2LLUA

Post-translational s-nitrosylation is an endogenous factor fine-tuning human s100a1 protein properties
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title Post-translational S-Nitrosylation Is an Endogenous Factor Fine Tuning the Properties of Human S100A1 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lluA00
4PCWA 1QIVA 4YGAA 5HKZA 1ALWA 3OB2B 1CM4A 2KHNA 2HF5A 1YURA 1SK6D 3SG2A 1S26D 3LLEA 1YR5A 2LCPA 3EKHA 1XFZO 1RFJA 2IS9A 1DJIA 1QV1A 3I5GC 4PALA 2BCAA 2OS8B 3NSLA 4TNCA 1S6JA 1RWYA 1QX5B 1DJGA 1SW8A 2L98A 1TTXA 1UHNA 2LUCA 3HX4A 1KK8C 4P2YB 4XYNA 2EC6B 3CGAA 2M1KB 1K8UA 1PALA 1SPYA 2JZIA 4I5KA 1QASA 2MAZA 2Y1MA 1B7TY 1TNPA 1S36A 1S3PA 3GK1A 2LNKA 2KAVA 4PE4A 1G33A 1J7RA 5F6TA 2LVKA 4YGEB 3O6BA 5DKRA 4C0LA 2B1UA 2LLSA 2LMVA 1EJ3A 3NSIA 3MSEB 1VRKA 1OMVA 3FIAA 4MRXA 3CLNA 3TDUA 1R6PA 2K7BA 2L50A 2BCXA 5HKYA 2NCOA 3I5HC 2PSRA 1IJ5A 2WC8A 1XO5A 3CTNA 4DCKA 1TCOB 1YTZC 3D0YB 3JVTC 3SG7A 1RK9A 1BF5A 2HPSA 4NQGA 4AQIA 4PHJA 1SL8A 2K7DA 1GGWA 3VRNA 1DJXA 1HQVA 2PVBA 3DF0A 1UURA 1QATA 4YI8A 1CNPA 1F70A 4M2PA 4MZLA 1CLBA 3CWGA 1BR4B 2ISDA 1SCMB 1H8BA 1B1GA 4FTGA 2JU0A 3AKAA 1AK8A 1CDLA 2GV5A 2KOTA 2O5GA 1UHIA 5HLOA 3GK2A 1RECA 2V53A 1TNXA 2KDHA 3EVRA 2E30A 3GK4X 3VRPA 1K9PA 1RJVA 2LVJA 2MLEC 1ODBA 3DVJA 3AAKA 1CLLA 3ZNIA 1H4BA 4MRYA 1AJ4A 2OPOA 3PSRA 5GQQC 1NIWA 1L2OB 1BLQA 4AQJA 1QLKA 5KTYA 1KQMB 4XJKA 3E3RA 1QLSA 1M39A 1KSOA 4HRHA 3NXAA 3JTDC 4ZCUA 1KK7Z 2KYCA 2PMYA 1S6IA 4R1EA 2JOJA 4NDDA 3VRQA 1YUUA 2LLUA 1NUBA 1SBJA 2BBNA 3FS7A 3KEVA 1N0YA 1BU3A 1SR6C 4DIRA 2SCPA 1C7VA 1V1GA 4XJKB 4D1EA 1KWOC 2D8NA 3BQ3A 1A03A 1K94A 3RLZA 1CTRA 4PDZA 4CIDA 3OP0A 1NCYA 5ER5A 2LVIA 3SG6A 4A4CA 5BPJA 2K7CA 1B8CA 4ORAB 2F3ZA 5K89A 3SJSA 1LA3A 1M46A 2JT3A 2M29A 1Q80A 1L7ZA 1YRTB 1N2DA 1QVIY 3I5GB 4MZKA 1F54A 4WQ3A 1M31A 2MJWB 4E68A 3QRXA 4IL1A 1KK8B 3KHEA 2COLB 2L5XB 1PSRA 3OX5A 3RM1A 3LK0A 1SY9A 1XK4C 1WY9A 3LCPC 4C0KA 1IQ3A 1JF0A 1S5GY 3A4UB 3CR2A 3EVVA 1W7IB 2ZFDA 2KGBC 1K90D 1MR8A 2KI4C 1B7TZ 1BJFA 3O2PA 4PE1A 3O4YA 2EHBA 1MXLC 4ZCVA 1KSMA 4ETOA 1NPQA 1J7OA 4FQOA 2M0RA 1B8LA 2L2EA 3I5HB 1G4YR 3WHTB 4OKHA 3SIAA 1JFKA 1JF2A 4BY4A 4ORCB 3JVTB 1Y1UA 2JXLA 4WQ2A 3D10A 1DT7B 3KPXA 1QX7A 2KNEA 1SNLA 2FCEA 1DJYA 3C1VA 1B47A 2JTZA 4YGBB 3ZWHA 1CB1A 2Y5IA 4CPVA 1F8HA 3PATA 2GGZA 4MLWA 2JPTA 5CSJA 1B4CA 3BXKA 2R2IA 3I5IC 1FI6A 3M0WA 2M3WA 2F2PA 3TDIA 3D0YA 1NYAA 1EG4A 2SASA 2BBMA 1QJTA 1WRLA 2NCPA 3LL8B 1MHOA 2MBXA 1XFXO 4DS7A 5AANA 1TIZA 2JRFA 2LE9B 1V1FA 4HREE 3BOWB 4USLA 1C7WA 4GUKA 1BODA 1MQ1A 1SMGA 2LLTA 1CDPA 1GGZA 5I2OA 1IKUA 2L4HA 2A4JA 1OZOA 3WXAA 1MXEA 2F3YA 4N5XA 1CMFA 2LHLA 1WDCC 2H61A 4HRGA 1J1DA 2LV7A 1IWQA 1FF1A 2M8UA 1OSAA 4M2QA 3EVUA 1NCXA 1TN4A 1KFUL 2CBLA 2KFGA 3O78A 3BUOB 3CS1A 1BOCA 3JTDB 1EXRA 1J7PA 2JTTA 5AFPA 5CSNA 5FYXA 1LA0A 2ZN9A 3EK7A 5ER4X 1SRAA 2LHIA 2I94A 1WRKA 2K7OA 1CDNA 1BT6A 3KF9A 1E8AA 2EGDA 1SR6B 2KBMA 2LP3A 4JQ0D 1KWOB 1TOPA 2F2OA 4HSZA 1DGUA 3WNXB 1K9KA 1WLZA 1PK0D 2JC2A 1J55A 2L0PA 1OMDA 1KQVA 1NP8A 1K2HA 2JT8A 2E6WA 2LM5A 2FCDA 1F4OA 1Y1AA 2I7AA 2BECA 2HQ8A 4MBEA 5G08A 3TDZA 4YRUA 2TN4A 2RGIA 3SG3A 2M49B 2G9BA 2WCEA 3F45A 1DJZA 1XK4A 1KFXL 1QS7A 1WLMA 1LVCD 1FI5A 2M1UA 1NX1A 3DVEA 1BG1A 4QJ4B 2WNDA 5JOLA 2ZKMX 2LAPA 1ZUZA 2CNPA 2MLFC 5D69A 1XFVO 1UWOA 5PALA 1S6CA 3NSKA 1NWDA 4WRIA 1F71A 3VROA 3OX6A 5CSFA 3TS5B 2KI4B 1FW4A 1YRUB 1UHHA 2FOTA 4CFRA 2Q91A 2H2KA 1TNWA 2WOSA 2NXQA 1XYDA 2MHHA 1MF8B 4BY5A 3I5FC 1JC2A 3IF7A 4OV2A 2KSPA 4MZJA 4PE0A 2K2AA 5HKWA 4I5JA 1AUIB 1IRJA 1AVSA 1SCVA 1TRFA 4C0JA 1CM1A 5TNCA 1A29A 1QXPA 2ZNEA 1EH2A 1YVHA 1R2UA 1LKJA 1OQPA 2CTNA 2OTGC 1MUXA 1K96A 2Y4QA 4AOMA 3IQQA 1U5IA 1UUSA 4I5LB 2F8PA 3I5IB 3TS5C 1KK7Y 1NCZA 2M7LA 3VGOA 1QTXA 2KQ6A 4F0ZB 5I2QA 4YGDB 1XFUO 3AKBA 4N1GA 1AJ5A 4PHNA 2CXJA 4N1FA 3DD4A 2NLNA 1G8IA 1M45A 2ZRSA 4P5OE 1ZMZA 2M97A 4DUQA 2LANA 1U5IB 4CLNA 1XFYO 1SL9A 1DVIA 1A75A 3DVKA 3PALA 2LMTA 4GGFC 1WDCB 2I2RE 4ORBB 1NX2A 1YUSA 4I5NB 3SG4A 4QJ5B 1SYMA 3PN7B 1SKTA 4YBHB 2WCFA 3BOWA 3TUYC 3BYAA 1W7JB 4Q04A 5DKQA 1A75B 1Y0VH 5AXIA 4A4BA 3CZTX 4UPGA 2CCMA 4L9MA 1JUOA 1N65A 1HT9A 3LK1A 3EKJA 2G2BA 3OB1B 2Q4UA 3IQOA 1OZSA 1F4QA 3KO0A 1J7QA 1LINA 2JNXA 2QACA 3EK4A 1CFCA 4MN0A 1ZOTB 1CFPA 4OR9B 2MRDA 4PE7A 1NSHA 1NX0A 1YX7A 1ZFSA 1DJHA 1XVJA 2BL0C 1SL7A 3PN7C 4NDCA 4PHKA 4U8DA 5B8IB 1PRWA 1OOJA 1FBVA 1QX2A 2HETA 2KBIA 4JPZB 5HYDA 2MA2A 3NSOA 5AERA 4GFTA 1TNQA 1XFWO 2JQ6A 2BCBA 3AAJA 5KU1A 4OVNF 1FPWA 2KAYA 2Y1NA 1QV0A 3K21A 2OS8C 1ALVA 3A8RA 3FWBA 1CMGA 1CLMA 4ICBA 1AP4A 3BUWB 2EC6C 2LP2A 5I2LA 2GGMA 2O60A 1X02A 2PALA 1IG5A 1K93D 3ICBA 1A2XA 1BMOA 1Y6WA 2F33A 2K0JA 2ZN8A 2NZ0A 3BUMB 5CSIA 1IH0A 1WRZA 2JXCA 3PM8A 1JWDA 4GAOA 2BKHB 5DKNA 4GPLB 1J1EA 4MSPA 1DJWA 3I5FB 1CFDA 1K95A 3SG5A 1PVBA 3EK8A 2AUCA 1M63B 3DF0B 3FWCA 1LXFC 1XA5A 2HQWA 2K2FA 1QIWA 2P6BB 1QVIZ 2WCBA 5J3XA 1DF0A 1CKKA 4NDBA 2OTGB 1OE9B 1PULA 1C07A 1EL4A 4MEWA 1DGVA 1JSAA 3HCMA 4GBAA 1RTP1 2I18A 4M2OA 2M7NA 4DRWA 1K9UA 2K61A 1PSBA 2JWWA 1S5GZ 1YVLA 1ZACA 1SCMC 1KFUS 2KAXA 2AAOA 2KI6D 4GGFA 1DF0B 2DOQA 2M9GA 5AEQA 3DVMA 1A4PA 3TZ1A 2LMUA 4YI9A 1JFJA 3SIBA 2ZNDA 3CR5X 1RROA 1BR1B 1GJYA 2VRGA 1UHKA 2H61C 5CPVA 3H4SE 1UHJA 1IJ6A 2CT9A 5JJGA 1UP5A 2KYFA 4MVFA 2WORA 2FJUB 1GQMA 2L4IA 1KCYA 1B8RA 3GOFA 1DMOA 2BKIB 1DTLA 2BE4A 4CFQA 2KI6C 2LUXA 2JULA 4GNKB 2ZRTA 1F55A 1MWNA 1OMRA 1CDMA 3CR4X 4PHMA 1L2OC 1AHRA 3TUYB 4QJ3B 4YGCB 1KQMC 5HLVA 1S1EA 5IBWA 1TCFA 1Y1XA 2QPTA 1IQ5A 1JBAA 1KFXS 2KFHA 3PFVA 4JWQA 1YX8A 2K8MB 3WHUB 1YUTA 1EG3A 2PRUA 2JT0A 4OCIA 2L51A 1CFFA 2PASA 2JNFA 2KGRA 2LVVA 3BUNB 3OHMB 2AMIA 5D7FA 3BUXB 3PLFB 3VRRA 1PVAA 1IGVA 5I8NA 1NX3A 4GGNA 5KSZA 2LC5A 2KFFA 1D1OA 1B9AA 2BE6A 2BL0B 2KQYA
chains in the Genus database with same CATH superfamily
4PCWA 1QIVA 2KLDA 4YGAA 5HKZA 1ALWA 3OB2B 1CM4A 2KHNA 3S0GA 2HF5A 1YURA 1SK6D 3SG2A 1W9ZA 3S0AA 1S26D 3LLEA 1YR5A 2LCPA 3EKHA 1XFZO 1RFJA 2IS9A 1DJIA 1QV1A 3I5GC 4PALA 2BCAA 2OS8B 3NSLA 4TNCA 3S0BA 1S6JA 1RWYA 1QX5B 1DJGA 1SW8A 2L98A 1TTXA 1UHNA 2LUCA 3HX4A 1KK8C 3R72A 4XYNA 2EC6B 3CGAA 2M1KB 1K8UA 1PALA 1SPYA 2JZIA 4I5KA 1QASA 2MAZA 2Y1MA 3CZ2A 1B7TY 1TNPA 1S36A 1S3PA 3GK1A 2LNKA 2KAVA 4PE4A 1G33A 1J7RA 5F6TA 2LVKA 2KPHA 4YGEB 3O6BA 5DKRA 4C0LA 2B1UA 2LLSA 2LMVA 1EJ3A 3NSIA 3QMEA 3MSEB 1VRKA 1OMVA 3FIAA 4MRXA 3CLNA 3TDUA 1R6PA 2K7BA 3SS3A 2L50A 2BCXA 5HKYA 2NCOA 3I5HC 2PSRA 1IJ5A 2WC8A 1Z2CB 1XO5A 3CTNA 4DCKA 1TCOB 1YTZC 3D0YB 3DYEA 3JVTC 1RK9A 3SG7A 1BF5A 2HPSA 4NQGA 4AQIA 4FQTA 4PHJA 1SL8A 2K7DA 1C3YA 1GGWA 3VRNA 1DELA 1DJXA 1HQVA 2PVBA 3DF0A 1UURA 5CPVA 1P28A 1QATA 1TUZA 4YI8A 3V2LA 1CNPA 1F70A 4M2PA 4MZLA 1CLBA 3CWGA 1BR4B 2ISDA 1SCMB 1H8BA 1B1GA 4FTGA 2JU0A 3AKAA 1AK8A 1CDLA 2GV5A 2KOTA 2O5GA 1UHIA 5HLOA 1SSEB 3GK2A 1RECA 2V53A 3D78A 1TNXA 2KDHA 3EVRA 2E30A 3GK4X 3VRPA 3OGNA 1K9PA 1RJVA 2LVJA 2MLEC 1ODBA 3DVJA 3AAKA 1CLLA 3SS4A 3ZNIA 1H4BA 3BFAA 4MRYA 3RZSA 1AJ4A 1TUJA 2OPOA 3PSRA 2L2CA 5GQQC 1NIWA 1L2OB 2PYQA 1BLQA 4AQJA 1QLKA 5KTYA 1KQMB 3N7HA 3E3RA 4XJKA 1QLSA 1M39A 1KSOA 4HRHA 3NXAA 3JTDC 4ZCUA 1KK7Z 2KYCA 2PMYA 1S6IA 4R1EA 2JOJA 4NDDA 3VRQA 1YUUA 2LLUA 1NUBA 1SBJA 2BBNA 3FS7A 3KEVA 1N0YA 1BU3A 1SR6C 4DIRA 2SCPA 1C7VA 1V1GA 2WCMA 4XJKB 4D1EA 1GM0A 1KWOC 2D8NA 3BQ3A 3L4LA 1A03A 5DICA 2QEBA 1K94A 3RLZA 1CTRA 4PDZA 5HL1A 4CIDA 3OP0A 1NCYA 5ER5A 2LVIA 3UNWA 3SG6A 4A4CA 5BPJA 2WCJA 2K7CA 1B8CA 3UO9A 4ORAB 2F3ZA 1OOHA 5K89A 3SJSA 1LA3A 1QWVA 1M46A 2WCLA 2JT3A 2M29A 1Q80A 1L7ZA 1YRTB 1N2DA 1QVIY 3I5GB 4MZKA 3S0DA 1F54A 4WQ3A 1M31A 2MJWB 4E68A 3QRXA 4IL1A 1KK8B 3KHEA 5FI2A 2COLB 2L5XB 1PSRA 3OX5A 3RM1A 3LK0A 2KLEA 1SY9A 1XK4C 1WY9A 3LCPC 4C0KA 1IQ3A 4OZDA 1JF0A 1S5GY 3A4UB 3CR2A 3EVVA 1W7IB 2ZFDA 2KGBC 1K90D 1MR8A 2KI4C 3PJIA 1B7TZ 1BJFA 3O2PA 4PE1A 3O4YA 2EHBA 1MXLC 4ZCVA 1KSMA 4ETOA 1NPQA 1J7OA 4FQOA 2M0RA 3NHTA 2K60A 1B8LA 2L2EA 3I5HB 1G4YR 3WHTB 4OKHA 3SIAA 1JFKA 1JF2A 2P70A 3OBVA 4ORCB 3S0EA 3FE9A 4BY4A 3JVTB 1Y1UA 2JXLA 4WQ2A 3D10A 1DT7B 3KPXA 1QX7A 2KNEA 1SNLA 2FCEA 1DJYA 3C1VA 3DY9A 1B47A 2QEHA 2JTZA 4YGBB 3ZWHA 1CB1A 2Y5IA 4CPVA 1F8HA 2YGUA 3PATA 2GGZA 4MLWA 2JPTA 5CSJA 3BJHA 1B4CA 3BXKA 2R2IA 3I5IC 1FI6A 3M0WA 2M3WA 2F2PA 3TDIA 3D0YA 1NYAA 2PQLA 1EG4A 2SASA 2BBMA 3D75A 1QJTA 1WRLA 2NCPA 3LL8B 1MHOA 2MBXA 1XFXO 2WCHA 5AANA 4DS7A 1TIZA 2JRFA 2LE9B 3VB1A 1V1FA 1DC1A 4HREE 3BOWB 4USLA 1C7WA 4GUKA 1BODA 1MQ1A 1SMGA 2LLTA 1CDPA 1GGZA 5I2OA 1IKUA 2L4HA 2A4JA 1OZOA 4INWA 3WXAA 1MXEA 2F3YA 4N5XA 1CMFA 2LHLA 1WDCC 2H61A 4HRGA 1J1DA 2LV7A 1IWQA 1FF1A 2M8UA 1OSAA 1OOIX 4M2QA 3EVUA 1NCXA 1TN4A 1KFUL 2CBLA 3L4AA 2KFGA 3O78A 3BUOB 3CS1A 1BOCA 3JTDB 1EXRA 1J7PA 2JTTA 5AFPA 5CSNA 5FYXA 1LA0A 2ZN9A 3EK7A 5ER4X 1SRAA 2LHIA 2I94A 1WRKA 2K7OA 1CDNA 1BT6A 3KF9A 1E8AA 2EGDA 1SR6B 2KBMA 2WC6A 5EL2A 2LP3A 4JQ0D 1KWOB 1TOPA 2F2OA 4HSZA 1DGUA 3WNXB 1K9KA 1WLZA 1PK0D 2JC2A 1J55A 2L0PA 1OMDA 1KQVA 1NP8A 4IJ7A 1K2HA 2JT8A 2E6WA 2LM5A 2FCDA 3R1PA 1F4OA 1Y1AA 2I7AA 2BECA 2HQ8A 4MBEA 5G08A 3TDZA 4YRUA 2TN4A 2RGIA 3SG3A 2M49B 3NGVA 2G9BA 2WCEA 3F45A 1DJZA 1XK4A 4INXA 1KFXL 1IIOA 1QS7A 2JPOA 1WLMA 1LVCD 4F7FA 1FI5A 1DQEA 2L5YA 1C3ZA 2M1UA 2QEOA 4JKTA 1NX1A 3DVEA 2WC5A 1BG1A 4QJ4B 2WNDA 5JOLA 2ZKMX 2LAPA 1ZUZA 2CNPA 2MLFC 5D69A 1XFVO 1UWOA 5PALA 1S6CA 3NSKA 1NWDA 4WRIA 1F71A 3VROA 3OX6A 5CSFA 3TS5B 2KI4B 1FW4A 1YRUB 1UHHA 2FOTA 4CFRA 2Q91A 2H2KA 1TNWA 2WOSA 2NXQA 1XYDA 5FI7A 2MHHA 1MF8B 4BY5A 3I5FC 1JC2A 3IF7A 4OV2A 2KSPA 3D77A 4MZJA 4PE0A 2K2AA 5HKWA 4I5JA 3B88A 1AUIB 1IRJA 1AVSA 1SCVA 1TRFA 4C0JA 1CM1A 5TNCA 1A29A 1QXPA 2ZNEA 1EH2A 1YVHA 1R2UA 3DXLA 1LKJA 1OQPA 2CTNA 2QEVA 2OTGC 1MUXA 1K96A 2Y4QA 4AOMA 3IQQA 1U5IA 1UUSA 3FE8A 4I5LB 2F8PA 3I5IB 3TS5C 2BNXA 1KK7Y 1NCZA 2M7LA 3VGOA 1QTXA 2KQ6A 4F0ZB 5I2QA 4YGDB 1XFUO 3AKBA 4N1GA 1AJ5A 4PHNA 2CXJA 4N1FA 3DD4A 2NLNA 1G8IA 1M45A 2ZRSA 4P5OE 1ZMZA 4JD9A 2M97A 4DUQA 2LANA 1U5IB 4CLNA 3B86A 2FJYA 1XFYO 1SL9A 1DVIA 1A75A 3DVKA 3PALA 2LMTA 4GGFC 1WDCB 2I2RE 4ORBB 1NX2A 1YUSA 3EG5B 4I5NB 3SG4A 1Z4HA 4QJ5B 1SYMA 3PN7B 1SKTA 4YBHB 2WCFA 1LS8A 3BOWA 3IVTA 3TUYC 3BYAA 1W7JB 4Q04A 5DKQA 1A75B 1Y0VH 5AXIA 4A4BA 3R1VA 3CZTX 4UPGA 2CCMA 4L9MA 1JUOA 1N65A 1HT9A 3LK1A 3EKJA 2G2BA 3D74A 3OB1B 4P2YB 2Q4UA 3CZ1A 3IQOA 5FI6A 1OZSA 1F4QA 3KO0A 1J7QA 1LINA 2JNXA 2QACA 3L47A 3EK4A 1CFCA 3R1OA 1ZOTB 4KYNA 4MN0A 1CFPA 4OR9B 2MRDA 4PE7A 2ERBA 1NSHA 1NX0A 1YX7A 1ZFSA 1DJHA 1XVJA 2BL0C 1DEKA 1SL7A 3O4XA 3PN7C 4NDCA 4PHKA 4U8DA 5B8IB 1PRWA 1OOJA 1FBVA 1QX2A 2HETA 2KBIA 4JPZB 5HYDA 2MA2A 3NSOA 5AERA 4GFTA 1TNQA 1XFWO 2JQ6A 2BCBA 3AAJA 4PT1A 4OVNF 5KU1A 1FPWA 2KAYA 2Y1NA 2QDIA 1QV0A 3K21A 2OS8C 1ALVA 3A8RA 3FWBA 1CMGA 3PM2A 1CLMA 4ICBA 1AP4A 3BUWB 2EC6C 2LP2A 5I2LA 2GGMA 2O60A 1X02A 2PALA 1IG5A 1K93D 3ICBA 1A2XA 1BMOA 3D73A 5D3OA 1Y6WA 2F33A 2K0JA 2ZN8A 2NZ0A 3BUMB 5CSIA 1IH0A 1WRZA 2JXCA 3PM8A 1JWDA 4GAOA 2BKHB 5DKNA 3D76A 4GPLB 1J1EA 4MSPA 1DJWA 3I5FB 1CFDA 1K95A 3SG5A 3CYZA 2H8VA 1PVBA 3EK8A 2AUCA 3SS5A 1M63B 3DF0B 3FWCA 1LXFC 1XA5A 2HQWA 2K2FA 1QIWA 2P6BB 1QVIZ 3S0FA 2WCBA 3NHIA 5J3XA 1DF0A 1CKKA 4NDBA 2OTGB 1OE9B 1PULA 1OOFA 1C07A 1EL4A 4MEWA 1DGVA 1JSAA 3B87A 3HCMA 4GBAA 1RTP1 2I18A 4M2OA 2M7NA 4DRWA 1K9UA 2K61A 1PSBA 2JWWA 1S5GZ 1YVLA 1ZACA 1SCMC 1T14A 1KFUS 2KAXA 2AAOA 2KI6D 3BFBA 1DF0B 2DOQA 2M9GA 4GGFA 5AEQA 3DVMA 2GTEA 1A4PA 3TZ1A 2LMUA 4YI9A 1JFJA 3SIBA 2ZNDA 3CR5X 1RROA 3CDNA 1BR1B 1GJYA 1OW4A 1UHKA 2H61C 2VRGA 1XFRA 1UHJA 1IJ6A 2CT9A 3FE6A 3H4SE 5JJGA 1UP5A 2KYFA 4MVFA 2WORA 2FJUB 1GQMA 2L4IA 1KCYA 1B8RA 2P71A 3CABA 3DZTA 3GOFA 1DMOA 2BKIB 1DTLA 2BE4A 4CFQA 2KI6C 2LUXA 2JULA 4GNKB 2ZRTA 1F55A 1MWNA 1OMRA 1CDMA 3CR4X 4PHMA 1L2OC 3B7AA 1AHRA 3TUYB 4QJ3B 4YGCB 1KQMC 2WCKA 5HLVA 1S1EA 3B6XA 5IBWA 1TCFA 2BAPA 5I94A 3CZ0A 3K1EA 1Y1XA 2QPTA 1OOGA 1IQ5A 1ORGA 1KFXS 1JBAA 3BFHA 2KFHA 3PFVA 4JWQA 1YX8A 2K8MB 3WHUB 1YUTA 1EG3A 2PRUA 2JT0A 4OCIA 2L51A 1CFFA 1TWOA 2PASA 2JNFA 2KGRA 2LVVA 3BUNB 3Q8IA 3OHMB 2AMIA 5D7FA 3BUXB 3PLFB 3VRRA 1PVAA 1IGVA 5I8NA 1NX3A 4GGNA 5KSZA 2LC5A 2KFFA 1D1OA 1B9AA 2BE6A 2BL0B 2KQYA
chains in the Genus database with same CATH topology
4PCWA 1QIVA 4YGAA 5HKZA 1ALWA 3OB2B 1CM4A 2KHNA 2HF5A 1YURA 1SK6D 3SG2A 1S26D 3LLEA 1YR5A 2LCPA 3EKHA 1XFZO 1RFJA 2IS9A 1DJIA 1QV1A 3I5GC 4PALA 2BCAA 2OS8B 3NSLA 4TNCA 1S6JA 1RWYA 1QX5B 1DJGA 1SW8A 2L98A 1TTXA 1UHNA 2LUCA 3HX4A 1KK8C 4P2YB 4XYNA 2EC6B 3CGAA 2M1KB 1K8UA 1PALA 1SPYA 2JZIA 4I5KA 1QASA 2MAZA 2Y1MA 1B7TY 1TNPA 1S36A 1S3PA 3GK1A 2LNKA 2KAVA 4PE4A 1G33A 1J7RA 5F6TA 2LVKA 4YGEB 3O6BA 5DKRA 4C0LA 2B1UA 2LLSA 2LMVA 1EJ3A 3NSIA 3MSEB 1VRKA 1OMVA 3FIAA 4MRXA 3CLNA 3TDUA 1R6PA 2K7BA 2L50A 2BCXA 5HKYA 2NCOA 3I5HC 2PSRA 1IJ5A 2WC8A 1XO5A 3CTNA 4DCKA 1TCOB 1YTZC 3D0YB 3JVTC 3SG7A 1RK9A 1BF5A 2HPSA 4NQGA 4AQIA 4PHJA 1SL8A 2K7DA 1GGWA 3VRNA 1DJXA 1HQVA 2PVBA 3DF0A 1UURA 1QATA 4YI8A 1CNPA 1F70A 4M2PA 4MZLA 1CLBA 3CWGA 1BR4B 2ISDA 1SCMB 1H8BA 1B1GA 4FTGA 2JU0A 3AKAA 1AK8A 1CDLA 2GV5A 2KOTA 2O5GA 1UHIA 5HLOA 3GK2A 1RECA 2V53A 1TNXA 2KDHA 3EVRA 2E30A 3GK4X 3VRPA 1K9PA 1RJVA 2LVJA 2MLEC 1ODBA 3DVJA 3AAKA 1CLLA 3ZNIA 1H4BA 4MRYA 1AJ4A 2OPOA 3PSRA 5GQQC 1NIWA 1L2OB 1BLQA 4AQJA 1QLKA 5KTYA 1KQMB 4XJKA 3E3RA 1QLSA 1M39A 1KSOA 4HRHA 3NXAA 3JTDC 4ZCUA 1KK7Z 2KYCA 2PMYA 1S6IA 4R1EA 2JOJA 4NDDA 3VRQA 1YUUA 2LLUA 1NUBA 1SBJA 2BBNA 3FS7A 3KEVA 1N0YA 1BU3A 1SR6C 4DIRA 2SCPA 1C7VA 1V1GA 4XJKB 4D1EA 1KWOC 2D8NA 3BQ3A 1A03A 1K94A 3RLZA 1CTRA 4PDZA 4CIDA 3OP0A 1NCYA 5ER5A 2LVIA 3SG6A 4A4CA 5BPJA 2K7CA 1B8CA 4ORAB 2F3ZA 5K89A 3SJSA 1LA3A 1M46A 2JT3A 2M29A 1Q80A 1L7ZA 1YRTB 1N2DA 1QVIY 3I5GB 4MZKA 1F54A 4WQ3A 1M31A 2MJWB 4E68A 3QRXA 4IL1A 1KK8B 3KHEA 2COLB 2L5XB 1PSRA 3OX5A 3RM1A 3LK0A 1SY9A 1XK4C 1WY9A 3LCPC 4C0KA 1IQ3A 1JF0A 1S5GY 3A4UB 3CR2A 3EVVA 1W7IB 2ZFDA 2KGBC 1K90D 1MR8A 2KI4C 1B7TZ 1BJFA 3O2PA 4PE1A 3O4YA 2EHBA 1MXLC 4ZCVA 1KSMA 4ETOA 1NPQA 1J7OA 4FQOA 2M0RA 1B8LA 2L2EA 3I5HB 1G4YR 3WHTB 4OKHA 3SIAA 1JFKA 1JF2A 4BY4A 4ORCB 3JVTB 1Y1UA 2JXLA 4WQ2A 3D10A 1DT7B 3KPXA 1QX7A 2KNEA 1SNLA 2FCEA 1DJYA 3C1VA 1B47A 2JTZA 4YGBB 3ZWHA 1CB1A 2Y5IA 4CPVA 1F8HA 3PATA 2GGZA 4MLWA 2JPTA 5CSJA 1B4CA 3BXKA 2R2IA 3I5IC 1FI6A 3M0WA 2M3WA 2F2PA 3TDIA 3D0YA 1NYAA 1EG4A 2SASA 2BBMA 1QJTA 1WRLA 2NCPA 3LL8B 1MHOA 2MBXA 1XFXO 4DS7A 5AANA 1TIZA 2JRFA 2LE9B 1V1FA 4HREE 3BOWB 4USLA 1C7WA 4GUKA 1BODA 1MQ1A 1SMGA 2LLTA 1CDPA 1GGZA 5I2OA 1IKUA 2L4HA 2A4JA 1OZOA 3WXAA 1MXEA 2F3YA 4N5XA 1CMFA 2LHLA 1WDCC 2H61A 4HRGA 1J1DA 2LV7A 1IWQA 1FF1A 2M8UA 1OSAA 4M2QA 3EVUA 1NCXA 1TN4A 1KFUL 2CBLA 2KFGA 3O78A 3BUOB 3CS1A 1BOCA 3JTDB 1EXRA 1J7PA 2JTTA 5AFPA 5CSNA 5FYXA 1LA0A 2ZN9A 3EK7A 5ER4X 1SRAA 2LHIA 2I94A 1WRKA 2K7OA 1CDNA 1BT6A 3KF9A 1E8AA 2EGDA 1SR6B 2KBMA 2LP3A 4JQ0D 1KWOB 1TOPA 2F2OA 4HSZA 1DGUA 3WNXB 1K9KA 1WLZA 1PK0D 2JC2A 1J55A 2L0PA 1OMDA 1KQVA 1NP8A 1K2HA 2JT8A 2E6WA 2LM5A 2FCDA 1F4OA 1Y1AA 2I7AA 2BECA 2HQ8A 4MBEA 5G08A 3TDZA 4YRUA 2TN4A 2RGIA 3SG3A 2M49B 2G9BA 2WCEA 3F45A 1DJZA 1XK4A 1KFXL 1QS7A 1WLMA 1LVCD 1FI5A 2M1UA 1NX1A 3DVEA 1BG1A 4QJ4B 2WNDA 5JOLA 2ZKMX 2LAPA 1ZUZA 2CNPA 2MLFC 5D69A 1XFVO 1UWOA 5PALA 1S6CA 3NSKA 1NWDA 4WRIA 1F71A 3VROA 3OX6A 5CSFA 3TS5B 2KI4B 1FW4A 1YRUB 1UHHA 2FOTA 4CFRA 2Q91A 2H2KA 1TNWA 2WOSA 2NXQA 1XYDA 2MHHA 1MF8B 4BY5A 3I5FC 1JC2A 3IF7A 4OV2A 2KSPA 4MZJA 4PE0A 2K2AA 5HKWA 4I5JA 1AUIB 1IRJA 1AVSA 1SCVA 1TRFA 4C0JA 1CM1A 5TNCA 1A29A 1QXPA 2ZNEA 1EH2A 1YVHA 1R2UA 1LKJA 1OQPA 2CTNA 2OTGC 1MUXA 1K96A 2Y4QA 4AOMA 3IQQA 1U5IA 1UUSA 4I5LB 2F8PA 3I5IB 3TS5C 1KK7Y 1NCZA 2M7LA 3VGOA 1QTXA 2KQ6A 4F0ZB 5I2QA 4YGDB 1XFUO 3AKBA 4N1GA 1AJ5A 4PHNA 2CXJA 4N1FA 3DD4A 2NLNA 1G8IA 1M45A 2ZRSA 4P5OE 1ZMZA 2M97A 4DUQA 2LANA 1U5IB 4CLNA 1XFYO 1SL9A 1DVIA 1A75A 3DVKA 3PALA 2LMTA 4GGFC 1WDCB 2I2RE 4ORBB 1NX2A 1YUSA 4I5NB 3SG4A 4QJ5B 1SYMA 3PN7B 1SKTA 4YBHB 2WCFA 3BOWA 3TUYC 3BYAA 1W7JB 4Q04A 5DKQA 1A75B 1Y0VH 5AXIA 4A4BA 3CZTX 4UPGA 2CCMA 4L9MA 1JUOA 1N65A 1HT9A 3LK1A 3EKJA 2G2BA 3OB1B 2Q4UA 3IQOA 1OZSA 1F4QA 3KO0A 1J7QA 1LINA 2JNXA 2QACA 3EK4A 1CFCA 4MN0A 1ZOTB 1CFPA 4OR9B 2MRDA 4PE7A 1NSHA 1NX0A 1YX7A 1ZFSA 1DJHA 1XVJA 2BL0C 1SL7A 3PN7C 4NDCA 4PHKA 4U8DA 5B8IB 1PRWA 1OOJA 1FBVA 1QX2A 2HETA 2KBIA 4JPZB 5HYDA 2MA2A 3NSOA 5AERA 4GFTA 1TNQA 1XFWO 2JQ6A 2BCBA 3AAJA 5KU1A 4OVNF 1FPWA 2KAYA 2Y1NA 1QV0A 3K21A 2OS8C 1ALVA 3A8RA 3FWBA 1CMGA 1CLMA 4ICBA 1AP4A 3BUWB 2EC6C 2LP2A 5I2LA 2GGMA 2O60A 1X02A 2PALA 1IG5A 1K93D 3ICBA 1A2XA 1BMOA 1Y6WA 2F33A 2K0JA 2ZN8A 2NZ0A 3BUMB 5CSIA 1IH0A 1WRZA 2JXCA 3PM8A 1JWDA 4GAOA 2BKHB 5DKNA 4GPLB 1J1EA 4MSPA 1DJWA 3I5FB 1CFDA 1K95A 3SG5A 1PVBA 3EK8A 2AUCA 1M63B 3DF0B 3FWCA 1LXFC 1XA5A 2HQWA 2K2FA 1QIWA 2P6BB 1QVIZ 2WCBA 5J3XA 1DF0A 1CKKA 4NDBA 2OTGB 1OE9B 1PULA 1C07A 1EL4A 4MEWA 1DGVA 1JSAA 3HCMA 4GBAA 1RTP1 2I18A 4M2OA 2M7NA 4DRWA 1K9UA 2K61A 1PSBA 2JWWA 1S5GZ 1YVLA 1ZACA 1SCMC 1KFUS 2KAXA 2AAOA 2KI6D 4GGFA 1DF0B 2DOQA 2M9GA 5AEQA 3DVMA 1A4PA 3TZ1A 2LMUA 4YI9A 1JFJA 3SIBA 2ZNDA 3CR5X 1RROA 1BR1B 1GJYA 2VRGA 1UHKA 2H61C 5CPVA 3H4SE 1UHJA 1IJ6A 2CT9A 5JJGA 1UP5A 2KYFA 4MVFA 2WORA 2FJUB 1GQMA 2L4IA 1KCYA 1B8RA 3GOFA 1DMOA 2BKIB 1DTLA 2BE4A 4CFQA 2KI6C 2LUXA 2JULA 4GNKB 2ZRTA 1F55A 1MWNA 1OMRA 1CDMA 3CR4X 4PHMA 1L2OC 1AHRA 3TUYB 4QJ3B 4YGCB 1KQMC 5HLVA 1S1EA 5IBWA 1TCFA 1Y1XA 2QPTA 1IQ5A 1JBAA 1KFXS 2KFHA 3PFVA 4JWQA 1YX8A 2K8MB 3WHUB 1YUTA 1EG3A 2PRUA 2JT0A 4OCIA 2L51A 1CFFA 2PASA 2JNFA 2KGRA 2LVVA 3BUNB 3OHMB 2AMIA 5D7FA 3BUXB 3PLFB 3VRRA 1PVAA 1IGVA 5I8NA 1NX3A 4GGNA 5KSZA 2LC5A 2KFFA 1D1OA 1B9AA 2BE6A 2BL0B 2KQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCW A;  1QIV A;  4YGA A;  5HKZ A;  1ALW A;  3OB2 B;  1CM4 A;  2KHN A;  2HF5 A;  1YUR A;  1SK6 D;  3SG2 A;  1S26 D;  3LLE A;  1YR5 A;  2LCP A;  3EKH A;  1XFZ O;  1RFJ A;  2IS9 A;  1DJI A;  1QV1 A;  3I5G C;  4PAL A;  2BCA A;  2OS8 B;  3NSL A;  4TNC A;  1S6J A;  1RWY A;  1QX5 B;  1DJG A;  1SW8 A;  2L98 A;  1TTX A;  1UHN A;  2LUC A;  3HX4 A;  1KK8 C;  4P2Y B;  4XYN A;  2EC6 B;  3CGA A;  2M1K B;  1K8U A;  1PAL A;  1SPY A;  2JZI A;  4I5K A;  1QAS A;  2MAZ A;  2Y1M A;  1B7T Y;  1TNP A;  1S36 A;  1S3P A;  3GK1 A;  2LNK A;  2KAV A;  4PE4 A;  1G33 A;  1J7R A;  5F6T A;  2LVK A;  4YGE B;  3O6B A;  5DKR A;  4C0L A;  2B1U A;  2LLS A;  2LMV A;  1EJ3 A;  3NSI A;  3MSE B;  1VRK A;  1OMV A;  3FIA A;  4MRX A;  3CLN A;  3TDU A;  1R6P A;  2K7B A;  2L50 A;  2BCX A;  5HKY A;  2NCO A;  3I5H C;  2PSR A;  1IJ5 A;  2WC8 A;  1XO5 A;  3CTN A;  4DCK A;  1TCO B;  1YTZ C;  3D0Y B;  3JVT C;  3SG7 A;  1RK9 A;  1BF5 A;  2HPS A;  4NQG A;  4AQI A;  4PHJ A;  1SL8 A;  2K7D A;  1GGW A;  3VRN A;  1DJX A;  1HQV A;  2PVB A;  3DF0 A;  1UUR A;  1QAT A;  4YI8 A;  1CNP A;  1F70 A;  4M2P A;  4MZL A;  1CLB A;  3CWG A;  1BR4 B;  2ISD A;  1SCM B;  1H8B A;  1B1G A;  4FTG A;  2JU0 A;  3AKA A;  1AK8 A;  1CDL A;  2GV5 A;  2KOT A;  2O5G A;  1UHI A;  5HLO A;  3GK2 A;  1REC A;  2V53 A;  1TNX A;  2KDH A;  3EVR A;  2E30 A;  3GK4 X;  3VRP A;  1K9P A;  1RJV A;  2LVJ A;  2MLE C;  1ODB A;  3DVJ A;  3AAK A;  1CLL A;  3ZNI A;  1H4B A;  4MRY A;  1AJ4 A;  2OPO A;  3PSR A;  5GQQ C;  1NIW A;  1L2O B;  1BLQ A;  4AQJ A;  1QLK A;  5KTY A;  1KQM B;  4XJK A;  3E3R A;  1QLS A;  1M39 A;  1KSO A;  4HRH A;  3NXA A;  3JTD C;  4ZCU A;  1KK7 Z;  2KYC A;  2PMY A;  1S6I A;  4R1E A;  2JOJ A;  4NDD A;  3VRQ A;  1YUU A;  2LLU A;  1NUB A;  1SBJ A;  2BBN A;  3FS7 A;  3KEV A;  1N0Y A;  1BU3 A;  1SR6 C;  4DIR A;  2SCP A;  1C7V A;  1V1G A;  4XJK B;  4D1E A;  1KWO C;  2D8N A;  3BQ3 A;  1A03 A;  1K94 A;  3RLZ A;  1CTR A;  4PDZ A;  4CID A;  3OP0 A;  1NCY A;  5ER5 A;  2LVI A;  3SG6 A;  4A4C A;  5BPJ A;  2K7C A;  1B8C A;  4ORA B;  2F3Z A;  5K89 A;  3SJS A;  1LA3 A;  1M46 A;  2JT3 A;  2M29 A;  1Q80 A;  1L7Z A;  1YRT B;  1N2D A;  1QVI Y;  3I5G B;  4MZK A;  1F54 A;  4WQ3 A;  1M31 A;  2MJW B;  4E68 A;  3QRX A;  4IL1 A;  1KK8 B;  3KHE A;  2COL B;  2L5X B;  1PSR A;  3OX5 A;  3RM1 A;  3LK0 A;  1SY9 A;  1XK4 C;  1WY9 A;  3LCP C;  4C0K A;  1IQ3 A;  1JF0 A;  1S5G Y;  3A4U B;  3CR2 A;  3EVV A;  1W7I B;  2ZFD A;  2KGB C;  1K90 D;  1MR8 A;  2KI4 C;  1B7T Z;  1BJF A;  3O2P A;  4PE1 A;  3O4Y A;  2EHB A;  1MXL C;  4ZCV A;  1KSM A;  4ETO A;  1NPQ A;  1J7O A;  4FQO A;  2M0R A;  1B8L A;  2L2E A;  3I5H B;  1G4Y R;  3WHT B;  4OKH A;  3SIA A;  1JFK A;  1JF2 A;  4BY4 A;  4ORC B;  3JVT B;  1Y1U A;  2JXL A;  4WQ2 A;  3D10 A;  1DT7 B;  3KPX A;  1QX7 A;  2KNE A;  1SNL A;  2FCE A;  1DJY A;  3C1V A;  1B47 A;  2JTZ A;  4YGB B;  3ZWH A;  1CB1 A;  2Y5I A;  4CPV A;  1F8H A;  3PAT A;  2GGZ A;  4MLW A;  2JPT A;  5CSJ A;  1B4C A;  3BXK A;  2R2I A;  3I5I C;  1FI6 A;  3M0W A;  2M3W A;  2F2P A;  3TDI A;  3D0Y A;  1NYA A;  1EG4 A;  2SAS A;  2BBM A;  1QJT A;  1WRL A;  2NCP A;  3LL8 B;  1MHO A;  2MBX A;  1XFX O;  4DS7 A;  5AAN A;  1TIZ A;  2JRF A;  2LE9 B;  1V1F A;  4HRE E;  3BOW B;  4USL A;  1C7W A;  4GUK A;  1BOD A;  1MQ1 A;  1SMG A;  2LLT A;  1CDP A;  1GGZ A;  5I2O A;  1IKU A;  2L4H A;  2A4J A;  1OZO A;  3WXA A;  1MXE A;  2F3Y A;  4N5X A;  1CMF A;  2LHL A;  1WDC C;  2H61 A;  4HRG A;  1J1D A;  2LV7 A;  1IWQ A;  1FF1 A;  2M8U A;  1OSA A;  4M2Q A;  3EVU A;  1NCX A;  1TN4 A;  1KFU L;  2CBL A;  2KFG A;  3O78 A;  3BUO B;  3CS1 A;  1BOC A;  3JTD B;  1EXR A;  1J7P A;  2JTT A;  5AFP A;  5CSN A;  5FYX A;  1LA0 A;  2ZN9 A;  3EK7 A;  5ER4 X;  1SRA A;  2LHI A;  2I94 A;  1WRK A;  2K7O A;  1CDN A;  1BT6 A;  3KF9 A;  1E8A A;  2EGD A;  1SR6 B;  2KBM A;  2LP3 A;  4JQ0 D;  1KWO B;  1TOP A;  2F2O A;  4HSZ A;  1DGU A;  3WNX B;  1K9K A;  1WLZ A;  1PK0 D;  2JC2 A;  1J55 A;  2L0P A;  1OMD A;  1KQV A;  1NP8 A;  1K2H A;  2JT8 A;  2E6W A;  2LM5 A;  2FCD A;  1F4O A;  1Y1A A;  2I7A A;  2BEC A;  2HQ8 A;  4MBE A;  5G08 A;  3TDZ A;  4YRU A;  2TN4 A;  2RGI A;  3SG3 A;  2M49 B;  2G9B A;  2WCE A;  3F45 A;  1DJZ A;  1XK4 A;  1KFX L;  1QS7 A;  1WLM A;  1LVC D;  1FI5 A;  2M1U A;  1NX1 A;  3DVE A;  1BG1 A;  4QJ4 B;  2WND A;  5JOL A;  2ZKM X;  2LAP A;  1ZUZ A;  2CNP A;  2MLF C;  5D69 A;  1XFV O;  1UWO A;  5PAL A;  1S6C A;  3NSK A;  1NWD A;  4WRI A;  1F71 A;  3VRO A;  3OX6 A;  5CSF A;  3TS5 B;  2KI4 B;  1FW4 A;  1YRU B;  1UHH A;  2FOT A;  4CFR A;  2Q91 A;  2H2K A;  1TNW A;  2WOS A;  2NXQ A;  1XYD A;  2MHH A;  1MF8 B;  4BY5 A;  3I5F C;  1JC2 A;  3IF7 A;  4OV2 A;  2KSP A;  4MZJ A;  4PE0 A;  2K2A A;  5HKW A;  4I5J A;  1AUI B;  1IRJ A;  1AVS A;  1SCV A;  1TRF A;  4C0J A;  1CM1 A;  5TNC A;  1A29 A;  1QXP A;  2ZNE A;  1EH2 A;  1YVH A;  1R2U A;  1LKJ A;  1OQP A;  2CTN A;  2OTG C;  1MUX A;  1K96 A;  2Y4Q A;  4AOM A;  3IQQ A;  1U5I A;  1UUS A;  4I5L B;  2F8P A;  3I5I B;  3TS5 C;  1KK7 Y;  1NCZ A;  2M7L A;  3VGO A;  1QTX A;  2KQ6 A;  4F0Z B;  5I2Q A;  4YGD B;  1XFU O;  3AKB A;  4N1G A;  1AJ5 A;  4PHN A;  2CXJ A;  4N1F A;  3DD4 A;  2NLN A;  1G8I A;  1M45 A;  2ZRS A;  4P5O E;  1ZMZ A;  2M97 A;  4DUQ A;  2LAN A;  1U5I B;  4CLN A;  1XFY O;  1SL9 A;  1DVI A;  1A75 A;  3DVK A;  3PAL A;  2LMT A;  4GGF C;  1WDC B;  2I2R E;  4ORB B;  1NX2 A;  1YUS A;  4I5N B;  3SG4 A;  4QJ5 B;  1SYM A;  3PN7 B;  1SKT A;  4YBH B;  2WCF A;  3BOW A;  3TUY C;  3BYA A;  1W7J B;  4Q04 A;  5DKQ A;  1A75 B;  1Y0V H;  5AXI A;  4A4B A;  3CZT X;  4UPG A;  2CCM A;  4L9M A;  1JUO A;  1N65 A;  1HT9 A;  3LK1 A;  3EKJ A;  2G2B A;  3OB1 B;  2Q4U A;  3IQO A;  1OZS A;  1F4Q A;  3KO0 A;  1J7Q A;  1LIN A;  2JNX A;  2QAC A;  3EK4 A;  1CFC A;  4MN0 A;  1ZOT B;  1CFP A;  4OR9 B;  2MRD A;  4PE7 A;  1NSH A;  1NX0 A;  1YX7 A;  1ZFS A;  1DJH A;  1XVJ A;  2BL0 C;  1SL7 A;  3PN7 C;  4NDC A;  4PHK A;  4U8D A;  5B8I B;  1PRW A;  1OOJ A;  1FBV A;  1QX2 A;  2HET A;  2KBI A;  4JPZ B;  5HYD A;  2MA2 A;  3NSO A;  5AER A;  4GFT A;  1TNQ A;  1XFW O;  2JQ6 A;  2BCB A;  3AAJ A;  5KU1 A;  4OVN F;  1FPW A;  2KAY A;  2Y1N A;  1QV0 A;  3K21 A;  2OS8 C;  1ALV A;  3A8R A;  3FWB A;  1CMG A;  1CLM A;  4ICB A;  1AP4 A;  3BUW B;  2EC6 C;  2LP2 A;  5I2L A;  2GGM A;  2O60 A;  1X02 A;  2PAL A;  1IG5 A;  1K93 D;  3ICB A;  1A2X A;  1BMO A;  1Y6W A;  2F33 A;  2K0J A;  2ZN8 A;  2NZ0 A;  3BUM B;  5CSI A;  1IH0 A;  1WRZ A;  2JXC A;  3PM8 A;  1JWD A;  4GAO A;  2BKH B;  5DKN A;  4GPL B;  1J1E A;  4MSP A;  1DJW A;  3I5F B;  1CFD A;  1K95 A;  3SG5 A;  1PVB A;  3EK8 A;  2AUC A;  1M63 B;  3DF0 B;  3FWC A;  1LXF C;  1XA5 A;  2HQW A;  2K2F A;  1QIW A;  2P6B B;  1QVI Z;  2WCB A;  5J3X A;  1DF0 A;  1CKK A;  4NDB A;  2OTG B;  1OE9 B;  1PUL A;  1C07 A;  1EL4 A;  4MEW A;  1DGV A;  1JSA A;  3HCM A;  4GBA A;  1RTP 1;  2I18 A;  4M2O A;  2M7N A;  4DRW A;  1K9U A;  2K61 A;  1PSB A;  2JWW A;  1S5G Z;  1YVL A;  1ZAC A;  1SCM C;  1KFU S;  2KAX A;  2AAO A;  2KI6 D;  4GGF A;  1DF0 B;  2DOQ A;  2M9G A;  5AEQ A;  3DVM A;  1A4P A;  3TZ1 A;  2LMU A;  4YI9 A;  1JFJ A;  3SIB A;  2ZND A;  3CR5 X;  1RRO A;  1BR1 B;  1GJY A;  2VRG A;  1UHK A;  2H61 C;  5CPV A;  3H4S E;  1UHJ A;  1IJ6 A;  2CT9 A;  5JJG A;  1UP5 A;  2KYF A;  4MVF A;  2WOR A;  2FJU B;  1GQM A;  2L4I A;  1KCY A;  1B8R A;  3GOF A;  1DMO A;  2BKI B;  1DTL A;  2BE4 A;  4CFQ A;  2KI6 C;  2LUX A;  2JUL A;  4GNK B;  2ZRT A;  1F55 A;  1MWN A;  1OMR A;  1CDM A;  3CR4 X;  4PHM A;  1L2O C;  1AHR A;  3TUY B;  4QJ3 B;  4YGC B;  1KQM C;  5HLV A;  1S1E A;  5IBW A;  1TCF A;  1Y1X A;  2QPT A;  1IQ5 A;  1JBA A;  1KFX S;  2KFH A;  3PFV A;  4JWQ A;  1YX8 A;  2K8M B;  3WHU B;  1YUT A;  1EG3 A;  2PRU A;  2JT0 A;  4OCI A;  2L51 A;  1CFF A;  2PAS A;  2JNF A;  2KGR A;  2LVV A;  3BUN B;  3OHM B;  2AMI A;  5D7F A;  3BUX B;  3PLF B;  3VRR A;  1PVA A;  1IGV A;  5I8N A;  1NX3 A;  4GGN A;  5KSZ A;  2LC5 A;  2KFF A;  1D1O A;  1B9A A;  2BE6 A;  2BL0 B;  2KQY A; 
#chains in the Genus database with same CATH topology
 4PCW A;  1QIV A;  2KLD A;  4YGA A;  5HKZ A;  1ALW A;  3OB2 B;  1CM4 A;  2KHN A;  3S0G A;  2HF5 A;  1YUR A;  1SK6 D;  3SG2 A;  1W9Z A;  3S0A A;  1S26 D;  3LLE A;  1YR5 A;  2LCP A;  3EKH A;  1XFZ O;  1RFJ A;  2IS9 A;  1DJI A;  1QV1 A;  3I5G C;  4PAL A;  2BCA A;  2OS8 B;  3NSL A;  4TNC A;  3S0B A;  1S6J A;  1RWY A;  1QX5 B;  1DJG A;  1SW8 A;  2L98 A;  1TTX A;  1UHN A;  2LUC A;  3HX4 A;  1KK8 C;  3R72 A;  4XYN A;  2EC6 B;  3CGA A;  2M1K B;  1K8U A;  1PAL A;  1SPY A;  2JZI A;  4I5K A;  1QAS A;  2MAZ A;  2Y1M A;  3CZ2 A;  1B7T Y;  1TNP A;  1S36 A;  1S3P A;  3GK1 A;  2LNK A;  2KAV A;  4PE4 A;  1G33 A;  1J7R A;  5F6T A;  2LVK A;  2KPH A;  4YGE B;  3O6B A;  5DKR A;  4C0L A;  2B1U A;  2LLS A;  2LMV A;  1EJ3 A;  3NSI A;  3QME A;  3MSE B;  1VRK A;  1OMV A;  3FIA A;  4MRX A;  3CLN A;  3TDU A;  1R6P A;  2K7B A;  3SS3 A;  2L50 A;  2BCX A;  5HKY A;  2NCO A;  3I5H C;  2PSR A;  1IJ5 A;  2WC8 A;  1Z2C B;  1XO5 A;  3CTN A;  4DCK A;  1TCO B;  1YTZ C;  3D0Y B;  3DYE A;  3JVT C;  1RK9 A;  3SG7 A;  1BF5 A;  2HPS A;  4NQG A;  4AQI A;  4FQT A;  4PHJ A;  1SL8 A;  2K7D A;  1C3Y A;  1GGW A;  3VRN A;  1DEL A;  1DJX A;  1HQV A;  2PVB A;  3DF0 A;  1UUR A;  5CPV A;  1P28 A;  1QAT A;  1TUZ A;  4YI8 A;  3V2L A;  1CNP A;  1F70 A;  4M2P A;  4MZL A;  1CLB A;  3CWG A;  1BR4 B;  2ISD A;  1SCM B;  1H8B A;  1B1G A;  4FTG A;  2JU0 A;  3AKA A;  1AK8 A;  1CDL A;  2GV5 A;  2KOT A;  2O5G A;  1UHI A;  5HLO A;  1SSE B;  3GK2 A;  1REC A;  2V53 A;  3D78 A;  1TNX A;  2KDH A;  3EVR A;  2E30 A;  3GK4 X;  3VRP A;  3OGN A;  1K9P A;  1RJV A;  2LVJ A;  2MLE C;  1ODB A;  3DVJ A;  3AAK A;  1CLL A;  3SS4 A;  3ZNI A;  1H4B A;  3BFA A;  4MRY A;  3RZS A;  1AJ4 A;  1TUJ A;  2OPO A;  3PSR A;  2L2C A;  5GQQ C;  1NIW A;  1L2O B;  2PYQ A;  1BLQ A;  4AQJ A;  1QLK A;  5KTY A;  1KQM B;  3N7H A;  3E3R A;  4XJK A;  1QLS A;  1M39 A;  1KSO A;  4HRH A;  3NXA A;  3JTD C;  4ZCU A;  1KK7 Z;  2KYC A;  2PMY A;  1S6I A;  4R1E A;  2JOJ A;  4NDD A;  3VRQ A;  1YUU A;  2LLU A;  1NUB A;  1SBJ A;  2BBN A;  3FS7 A;  3KEV A;  1N0Y A;  1BU3 A;  1SR6 C;  4DIR A;  2SCP A;  1C7V A;  1V1G A;  2WCM A;  4XJK B;  4D1E A;  1GM0 A;  1KWO C;  2D8N A;  3BQ3 A;  3L4L A;  1A03 A;  5DIC A;  2QEB A;  1K94 A;  3RLZ A;  1CTR A;  4PDZ A;  5HL1 A;  4CID A;  3OP0 A;  1NCY A;  5ER5 A;  2LVI A;  3UNW A;  3SG6 A;  4A4C A;  5BPJ A;  2WCJ A;  2K7C A;  1B8C A;  3UO9 A;  4ORA B;  2F3Z A;  1OOH A;  5K89 A;  3SJS A;  1LA3 A;  1QWV A;  1M46 A;  2WCL A;  2JT3 A;  2M29 A;  1Q80 A;  1L7Z A;  1YRT B;  1N2D A;  1QVI Y;  3I5G B;  4MZK A;  3S0D A;  1F54 A;  4WQ3 A;  1M31 A;  2MJW B;  4E68 A;  3QRX A;  4IL1 A;  1KK8 B;  3KHE A;  5FI2 A;  2COL B;  2L5X B;  1PSR A;  3OX5 A;  3RM1 A;  3LK0 A;  2KLE A;  1SY9 A;  1XK4 C;  1WY9 A;  3LCP C;  4C0K A;  1IQ3 A;  4OZD A;  1JF0 A;  1S5G Y;  3A4U B;  3CR2 A;  3EVV A;  1W7I B;  2ZFD A;  2KGB C;  1K90 D;  1MR8 A;  2KI4 C;  3PJI A;  1B7T Z;  1BJF A;  3O2P A;  4PE1 A;  3O4Y A;  2EHB A;  1MXL C;  4ZCV A;  1KSM A;  4ETO A;  1NPQ A;  1J7O A;  4FQO A;  2M0R A;  3NHT A;  2K60 A;  1B8L A;  2L2E A;  3I5H B;  1G4Y R;  3WHT B;  4OKH A;  3SIA A;  1JFK A;  1JF2 A;  2P70 A;  3OBV A;  4ORC B;  3S0E A;  3FE9 A;  4BY4 A;  3JVT B;  1Y1U A;  2JXL A;  4WQ2 A;  3D10 A;  1DT7 B;  3KPX A;  1QX7 A;  2KNE A;  1SNL A;  2FCE A;  1DJY A;  3C1V A;  3DY9 A;  1B47 A;  2QEH A;  2JTZ A;  4YGB B;  3ZWH A;  1CB1 A;  2Y5I A;  4CPV A;  1F8H A;  2YGU A;  3PAT A;  2GGZ A;  4MLW A;  2JPT A;  5CSJ A;  3BJH A;  1B4C A;  3BXK A;  2R2I A;  3I5I C;  1FI6 A;  3M0W A;  2M3W A;  2F2P A;  3TDI A;  3D0Y A;  1NYA A;  2PQL A;  1EG4 A;  2SAS A;  2BBM A;  3D75 A;  1QJT A;  1WRL A;  2NCP A;  3LL8 B;  1MHO A;  2MBX A;  1XFX O;  2WCH A;  5AAN A;  4DS7 A;  1TIZ A;  2JRF A;  2LE9 B;  3VB1 A;  1V1F A;  1DC1 A;  4HRE E;  3BOW B;  4USL A;  1C7W A;  4GUK A;  1BOD A;  1MQ1 A;  1SMG A;  2LLT A;  1CDP A;  1GGZ A;  5I2O A;  1IKU A;  2L4H A;  2A4J A;  1OZO A;  4INW A;  3WXA A;  1MXE A;  2F3Y A;  4N5X A;  1CMF A;  2LHL A;  1WDC C;  2H61 A;  4HRG A;  1J1D A;  2LV7 A;  1IWQ A;  1FF1 A;  2M8U A;  1OSA A;  1OOI X;  4M2Q A;  3EVU A;  1NCX A;  1TN4 A;  1KFU L;  2CBL A;  3L4A A;  2KFG A;  3O78 A;  3BUO B;  3CS1 A;  1BOC A;  3JTD B;  1EXR A;  1J7P A;  2JTT A;  5AFP A;  5CSN A;  5FYX A;  1LA0 A;  2ZN9 A;  3EK7 A;  5ER4 X;  1SRA A;  2LHI A;  2I94 A;  1WRK A;  2K7O A;  1CDN A;  1BT6 A;  3KF9 A;  1E8A A;  2EGD A;  1SR6 B;  2KBM A;  2WC6 A;  5EL2 A;  2LP3 A;  4JQ0 D;  1KWO B;  1TOP A;  2F2O A;  4HSZ A;  1DGU A;  3WNX B;  1K9K A;  1WLZ A;  1PK0 D;  2JC2 A;  1J55 A;  2L0P A;  1OMD A;  1KQV A;  1NP8 A;  4IJ7 A;  1K2H A;  2JT8 A;  2E6W A;  2LM5 A;  2FCD A;  3R1P A;  1F4O A;  1Y1A A;  2I7A A;  2BEC A;  2HQ8 A;  4MBE A;  5G08 A;  3TDZ A;  4YRU A;  2TN4 A;  2RGI A;  3SG3 A;  2M49 B;  3NGV A;  2G9B A;  2WCE A;  3F45 A;  1DJZ A;  1XK4 A;  4INX A;  1KFX L;  1IIO A;  1QS7 A;  2JPO A;  1WLM A;  1LVC D;  4F7F A;  1FI5 A;  1DQE A;  2L5Y A;  1C3Z A;  2M1U A;  2QEO A;  4JKT A;  1NX1 A;  3DVE A;  2WC5 A;  1BG1 A;  4QJ4 B;  2WND A;  5JOL A;  2ZKM X;  2LAP A;  1ZUZ A;  2CNP A;  2MLF C;  5D69 A;  1XFV O;  1UWO A;  5PAL A;  1S6C A;  3NSK A;  1NWD A;  4WRI A;  1F71 A;  3VRO A;  3OX6 A;  5CSF A;  3TS5 B;  2KI4 B;  1FW4 A;  1YRU B;  1UHH A;  2FOT A;  4CFR A;  2Q91 A;  2H2K A;  1TNW A;  2WOS A;  2NXQ A;  1XYD A;  5FI7 A;  2MHH A;  1MF8 B;  4BY5 A;  3I5F C;  1JC2 A;  3IF7 A;  4OV2 A;  2KSP A;  3D77 A;  4MZJ A;  4PE0 A;  2K2A A;  5HKW A;  4I5J A;  3B88 A;  1AUI B;  1IRJ A;  1AVS A;  1SCV A;  1TRF A;  4C0J A;  1CM1 A;  5TNC A;  1A29 A;  1QXP A;  2ZNE A;  1EH2 A;  1YVH A;  1R2U A;  3DXL A;  1LKJ A;  1OQP A;  2CTN A;  2QEV A;  2OTG C;  1MUX A;  1K96 A;  2Y4Q A;  4AOM A;  3IQQ A;  1U5I A;  1UUS A;  3FE8 A;  4I5L B;  2F8P A;  3I5I B;  3TS5 C;  2BNX A;  1KK7 Y;  1NCZ A;  2M7L A;  3VGO A;  1QTX A;  2KQ6 A;  4F0Z B;  5I2Q A;  4YGD B;  1XFU O;  3AKB A;  4N1G A;  1AJ5 A;  4PHN A;  2CXJ A;  4N1F A;  3DD4 A;  2NLN A;  1G8I A;  1M45 A;  2ZRS A;  4P5O E;  1ZMZ A;  4JD9 A;  2M97 A;  4DUQ A;  2LAN A;  1U5I B;  4CLN A;  3B86 A;  2FJY A;  1XFY O;  1SL9 A;  1DVI A;  1A75 A;  3DVK A;  3PAL A;  2LMT A;  4GGF C;  1WDC B;  2I2R E;  4ORB B;  1NX2 A;  1YUS A;  3EG5 B;  4I5N B;  3SG4 A;  1Z4H A;  4QJ5 B;  1SYM A;  3PN7 B;  1SKT A;  4YBH B;  2WCF A;  1LS8 A;  3BOW A;  3IVT A;  3TUY C;  3BYA A;  1W7J B;  4Q04 A;  5DKQ A;  1A75 B;  1Y0V H;  5AXI A;  4A4B A;  3R1V A;  3CZT X;  4UPG A;  2CCM A;  4L9M A;  1JUO A;  1N65 A;  1HT9 A;  3LK1 A;  3EKJ A;  2G2B A;  3D74 A;  3OB1 B;  4P2Y B;  2Q4U A;  3CZ1 A;  3IQO A;  5FI6 A;  1OZS A;  1F4Q A;  3KO0 A;  1J7Q A;  1LIN A;  2JNX A;  2QAC A;  3L47 A;  3EK4 A;  1CFC A;  3R1O A;  1ZOT B;  4KYN A;  4MN0 A;  1CFP A;  4OR9 B;  2MRD A;  4PE7 A;  2ERB A;  1NSH A;  1NX0 A;  1YX7 A;  1ZFS A;  1DJH A;  1XVJ A;  2BL0 C;  1DEK A;  1SL7 A;  3O4X A;  3PN7 C;  4NDC A;  4PHK A;  4U8D A;  5B8I B;  1PRW A;  1OOJ A;  1FBV A;  1QX2 A;  2HET A;  2KBI A;  4JPZ B;  5HYD A;  2MA2 A;  3NSO A;  5AER A;  4GFT A;  1TNQ A;  1XFW O;  2JQ6 A;  2BCB A;  3AAJ A;  4PT1 A;  4OVN F;  5KU1 A;  1FPW A;  2KAY A;  2Y1N A;  2QDI A;  1QV0 A;  3K21 A;  2OS8 C;  1ALV A;  3A8R A;  3FWB A;  1CMG A;  3PM2 A;  1CLM A;  4ICB A;  1AP4 A;  3BUW B;  2EC6 C;  2LP2 A;  5I2L A;  2GGM A;  2O60 A;  1X02 A;  2PAL A;  1IG5 A;  1K93 D;  3ICB A;  1A2X A;  1BMO A;  3D73 A;  5D3O A;  1Y6W A;  2F33 A;  2K0J A;  2ZN8 A;  2NZ0 A;  3BUM B;  5CSI A;  1IH0 A;  1WRZ A;  2JXC A;  3PM8 A;  1JWD A;  4GAO A;  2BKH B;  5DKN A;  3D76 A;  4GPL B;  1J1E A;  4MSP A;  1DJW A;  3I5F B;  1CFD A;  1K95 A;  3SG5 A;  3CYZ A;  2H8V A;  1PVB A;  3EK8 A;  2AUC A;  3SS5 A;  1M63 B;  3DF0 B;  3FWC A;  1LXF C;  1XA5 A;  2HQW A;  2K2F A;  1QIW A;  2P6B B;  1QVI Z;  3S0F A;  2WCB A;  3NHI A;  5J3X A;  1DF0 A;  1CKK A;  4NDB A;  2OTG B;  1OE9 B;  1PUL A;  1OOF A;  1C07 A;  1EL4 A;  4MEW A;  1DGV A;  1JSA A;  3B87 A;  3HCM A;  4GBA A;  1RTP 1;  2I18 A;  4M2O A;  2M7N A;  4DRW A;  1K9U A;  2K61 A;  1PSB A;  2JWW A;  1S5G Z;  1YVL A;  1ZAC A;  1SCM C;  1T14 A;  1KFU S;  2KAX A;  2AAO A;  2KI6 D;  3BFB A;  1DF0 B;  2DOQ A;  2M9G A;  4GGF A;  5AEQ A;  3DVM A;  2GTE A;  1A4P A;  3TZ1 A;  2LMU A;  4YI9 A;  1JFJ A;  3SIB A;  2ZND A;  3CR5 X;  1RRO A;  3CDN A;  1BR1 B;  1GJY A;  1OW4 A;  1UHK A;  2H61 C;  2VRG A;  1XFR A;  1UHJ A;  1IJ6 A;  2CT9 A;  3FE6 A;  3H4S E;  5JJG A;  1UP5 A;  2KYF A;  4MVF A;  2WOR A;  2FJU B;  1GQM A;  2L4I A;  1KCY A;  1B8R A;  2P71 A;  3CAB A;  3DZT A;  3GOF A;  1DMO A;  2BKI B;  1DTL A;  2BE4 A;  4CFQ A;  2KI6 C;  2LUX A;  2JUL A;  4GNK B;  2ZRT A;  1F55 A;  1MWN A;  1OMR A;  1CDM A;  3CR4 X;  4PHM A;  1L2O C;  3B7A A;  1AHR A;  3TUY B;  4QJ3 B;  4YGC B;  1KQM C;  2WCK A;  5HLV A;  1S1E A;  3B6X A;  5IBW A;  1TCF A;  2BAP A;  5I94 A;  3CZ0 A;  3K1E A;  1Y1X A;  2QPT A;  1OOG A;  1IQ5 A;  1ORG A;  1KFX S;  1JBA A;  3BFH A;  2KFH A;  3PFV A;  4JWQ A;  1YX8 A;  2K8M B;  3WHU B;  1YUT A;  1EG3 A;  2PRU A;  2JT0 A;  4OCI A;  2L51 A;  1CFF A;  1TWO A;  2PAS A;  2JNF A;  2KGR A;  2LVV A;  3BUN B;  3Q8I A;  3OHM B;  2AMI A;  5D7F A;  3BUX B;  3PLF B;  3VRR A;  1PVA A;  1IGV A;  5I8N A;  1NX3 A;  4GGN A;  5KSZ A;  2LC5 A;  2KFF A;  1D1O A;  1B9A A;  2BE6 A;  2BL0 B;  2KQY A; 
#chains in the Genus database with same CATH homology
 4PCW A;  1QIV A;  4YGA A;  5HKZ A;  1ALW A;  3OB2 B;  1CM4 A;  2KHN A;  2HF5 A;  1YUR A;  1SK6 D;  3SG2 A;  1S26 D;  3LLE A;  1YR5 A;  2LCP A;  3EKH A;  1XFZ O;  1RFJ A;  2IS9 A;  1DJI A;  1QV1 A;  3I5G C;  4PAL A;  2BCA A;  2OS8 B;  3NSL A;  4TNC A;  1S6J A;  1RWY A;  1QX5 B;  1DJG A;  1SW8 A;  2L98 A;  1TTX A;  1UHN A;  2LUC A;  3HX4 A;  1KK8 C;  4P2Y B;  4XYN A;  2EC6 B;  3CGA A;  2M1K B;  1K8U A;  1PAL A;  1SPY A;  2JZI A;  4I5K A;  1QAS A;  2MAZ A;  2Y1M A;  1B7T Y;  1TNP A;  1S36 A;  1S3P A;  3GK1 A;  2LNK A;  2KAV A;  4PE4 A;  1G33 A;  1J7R A;  5F6T A;  2LVK A;  4YGE B;  3O6B A;  5DKR A;  4C0L A;  2B1U A;  2LLS A;  2LMV A;  1EJ3 A;  3NSI A;  3MSE B;  1VRK A;  1OMV A;  3FIA A;  4MRX A;  3CLN A;  3TDU A;  1R6P A;  2K7B A;  2L50 A;  2BCX A;  5HKY A;  2NCO A;  3I5H C;  2PSR A;  1IJ5 A;  2WC8 A;  1XO5 A;  3CTN A;  4DCK A;  1TCO B;  1YTZ C;  3D0Y B;  3JVT C;  3SG7 A;  1RK9 A;  1BF5 A;  2HPS A;  4NQG A;  4AQI A;  4PHJ A;  1SL8 A;  2K7D A;  1GGW A;  3VRN A;  1DJX A;  1HQV A;  2PVB A;  3DF0 A;  1UUR A;  1QAT A;  4YI8 A;  1CNP A;  1F70 A;  4M2P A;  4MZL A;  1CLB A;  3CWG A;  1BR4 B;  2ISD A;  1SCM B;  1H8B A;  1B1G A;  4FTG A;  2JU0 A;  3AKA A;  1AK8 A;  1CDL A;  2GV5 A;  2KOT A;  2O5G A;  1UHI A;  5HLO A;  3GK2 A;  1REC A;  2V53 A;  1TNX A;  2KDH A;  3EVR A;  2E30 A;  3GK4 X;  3VRP A;  1K9P A;  1RJV A;  2LVJ A;  2MLE C;  1ODB A;  3DVJ A;  3AAK A;  1CLL A;  3ZNI A;  1H4B A;  4MRY A;  1AJ4 A;  2OPO A;  3PSR A;  5GQQ C;  1NIW A;  1L2O B;  1BLQ A;  4AQJ A;  1QLK A;  5KTY A;  1KQM B;  4XJK A;  3E3R A;  1QLS A;  1M39 A;  1KSO A;  4HRH A;  3NXA A;  3JTD C;  4ZCU A;  1KK7 Z;  2KYC A;  2PMY A;  1S6I A;  4R1E A;  2JOJ A;  4NDD A;  3VRQ A;  1YUU A;  2LLU A;  1NUB A;  1SBJ A;  2BBN A;  3FS7 A;  3KEV A;  1N0Y A;  1BU3 A;  1SR6 C;  4DIR A;  2SCP A;  1C7V A;  1V1G A;  4XJK B;  4D1E A;  1KWO C;  2D8N A;  3BQ3 A;  1A03 A;  1K94 A;  3RLZ A;  1CTR A;  4PDZ A;  4CID A;  3OP0 A;  1NCY A;  5ER5 A;  2LVI A;  3SG6 A;  4A4C A;  5BPJ A;  2K7C A;  1B8C A;  4ORA B;  2F3Z A;  5K89 A;  3SJS A;  1LA3 A;  1M46 A;  2JT3 A;  2M29 A;  1Q80 A;  1L7Z A;  1YRT B;  1N2D A;  1QVI Y;  3I5G B;  4MZK A;  1F54 A;  4WQ3 A;  1M31 A;  2MJW B;  4E68 A;  3QRX A;  4IL1 A;  1KK8 B;  3KHE A;  2COL B;  2L5X B;  1PSR A;  3OX5 A;  3RM1 A;  3LK0 A;  1SY9 A;  1XK4 C;  1WY9 A;  3LCP C;  4C0K A;  1IQ3 A;  1JF0 A;  1S5G Y;  3A4U B;  3CR2 A;  3EVV A;  1W7I B;  2ZFD A;  2KGB C;  1K90 D;  1MR8 A;  2KI4 C;  1B7T Z;  1BJF A;  3O2P A;  4PE1 A;  3O4Y A;  2EHB A;  1MXL C;  4ZCV A;  1KSM A;  4ETO A;  1NPQ A;  1J7O A;  4FQO A;  2M0R A;  1B8L A;  2L2E A;  3I5H B;  1G4Y R;  3WHT B;  4OKH A;  3SIA A;  1JFK A;  1JF2 A;  4BY4 A;  4ORC B;  3JVT B;  1Y1U A;  2JXL A;  4WQ2 A;  3D10 A;  1DT7 B;  3KPX A;  1QX7 A;  2KNE A;  1SNL A;  2FCE A;  1DJY A;  3C1V A;  1B47 A;  2JTZ A;  4YGB B;  3ZWH A;  1CB1 A;  2Y5I A;  4CPV A;  1F8H A;  3PAT A;  2GGZ A;  4MLW A;  2JPT A;  5CSJ A;  1B4C A;  3BXK A;  2R2I A;  3I5I C;  1FI6 A;  3M0W A;  2M3W A;  2F2P A;  3TDI A;  3D0Y A;  1NYA A;  1EG4 A;  2SAS A;  2BBM A;  1QJT A;  1WRL A;  2NCP A;  3LL8 B;  1MHO A;  2MBX A;  1XFX O;  4DS7 A;  5AAN A;  1TIZ A;  2JRF A;  2LE9 B;  1V1F A;  4HRE E;  3BOW B;  4USL A;  1C7W A;  4GUK A;  1BOD A;  1MQ1 A;  1SMG A;  2LLT A;  1CDP A;  1GGZ A;  5I2O A;  1IKU A;  2L4H A;  2A4J A;  1OZO A;  3WXA A;  1MXE A;  2F3Y A;  4N5X A;  1CMF A;  2LHL A;  1WDC C;  2H61 A;  4HRG A;  1J1D A;  2LV7 A;  1IWQ A;  1FF1 A;  2M8U A;  1OSA A;  4M2Q A;  3EVU A;  1NCX A;  1TN4 A;  1KFU L;  2CBL A;  2KFG A;  3O78 A;  3BUO B;  3CS1 A;  1BOC A;  3JTD B;  1EXR A;  1J7P A;  2JTT A;  5AFP A;  5CSN A;  5FYX A;  1LA0 A;  2ZN9 A;  3EK7 A;  5ER4 X;  1SRA A;  2LHI A;  2I94 A;  1WRK A;  2K7O A;  1CDN A;  1BT6 A;  3KF9 A;  1E8A A;  2EGD A;  1SR6 B;  2KBM A;  2LP3 A;  4JQ0 D;  1KWO B;  1TOP A;  2F2O A;  4HSZ A;  1DGU A;  3WNX B;  1K9K A;  1WLZ A;  1PK0 D;  2JC2 A;  1J55 A;  2L0P A;  1OMD A;  1KQV A;  1NP8 A;  1K2H A;  2JT8 A;  2E6W A;  2LM5 A;  2FCD A;  1F4O A;  1Y1A A;  2I7A A;  2BEC A;  2HQ8 A;  4MBE A;  5G08 A;  3TDZ A;  4YRU A;  2TN4 A;  2RGI A;  3SG3 A;  2M49 B;  2G9B A;  2WCE A;  3F45 A;  1DJZ A;  1XK4 A;  1KFX L;  1QS7 A;  1WLM A;  1LVC D;  1FI5 A;  2M1U A;  1NX1 A;  3DVE A;  1BG1 A;  4QJ4 B;  2WND A;  5JOL A;  2ZKM X;  2LAP A;  1ZUZ A;  2CNP A;  2MLF C;  5D69 A;  1XFV O;  1UWO A;  5PAL A;  1S6C A;  3NSK A;  1NWD A;  4WRI A;  1F71 A;  3VRO A;  3OX6 A;  5CSF A;  3TS5 B;  2KI4 B;  1FW4 A;  1YRU B;  1UHH A;  2FOT A;  4CFR A;  2Q91 A;  2H2K A;  1TNW A;  2WOS A;  2NXQ A;  1XYD A;  2MHH A;  1MF8 B;  4BY5 A;  3I5F C;  1JC2 A;  3IF7 A;  4OV2 A;  2KSP A;  4MZJ A;  4PE0 A;  2K2A A;  5HKW A;  4I5J A;  1AUI B;  1IRJ A;  1AVS A;  1SCV A;  1TRF A;  4C0J A;  1CM1 A;  5TNC A;  1A29 A;  1QXP A;  2ZNE A;  1EH2 A;  1YVH A;  1R2U A;  1LKJ A;  1OQP A;  2CTN A;  2OTG C;  1MUX A;  1K96 A;  2Y4Q A;  4AOM A;  3IQQ A;  1U5I A;  1UUS A;  4I5L B;  2F8P A;  3I5I B;  3TS5 C;  1KK7 Y;  1NCZ A;  2M7L A;  3VGO A;  1QTX A;  2KQ6 A;  4F0Z B;  5I2Q A;  4YGD B;  1XFU O;  3AKB A;  4N1G A;  1AJ5 A;  4PHN A;  2CXJ A;  4N1F A;  3DD4 A;  2NLN A;  1G8I A;  1M45 A;  2ZRS A;  4P5O E;  1ZMZ A;  2M97 A;  4DUQ A;  2LAN A;  1U5I B;  4CLN A;  1XFY O;  1SL9 A;  1DVI A;  1A75 A;  3DVK A;  3PAL A;  2LMT A;  4GGF C;  1WDC B;  2I2R E;  4ORB B;  1NX2 A;  1YUS A;  4I5N B;  3SG4 A;  4QJ5 B;  1SYM A;  3PN7 B;  1SKT A;  4YBH B;  2WCF A;  3BOW A;  3TUY C;  3BYA A;  1W7J B;  4Q04 A;  5DKQ A;  1A75 B;  1Y0V H;  5AXI A;  4A4B A;  3CZT X;  4UPG A;  2CCM A;  4L9M A;  1JUO A;  1N65 A;  1HT9 A;  3LK1 A;  3EKJ A;  2G2B A;  3OB1 B;  2Q4U A;  3IQO A;  1OZS A;  1F4Q A;  3KO0 A;  1J7Q A;  1LIN A;  2JNX A;  2QAC A;  3EK4 A;  1CFC A;  4MN0 A;  1ZOT B;  1CFP A;  4OR9 B;  2MRD A;  4PE7 A;  1NSH A;  1NX0 A;  1YX7 A;  1ZFS A;  1DJH A;  1XVJ A;  2BL0 C;  1SL7 A;  3PN7 C;  4NDC A;  4PHK A;  4U8D A;  5B8I B;  1PRW A;  1OOJ A;  1FBV A;  1QX2 A;  2HET A;  2KBI A;  4JPZ B;  5HYD A;  2MA2 A;  3NSO A;  5AER A;  4GFT A;  1TNQ A;  1XFW O;  2JQ6 A;  2BCB A;  3AAJ A;  5KU1 A;  4OVN F;  1FPW A;  2KAY A;  2Y1N A;  1QV0 A;  3K21 A;  2OS8 C;  1ALV A;  3A8R A;  3FWB A;  1CMG A;  1CLM A;  4ICB A;  1AP4 A;  3BUW B;  2EC6 C;  2LP2 A;  5I2L A;  2GGM A;  2O60 A;  1X02 A;  2PAL A;  1IG5 A;  1K93 D;  3ICB A;  1A2X A;  1BMO A;  1Y6W A;  2F33 A;  2K0J A;  2ZN8 A;  2NZ0 A;  3BUM B;  5CSI A;  1IH0 A;  1WRZ A;  2JXC A;  3PM8 A;  1JWD A;  4GAO A;  2BKH B;  5DKN A;  4GPL B;  1J1E A;  4MSP A;  1DJW A;  3I5F B;  1CFD A;  1K95 A;  3SG5 A;  1PVB A;  3EK8 A;  2AUC A;  1M63 B;  3DF0 B;  3FWC A;  1LXF C;  1XA5 A;  2HQW A;  2K2F A;  1QIW A;  2P6B B;  1QVI Z;  2WCB A;  5J3X A;  1DF0 A;  1CKK A;  4NDB A;  2OTG B;  1OE9 B;  1PUL A;  1C07 A;  1EL4 A;  4MEW A;  1DGV A;  1JSA A;  3HCM A;  4GBA A;  1RTP 1;  2I18 A;  4M2O A;  2M7N A;  4DRW A;  1K9U A;  2K61 A;  1PSB A;  2JWW A;  1S5G Z;  1YVL A;  1ZAC A;  1SCM C;  1KFU S;  2KAX A;  2AAO A;  2KI6 D;  4GGF A;  1DF0 B;  2DOQ A;  2M9G A;  5AEQ A;  3DVM A;  1A4P A;  3TZ1 A;  2LMU A;  4YI9 A;  1JFJ A;  3SIB A;  2ZND A;  3CR5 X;  1RRO A;  1BR1 B;  1GJY A;  2VRG A;  1UHK A;  2H61 C;  5CPV A;  3H4S E;  1UHJ A;  1IJ6 A;  2CT9 A;  5JJG A;  1UP5 A;  2KYF A;  4MVF A;  2WOR A;  2FJU B;  1GQM A;  2L4I A;  1KCY A;  1B8R A;  3GOF A;  1DMO A;  2BKI B;  1DTL A;  2BE4 A;  4CFQ A;  2KI6 C;  2LUX A;  2JUL A;  4GNK B;  2ZRT A;  1F55 A;  1MWN A;  1OMR A;  1CDM A;  3CR4 X;  4PHM A;  1L2O C;  1AHR A;  3TUY B;  4QJ3 B;  4YGC B;  1KQM C;  5HLV A;  1S1E A;  5IBW A;  1TCF A;  1Y1X A;  2QPT A;  1IQ5 A;  1JBA A;  1KFX S;  2KFH A;  3PFV A;  4JWQ A;  1YX8 A;  2K8M B;  3WHU B;  1YUT A;  1EG3 A;  2PRU A;  2JT0 A;  4OCI A;  2L51 A;  1CFF A;  2PAS A;  2JNF A;  2KGR A;  2LVV A;  3BUN B;  3OHM B;  2AMI A;  5D7F A;  3BUX B;  3PLF B;  3VRR A;  1PVA A;  1IGV A;  5I8N A;  1NX3 A;  4GGN A;  5KSZ A;  2LC5 A;  2KFF A;  1D1O A;  1B9A A;  2BE6 A;  2BL0 B;  2KQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...