A;  2AMI A;  2Y4Q A;  4DIR A;  1CFP A;  2ISD A;  3GK2 A;  2KBI A;  2M97 A;  1NSH A;  2JT3 A;  3PSR A;  2VRG A;  3NSL A;  1XK4 C;  1S6I A;  2L0P A;  5FYX A;  3TZ1 A;  5I2Q A;  1F4O A;  1XA5 A;  2K61 A;  4MSP A;  4M2Q A;  1V1G A;  3FWC A;  1S26 D;  2LC5 A;  3BUM B;  1DJI A;  1WRL A;  1CTR A;  3IF7 A;  1MUX A;  3OX5 A;  1K93 D;  2QPT A;  1UP5 A;  1GGZ A;  1G4Y R;  3FS7 A;  1F8H A;  1CDM A;  2JNX A;  1FI6 A;  1XFW O;  1GQM A;  1KFX L;  2BCA A;  2KI4 B;  1TNX A;  3EK4 A;  3OX6 A;  3SG3 A;  1SBJ A;  1H4B A;  3OB2 B;  2KI6 D;  2OPO A;  4L9M A;  1MWN A;  4USL A;  3CS1 A;  1W7J B;  4QJ3 B;  2ZFD A;  2BBN A;  2MAZ A;  1S5G Z;  3AAJ A;  1OOJ A;  2BL0 B;  1B8L A;  1VRK A;  3OHM B;  4PHM A;  1IQ5 A;  1NX2 A;  1GJY A;  2NCO A;  5CSF A;  1AJ5 A;  1SYM A;  1NP8 A;  1V1F A;  3LK0 A;  5CSI A;  1TNW A;  1LKJ A;  2M8U A;  2HF5 A;  3D0Y B;  4AOM A;  1Y1A A;  4I5L B;  4YGB B;  4YGE B;  2LNK A;  3JVT B;  1QIW A;  1TTX A;  1TNP A;  3WHT B;  3HX4 A;  1YUR A;  3SJS A;  3QRX A;  3PAL A;  2TN4 A;  1KWO B;  1ZFS A;  2L4H A;  1KK8 B;  1JBA A;  2GV5 A;  1SK6 D;  1WDC C;  3ZNI A;  2O5G A;  2F2P A;  3EKH A;  3I5H B;  1K90 D;  2L98 A;  1CFC A;  4F0Z B;  1N65 A;  4TNC A;  5KSZ A;  1CFF A;  3E3R A;  1M39 A;  3CZT X;  1XFZ O;  3EK8 A;  4PE7 A;  3LLE A;  1SR6 B;  3CGA A;  3H4S E;  1KFU S;  1K9U A;  1S1E A;  1TCF A;  1NX0 A;  2LMU A;  4YGD B;  3M0W A;  1HQV A;  4YI8 A;  1UHK A;  4YGC B;  2L51 A;  2E30 A;  5D7F A;  4PCW A;  1NYA A;  2NZ0 A;  2R2I A;  1SPY A;  4ORA B;  4ZCU A;  1CMG A;  3AKA A;  1J7R A;  1Y0V H;  5JOL A;  4CID A;  1XK4 A;  1B7T Z;  1AJ4 A;  2MBX A;  1M31 A;  4ORC B;  4YI9 A;  3KHE A;  1QS7 A;  2NCP A;  1B8C A;  1SY9 A;  3WXA A;  4P2Y B;  2BKI B;  1TOP A;  2JWW A;  4NDD A;  2LAN A;  5KTY A;  1K96 A;  2LVI A;  3KPX A;  2V53 A;  4JPZ B;  1SL8 A;  5GQQ C;  5AER A;  2F8P A;  1JF0 A;  5BPJ A;  1MXE A;  4BY5 A;  4DS7 A;  4WQ3 A;  1YTZ C;  1BR4 B;  1B4C A;  1B8R A;  2PAL A;  2ZNE A;  2M49 B;  2M7N A;  1HT9 A;  2M29 A;  1QX5 B;  3JTD C;  1SCM B;  4ETO A;  3PN7 B;  5CSN A;  5G08 A;  4GGF C;  1K2H A;  5B8I B;  4HRG A;  2KYC A;  1CDN A;  2KNE A;  1B47 A;  2F3Y A;  2MRD A;  1JFJ A;  3OP0 A;  1OZO A;  1QTX A;  3CR4 X;  2WCF A;  4MN0 A;  4OKH A;  2G9B A;  1L7Z A;  1QVI Y;  2SAS A;  2OS8 C;  1B1G A;  2HQ8 A;  2SCP A;  2KFH A;  2HPS A;  1EXR A;  2BEC A;  2PVB A;  1DF0 A;  1BU3 A;  1QV0 A;  1Y1X A;  2KAY A;  4IL1 A;  4XYN A;  1BT6 A;  5JJG A;  2MHH A;  1J7P A;  4MZL A;  4WQ2 A;  1IG5 A;  1XFX O;  4M2P A;  2LUX A;  4NQG A;  3TDU A;  3PFV A;  1BF5 A;  5PAL A;  4FQO A;  1YUT A;  3I5I C;  2KQY A;  2L5X B;  4PE0 A;  1NUB A;  2K2F A;  2ZN9 A;  5HKZ A;  2K7O A;  3FWB A;  1CLM A;  3BOW A;  1SCV A;  1AVS A;  3NXA A;  3OB1 B;  1PSR A;  2CBL A;  1M45 A;  1AHR A;  1BMO A;  2MJW B;  2NXQ A;  2MLF C;  1NWD A;  2M7L A;  1SRA A;  1BR1 B;  3EVR A;  1UHJ A;  4N1G A;  2ZKM X;  4ZCV A;  3EVV A;  1YVL A;  2G2B A;  2JRF A;  3A8R A;  3DF0 A;  1JSA A;  3CR2 A;  1YRU B;  3I5G C;  2FCE A;  4DUQ A;  3HCM A;  1KCY A;  1CNP A;  2KSP A;  4GNK B;  5DKR A;  1F4Q A;  2D8N A;  3O6B A;  1DTL A;  1SKT A;  4PE4 A;  2BKH B;  1J55 A;  1S6C A;  2KAV A;  2PRU A;  1DJG A;  1NX3 A;  4E68 A;  1CMF A;  3EVU A;  1DF0 B;  4HRE E;  3IQO A;  1SL9 A;  1A75 A;  2EGD A;  4OVN F;  2L4I A;  1IJ5 A;  2Y1N A;  3DVE A;  1WDC B;  4I5N B;  1L2O C;  1QXP A;  4OR9 B;  4C0L A;  4UPG A;  1Y6W A;  2A4J A;  4DCK A;  4GGF A;  5ER5 A;  1MXL C;  2LP2 A;  1J7O A;  1OMR A;  4YGA A;  1WRZ A;  1BLQ A;  1XFV O;  3BUN B;  1FF1 A;  1KSO A;  5IBW A;  3ICB A;  2KQ6 A;  3DD4 A;  1A2X A;  2KOT A;  1DMO A;  1CLB A;  4MEW A;  1SL7 A;  3BOW B;  2LVK A;  2M3W A;  2KFF A;  1NPQ A;  1YX8 A;  2JXC A;  1YVH A;  2BE6 A;  5K89 A;  1SMG A;  2KYF A;  2JT8 A;  1CM1 A;  1PSB A;  4QJ5 B;  1TNQ A;  1K94 A;  1XVJ A;  1Q80 A;  3DF0 B;  4ORB B;  4YBH B;  3KF9 A;  1QX2 A;  4DRW A;  3WHU B;  1LA3 A;  3IQQ A;  3TDI A;  1E8A A;  1EG3 A;  1ZOT B;  2LLU A;  2OTG C;  1X02 A;  3I5F C;  2LAP A;  1JFK A;  2GGM A;  4PDZ A;  1ALW A;  3PAT A;  5DKN A;  2Y1M A;  1UHN A;  1A75 B;  2JC2 A;  1C07 A;  1GGW A;  2GGZ A;  2EC6 C;  3JTD B;  2KBM A;  2CTN A;  1UUS A;  1JUO A;  2K7D A;  1YUS A;  2M0R A;  4MZK A;  1CDP A;  1RTP 1;  2LE9 B;  4BY4 A;  1XFU O;  2LUC A;  2H61 C;  4GPL B;  2LLT A;  3CR5 X;  4PHN A;  3LL8 B;  3NSK A;  1RFJ A;  1M46 A;  1PVA A;  1QAT A;  4HSZ A;  4HRH A;  2OS8 B;  3VRQ A;  3SG5 A;  1KQM C;  1YX7 A;  4NDC A;  2BBM A;  1C7W A;  2AAO A;  1NX1 A;  3DVJ A;  3BXK A;  3GK1 A;  3SG2 A;  2DOQ A;  2K7B A;  4QJ4 B;  1R2U A;  1TN4 A;  1WLM A;  4GAO A;  3PM8 A;  1PUL A;  5AEQ A;  3DVM A;  3SG7 A;  1PVB A;  2FJU B;  1F54 A;  1FPW A;  1DJW A;  3PLF B;  1ZUZ A;  1PK0 D;  3AKB A;  5ER4 X;  2PAS A;  3AAK A;  3BUW B;  3I5I B;  4GUK A;  2JNF A;  2COL B;  1K8U A;  1PRW A;  5HYD A;  1KSM A;  1AK8 A;  2LHI A;  4CFR A;  1QLK A;  1F55 A;  1JF2 A;  3RLZ A;  1S6J A;  1IKU A;  3GOF A;  1RWY A;  1LIN A;  5DKQ A;  1MR8 A;  1QAS A;  1QVI Z;  3C1V A;  1NIW A;  4PHK A;  4PE1 A;  3WNX B;  1LVC D;  2WOR A;  2QAC A;  1IGV A;  1TCO B;  1ALV A;  1KK7 Z;  4JWQ A;  3VRP A;  2CNP A;  2L50 A;  4CLN A;  1IWQ A;  4PAL A;  3TS5 C;  3I5G B;  2ZRS A;  1C7V A;  1G33 A;  1PAL A;  1CM4 A;  2F33 A;  1UUR A;  2E6W A;  3BYA A;  3GK4 X;  5I2O A;  1OZS A;  2KAX A;  4R1E A;  1MQ1 A;  2ZN8 A;  1RRO A;  5D69 A;  3A4U B;  1EH2 A;  1F70 A;  1UHI A;  1J1E A;  2I2R E;  2FCD A;  2Q91 A;  3TUY C;  3RM1 A;  2RGI A;  2PMY A;  2AUC A;  1YUU A;  1OE9 B;  2JUL A;  3BQ3 A;  3CWG A;  3FIA A;  1UHH A;  3KEV A;  1L2O B;  1Y1U A;  1D1O A;  2HQW A;  2HET A;  1JWD A;  4GGN A;  1ZMZ A;  3D0Y A;  2JT0 A;  3VRN A;  1QLS A;  1OMV A;  2WCB A;  1QV1 A;  1DVI A;  1K9K A;  4C0J A;  2H61 A;  1LA0 A;  1K9P A;  1OQP A;  1BJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...