2LLUA

Post-translational s-nitrosylation is an endogenous factor fine-tuning human s100a1 protein properties
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Post-translational S-Nitrosylation Is an Endogenous Factor Fine Tuning the Properties of Human S100A1 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lluA00
4MVFA 4P2YB 1ZFSA 1RTP1 3VRRA 1OSAA 3TUYC 4QJ5B 2WOSA 1CKKA 2KI4C 1F71A 4GGFA 1BR4B 2HETA 1J7PA 2I2RE 2JT8A 1J7OA 1DMOA 3KPXA 1SCVA 1IJ6A 1D1OA 2NZ0A 1G8IA 2KHNA 3KF9A 4MLWA 1YVHA 2LANA 2KNEA 2WCEA 4GBAA 2Q4UA 3GK1A 3IF7A 4PE4A 4ZCVA 1YVLA 2Y4QA 3NXAA 1K93D 1QX7A 2M9GA 1BT6A 4ETOA 4ZCUA 1EG4A 2OS8C 2MAZA 2BBNA 3TUYB 2BECA 5AANA 5AERA 1IH0A 1S3PA 1XFXO 1DJGA 1NSHA 4MBEA 1N65A 1IRJA 3E3RA 1XK4C 3GK4X 3SG3A 4GPLB 1SMGA 5K89A 2ZFDA 2JXCA 1CB1A 2ZN9A 2NCOA 3AKBA 1AK8A 1H8BA 3PALA 2LLSA 4OV2A 1J1EA 3SG6A 1KWOC 1WDCC 2HQ8A 2ZN8A 1B7TY 4MN0A 2M29A 4R1EA 2L0PA 4CPVA 3O78A 3EVVA 1PSBA 2LHIA 4MSPA 1QATA 2OS8B 1SR6C 2SCPA 3JTDB 4C0LA 4ICBA 2BE4A 3I5IC 1EG3A 4PE0A 4MZJA 2FCEA 1S5GY 3TDUA 2WC8A 1QXPA 3EK4A 3TZ1A 5D7FA 4GGNA 1A75B 3A4UB 1F4OA 3GOFA 3JVTC 1JWDA 4HRHA 3CZTX 2LCPA 1LA0A 1S36A 3EVRA 4DS7A 1KSMA 4GGFC 1KFUS 1A4PA 5I2OA 1OQPA 1RFJA 4JQ0D 5DKRA 1CLBA 2BCBA 1SL8A 2AAOA 3DVJA 3I5IB 2G2BA 4JWQA 1NX0A 3F45A 1NX1A 1DF0B 3ICBA 2JTZA 3NSKA 1CNPA 3I5HC 1ALVA 1DGUA 1LA3A 1OE9B 1SRAA 3FIAA 4ORBB 1K9UA 3LCPC 2LHLA 1MQ1A 4A4BA 2LM5A 2ZNEA 3DVEA 5CSFA 2F8PA 2SASA 1YTZC 4FTGA 4Q04A 3DVKA 1QIVA 2Y1MA 1Y1UA 1IGVA 1KK7Y 5AEQA 4L9MA 1ZUZA 1QS7A 2BL0C 1LXFC 2B1UA 2BKHB 2KFFA 3AAKA 1F70A 5HLOA 5CSJA 2O60A 1SCMC 3FS7A 3TS5C 4NDCA 2ZRTA 1CMGA 3OB2B 1KK8B 4YBHB 1YX8A 2LV7A 1TOPA 1XK4A 2R2IA 2TN4A 1S6JA 3TDZA 2KDHA 3PM8A 3SG7A 1X02A 1UHJA 4I5JA 1QIWA 3FWBA 5FYXA 3TDIA 2OPOA 2WORA 1IWQA 4PCWA 1AHRA 2EC6C 1UP5A 4YGCB 1M46A 1UWOA 2MA2A 4YRUA 3TS5B 2MBXA 2G9BA 2KGRA 1JBAA 3A8RA 1OOJA 2KAVA 1UHIA 4YGEB 4WQ3A 4XJKB 1YR5A 1KCYA 1DJYA 2LC5A 1QLSA 1DF0A 2RGIA 1IQ5A 4M2OA 3WXAA 1UHNA 1CM4A 1QVIZ 2L2EA 2Q91A 2K2FA 2Y1NA 4IL1A 1FBVA 4C0KA 3CR4X 1RECA 2EC6B 1SY9A 2M1UA 1NIWA 2K8MB 4N1FA 1IKUA 2KSPA 2IS9A 1XFWO 1R2UA 2M7NA 1M63B 1MWNA 2H61C 4YGAA 2JT0A 2JWWA 1BF5A 1K9PA 3DF0B 3PSRA 1RROA 2FCDA 1QX5B 3BOWB 1NCXA 4GFTA 2JZIA 4CFRA 2F3YA 2L5XB 1S1EA 1F4QA 4OR9B 2GGZA 2M7LA 1YX7A 2LP2A 3BUXB 3BUWB 1G4YR 3IQOA 5AXIA 1K2HA 3JTDC 3AKAA 2KYFA 4USLA 1EJ3A 1B7TZ 1N2DA 3I5FB 2JXLA 1EH2A 4CFQA 1L7ZA 1YRUB 2NCPA 2LUXA 5GQQC 5D69A 3O6BA 1YUSA 5HYDA 3KHEA 3EKHA 5KTYA 3SG4A 1CM1A 1NUBA 4GNKB 4C0JA 4OKHA 1ODBA 2MLFC 2BKIB 2L51A 2L98A 1NYAA 3EK7A 1A29A 2JOJA 1S5GZ 2JNXA 2BBMA 2KAXA 4E68A 1TNWA 2PALA 2V53A 4MRXA 1JFKA 1KFXL 1A2XA 3OB1B 3OHMB 3DD4A 1ALWA 2PMYA 5ER5A 2JRFA 2L4HA 4PHKA 2BE6A 2CTNA 3KEVA 4PHJA 1YUTA 1M45A 4PALA 3VROA 5F6TA 1PRWA 1E8AA 1NP8A 2QPTA 1B1GA 2D8NA 1K90D 4AQIA 1TNPA 1DTLA 1K94A 5CSNA 4PE1A 1CFPA 2COLB 2LP3A 1JF0A 2O5GA 1Y0VH 3LK0A 4DCKA 2JPTA 2JT3A 1FW4A 1PVAA 3SIBA 3FWCA 3BOWA 1KQMB 2M8UA 3O2PA 4I5LB 2I18A 4M2QA 1CDPA 1CFCA 5AFPA 1L2OB 1WLZA 3VRPA 5DKNA 1NX2A 1TN4A 2LNKA 1KK8C 4PDZA 5I2QA 4CIDA 1TTXA 1B9AA 1NPQA 1V1FA 2H61A 3DVMA 3C1VA 3VRQA 2MHHA 1BMOA 1QJTA 1Q80A 1UURA 1U5IB 1LINA 2KQ6A 4HREE 1YUUA 2LVJA 4ORAB 1CLMA 1GJYA 1SBJA 3OX6A 1WY9A 1ZMZA 1FI5A 2WNDA 2KYCA 1G33A 2ZRSA 1GQMA 1VRKA 2K7DA 2F3ZA 1JFJA 2FOTA 3SG5A 4MZLA 5J3XA 1CDMA 4QJ4B 2KGBC 5HKYA 2LLTA 2BCAA 4UPGA 1YRTB 1S6IA 2LVIA 1EXRA 1J55A 3PN7B 5G08A 1CFFA 2LMTA 1GGZA 1DJIA 4M2PA 1DJWA 1B4CA 1A75A 1MXEA 2JULA 3EK8A 1AJ5A 5CSIA 1TRFA 2PSRA 2ZKMX 1C07A 1J1DA 1TCFA 1XFUO 1NCYA 1SL7A 3EKJA 5IBWA 2F2OA 2I7AA 1LKJA 1NX3A 4P5OE 3OX5A 5HKZA 4YGBB 1R6PA 2LUCA 1WRZA 2KOTA 1SNLA 3SG2A 4MEWA 3HX4A 2M97A 1AUIB 3CR2A 5HKWA 1OMVA 4A4CA 1MXLC 1PSRA 1SPYA 2JQ6A 3EVUA 4OVNF 3M0WA 4JPZB 1QX2A 2E30A 1TCOB 3LLEA 1S6CA 1KSOA 5BPJA 4D1EA 5KU1A 1SKTA 3ZNIA 1ZACA 2MLEC 2PVBA 1KQVA 3I5FC 5KSZA 2KI6C 1C7WA 4U8DA 3CWGA 4WRIA 4GAOA 5I2LA 2NLNA 2QACA 2CCMA 1IJ5A 1WRKA 1MUXA 3D0YB 4AQJA 1QV1A 4NDBA 2LVKA 3VRNA 4YI8A 1OMRA 1TNXA 1W7JB 2I94A 2Y5IA 1LVCD 1WRLA 4YI9A 4WQ2A 1CTRA 1ZOTB 1PVBA 1B8CA 3I5GC 2JTTA 2K7OA 1B8LA 1PALA 1A03A 1DGVA 2LAPA 1IQ3A 1KFUL 1QVIY 2PRUA 3K21A 3O4YA 3WHTB 3BYAA 2K7CA 4GUKA 3NSIA 2NXQA 4QJ3B 4NDDA 4BY5A 1MR8A 2KBMA 2CBLA 1RWYA 1BU3A 1UHHA 2ISDA 1XVJA 2M3WA 4XJKA 1HT9A 3H4SE 5CPVA 4XYNA 3WHUB 1DJZA 2KI4B 3I5GB 2FJUB 1QTXA 1AP4A 1CDNA 1NCZA 1KQMC 2OTGC 1QLKA 5I8NA 1IG5A 2K2AA 2KQYA 1BLQA 1MHOA 1RK9A 2AMIA 1L2OC 3QRXA 3CTNA 4TNCA 1XA5A 2F2PA 2AUCA 1JF2A 1UHKA 3BUNB 1BODA 3BUMB 3CS1A 1F55A 4DUQA 3CLNA 3DF0A 3SJSA 1DJHA 5B8IB 1K96A 1AJ4A 2HF5A 2WCFA 1CFDA 3BUOB 3CGAA 3D0YA 3KO0A 1GGWA 2PASA 2K0JA 3PLFB 2F33A 2E6WA 2OTGB 1KK7Z 3PATA 1BG1A 2CT9A 1DT7B 1SW8A 5HLVA 2KFHA 4MZKA 4N5XA 5JOLA 4CLNA 3VGOA 2LMVA 3BXKA 4FQOA 1KWOB 2MJWB 1F54A 1WDCB 1XFZO 1FF1A 2M1KB 4BY4A 1NWDA 2CXJA 1RJVA 1BOCA 1S26D 3PN7C 1BJFA 1HQVA 1YURA 1SR6B 1XYDA 4ORCB 1XFYO 1F8HA 2GV5A 2KAYA 2HPSA 1CDLA 3MSEB 1K95A 2VRGA 4MRYA 1Y6WA 1W7IB 1XFVO 3AAJA 3IQQA 2H2KA 1KFXS 4YGDB 1BR1B 3D10A 3JVTB 1SYMA 1QASA 2KBIA 2BCXA 4PHMA 1Y1AA 3HCMA 1B47A 4OCIA 1AVSA 1K8UA 1OZSA 1B8RA 2EGDA 2K7BA 3LL8B 5ER4X 1OZOA 2LLUA 2LVVA 3NSLA 1M39A 1EL4A 3SIAA 1FPWA 3NSOA 3ZWHA 3LK1A 1OMDA 1WLMA 3RM1A 1PULA 2LE9B 3WNXB 3PFVA 4I5KA 4AOMA 2LMUA 1CLLA 2L4IA 2P6BB 3I5HB 2DOQA 4HSZA 2JU0A 5PALA 2L50A 4NQGA 1H4BA 1V1GA 2M49B 4DIRA 2A4JA 2M0RA 1TIZA 1M31A 1JUOA 5DKQA 2HQWA 1DVIA 1XO5A 2CNPA 3BQ3A 4HRGA 4DRWA 1JSAA 2ZNDA 2BL0B 2GGMA 1J7RA 2KI6D 2EHBA 2WCBA 1CMFA 1FI6A 2K61A 1UUSA 1TNQA 1SCMB 1Y1XA 1N0YA 2KFGA 1U5IA 3RLZA 1SK6D 3CR5X 2JNFA 1C7VA 4PHNA 1J7QA 4PE7A 1K9KA 1JC2A 1PK0D 1MF8B 2MRDA 1DJXA 5TNCA 2JC2A 4N1GA 4I5NB 4F0ZB 1SL9A 3GK2A 5JJGA 1QV0A 3OP0A
chains in the Genus database with same CATH superfamily
4MVFA 4P2YB 1ZFSA 5DICA 1RTP1 3VRRA 1OSAA 3TUYC 4QJ5B 2WOSA 1CKKA 2KI4C 3D78A 1F71A 4GGFA 1BR4B 2HETA 1J7PA 2I2RE 2JT8A 3B88A 1J7OA 1DMOA 3KPXA 1SCVA 1IJ6A 1D1OA 2NZ0A 1G8IA 2KHNA 3KF9A 4MLWA 1YVHA 2LANA 2KNEA 2WCEA 4GBAA 2Q4UA 3GK1A 3IF7A 4PE4A 4ZCVA 1YVLA 2Y4QA 2WCMA 3NXAA 1K93D 1QX7A 2M9GA 1BT6A 4ETOA 1ORGA 4ZCUA 1EG4A 2OS8C 2MAZA 2BBNA 3TUYB 2BECA 5AANA 5AERA 1IH0A 1S3PA 1XFXO 1DJGA 1NSHA 1Z4HA 4MBEA 1N65A 3RZSA 1IRJA 3E3RA 1XK4C 3GK4X 3SG3A 4GPLB 1SMGA 2L2CA 5K89A 3CDNA 2ZFDA 2JXCA 1CB1A 3R72A 2ZN9A 3EG5B 2NCOA 3AKBA 1T14A 1AK8A 1H8BA 3PALA 2LLSA 4OV2A 1J1EA 3SG6A 1KWOC 1WDCC 2HQ8A 1XFRA 1B7TY 2ZN8A 4MN0A 2M29A 4R1EA 2L0PA 1Z2CB 4CPVA 2WCHA 2GTEA 3EVVA 3O78A 1PSBA 2LHIA 4MSPA 4PT1A 1QATA 2OS8B 1SR6C 2SCPA 3JTDB 4C0LA 4ICBA 2BE4A 3I5IC 1EG3A 4PE0A 4MZJA 3CYZA 2FCEA 3DY9A 1S5GY 3TDUA 2WC8A 1QXPA 1OW4A 3EK4A 3TZ1A 5D7FA 4GGNA 1A75B 3A4UB 1F4OA 3GOFA 3JVTC 1JWDA 4HRHA 3CZTX 2LCPA 1LA0A 1S36A 3S0BA 3EVRA 4DS7A 1KSMA 3IVTA 1KFUS 4GGFC 5HL1A 1A4PA 5I2OA 1OQPA 1RFJA 4JQ0D 5DKRA 1CLBA 2BCBA 1SL8A 2AAOA 3DVJA 3I5IB 3OGNA 2G2BA 2YGUA 4JWQA 1NX0A 3F45A 1NX1A 1DF0B 3B6XA 3ICBA 2JTZA 3S0FA 3B87A 3NSKA 1CNPA 3I5HC 1ALVA 1DGUA 1LA3A 1OE9B 1SRAA 3FIAA 4ORBB 1K9UA 3LCPC 2LHLA 1MQ1A 4A4BA 2LM5A 2ZNEA 3DVEA 5CSFA 2F8PA 2SASA 1YTZC 4FTGA 3S0GA 4Q04A 3DVKA 1QIVA 2Y1MA 1Y1UA 1IGVA 1KK7Y 5AEQA 4L9MA 1ZUZA 1QS7A 2BL0C 1LXFC 2B1UA 2BKHB 2KFFA 3AAKA 1F70A 5HLOA 5CSJA 2O60A 1SCMC 2WCLA 3FS7A 3TS5C 4NDCA 2ZRTA 1CMGA 3OB2B 1KK8B 4YBHB 1YX8A 3BJHA 2LV7A 1TOPA 1XK4A 2R2IA 2TN4A 1S6JA 3TDZA 2KDHA 3PM8A 3SG7A 1X02A 1UHJA 4I5JA 1QIWA 3FWBA 5FYXA 3TDIA 2OPOA 2WORA 1IWQA 4PCWA 3DYEA 1AHRA 2EC6C 1UP5A 3B86A 4YGCB 1M46A 1UWOA 1SSEB 2MA2A 4YRUA 2PQLA 3TS5B 2MBXA 2G9BA 2KGRA 3CZ2A 1JBAA 3A8RA 1OOJA 2KAVA 4A4CA 1UHIA 4YGEB 4WQ3A 4XJKB 1YR5A 1KCYA 1DJYA 2LC5A 1QLSA 1DF0A 2RGIA 1IQ5A 4M2OA 3WXAA 1UHNA 1CM4A 1QVIZ 2L2EA 2Q91A 2K2FA 2Y1NA 4IL1A 1FBVA 4C0KA 3CR4X 1RECA 2EC6B 1SY9A 2M1UA 1NIWA 3R1OA 2K8MB 4N1FA 1IKUA 2KSPA 2IS9A 1XFWO 1R2UA 2M7NA 1M63B 1MWNA 2H61C 3PJIA 4YGAA 2JT0A 2JWWA 3D74A 1K9PA 2QDIA 1BF5A 3DF0B 3SS4A 3PSRA 1RROA 2FCDA 1QX5B 3BOWB 1NCXA 4GFTA 2JZIA 4CFRA 2F3YA 2L5XB 3O4XA 1S1EA 1F4QA 4OR9B 2GGZA 2M7LA 1YX7A 2LP2A 3BUXB 3BUWB 1G4YR 3IQOA 5AXIA 1K2HA 3JTDC 3AKAA 2KYFA 4USLA 1EJ3A 1B7TZ 1N2DA 3I5FB 2JXLA 1EH2A 4CFQA 1L7ZA 1YRUB 2NCPA 2BNXA 2LUXA 5GQQC 5D69A 3O6BA 1YUSA 5HYDA 3KHEA 3EKHA 5KTYA 5EL2A 3SG4A 1CM1A 1NUBA 4GNKB 4C0JA 4OKHA 1ODBA 2MLFC 2BKIB 2L51A 3D75A 2L98A 1NYAA 3EK7A 1A29A 2JOJA 1S5GZ 2JNXA 2BBMA 2KAXA 4E68A 1TNWA 3NGVA 2PALA 2V53A 4MRXA 1JFKA 4INXA 1KFXL 1A2XA 3OB1B 3OHMB 3DD4A 1ALWA 1LS8A 2L5YA 2PMYA 5ER5A 2JRFA 2KLEA 2L4HA 4PHKA 2BE6A 2CTNA 3KEVA 4PHJA 1YUTA 1M45A 4PALA 3VROA 5F6TA 1PRWA 1E8AA 1NP8A 2QPTA 1B1GA 2D8NA 1K90D 4AQIA 1TNPA 1DTLA 1K94A 5CSNA 4PE1A 1CFPA 2COLB 2LP3A 1JF0A 1OOIX 2O5GA 3B7AA 1Y0VH 3LK0A 1DELA 2JPTA 4DCKA 2JT3A 1FW4A 1PVAA 3SIBA 3FWCA 2P70A 3BOWA 1KQMB 2M8UA 3O2PA 4I5LB 3FE8A 2I18A 4M2QA 1CDPA 1CFCA 5AFPA 1L2OB 1WLZA 3VRPA 5DKNA 1NX2A 1TN4A 2LNKA 1KK8C 4PDZA 5FI7A 5I2QA 4CIDA 1TTXA 1B9AA 1NPQA 2ERBA 3DXLA 1V1FA 2H61A 3DVMA 3C1VA 3VRQA 1C3YA 2MHHA 1BMOA 1QJTA 1Q80A 1UURA 1U5IB 1LINA 2KQ6A 4HREE 1YUUA 2LVJA 4ORAB 3PM2A 1CLMA 1GJYA 1SBJA 3OX6A 1WY9A 1ZMZA 1FI5A 2QEBA 2WNDA 3L4AA 1OOHA 2KYCA 1G33A 3R1VA 2ZRSA 3BFBA 3NHTA 1GQMA 1VRKA 2K7DA 1DC1A 2F3ZA 1JFJA 2FOTA 2QEVA 3SG5A 4MZLA 5J3XA 1CDMA 4QJ4B 2KGBC 5HKYA 2LLTA 1TUZA 2BCAA 1YRTB 2WC5A 4UPGA 1S6IA 2LVIA 1EXRA 1J55A 3PN7B 5G08A 1CFFA 2LMTA 1GGZA 1DJIA 2JPOA 4M2PA 1DJWA 1DQEA 1B4CA 1A75A 1MXEA 2JULA 3EK8A 1AJ5A 5CSIA 1TRFA 3K1EA 2PSRA 2ZKMX 1C07A 1J1DA 1TCFA 1XFUO 5FI6A 1NCYA 1SL7A 3EKJA 5IBWA 2F2OA 2I7AA 1LKJA 1NX3A 4P5OE 3OX5A 5HKZA 4YGBB 1R6PA 2LUCA 1WRZA 2KOTA 1SNLA 3SG2A 4JKTA 4MEWA 3Q8IA 3HX4A 2M97A 1AUIB 3CR2A 2BAPA 1OMVA 5HKWA 1MXLC 1PSRA 1SPYA 2JQ6A 3EVUA 4OVNF 2WCKA 3M0WA 1QX2A 2E30A 1TCOB 3LLEA 4JPZB 3UNWA 1S6CA 1KSOA 5BPJA 4D1EA 5KU1A 5I94A 1SKTA 3ZNIA 1ZACA 2MLEC 2PVBA 1KQVA 3I5FC 5KSZA 2KI6C 1C7WA 4U8DA 3CWGA 4WRIA 4GAOA 1W9ZA 5I2LA 2NLNA 2QACA 2CCMA 3D77A 1IJ5A 1WRKA 1MUXA 3D0YB 3L4LA 4AQJA 1QV1A 4NDBA 2LVKA 3VRNA 4YI8A 1OMRA 1TNXA 1W7JB 2I94A 2Y5IA 1LVCD 1WRLA 4YI9A 4WQ2A 5D3OA 3FE9A 3N7HA 1CTRA 1ZOTB 2WCJA 1PVBA 1B8CA 3I5GC 2JTTA 3OBVA 2K7OA 1B8LA 1PALA 1A03A 1DGVA 2LAPA 1IQ3A 4JD9A 1KFUL 1QVIY 2PRUA 3K21A 3O4YA 3WHTB 2KLDA 3BYAA 3UO9A 2K7CA 4GUKA 3NSIA 2NXQA 4QJ3B 4NDDA 4BY5A 1MR8A 2KBMA 2CBLA 3BFAA 1RWYA 3CZ1A 1BU3A 1UHHA 2ISDA 1XVJA 2FJYA 2M3WA 3QMEA 4XJKA 1TWOA 1HT9A 3H4SE 5CPVA 4XYNA 3WHUB 3FE6A 3SS5A 1DJZA 2KI4B 3I5GB 2FJUB 1QTXA 1AP4A 1CDNA 2KPHA 1NCZA 3D73A 1KQMC 2PYQA 2OTGC 1QLKA 5I8NA 1IG5A 2K2AA 3S0EA 1P28A 2KQYA 1BLQA 1MHOA 1RK9A 2AMIA 4F7FA 1L2OC 3QRXA 3CTNA 4TNCA 1OOFA 1XA5A 3V2LA 2F2PA 2AUCA 1JF2A 3S0DA 1UHKA 3BUNB 1BODA 3BUMB 3CS1A 1F55A 4DUQA 3CLNA 3DF0A 3SJSA 1DJHA 5B8IB 3R1PA 1K96A 1AJ4A 2HF5A 2WCFA 1CFDA 3BUOB 3CGAA 3D0YA 3KO0A 1GGWA 2PASA 2K0JA 3PLFB 2F33A 2E6WA 2OTGB 1KK7Z 3PATA 1BG1A 2CT9A 1DT7B 1SW8A 5HLVA 2KFHA 4MZKA 4N5XA 5JOLA 4CLNA 3VGOA 2LMVA 3BXKA 4FQOA 1KWOB 2MJWB 4KYNA 1WDCB 1XFZO 1F54A 2M1KB 1FF1A 4BY4A 1NWDA 2CXJA 3SS3A 1RJVA 1BOCA 1S26D 3PN7C 1BJFA 1HQVA 3CZ0A 1YURA 1SR6B 1XYDA 4ORCB 2H8VA 1XFYO 3D76A 3S0AA 1F8HA 2GV5A 2KAYA 2HPSA 1CDLA 3MSEB 1K95A 2VRGA 4MRYA 1Y6WA 1W7IB 1XFVO 3VB1A 3AAJA 3IQQA 2H2KA 1KFXS 4YGDB 1BR1B 1OOGA 3D10A 1SYMA 1QASA 2KBIA 3JVTB 2BCXA 4PHMA 1Y1AA 3HCMA 1B47A 4OCIA 1AVSA 1K8UA 1OZSA 1B8RA 1TUJA 2EGDA 2K7BA 3LL8B 5ER4X 1OZOA 2LLUA 2LVVA 3NSLA 1M39A 1EL4A 1C3ZA 3SIAA 1FPWA 3NSOA 3ZWHA 3LK1A 1OMDA 1WLMA 1GM0A 3RM1A 1PULA 2LE9B 3WNXB 3PFVA 4I5KA 4AOMA 2LMUA 1CLLA 3NHIA 2L4IA 2P6BB 3I5HB 2DOQA 4HSZA 2JU0A 5PALA 2L50A 4NQGA 1H4BA 1V1GA 2M49B 4DIRA 2A4JA 3DZTA 4IJ7A 2M0RA 1TIZA 1M31A 1JUOA 4OZDA 1DEKA 2HQWA 5DKQA 1DVIA 1XO5A 2CNPA 2P71A 4INWA 3BQ3A 4HRGA 2QEOA 4DRWA 1JSAA 2ZNDA 2BL0B 2GGMA 1J7RA 2KI6D 2EHBA 2QEHA 2WCBA 4FQTA 1CMFA 1FI6A 2K61A 1UUSA 1TNQA 1SCMB 5FI2A 1Y1XA 2WC6A 1N0YA 2KFGA 1U5IA 3RLZA 3BFHA 1SK6D 1IIOA 3CR5X 2JNFA 1C7VA 4PHNA 3L47A 1J7QA 4PE7A 1K9KA 3CABA 1PK0D 1JC2A 1MF8B 2MRDA 1DJXA 5TNCA 2JC2A 2K60A 4N1GA 4I5NB 1QWVA 4F0ZB 1SL9A 3GK2A 5JJGA 1QV0A 3OP0A
chains in the Genus database with same CATH topology
4MVFA 4P2YB 1ZFSA 1RTP1 3VRRA 1OSAA 3TUYC 4QJ5B 2WOSA 1CKKA 2KI4C 1F71A 4GGFA 1BR4B 2HETA 1J7PA 2I2RE 2JT8A 1J7OA 1DMOA 3KPXA 1SCVA 1IJ6A 1D1OA 2NZ0A 1G8IA 2KHNA 3KF9A 4MLWA 1YVHA 2LANA 2KNEA 2WCEA 4GBAA 2Q4UA 3GK1A 3IF7A 4PE4A 4ZCVA 1YVLA 2Y4QA 3NXAA 1K93D 1QX7A 2M9GA 1BT6A 4ETOA 4ZCUA 1EG4A 2OS8C 2MAZA 2BBNA 3TUYB 2BECA 5AANA 5AERA 1IH0A 1S3PA 1XFXO 1DJGA 1NSHA 4MBEA 1N65A 1IRJA 3E3RA 1XK4C 3GK4X 3SG3A 4GPLB 1SMGA 5K89A 2ZFDA 2JXCA 1CB1A 2ZN9A 2NCOA 3AKBA 1AK8A 1H8BA 3PALA 2LLSA 4OV2A 1J1EA 3SG6A 1KWOC 1WDCC 2HQ8A 2ZN8A 1B7TY 4MN0A 2M29A 4R1EA 2L0PA 4CPVA 3O78A 3EVVA 1PSBA 2LHIA 4MSPA 1QATA 2OS8B 1SR6C 2SCPA 3JTDB 4C0LA 4ICBA 2BE4A 3I5IC 1EG3A 4PE0A 4MZJA 2FCEA 1S5GY 3TDUA 2WC8A 1QXPA 3EK4A 3TZ1A 5D7FA 4GGNA 1A75B 3A4UB 1F4OA 3GOFA 3JVTC 1JWDA 4HRHA 3CZTX 2LCPA 1LA0A 1S36A 3EVRA 4DS7A 1KSMA 4GGFC 1KFUS 1A4PA 5I2OA 1OQPA 1RFJA 4JQ0D 5DKRA 1CLBA 2BCBA 1SL8A 2AAOA 3DVJA 3I5IB 2G2BA 4JWQA 1NX0A 3F45A 1NX1A 1DF0B 3ICBA 2JTZA 3NSKA 1CNPA 3I5HC 1ALVA 1DGUA 1LA3A 1OE9B 1SRAA 3FIAA 4ORBB 1K9UA 3LCPC 2LHLA 1MQ1A 4A4BA 2LM5A 2ZNEA 3DVEA 5CSFA 2F8PA 2SASA 1YTZC 4FTGA 4Q04A 3DVKA 1QIVA 2Y1MA 1Y1UA 1IGVA 1KK7Y 5AEQA 4L9MA 1ZUZA 1QS7A 2BL0C 1LXFC 2B1UA 2BKHB 2KFFA 3AAKA 1F70A 5HLOA 5CSJA 2O60A 1SCMC 3FS7A 3TS5C 4NDCA 2ZRTA 1CMGA 3OB2B 1KK8B 4YBHB 1YX8A 2LV7A 1TOPA 1XK4A 2R2IA 2TN4A 1S6JA 3TDZA 2KDHA 3PM8A 3SG7A 1X02A 1UHJA 4I5JA 1QIWA 3FWBA 5FYXA 3TDIA 2OPOA 2WORA 1IWQA 4PCWA 1AHRA 2EC6C 1UP5A 4YGCB 1M46A 1UWOA 2MA2A 4YRUA 3TS5B 2MBXA 2G9BA 2KGRA 1JBAA 3A8RA 1OOJA 2KAVA 1UHIA 4YGEB 4WQ3A 4XJKB 1YR5A 1KCYA 1DJYA 2LC5A 1QLSA 1DF0A 2RGIA 1IQ5A 4M2OA 3WXAA 1UHNA 1CM4A 1QVIZ 2L2EA 2Q91A 2K2FA 2Y1NA 4IL1A 1FBVA 4C0KA 3CR4X 1RECA 2EC6B 1SY9A 2M1UA 1NIWA 2K8MB 4N1FA 1IKUA 2KSPA 2IS9A 1XFWO 1R2UA 2M7NA 1M63B 1MWNA 2H61C 4YGAA 2JT0A 2JWWA 1BF5A 1K9PA 3DF0B 3PSRA 1RROA 2FCDA 1QX5B 3BOWB 1NCXA 4GFTA 2JZIA 4CFRA 2F3YA 2L5XB 1S1EA 1F4QA 4OR9B 2GGZA 2M7LA 1YX7A 2LP2A 3BUXB 3BUWB 1G4YR 3IQOA 5AXIA 1K2HA 3JTDC 3AKAA 2KYFA 4USLA 1EJ3A 1B7TZ 1N2DA 3I5FB 2JXLA 1EH2A 4CFQA 1L7ZA 1YRUB 2NCPA 2LUXA 5GQQC 5D69A 3O6BA 1YUSA 5HYDA 3KHEA 3EKHA 5KTYA 3SG4A 1CM1A 1NUBA 4GNKB 4C0JA 4OKHA 1ODBA 2MLFC 2BKIB 2L51A 2L98A 1NYAA 3EK7A 1A29A 2JOJA 1S5GZ 2JNXA 2BBMA 2KAXA 4E68A 1TNWA 2PALA 2V53A 4MRXA 1JFKA 1KFXL 1A2XA 3OB1B 3OHMB 3DD4A 1ALWA 2PMYA 5ER5A 2JRFA 2L4HA 4PHKA 2BE6A 2CTNA 3KEVA 4PHJA 1YUTA 1M45A 4PALA 3VROA 5F6TA 1PRWA 1E8AA 1NP8A 2QPTA 1B1GA 2D8NA 1K90D 4AQIA 1TNPA 1DTLA 1K94A 5CSNA 4PE1A 1CFPA 2COLB 2LP3A 1JF0A 2O5GA 1Y0VH 3LK0A 4DCKA 2JPTA 2JT3A 1FW4A 1PVAA 3SIBA 3FWCA 3BOWA 1KQMB 2M8UA 3O2PA 4I5LB 2I18A 4M2QA 1CDPA 1CFCA 5AFPA 1L2OB 1WLZA 3VRPA 5DKNA 1NX2A 1TN4A 2LNKA 1KK8C 4PDZA 5I2QA 4CIDA 1TTXA 1B9AA 1NPQA 1V1FA 2H61A 3DVMA 3C1VA 3VRQA 2MHHA 1BMOA 1QJTA 1Q80A 1UURA 1U5IB 1LINA 2KQ6A 4HREE 1YUUA 2LVJA 4ORAB 1CLMA 1GJYA 1SBJA 3OX6A 1WY9A 1ZMZA 1FI5A 2WNDA 2KYCA 1G33A 2ZRSA 1GQMA 1VRKA 2K7DA 2F3ZA 1JFJA 2FOTA 3SG5A 4MZLA 5J3XA 1CDMA 4QJ4B 2KGBC 5HKYA 2LLTA 2BCAA 4UPGA 1YRTB 1S6IA 2LVIA 1EXRA 1J55A 3PN7B 5G08A 1CFFA 2LMTA 1GGZA 1DJIA 4M2PA 1DJWA 1B4CA 1A75A 1MXEA 2JULA 3EK8A 1AJ5A 5CSIA 1TRFA 2PSRA 2ZKMX 1C07A 1J1DA 1TCFA 1XFUO 1NCYA 1SL7A 3EKJA 5IBWA 2F2OA 2I7AA 1LKJA 1NX3A 4P5OE 3OX5A 5HKZA 4YGBB 1R6PA 2LUCA 1WRZA 2KOTA 1SNLA 3SG2A 4MEWA 3HX4A 2M97A 1AUIB 3CR2A 5HKWA 1OMVA 4A4CA 1MXLC 1PSRA 1SPYA 2JQ6A 3EVUA 4OVNF 3M0WA 4JPZB 1QX2A 2E30A 1TCOB 3LLEA 1S6CA 1KSOA 5BPJA 4D1EA 5KU1A 1SKTA 3ZNIA 1ZACA 2MLEC 2PVBA 1KQVA 3I5FC 5KSZA 2KI6C 1C7WA 4U8DA 3CWGA 4WRIA 4GAOA 5I2LA 2NLNA 2QACA 2CCMA 1IJ5A 1WRKA 1MUXA 3D0YB 4AQJA 1QV1A 4NDBA 2LVKA 3VRNA 4YI8A 1OMRA 1TNXA 1W7JB 2I94A 2Y5IA 1LVCD 1WRLA 4YI9A 4WQ2A 1CTRA 1ZOTB 1PVBA 1B8CA 3I5GC 2JTTA 2K7OA 1B8LA 1PALA 1A03A 1DGVA 2LAPA 1IQ3A 1KFUL 1QVIY 2PRUA 3K21A 3O4YA 3WHTB 3BYAA 2K7CA 4GUKA 3NSIA 2NXQA 4QJ3B 4NDDA 4BY5A 1MR8A 2KBMA 2CBLA 1RWYA 1BU3A 1UHHA 2ISDA 1XVJA 2M3WA 4XJKA 1HT9A 3H4SE 5CPVA 4XYNA 3WHUB 1DJZA 2KI4B 3I5GB 2FJUB 1QTXA 1AP4A 1CDNA 1NCZA 1KQMC 2OTGC 1QLKA 5I8NA 1IG5A 2K2AA 2KQYA 1BLQA 1MHOA 1RK9A 2AMIA 1L2OC 3QRXA 3CTNA 4TNCA 1XA5A 2F2PA 2AUCA 1JF2A 1UHKA 3BUNB 1BODA 3BUMB 3CS1A 1F55A 4DUQA 3CLNA 3DF0A 3SJSA 1DJHA 5B8IB 1K96A 1AJ4A 2HF5A 2WCFA 1CFDA 3BUOB 3CGAA 3D0YA 3KO0A 1GGWA 2PASA 2K0JA 3PLFB 2F33A 2E6WA 2OTGB 1KK7Z 3PATA 1BG1A 2CT9A 1DT7B 1SW8A 5HLVA 2KFHA 4MZKA 4N5XA 5JOLA 4CLNA 3VGOA 2LMVA 3BXKA 4FQOA 1KWOB 2MJWB 1F54A 1WDCB 1XFZO 1FF1A 2M1KB 4BY4A 1NWDA 2CXJA 1RJVA 1BOCA 1S26D 3PN7C 1BJFA 1HQVA 1YURA 1SR6B 1XYDA 4ORCB 1XFYO 1F8HA 2GV5A 2KAYA 2HPSA 1CDLA 3MSEB 1K95A 2VRGA 4MRYA 1Y6WA 1W7IB 1XFVO 3AAJA 3IQQA 2H2KA 1KFXS 4YGDB 1BR1B 3D10A 3JVTB 1SYMA 1QASA 2KBIA 2BCXA 4PHMA 1Y1AA 3HCMA 1B47A 4OCIA 1AVSA 1K8UA 1OZSA 1B8RA 2EGDA 2K7BA 3LL8B 5ER4X 1OZOA 2LLUA 2LVVA 3NSLA 1M39A 1EL4A 3SIAA 1FPWA 3NSOA 3ZWHA 3LK1A 1OMDA 1WLMA 3RM1A 1PULA 2LE9B 3WNXB 3PFVA 4I5KA 4AOMA 2LMUA 1CLLA 2L4IA 2P6BB 3I5HB 2DOQA 4HSZA 2JU0A 5PALA 2L50A 4NQGA 1H4BA 1V1GA 2M49B 4DIRA 2A4JA 2M0RA 1TIZA 1M31A 1JUOA 5DKQA 2HQWA 1DVIA 1XO5A 2CNPA 3BQ3A 4HRGA 4DRWA 1JSAA 2ZNDA 2BL0B 2GGMA 1J7RA 2KI6D 2EHBA 2WCBA 1CMFA 1FI6A 2K61A 1UUSA 1TNQA 1SCMB 1Y1XA 1N0YA 2KFGA 1U5IA 3RLZA 1SK6D 3CR5X 2JNFA 1C7VA 4PHNA 1J7QA 4PE7A 1K9KA 1JC2A 1PK0D 1MF8B 2MRDA 1DJXA 5TNCA 2JC2A 4N1GA 4I5NB 4F0ZB 1SL9A 3GK2A 5JJGA 1QV0A 3OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVF A;  4P2Y B;  1ZFS A;  1RTP 1;  3VRR A;  1OSA A;  3TUY C;  4QJ5 B;  2WOS A;  1CKK A;  2KI4 C;  1F71 A;  4GGF A;  1BR4 B;  2HET A;  1J7P A;  2I2R E;  2JT8 A;  1J7O A;  1DMO A;  3KPX A;  1SCV A;  1IJ6 A;  1D1O A;  2NZ0 A;  1G8I A;  2KHN A;  3KF9 A;  4MLW A;  1YVH A;  2LAN A;  2KNE A;  2WCE A;  4GBA A;  2Q4U A;  3GK1 A;  3IF7 A;  4PE4 A;  4ZCV A;  1YVL A;  2Y4Q A;  3NXA A;  1K93 D;  1QX7 A;  2M9G A;  1BT6 A;  4ETO A;  4ZCU A;  1EG4 A;  2OS8 C;  2MAZ A;  2BBN A;  3TUY B;  2BEC A;  5AAN A;  5AER A;  1IH0 A;  1S3P A;  1XFX O;  1DJG A;  1NSH A;  4MBE A;  1N65 A;  1IRJ A;  3E3R A;  1XK4 C;  3GK4 X;  3SG3 A;  4GPL B;  1SMG A;  5K89 A;  2ZFD A;  2JXC A;  1CB1 A;  2ZN9 A;  2NCO A;  3AKB A;  1AK8 A;  1H8B A;  3PAL A;  2LLS A;  4OV2 A;  1J1E A;  3SG6 A;  1KWO C;  1WDC C;  2HQ8 A;  2ZN8 A;  1B7T Y;  4MN0 A;  2M29 A;  4R1E A;  2L0P A;  4CPV A;  3O78 A;  3EVV A;  1PSB A;  2LHI A;  4MSP A;  1QAT A;  2OS8 B;  1SR6 C;  2SCP A;  3JTD B;  4C0L A;  4ICB A;  2BE4 A;  3I5I C;  1EG3 A;  4PE0 A;  4MZJ A;  2FCE A;  1S5G Y;  3TDU A;  2WC8 A;  1QXP A;  3EK4 A;  3TZ1 A;  5D7F A;  4GGN A;  1A75 B;  3A4U B;  1F4O A;  3GOF A;  3JVT C;  1JWD A;  4HRH A;  3CZT X;  2LCP A;  1LA0 A;  1S36 A;  3EVR A;  4DS7 A;  1KSM A;  4GGF C;  1KFU S;  1A4P A;  5I2O A;  1OQP A;  1RFJ A;  4JQ0 D;  5DKR A;  1CLB A;  2BCB A;  1SL8 A;  2AAO A;  3DVJ A;  3I5I B;  2G2B A;  4JWQ A;  1NX0 A;  3F45 A;  1NX1 A;  1DF0 B;  3ICB A;  2JTZ A;  3NSK A;  1CNP A;  3I5H C;  1ALV A;  1DGU A;  1LA3 A;  1OE9 B;  1SRA A;  3FIA A;  4ORB B;  1K9U A;  3LCP C;  2LHL A;  1MQ1 A;  4A4B A;  2LM5 A;  2ZNE A;  3DVE A;  5CSF A;  2F8P A;  2SAS A;  1YTZ C;  4FTG A;  4Q04 A;  3DVK A;  1QIV A;  2Y1M A;  1Y1U A;  1IGV A;  1KK7 Y;  5AEQ A;  4L9M A;  1ZUZ A;  1QS7 A;  2BL0 C;  1LXF C;  2B1U A;  2BKH B;  2KFF A;  3AAK A;  1F70 A;  5HLO A;  5CSJ A;  2O60 A;  1SCM C;  3FS7 A;  3TS5 C;  4NDC A;  2ZRT A;  1CMG A;  3OB2 B;  1KK8 B;  4YBH B;  1YX8 A;  2LV7 A;  1TOP A;  1XK4 A;  2R2I A;  2TN4 A;  1S6J A;  3TDZ A;  2KDH A;  3PM8 A;  3SG7 A;  1X02 A;  1UHJ A;  4I5J A;  1QIW A;  3FWB A;  5FYX A;  3TDI A;  2OPO A;  2WOR A;  1IWQ A;  4PCW A;  1AHR A;  2EC6 C;  1UP5 A;  4YGC B;  1M46 A;  1UWO A;  2MA2 A;  4YRU A;  3TS5 B;  2MBX A;  2G9B A;  2KGR A;  1JBA A;  3A8R A;  1OOJ A;  2KAV A;  1UHI A;  4YGE B;  4WQ3 A;  4XJK B;  1YR5 A;  1KCY A;  1DJY A;  2LC5 A;  1QLS A;  1DF0 A;  2RGI A;  1IQ5 A;  4M2O A;  3WXA A;  1UHN A;  1CM4 A;  1QVI Z;  2L2E A;  2Q91 A;  2K2F A;  2Y1N A;  4IL1 A;  1FBV A;  4C0K A;  3CR4 X;  1REC A;  2EC6 B;  1SY9 A;  2M1U A;  1NIW A;  2K8M B;  4N1F A;  1IKU A;  2KSP A;  2IS9 A;  1XFW O;  1R2U A;  2M7N A;  1M63 B;  1MWN A;  2H61 C;  4YGA A;  2JT0 A;  2JWW A;  1BF5 A;  1K9P A;  3DF0 B;  3PSR A;  1RRO A;  2FCD A;  1QX5 B;  3BOW B;  1NCX A;  4GFT A;  2JZI A;  4CFR A;  2F3Y A;  2L5X B;  1S1E A;  1F4Q A;  4OR9 B;  2GGZ A;  2M7L A;  1YX7 A;  2LP2 A;  3BUX B;  3BUW B;  1G4Y R;  3IQO A;  5AXI A;  1K2H A;  3JTD C;  3AKA A;  2KYF A;  4USL A;  1EJ3 A;  1B7T Z;  1N2D A;  3I5F B;  2JXL A;  1EH2 A;  4CFQ A;  1L7Z A;  1YRU B;  2NCP A;  2LUX A;  5GQQ C;  5D69 A;  3O6B A;  1YUS A;  5HYD A;  3KHE A;  3EKH A;  5KTY A;  3SG4 A;  1CM1 A;  1NUB A;  4GNK B;  4C0J A;  4OKH A;  1ODB A;  2MLF C;  2BKI B;  2L51 A;  2L98 A;  1NYA A;  3EK7 A;  1A29 A;  2JOJ A;  1S5G Z;  2JNX A;  2BBM A;  2KAX A;  4E68 A;  1TNW A;  2PAL A;  2V53 A;  4MRX A;  1JFK A;  1KFX L;  1A2X A;  3OB1 B;  3OHM B;  3DD4 A;  1ALW A;  2PMY A;  5ER5 A;  2JRF A;  2L4H A;  4PHK A;  2BE6 A;  2CTN A;  3KEV A;  4PHJ A;  1YUT A;  1M45 A;  4PAL A;  3VRO A;  5F6T A;  1PRW A;  1E8A A;  1NP8 A;  2QPT A;  1B1G A;  2D8N A;  1K90 D;  4AQI A;  1TNP A;  1DTL A;  1K94 A;  5CSN A;  4PE1 A;  1CFP A;  2COL B;  2LP3 A;  1JF0 A;  2O5G A;  1Y0V H;  3LK0 A;  4DCK A;  2JPT A;  2JT3 A;  1FW4 A;  1PVA A;  3SIB A;  3FWC A;  3BOW A;  1KQM B;  2M8U A;  3O2P A;  4I5L B;  2I18 A;  4M2Q A;  1CDP A;  1CFC A;  5AFP A;  1L2O B;  1WLZ A;  3VRP A;  5DKN A;  1NX2 A;  1TN4 A;  2LNK A;  1KK8 C;  4PDZ A;  5I2Q A;  4CID A;  1TTX A;  1B9A A;  1NPQ A;  1V1F A;  2H61 A;  3DVM A;  3C1V A;  3VRQ A;  2MHH A;  1BMO A;  1QJT A;  1Q80 A;  1UUR A;  1U5I B;  1LIN A;  2KQ6 A;  4HRE E;  1YUU A;  2LVJ A;  4ORA B;  1CLM A;  1GJY A;  1SBJ A;  3OX6 A;  1WY9 A;  1ZMZ A;  1FI5 A;  2WND A;  2KYC A;  1G33 A;  2ZRS A;  1GQM A;  1VRK A;  2K7D A;  2F3Z A;  1JFJ A;  2FOT A;  3SG5 A;  4MZL A;  5J3X A;  1CDM A;  4QJ4 B;  2KGB C;  5HKY A;  2LLT A;  2BCA A;  4UPG A;  1YRT B;  1S6I A;  2LVI A;  1EXR A;  1J55 A;  3PN7 B;  5G08 A;  1CFF A;  2LMT A;  1GGZ A;  1DJI A;  4M2P A;  1DJW A;  1B4C A;  1A75 A;  1MXE A;  2JUL A;  3EK8 A;  1AJ5 A;  5CSI A;  1TRF A;  2PSR A;  2ZKM X;  1C07 A;  1J1D A;  1TCF A;  1XFU O;  1NCY A;  1SL7 A;  3EKJ A;  5IBW A;  2F2O A;  2I7A A;  1LKJ A;  1NX3 A;  4P5O E;  3OX5 A;  5HKZ A;  4YGB B;  1R6P A;  2LUC A;  1WRZ A;  2KOT A;  1SNL A;  3SG2 A;  4MEW A;  3HX4 A;  2M97 A;  1AUI B;  3CR2 A;  5HKW A;  1OMV A;  4A4C A;  1MXL C;  1PSR A;  1SPY A;  2JQ6 A;  3EVU A;  4OVN F;  3M0W A;  4JPZ B;  1QX2 A;  2E30 A;  1TCO B;  3LLE A;  1S6C A;  1KSO A;  5BPJ A;  4D1E A;  5KU1 A;  1SKT A;  3ZNI A;  1ZAC A;  2MLE C;  2PVB A;  1KQV A;  3I5F C;  5KSZ A;  2KI6 C;  1C7W A;  4U8D A;  3CWG A;  4WRI A;  4GAO A;  5I2L A;  2NLN A;  2QAC A;  2CCM A;  1IJ5 A;  1WRK A;  1MUX A;  3D0Y B;  4AQJ A;  1QV1 A;  4NDB A;  2LVK A;  3VRN A;  4YI8 A;  1OMR A;  1TNX A;  1W7J B;  2I94 A;  2Y5I A;  1LVC D;  1WRL A;  4YI9 A;  4WQ2 A;  1CTR A;  1ZOT B;  1PVB A;  1B8C A;  3I5G C;  2JTT A;  2K7O A;  1B8L A;  1PAL A;  1A03 A;  1DGV A;  2LAP A;  1IQ3 A;  1KFU L;  1QVI Y;  2PRU A;  3K21 A;  3O4Y A;  3WHT B;  3BYA A;  2K7C A;  4GUK A;  3NSI A;  2NXQ A;  4QJ3 B;  4NDD A;  4BY5 A;  1MR8 A;  2KBM A;  2CBL A;  1RWY A;  1BU3 A;  1UHH A;  2ISD A;  1XVJ A;  2M3W A;  4XJK A;  1HT9 A;  3H4S E;  5CPV A;  4XYN A;  3WHU B;  1DJZ A;  2KI4 B;  3I5G B;  2FJU B;  1QTX A;  1AP4 A;  1CDN A;  1NCZ A;  1KQM C;  2OTG C;  1QLK A;  5I8N A;  1IG5 A;  2K2A A;  2KQY A;  1BLQ A;  1MHO A;  1RK9 A;  2AMI A;  1L2O C;  3QRX A;  3CTN A;  4TNC A;  1XA5 A;  2F2P A;  2AUC A;  1JF2 A;  1UHK A;  3BUN B;  1BOD A;  3BUM B;  3CS1 A;  1F55 A;  4DUQ A;  3CLN A;  3DF0 A;  3SJS A;  1DJH A;  5B8I B;  1K96 A;  1AJ4 A;  2HF5 A;  2WCF A;  1CFD A;  3BUO B;  3CGA A;  3D0Y A;  3KO0 A;  1GGW A;  2PAS A;  2K0J A;  3PLF B;  2F33 A;  2E6W A;  2OTG B;  1KK7 Z;  3PAT A;  1BG1 A;  2CT9 A;  1DT7 B;  1SW8 A;  5HLV A;  2KFH A;  4MZK A;  4N5X A;  5JOL A;  4CLN A;  3VGO A;  2LMV A;  3BXK A;  4FQO A;  1KWO B;  2MJW B;  1F54 A;  1WDC B;  1XFZ O;  1FF1 A;  2M1K B;  4BY4 A;  1NWD A;  2CXJ A;  1RJV A;  1BOC A;  1S26 D;  3PN7 C;  1BJF A;  1HQV A;  1YUR A;  1SR6 B;  1XYD A;  4ORC B;  1XFY O;  1F8H A;  2GV5 A;  2KAY A;  2HPS A;  1CDL A;  3MSE B;  1K95 A;  2VRG A;  4MRY A;  1Y6W A;  1W7I B;  1XFV O;  3AAJ A;  3IQQ A;  2H2K A;  1KFX S;  4YGD B;  1BR1 B;  3D10 A;  3JVT B;  1SYM A;  1QAS A;  2KBI A;  2BCX A;  4PHM A;  1Y1A A;  3HCM A;  1B47 A;  4OCI A;  1AVS A;  1K8U A;  1OZS A;  1B8R A;  2EGD A;  2K7B A;  3LL8 B;  5ER4 X;  1OZO A;  2LLU A;  2LVV A;  3NSL A;  1M39 A;  1EL4 A;  3SIA A;  1FPW A;  3NSO A;  3ZWH A;  3LK1 A;  1OMD A;  1WLM A;  3RM1 A;  1PUL A;  2LE9 B;  3WNX B;  3PFV A;  4I5K A;  4AOM A;  2LMU A;  1CLL A;  2L4I A;  2P6B B;  3I5H B;  2DOQ A;  4HSZ A;  2JU0 A;  5PAL A;  2L50 A;  4NQG A;  1H4B A;  1V1G A;  2M49 B;  4DIR A;  2A4J A;  2M0R A;  1TIZ A;  1M31 A;  1JUO A;  5DKQ A;  2HQW A;  1DVI A;  1XO5 A;  2CNP A;  3BQ3 A;  4HRG A;  4DRW A;  1JSA A;  2ZND A;  2BL0 B;  2GGM A;  1J7R A;  2KI6 D;  2EHB A;  2WCB A;  1CMF A;  1FI6 A;  2K61 A;  1UUS A;  1TNQ A;  1SCM B;  1Y1X A;  1N0Y A;  2KFG A;  1U5I A;  3RLZ A;  1SK6 D;  3CR5 X;  2JNF A;  1C7V A;  4PHN A;  1J7Q A;  4PE7 A;  1K9K A;  1JC2 A;  1PK0 D;  1MF8 B;  2MRD A;  1DJX A;  5TNC A;  2JC2 A;  4N1G A;  4I5N B;  4F0Z B;  1SL9 A;  3GK2 A;  5JJG A;  1QV0 A;  3OP0 A; 
#chains in the Genus database with same CATH topology
 4MVF A;  4P2Y B;  1ZFS A;  5DIC A;  1RTP 1;  3VRR A;  1OSA A;  3TUY C;  4QJ5 B;  2WOS A;  1CKK A;  2KI4 C;  3D78 A;  1F71 A;  4GGF A;  1BR4 B;  2HET A;  1J7P A;  2I2R E;  2JT8 A;  3B88 A;  1J7O A;  1DMO A;  3KPX A;  1SCV A;  1IJ6 A;  1D1O A;  2NZ0 A;  1G8I A;  2KHN A;  3KF9 A;  4MLW A;  1YVH A;  2LAN A;  2KNE A;  2WCE A;  4GBA A;  2Q4U A;  3GK1 A;  3IF7 A;  4PE4 A;  4ZCV A;  1YVL A;  2Y4Q A;  2WCM A;  3NXA A;  1K93 D;  1QX7 A;  2M9G A;  1BT6 A;  4ETO A;  1ORG A;  4ZCU A;  1EG4 A;  2OS8 C;  2MAZ A;  2BBN A;  3TUY B;  2BEC A;  5AAN A;  5AER A;  1IH0 A;  1S3P A;  1XFX O;  1DJG A;  1NSH A;  1Z4H A;  4MBE A;  1N65 A;  3RZS A;  1IRJ A;  3E3R A;  1XK4 C;  3GK4 X;  3SG3 A;  4GPL B;  1SMG A;  2L2C A;  5K89 A;  3CDN A;  2ZFD A;  2JXC A;  1CB1 A;  3R72 A;  2ZN9 A;  3EG5 B;  2NCO A;  3AKB A;  1T14 A;  1AK8 A;  1H8B A;  3PAL A;  2LLS A;  4OV2 A;  1J1E A;  3SG6 A;  1KWO C;  1WDC C;  2HQ8 A;  1XFR A;  1B7T Y;  2ZN8 A;  4MN0 A;  2M29 A;  4R1E A;  2L0P A;  1Z2C B;  4CPV A;  2WCH A;  2GTE A;  3EVV A;  3O78 A;  1PSB A;  2LHI A;  4MSP A;  4PT1 A;  1QAT A;  2OS8 B;  1SR6 C;  2SCP A;  3JTD B;  4C0L A;  4ICB A;  2BE4 A;  3I5I C;  1EG3 A;  4PE0 A;  4MZJ A;  3CYZ A;  2FCE A;  3DY9 A;  1S5G Y;  3TDU A;  2WC8 A;  1QXP A;  1OW4 A;  3EK4 A;  3TZ1 A;  5D7F A;  4GGN A;  1A75 B;  3A4U B;  1F4O A;  3GOF A;  3JVT C;  1JWD A;  4HRH A;  3CZT X;  2LCP A;  1LA0 A;  1S36 A;  3S0B A;  3EVR A;  4DS7 A;  1KSM A;  3IVT A;  1KFU S;  4GGF C;  5HL1 A;  1A4P A;  5I2O A;  1OQP A;  1RFJ A;  4JQ0 D;  5DKR A;  1CLB A;  2BCB A;  1SL8 A;  2AAO A;  3DVJ A;  3I5I B;  3OGN A;  2G2B A;  2YGU A;  4JWQ A;  1NX0 A;  3F45 A;  1NX1 A;  1DF0 B;  3B6X A;  3ICB A;  2JTZ A;  3S0F A;  3B87 A;  3NSK A;  1CNP A;  3I5H C;  1ALV A;  1DGU A;  1LA3 A;  1OE9 B;  1SRA A;  3FIA A;  4ORB B;  1K9U A;  3LCP C;  2LHL A;  1MQ1 A;  4A4B A;  2LM5 A;  2ZNE A;  3DVE A;  5CSF A;  2F8P A;  2SAS A;  1YTZ C;  4FTG A;  3S0G A;  4Q04 A;  3DVK A;  1QIV A;  2Y1M A;  1Y1U A;  1IGV A;  1KK7 Y;  5AEQ A;  4L9M A;  1ZUZ A;  1QS7 A;  2BL0 C;  1LXF C;  2B1U A;  2BKH B;  2KFF A;  3AAK A;  1F70 A;  5HLO A;  5CSJ A;  2O60 A;  1SCM C;  2WCL A;  3FS7 A;  3TS5 C;  4NDC A;  2ZRT A;  1CMG A;  3OB2 B;  1KK8 B;  4YBH B;  1YX8 A;  3BJH A;  2LV7 A;  1TOP A;  1XK4 A;  2R2I A;  2TN4 A;  1S6J A;  3TDZ A;  2KDH A;  3PM8 A;  3SG7 A;  1X02 A;  1UHJ A;  4I5J A;  1QIW A;  3FWB A;  5FYX A;  3TDI A;  2OPO A;  2WOR A;  1IWQ A;  4PCW A;  3DYE A;  1AHR A;  2EC6 C;  1UP5 A;  3B86 A;  4YGC B;  1M46 A;  1UWO A;  1SSE B;  2MA2 A;  4YRU A;  2PQL A;  3TS5 B;  2MBX A;  2G9B A;  2KGR A;  3CZ2 A;  1JBA A;  3A8R A;  1OOJ A;  2KAV A;  4A4C A;  1UHI A;  4YGE B;  4WQ3 A;  4XJK B;  1YR5 A;  1KCY A;  1DJY A;  2LC5 A;  1QLS A;  1DF0 A;  2RGI A;  1IQ5 A;  4M2O A;  3WXA A;  1UHN A;  1CM4 A;  1QVI Z;  2L2E A;  2Q91 A;  2K2F A;  2Y1N A;  4IL1 A;  1FBV A;  4C0K A;  3CR4 X;  1REC A;  2EC6 B;  1SY9 A;  2M1U A;  1NIW A;  3R1O A;  2K8M B;  4N1F A;  1IKU A;  2KSP A;  2IS9 A;  1XFW O;  1R2U A;  2M7N A;  1M63 B;  1MWN A;  2H61 C;  3PJI A;  4YGA A;  2JT0 A;  2JWW A;  3D74 A;  1K9P A;  2QDI A;  1BF5 A;  3DF0 B;  3SS4 A;  3PSR A;  1RRO A;  2FCD A;  1QX5 B;  3BOW B;  1NCX A;  4GFT A;  2JZI A;  4CFR A;  2F3Y A;  2L5X B;  3O4X A;  1S1E A;  1F4Q A;  4OR9 B;  2GGZ A;  2M7L A;  1YX7 A;  2LP2 A;  3BUX B;  3BUW B;  1G4Y R;  3IQO A;  5AXI A;  1K2H A;  3JTD C;  3AKA A;  2KYF A;  4USL A;  1EJ3 A;  1B7T Z;  1N2D A;  3I5F B;  2JXL A;  1EH2 A;  4CFQ A;  1L7Z A;  1YRU B;  2NCP A;  2BNX A;  2LUX A;  5GQQ C;  5D69 A;  3O6B A;  1YUS A;  5HYD A;  3KHE A;  3EKH A;  5KTY A;  5EL2 A;  3SG4 A;  1CM1 A;  1NUB A;  4GNK B;  4C0J A;  4OKH A;  1ODB A;  2MLF C;  2BKI B;  2L51 A;  3D75 A;  2L98 A;  1NYA A;  3EK7 A;  1A29 A;  2JOJ A;  1S5G Z;  2JNX A;  2BBM A;  2KAX A;  4E68 A;  1TNW A;  3NGV A;  2PAL A;  2V53 A;  4MRX A;  1JFK A;  4INX A;  1KFX L;  1A2X A;  3OB1 B;  3OHM B;  3DD4 A;  1ALW A;  1LS8 A;  2L5Y A;  2PMY A;  5ER5 A;  2JRF A;  2KLE A;  2L4H A;  4PHK A;  2BE6 A;  2CTN A;  3KEV A;  4PHJ A;  1YUT A;  1M45 A;  4PAL A;  3VRO A;  5F6T A;  1PRW A;  1E8A A;  1NP8 A;  2QPT A;  1B1G A;  2D8N A;  1K90 D;  4AQI A;  1TNP A;  1DTL A;  1K94 A;  5CSN A;  4PE1 A;  1CFP A;  2COL B;  2LP3 A;  1JF0 A;  1OOI X;  2O5G A;  3B7A A;  1Y0V H;  3LK0 A;  1DEL A;  2JPT A;  4DCK A;  2JT3 A;  1FW4 A;  1PVA A;  3SIB A;  3FWC A;  2P70 A;  3BOW A;  1KQM B;  2M8U A;  3O2P A;  4I5L B;  3FE8 A;  2I18 A;  4M2Q A;  1CDP A;  1CFC A;  5AFP A;  1L2O B;  1WLZ A;  3VRP A;  5DKN A;  1NX2 A;  1TN4 A;  2LNK A;  1KK8 C;  4PDZ A;  5FI7 A;  5I2Q A;  4CID A;  1TTX A;  1B9A A;  1NPQ A;  2ERB A;  3DXL A;  1V1F A;  2H61 A;  3DVM A;  3C1V A;  3VRQ A;  1C3Y A;  2MHH A;  1BMO A;  1QJT A;  1Q80 A;  1UUR A;  1U5I B;  1LIN A;  2KQ6 A;  4HRE E;  1YUU A;  2LVJ A;  4ORA B;  3PM2 A;  1CLM A;  1GJY A;  1SBJ A;  3OX6 A;  1WY9 A;  1ZMZ A;  1FI5 A;  2QEB A;  2WND A;  3L4A A;  1OOH A;  2KYC A;  1G33 A;  3R1V A;  2ZRS A;  3BFB A;  3NHT A;  1GQM A;  1VRK A;  2K7D A;  1DC1 A;  2F3Z A;  1JFJ A;  2FOT A;  2QEV A;  3SG5 A;  4MZL A;  5J3X A;  1CDM A;  4QJ4 B;  2KGB C;  5HKY A;  2LLT A;  1TUZ A;  2BCA A;  1YRT B;  2WC5 A;  4UPG A;  1S6I A;  2LVI A;  1EXR A;  1J55 A;  3PN7 B;  5G08 A;  1CFF A;  2LMT A;  1GGZ A;  1DJI A;  2JPO A;  4M2P A;  1DJW A;  1DQE A;  1B4C A;  1A75 A;  1MXE A;  2JUL A;  3EK8 A;  1AJ5 A;  5CSI A;  1TRF A;  3K1E A;  2PSR A;  2ZKM X;  1C07 A;  1J1D A;  1TCF A;  1XFU O;  5FI6 A;  1NCY A;  1SL7 A;  3EKJ A;  5IBW A;  2F2O A;  2I7A A;  1LKJ A;  1NX3 A;  4P5O E;  3OX5 A;  5HKZ A;  4YGB B;  1R6P A;  2LUC A;  1WRZ A;  2KOT A;  1SNL A;  3SG2 A;  4JKT A;  4MEW A;  3Q8I A;  3HX4 A;  2M97 A;  1AUI B;  3CR2 A;  2BAP A;  1OMV A;  5HKW A;  1MXL C;  1PSR A;  1SPY A;  2JQ6 A;  3EVU A;  4OVN F;  2WCK A;  3M0W A;  1QX2 A;  2E30 A;  1TCO B;  3LLE A;  4JPZ B;  3UNW A;  1S6C A;  1KSO A;  5BPJ A;  4D1E A;  5KU1 A;  5I94 A;  1SKT A;  3ZNI A;  1ZAC A;  2MLE C;  2PVB A;  1KQV A;  3I5F C;  5KSZ A;  2KI6 C;  1C7W A;  4U8D A;  3CWG A;  4WRI A;  4GAO A;  1W9Z A;  5I2L A;  2NLN A;  2QAC A;  2CCM A;  3D77 A;  1IJ5 A;  1WRK A;  1MUX A;  3D0Y B;  3L4L A;  4AQJ A;  1QV1 A;  4NDB A;  2LVK A;  3VRN A;  4YI8 A;  1OMR A;  1TNX A;  1W7J B;  2I94 A;  2Y5I A;  1LVC D;  1WRL A;  4YI9 A;  4WQ2 A;  5D3O A;  3FE9 A;  3N7H A;  1CTR A;  1ZOT B;  2WCJ A;  1PVB A;  1B8C A;  3I5G C;  2JTT A;  3OBV A;  2K7O A;  1B8L A;  1PAL A;  1A03 A;  1DGV A;  2LAP A;  1IQ3 A;  4JD9 A;  1KFU L;  1QVI Y;  2PRU A;  3K21 A;  3O4Y A;  3WHT B;  2KLD A;  3BYA A;  3UO9 A;  2K7C A;  4GUK A;  3NSI A;  2NXQ A;  4QJ3 B;  4NDD A;  4BY5 A;  1MR8 A;  2KBM A;  2CBL A;  3BFA A;  1RWY A;  3CZ1 A;  1BU3 A;  1UHH A;  2ISD A;  1XVJ A;  2FJY A;  2M3W A;  3QME A;  4XJK A;  1TWO A;  1HT9 A;  3H4S E;  5CPV A;  4XYN A;  3WHU B;  3FE6 A;  3SS5 A;  1DJZ A;  2KI4 B;  3I5G B;  2FJU B;  1QTX A;  1AP4 A;  1CDN A;  2KPH A;  1NCZ A;  3D73 A;  1KQM C;  2PYQ A;  2OTG C;  1QLK A;  5I8N A;  1IG5 A;  2K2A A;  3S0E A;  1P28 A;  2KQY A;  1BLQ A;  1MHO A;  1RK9 A;  2AMI A;  4F7F A;  1L2O C;  3QRX A;  3CTN A;  4TNC A;  1OOF A;  1XA5 A;  3V2L A;  2F2P A;  2AUC A;  1JF2 A;  3S0D A;  1UHK A;  3BUN B;  1BOD A;  3BUM B;  3CS1 A;  1F55 A;  4DUQ A;  3CLN A;  3DF0 A;  3SJS A;  1DJH A;  5B8I B;  3R1P A;  1K96 A;  1AJ4 A;  2HF5 A;  2WCF A;  1CFD A;  3BUO B;  3CGA A;  3D0Y A;  3KO0 A;  1GGW A;  2PAS A;  2K0J A;  3PLF B;  2F33 A;  2E6W A;  2OTG B;  1KK7 Z;  3PAT A;  1BG1 A;  2CT9 A;  1DT7 B;  1SW8 A;  5HLV A;  2KFH A;  4MZK A;  4N5X A;  5JOL A;  4CLN A;  3VGO A;  2LMV A;  3BXK A;  4FQO A;  1KWO B;  2MJW B;  4KYN A;  1WDC B;  1XFZ O;  1F54 A;  2M1K B;  1FF1 A;  4BY4 A;  1NWD A;  2CXJ A;  3SS3 A;  1RJV A;  1BOC A;  1S26 D;  3PN7 C;  1BJF A;  1HQV A;  3CZ0 A;  1YUR A;  1SR6 B;  1XYD A;  4ORC B;  2H8V A;  1XFY O;  3D76 A;  3S0A A;  1F8H A;  2GV5 A;  2KAY A;  2HPS A;  1CDL A;  3MSE B;  1K95 A;  2VRG A;  4MRY A;  1Y6W A;  1W7I B;  1XFV O;  3VB1 A;  3AAJ A;  3IQQ A;  2H2K A;  1KFX S;  4YGD B;  1BR1 B;  1OOG A;  3D10 A;  1SYM A;  1QAS A;  2KBI A;  3JVT B;  2BCX A;  4PHM A;  1Y1A A;  3HCM A;  1B47 A;  4OCI A;  1AVS A;  1K8U A;  1OZS A;  1B8R A;  1TUJ A;  2EGD A;  2K7B A;  3LL8 B;  5ER4 X;  1OZO A;  2LLU A;  2LVV A;  3NSL A;  1M39 A;  1EL4 A;  1C3Z A;  3SIA A;  1FPW A;  3NSO A;  3ZWH A;  3LK1 A;  1OMD A;  1WLM A;  1GM0 A;  3RM1 A;  1PUL A;  2LE9 B;  3WNX B;  3PFV A;  4I5K A;  4AOM A;  2LMU A;  1CLL A;  3NHI A;  2L4I A;  2P6B B;  3I5H B;  2DOQ A;  4HSZ A;  2JU0 A;  5PAL A;  2L50 A;  4NQG A;  1H4B A;  1V1G A;  2M49 B;  4DIR A;  2A4J A;  3DZT A;  4IJ7 A;  2M0R A;  1TIZ A;  1M31 A;  1JUO A;  4OZD A;  1DEK A;  2HQW A;  5DKQ A;  1DVI A;  1XO5 A;  2CNP A;  2P71 A;  4INW A;  3BQ3 A;  4HRG A;  2QEO A;  4DRW A;  1JSA A;  2ZND A;  2BL0 B;  2GGM A;  1J7R A;  2KI6 D;  2EHB A;  2QEH A;  2WCB A;  4FQT A;  1CMF A;  1FI6 A;  2K61 A;  1UUS A;  1TNQ A;  1SCM B;  5FI2 A;  1Y1X A;  2WC6 A;  1N0Y A;  2KFG A;  1U5I A;  3RLZ A;  3BFH A;  1SK6 D;  1IIO A;  3CR5 X;  2JNF A;  1C7V A;  4PHN A;  3L47 A;  1J7Q A;  4PE7 A;  1K9K A;  3CAB A;  1PK0 D;  1JC2 A;  1MF8 B;  2MRD A;  1DJX A;  5TNC A;  2JC2 A;  2K60 A;  4N1G A;  4I5N B;  1QWV A;  4F0Z B;  1SL9 A;  3GK2 A;  5JJG A;  1QV0 A;  3OP0 A; 
#chains in the Genus database with same CATH homology
 4MVF A;  4P2Y B;  1ZFS A;  1RTP 1;  3VRR A;  1OSA A;  3TUY C;  4QJ5 B;  2WOS A;  1CKK A;  2KI4 C;  1F71 A;  4GGF A;  1BR4 B;  2HET A;  1J7P A;  2I2R E;  2JT8 A;  1J7O A;  1DMO A;  3KPX A;  1SCV A;  1IJ6 A;  1D1O A;  2NZ0 A;  1G8I A;  2KHN A;  3KF9 A;  4MLW A;  1YVH A;  2LAN A;  2KNE A;  2WCE A;  4GBA A;  2Q4U A;  3GK1 A;  3IF7 A;  4PE4 A;  4ZCV A;  1YVL A;  2Y4Q A;  3NXA A;  1K93 D;  1QX7 A;  2M9G A;  1BT6 A;  4ETO A;  4ZCU A;  1EG4 A;  2OS8 C;  2MAZ A;  2BBN A;  3TUY B;  2BEC A;  5AAN A;  5AER A;  1IH0 A;  1S3P A;  1XFX O;  1DJG A;  1NSH A;  4MBE A;  1N65 A;  1IRJ A;  3E3R A;  1XK4 C;  3GK4 X;  3SG3 A;  4GPL B;  1SMG A;  5K89 A;  2ZFD A;  2JXC A;  1CB1 A;  2ZN9 A;  2NCO A;  3AKB A;  1AK8 A;  1H8B A;  3PAL A;  2LLS A;  4OV2 A;  1J1E A;  3SG6 A;  1KWO C;  1WDC C;  2HQ8 A;  2ZN8 A;  1B7T Y;  4MN0 A;  2M29 A;  4R1E A;  2L0P A;  4CPV A;  3O78 A;  3EVV A;  1PSB A;  2LHI A;  4MSP A;  1QAT A;  2OS8 B;  1SR6 C;  2SCP A;  3JTD B;  4C0L A;  4ICB A;  2BE4 A;  3I5I C;  1EG3 A;  4PE0 A;  4MZJ A;  2FCE A;  1S5G Y;  3TDU A;  2WC8 A;  1QXP A;  3EK4 A;  3TZ1 A;  5D7F A;  4GGN A;  1A75 B;  3A4U B;  1F4O A;  3GOF A;  3JVT C;  1JWD A;  4HRH A;  3CZT X;  2LCP A;  1LA0 A;  1S36 A;  3EVR A;  4DS7 A;  1KSM A;  4GGF C;  1KFU S;  1A4P A;  5I2O A;  1OQP A;  1RFJ A;  4JQ0 D;  5DKR A;  1CLB A;  2BCB A;  1SL8 A;  2AAO A;  3DVJ A;  3I5I B;  2G2B A;  4JWQ A;  1NX0 A;  3F45 A;  1NX1 A;  1DF0 B;  3ICB A;  2JTZ A;  3NSK A;  1CNP A;  3I5H C;  1ALV A;  1DGU A;  1LA3 A;  1OE9 B;  1SRA A;  3FIA A;  4ORB B;  1K9U A;  3LCP C;  2LHL A;  1MQ1 A;  4A4B A;  2LM5 A;  2ZNE A;  3DVE A;  5CSF A;  2F8P A;  2SAS A;  1YTZ C;  4FTG A;  4Q04 A;  3DVK A;  1QIV A;  2Y1M A;  1Y1U A;  1IGV A;  1KK7 Y;  5AEQ A;  4L9M A;  1ZUZ A;  1QS7 A;  2BL0 C;  1LXF C;  2B1U A;  2BKH B;  2KFF A;  3AAK A;  1F70 A;  5HLO A;  5CSJ A;  2O60 A;  1SCM C;  3FS7 A;  3TS5 C;  4NDC A;  2ZRT A;  1CMG A;  3OB2 B;  1KK8 B;  4YBH B;  1YX8 A;  2LV7 A;  1TOP A;  1XK4 A;  2R2I A;  2TN4 A;  1S6J A;  3TDZ A;  2KDH A;  3PM8 A;  3SG7 A;  1X02 A;  1UHJ A;  4I5J A;  1QIW A;  3FWB A;  5FYX A;  3TDI A;  2OPO A;  2WOR A;  1IWQ A;  4PCW A;  1AHR A;  2EC6 C;  1UP5 A;  4YGC B;  1M46 A;  1UWO A;  2MA2 A;  4YRU A;  3TS5 B;  2MBX A;  2G9B A;  2KGR A;  1JBA A;  3A8R A;  1OOJ A;  2KAV A;  1UHI A;  4YGE B;  4WQ3 A;  4XJK B;  1YR5 A;  1KCY A;  1DJY A;  2LC5 A;  1QLS A;  1DF0 A;  2RGI A;  1IQ5 A;  4M2O A;  3WXA A;  1UHN A;  1CM4 A;  1QVI Z;  2L2E A;  2Q91 A;  2K2F A;  2Y1N A;  4IL1 A;  1FBV A;  4C0K A;  3CR4 X;  1REC A;  2EC6 B;  1SY9 A;  2M1U A;  1NIW A;  2K8M B;  4N1F A;  1IKU A;  2KSP A;  2IS9 A;  1XFW O;  1R2U A;  2M7N A;  1M63 B;  1MWN A;  2H61 C;  4YGA A;  2JT0 A;  2JWW A;  1BF5 A;  1K9P A;  3DF0 B;  3PSR A;  1RRO A;  2FCD A;  1QX5 B;  3BOW B;  1NCX A;  4GFT A;  2JZI A;  4CFR A;  2F3Y A;  2L5X B;  1S1E A;  1F4Q A;  4OR9 B;  2GGZ A;  2M7L A;  1YX7 A;  2LP2 A;  3BUX B;  3BUW B;  1G4Y R;  3IQO A;  5AXI A;  1K2H A;  3JTD C;  3AKA A;  2KYF A;  4USL A;  1EJ3 A;  1B7T Z;  1N2D A;  3I5F B;  2JXL A;  1EH2 A;  4CFQ A;  1L7Z A;  1YRU B;  2NCP A;  2LUX A;  5GQQ C;  5D69 A;  3O6B A;  1YUS A;  5HYD A;  3KHE A;  3EKH A;  5KTY A;  3SG4 A;  1CM1 A;  1NUB A;  4GNK B;  4C0J A;  4OKH A;  1ODB A;  2MLF C;  2BKI B;  2L51 A;  2L98 A;  1NYA A;  3EK7 A;  1A29 A;  2JOJ A;  1S5G Z;  2JNX A;  2BBM A;  2KAX A;  4E68 A;  1TNW A;  2PAL A;  2V53 A;  4MRX A;  1JFK A;  1KFX L;  1A2X A;  3OB1 B;  3OHM B;  3DD4 A;  1ALW A;  2PMY A;  5ER5 A;  2JRF A;  2L4H A;  4PHK A;  2BE6 A;  2CTN A;  3KEV A;  4PHJ A;  1YUT A;  1M45 A;  4PAL A;  3VRO A;  5F6T A;  1PRW A;  1E8A A;  1NP8 A;  2QPT A;  1B1G A;  2D8N A;  1K90 D;  4AQI A;  1TNP A;  1DTL A;  1K94 A;  5CSN A;  4PE1 A;  1CFP A;  2COL B;  2LP3 A;  1JF0 A;  2O5G A;  1Y0V H;  3LK0 A;  4DCK A;  2JPT A;  2JT3 A;  1FW4 A;  1PVA A;  3SIB A;  3FWC A;  3BOW A;  1KQM B;  2M8U A;  3O2P A;  4I5L B;  2I18 A;  4M2Q A;  1CDP A;  1CFC A;  5AFP A;  1L2O B;  1WLZ A;  3VRP A;  5DKN A;  1NX2 A;  1TN4 A;  2LNK A;  1KK8 C;  4PDZ A;  5I2Q A;  4CID A;  1TTX A;  1B9A A;  1NPQ A;  1V1F A;  2H61 A;  3DVM A;  3C1V A;  3VRQ A;  2MHH A;  1BMO A;  1QJT A;  1Q80 A;  1UUR A;  1U5I B;  1LIN A;  2KQ6 A;  4HRE E;  1YUU A;  2LVJ A;  4ORA B;  1CLM A;  1GJY A;  1SBJ A;  3OX6 A;  1WY9 A;  1ZMZ A;  1FI5 A;  2WND A;  2KYC A;  1G33 A;  2ZRS A;  1GQM A;  1VRK A;  2K7D A;  2F3Z A;  1JFJ A;  2FOT A;  3SG5 A;  4MZL A;  5J3X A;  1CDM A;  4QJ4 B;  2KGB C;  5HKY A;  2LLT A;  2BCA A;  4UPG A;  1YRT B;  1S6I A;  2LVI A;  1EXR A;  1J55 A;  3PN7 B;  5G08 A;  1CFF A;  2LMT A;  1GGZ A;  1DJI A;  4M2P A;  1DJW A;  1B4C A;  1A75 A;  1MXE A;  2JUL A;  3EK8 A;  1AJ5 A;  5CSI A;  1TRF A;  2PSR A;  2ZKM X;  1C07 A;  1J1D A;  1TCF A;  1XFU O;  1NCY A;  1SL7 A;  3EKJ A;  5IBW A;  2F2O A;  2I7A A;  1LKJ A;  1NX3 A;  4P5O E;  3OX5 A;  5HKZ A;  4YGB B;  1R6P A;  2LUC A;  1WRZ A;  2KOT A;  1SNL A;  3SG2 A;  4MEW A;  3HX4 A;  2M97 A;  1AUI B;  3CR2 A;  5HKW A;  1OMV A;  4A4C A;  1MXL C;  1PSR A;  1SPY A;  2JQ6 A;  3EVU A;  4OVN F;  3M0W A;  4JPZ B;  1QX2 A;  2E30 A;  1TCO B;  3LLE A;  1S6C A;  1KSO A;  5BPJ A;  4D1E A;  5KU1 A;  1SKT A;  3ZNI A;  1ZAC A;  2MLE C;  2PVB A;  1KQV A;  3I5F C;  5KSZ A;  2KI6 C;  1C7W A;  4U8D A;  3CWG A;  4WRI A;  4GAO A;  5I2L A;  2NLN A;  2QAC A;  2CCM A;  1IJ5 A;  1WRK A;  1MUX A;  3D0Y B;  4AQJ A;  1QV1 A;  4NDB A;  2LVK A;  3VRN A;  4YI8 A;  1OMR A;  1TNX A;  1W7J B;  2I94 A;  2Y5I A;  1LVC D;  1WRL A;  4YI9 A;  4WQ2 A;  1CTR A;  1ZOT B;  1PVB A;  1B8C A;  3I5G C;  2JTT A;  2K7O A;  1B8L A;  1PAL A;  1A03 A;  1DGV A;  2LAP A;  1IQ3 A;  1KFU L;  1QVI Y;  2PRU A;  3K21 A;  3O4Y A;  3WHT B;  3BYA A;  2K7C A;  4GUK A;  3NSI A;  2NXQ A;  4QJ3 B;  4NDD A;  4BY5 A;  1MR8 A;  2KBM A;  2CBL A;  1RWY A;  1BU3 A;  1UHH A;  2ISD A;  1XVJ A;  2M3W A;  4XJK A;  1HT9 A;  3H4S E;  5CPV A;  4XYN A;  3WHU B;  1DJZ A;  2KI4 B;  3I5G B;  2FJU B;  1QTX A;  1AP4 A;  1CDN A;  1NCZ A;  1KQM C;  2OTG C;  1QLK A;  5I8N A;  1IG5 A;  2K2A A;  2KQY A;  1BLQ A;  1MHO A;  1RK9 A;  2AMI A;  1L2O C;  3QRX A;  3CTN A;  4TNC A;  1XA5 A;  2F2P A;  2AUC A;  1JF2 A;  1UHK A;  3BUN B;  1BOD A;  3BUM B;  3CS1 A;  1F55 A;  4DUQ A;  3CLN A;  3DF0 A;  3SJS A;  1DJH A;  5B8I B;  1K96 A;  1AJ4 A;  2HF5 A;  2WCF A;  1CFD A;  3BUO B;  3CGA A;  3D0Y A;  3KO0 A;  1GGW A;  2PAS A;  2K0J A;  3PLF B;  2F33 A;  2E6W A;  2OTG B;  1KK7 Z;  3PAT A;  1BG1 A;  2CT9 A;  1DT7 B;  1SW8 A;  5HLV A;  2KFH A;  4MZK A;  4N5X A;  5JOL A;  4CLN A;  3VGO A;  2LMV A;  3BXK A;  4FQO A;  1KWO B;  2MJW B;  1F54 A;  1WDC B;  1XFZ O;  1FF1 A;  2M1K B;  4BY4 A;  1NWD A;  2CXJ A;  1RJV A;  1BOC A;  1S26 D;  3PN7 C;  1BJF A;  1HQV A;  1YUR A;  1SR6 B;  1XYD A;  4ORC B;  1XFY O;  1F8H A;  2GV5 A;  2KAY A;  2HPS A;  1CDL A;  3MSE B;  1K95 A;  2VRG A;  4MRY A;  1Y6W A;  1W7I B;  1XFV O;  3AAJ A;  3IQQ A;  2H2K A;  1KFX S;  4YGD B;  1BR1 B;  3D10 A;  3JVT B;  1SYM A;  1QAS A;  2KBI A;  2BCX A;  4PHM A;  1Y1A A;  3HCM A;  1B47 A;  4OCI A;  1AVS A;  1K8U A;  1OZS A;  1B8R A;  2EGD A;  2K7B A;  3LL8 B;  5ER4 X;  1OZO A;  2LLU A;  2LVV A;  3NSL A;  1M39 A;  1EL4 A;  3SIA A;  1FPW A;  3NSO A;  3ZWH A;  3LK1 A;  1OMD A;  1WLM A;  3RM1 A;  1PUL A;  2LE9 B;  3WNX B;  3PFV A;  4I5K A;  4AOM A;  2LMU A;  1CLL A;  2L4I A;  2P6B B;  3I5H B;  2DOQ A;  4HSZ A;  2JU0 A;  5PAL A;  2L50 A;  4NQG A;  1H4B A;  1V1G A;  2M49 B;  4DIR A;  2A4J A;  2M0R A;  1TIZ A;  1M31 A;  1JUO A;  5DKQ A;  2HQW A;  1DVI A;  1XO5 A;  2CNP A;  3BQ3 A;  4HRG A;  4DRW A;  1JSA A;  2ZND A;  2BL0 B;  2GGM A;  1J7R A;  2KI6 D;  2EHB A;  2WCB A;  1CMF A;  1FI6 A;  2K61 A;  1UUS A;  1TNQ A;  1SCM B;  1Y1X A;  1N0Y A;  2KFG A;  1U5I A;  3RLZ A;  1SK6 D;  3CR5 X;  2JNF A;  1C7V A;  4PHN A;  1J7Q A;  4PE7 A;  1K9K A;  1JC2 A;  1PK0 D;  1MF8 B;  2MRD A;  1DJX A;  5TNC A;  2JC2 A;  4N1G A;  4I5N B;  4F0Z B;  1SL9 A;  3GK2 A;  5JJG A;  1QV0 A;  3OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...