4GUKA

New crystal form structure of human ncs1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
185
structure length
183
Chain Sequence
SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title new crystal form structure of human NCS1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Neuronal calcium sensor 1
total genus 73
structure length 183
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA02
5JOLA 1PSRA 1N0YA 4XJKB 4P2YB 1QX5B 3BQ3A 3EVVA 2LVIA 1S26D 3LL8B 1B7TY 3VRQA 1DGUA 2KOTA 1YUUA 2LP3A 1J7RA 1PSBA 1SBJA 1RTP1 4P5OE 3F45A 4D1EA 2EHBA 3GOFA 1K93D 2E30A 3BXKA 4IL1A 2OTGB 2LCPA 2BE6A 2CNPA 4AOMA 1CLBA 1M63B 1TNQA 1BR1B 1Y1XA 2L0PA 3BYAA 2CXJA 2PASA 2BE4A 3LK0A 5I8NA 1BODA 2K0JA 1QVIZ 3WHTB 2H2KA 1DJGA 1CB1A 1W7IB 3IQQA 2MJWB 2JQ6A 5HKWA 4N1GA 1J7QA 4GPLB 1IJ5A 2LANA 2M1UA 2NCPA 1EJ3A 2ZFDA 1CDPA 5G08A 2JT8A 3JTDB 1LKJA 4E68A 2BKHB 3ZNIA 1CMGA 3PATA 1U5IB 2K7DA 3AKAA 4YGEB 1G8IA 3PN7C 1FW4A 3SIBA 2KBMA 1CM1A 2LUCA 4DS7A 3PSRA 5KSZA 2JC2A 1SKTA 3GK4X 2WCBA 4I5JA 4PDZA 2JNFA 3JVTC 2HF5A 2BBNA 3OB1B 4M2QA 1YURA 1XK4A 2WCFA 1TTXA 3PALA 2I94A 5D69A 1KQMC 2BL0B 1RECA 2M1KB 4JWQA 2BL0C 3FWCA 3EVRA 3WXAA 4MZJA 1B4CA 1AUIB 4MRYA 5GQQC 2LMUA 1TCFA 1RJVA 1V1FA 1TRFA 2JOJA 1K9UA 2KNEA 2ZNEA 4QJ4B 5HKYA 1S5GY 3TDIA 3HX4A 1S3PA 2K8MB 2ZRSA 2K61A 1CTRA 1QV0A 1S5GZ 1UP5A 2JXCA 3D10A 4GGNA 1B7TZ 3OX5A 4CFRA 2Y4QA 1IGVA 1K95A 1XA5A 1F54A 1J1DA 4I5KA 2KI4B 3TS5C 4YI9A 4PE4A 2F33A 1LVCD 1ODBA 1WLMA 1YR5A 2QACA 1JSAA 3EK4A 1FPWA 1MR8A 3KF9A 3OX6A 2SASA 1UURA 1WDCB 2CTNA 3DF0A 1KWOB 1DJHA 4GGFC 1LINA 1UHNA 1CDLA 2MLEC 4TNCA 2CCMA 2GGMA 1FF1A 1YRUB 4MRXA 3EKHA 1OOJA 2A4JA 1BF5A 4OKHA 4ORCB 1AVSA 2MAZA 1QLKA 3OHMB 4ETOA 4NDCA 2LVVA 1MXLC 2Y1NA 1ALVA 2ZNDA 1XFUO 4FQOA 1CLMA 2KBIA 3I5IC 4M2PA 3KHEA 2LVKA 2F3ZA 4CFQA 4YRUA 1OQPA 2FCDA 2E6WA 5AERA 4ORBB 2H61C 3TZ1A 1SL9A 1A75A 3SG6A 2KYFA 2G9BA 4MSPA 4JQ0D 1Y0VH 1F4QA 1QATA 2KYCA 3O4YA 1H8BA 1YX8A 2AAOA 4USLA 1CNPA 4OVNF 3VROA 1QS7A 1CDNA 2LNKA 1MXEA 2LHIA 1A2XA 2KFHA 2IS9A 4OR9B 1BG1A 1ZOTB 1TNPA 4ZCVA 1YUSA 1QASA 4CLNA 2CT9A 1TOPA 2LUXA 1C07A 4QJ5B 2JULA 5AXIA 3EK7A 5DKQA 3CR5X 1B8RA 2MBXA 2LAPA 2KQ6A 3TUYC 1M46A 1UHIA 4NDBA 4OV2A 1UHHA 1G33A 3VRRA 4MZKA 1DJWA 4BY4A 4PE7A 1CFCA 1CM4A 3I5FB 1S6JA 2ZN8A 3LCPC 1ALWA 1HT9A 1NX1A 2NZ0A 5HLVA 2K7BA 2LLTA 1BT6A 3KPXA 1K9KA 4PHJA 1RFJA 2FCEA 1JC2A 2JZIA 4C0JA 1XFWO 1IJ6A 4DUQA 1A29A 1J1EA 3LK1A 4ICBA 1CLLA 1R2UA 2KAXA 4YGCB 3SG2A 3JTDC 2I2RE 3BUWB 1UWOA 4PHKA 4GGFA 1IKUA 1FI6A 1MUXA 2MA2A 4MVFA 2NLNA 3DD4A 1M45A 4XJKA 2L2EA 2LMVA 3E3RA 2NXQA 2K2FA 1KFXL 1YVLA 1NCXA 2KI6D 3IQOA 2LM5A 3SJSA 1XFXO 1SY9A 1B8CA 1IH0A 1Y1UA 2BKIB 1SYMA 4GAOA 2SCPA 1NPQA 2KGRA 1IQ5A 3BUNB 2V53A 1NX2A 3BOWA 4I5NB 2P6BB 1KQMB 1N2DA 2MLFC 4Q04A 5HKZA 1A75B 1M39A 2JWWA 3H4SE 1N65A 3ICBA 1QV1A 3PLFB 1TNWA 1M31A 3BUXB 1F4OA 2OTGC 1UHKA 4GFTA 3CTNA 4PHMA 3CR2A 1JFKA 1QIWA 2L5XB 2M8UA 1KCYA 1IG5A 1GJYA 1OE9B 1AJ5A 1G4YR 1KSOA 2R2IA 1JF2A 4QJ3B 3RM1A 1GGWA 1Q80A 2BCXA 1RROA 2F3YA 1S6CA 1KFUS 1L2OC 2M7LA 3CGAA 1K96A 1KSMA 1X02A 2BECA 1K8UA 5FYXA 2KI4C 1ZFSA 5HLOA 1DJZA 2BCBA 1ZACA 1WRZA 1C7VA 4ZCUA 2KI6C 2M0RA 1XFZO 3SIAA 3A8RA 4AQJA 3A4UB 3PM8A 2ISDA 3RLZA 1PRWA 4PHNA 3SG7A 2AMIA 1YRTB 1BJFA 1LA0A 1LXFC 3EK8A 1S36A 1XVJA 5I2LA 1JFJA 3QRXA 1F71A 2KAYA 2EC6C 2JRFA 1QVIY 1YX7A 4MBEA 4PCWA 2G2BA 1IWQA 2KGBC 3I5GC 1YTZC 2QPTA 2F2OA 3WHUB 1SCMC 1MHOA 4DIRA 3EVUA 1QTXA 2JT0A 1DJXA 5D7FA 1NP8A 2PSRA 1V1GA 3NSLA 2HPSA 3MSEB 1BU3A 2COLB 2EGDA 1NUBA 2DOQA 1CFDA 2HETA 5CSFA 4MN0A 1J55A 4BY5A 1LA3A 1NSHA 4C0LA 3DVJA 1EG3A 2VRGA 3VRPA 1CMFA 1E8AA 3TDUA 1A03A 3NSKA 2LHLA 2EC6B 2PVBA 3VGOA 2LMTA 1JUOA 1XFYO 2Y5IA 3DF0B 1FBVA 1K2HA 3I5HB 2H61A 3BUOB 1EXRA 1NWDA 1RWYA 3O6BA 4WQ2A 1PVAA 2PMYA 5HYDA 4YGDB 5I2QA 1H4BA 3TUYB 4HREE 3O2PA 3PFVA 3BUMB 1J7OA 1YVHA 5AFPA 1YUTA 4JPZB 1MQ1A 1PULA 2I7AA 4N5XA 2KHNA 1IRJA 4UPGA 4HSZA 1NX0A 2K2AA 4I5LB 1SCMB 4ORAB 1S6IA 2JT3A 4L9MA 1Y6WA 3C1VA 3K21A 4YGBB 3KEVA 5AEQA 4CPVA 1BR4B 1F70A 2JTZA 2KSPA 1PVBA 3DVMA 1KK8C 2M3WA 4CIDA 3FWBA 5PALA 2GV5A 1B9AA 2M9GA 3I5IB 4GNKB 3GK1A 4N1FA 2ZRTA 3FS7A 5J3XA 1DF0B 1SRAA 2KFFA 3BOWB 4HRHA 3D0YB 2FJUB 1A4PA 1OZOA 3EKJA 1DTLA 1NCYA 3NXAA 4R1EA 3JVTB 4YBHB 5CSNA 1TNXA 1PALA 2L4HA 2PRUA 1SMGA 3CLNA 1SL8A 1WLZA 1EG4A 1KK7Y 1L2OB 5TNCA 1J7PA 3OB2B 1DJIA 2WOSA 3NSIA 1RK9A 2L98A 2HQ8A 3PN7B 1U5IA 1UHJA 1CFFA 5ER4X 5K89A 2F8PA 3M0WA 1DMOA 1EH2A 2OS8C 4PALA 1WRKA 5DKRA 2GGZA 2ZN9A 4GUKA 2M7NA 1WY9A 4WQ3A 3VRNA 1W7JB 1CFPA 1VRKA 2BCAA 2L50A 1AP4A 1XYDA 5DKNA 1QXPA 1SR6C 5I2OA 1CKKA 3HCMA 2WC8A 2LP2A 4PE0A 2KQYA 1SL7A 1MWNA 3DVKA 2M97A 1TN4A 1DJYA 1KFXS 4AQIA 1DT7B 2KDHA 2WORA 3AKBA 2PALA 4YI8A 1EL4A 3AAKA 1OZSA 1SCVA 3CWGA 3ZWHA 1AK8A 2F2PA 1GQMA 2M49B 2I18A 5JJGA 1ZMZA 1FI5A 2KFGA 4WRIA 3TS5B 2CBLA 1AJ4A 4U8DA 1UUSA 1SPYA 1SNLA 2D8NA 1JF0A 2LLSA 3FIAA 2Q4UA 1WDCC 3I5HC 3LLEA 1R6PA 1OSAA 1SR6B 2K7OA 2TN4A 2K7CA 3O78A 2LC5A 1ZUZA 3OP0A 5CSIA 3SG4A 1DGVA 1F8HA 1C7WA 2OS8B 1AHRA 1BMOA 5F6TA 1SK6D 2LE9B 3DVEA 1XK4C 3NSOA 1PK0D 4DRWA 4M2OA 1QX2A 1DVIA 2LV7A 3GK2A 4PE1A 3CR4X 2JTTA 2HQWA 2LLUA 5IBWA 3TDZA 1OMDA 1K9PA 1L7ZA 2FOTA 2MRDA 2Y1MA 2MHHA 1NX3A 3SG5A 1JBAA 4F0ZB 2AUCA 2Q91A 4DCKA 2L4IA 1NIWA 1KK7Z 2JPTA 2LVJA 2JU0A 5ER5A 2JXLA 1XO5A 4NQGA 4OCIA 4XYNA 2OPOA 1B8LA 1Y1AA 4C0KA 3D0YA 1KK8B 4MLWA 2NCOA 1QLSA 1DF0A 1GGZA 5B8IB 4A4CA 2M29A 2B1UA 5KTYA 1KWOC 4HRGA 4NDDA 3IF7A 2WNDA 1SW8A 2JNXA 1QIVA 1TCOB 5CSJA 1KFUL 2L51A 1QX7A 1QJTA 3I5FC 4MZLA 3SG3A 4YGAA 1B1GA 1NCZA 1IQ3A 1OMRA 1OMVA 5KU1A 1TIZA 4A4BA 1NYAA 1XFVO 3CS1A 2O5GA 4MEWA 1KQVA 3AAJA 5AANA 3KO0A 1F55A 1K94A 1MF8B 1JWDA 1CDMA 2KAVA 3CZTX 3I5GB 4FTGA 1S1EA 2RGIA 1B47A 5BPJA 5CPVA 1WRLA 2ZKMX 1BLQA 1K90D 3WNXB 1HQVA 2O60A 1D1OA 2BBMA 4GBAA 1BOCA 2WCEA
chains in the Genus database with same CATH superfamily
5JOLA 1PSRA 1N0YA 4XJKB 4P2YB 1QX5B 5FI6A 3BQ3A 3EVVA 2LVIA 2WCMA 1S26D 3LL8B 1B7TY 3S0EA 3SS5A 3VRQA 1DGUA 2KOTA 1YUUA 2LP3A 2GTEA 1J7RA 1PSBA 1SBJA 2L2CA 3NHIA 1RTP1 4P5OE 3F45A 4D1EA 2EHBA 3GOFA 1K93D 2E30A 3BXKA 2FJYA 4IL1A 2OTGB 3DY9A 5I94A 2LCPA 3PM2A 2BE6A 2CNPA 4AOMA 1CLBA 1M63B 1TWOA 1TNQA 1BR1B 1Y1XA 3SS3A 2L0PA 3BYAA 2CXJA 2PASA 2BE4A 3LK0A 5I8NA 1BODA 2K0JA 1QVIZ 2QEHA 3WHTB 2H2KA 1GM0A 1DJGA 2WCLA 1CB1A 1W7IB 3IQQA 2MJWB 2JQ6A 5HKWA 4N1GA 1J7QA 4GPLB 4IJ7A 1IJ5A 2LANA 2M1UA 2NCPA 1EJ3A 2ZFDA 1CDPA 5G08A 2JT8A 3JTDB 1LKJA 4E68A 2BKHB 3ZNIA 1CMGA 3PATA 1U5IB 2K7DA 3AKAA 4YGEB 1G8IA 3PN7C 1FW4A 3SIBA 2KBMA 1CM1A 2LUCA 4DS7A 3PSRA 1DELA 5KSZA 2L5YA 3CYZA 2JC2A 1SKTA 3GK4X 2WCBA 3PJIA 4I5JA 4PDZA 2JNFA 3JVTC 2HF5A 2BBNA 3OB1B 4M2QA 2QEVA 1YURA 1XK4A 2WCFA 1TTXA 3PALA 2I94A 5D69A 1KQMC 2BL0B 5FI7A 1RECA 2M1KB 4JWQA 3B87A 2BL0C 3FWCA 3EVRA 5D3OA 3WXAA 4MZJA 1B4CA 1AUIB 4MRYA 5GQQC 3B88A 2LMUA 1TCFA 1RJVA 1V1FA 1TRFA 2JOJA 1K9UA 2KNEA 2ZNEA 4QJ4B 5HKYA 1S5GY 3TDIA 3HX4A 1S3PA 4JD9A 2K8MB 2ZRSA 2K61A 1CTRA 1QV0A 1S5GZ 1UP5A 2JXCA 3D10A 4GGNA 1B7TZ 3OX5A 4CFRA 2Y4QA 3SS4A 1IGVA 1K95A 2KPHA 1XA5A 1F54A 1J1DA 4I5KA 2KI4B 3TS5C 4YI9A 3RZSA 4PE4A 1LVCD 1ODBA 1WLMA 2F33A 1YR5A 2QACA 3S0DA 1JSAA 3EK4A 1FPWA 1MR8A 3KF9A 3OX6A 2SASA 1UURA 1WDCB 2CTNA 3DF0A 1KWOB 1DJHA 4GGFC 1LINA 1UHNA 1CDLA 2MLEC 4TNCA 2CCMA 2GGMA 1FF1A 1YRUB 4MRXA 2ERBA 3EKHA 1OOJA 2A4JA 1BF5A 4OKHA 4ORCB 3R1OA 1AVSA 2MAZA 1QLKA 3OHMB 4ETOA 4NDCA 2LVVA 1MXLC 2Y1NA 1ALVA 2ZNDA 1XFUO 4FQOA 1CLMA 2KBIA 3I5IC 4M2PA 3KHEA 2LVKA 2F3ZA 4CFQA 4YRUA 1OQPA 2FCDA 2E6WA 5AERA 4ORBB 2H61C 3TZ1A 1SL9A 1A75A 3SG6A 1TUJA 2KYFA 2G9BA 4MSPA 4JQ0D 1Y0VH 1F4QA 1QATA 2KYCA 3O4YA 3BFBA 1H8BA 3K1EA 1YX8A 2AAOA 4USLA 1CNPA 4OVNF 3VROA 1QS7A 2YGUA 1CDNA 2LNKA 1MXEA 2LHIA 1A2XA 2KFHA 2IS9A 4OR9B 1BG1A 1ZOTB 1TNPA 4ZCVA 1YUSA 1QASA 1Z2CB 4CLNA 2CT9A 1TOPA 2LUXA 1C07A 4QJ5B 2JULA 5AXIA 3EK7A 2QEOA 5DKQA 3CR5X 1B8RA 2MBXA 2LAPA 2KQ6A 3TUYC 1M46A 1UHIA 4NDBA 4OV2A 1UHHA 1G33A 3CZ2A 4MZKA 3VRRA 1IIOA 1DJWA 4BY4A 4PE7A 1CFCA 2K60A 1CM4A 3I5FB 1S6JA 2ZN8A 3LCPC 3VB1A 1ALWA 1HT9A 1NX1A 2NZ0A 5HLVA 2K7BA 2LLTA 1BT6A 2KLDA 3KPXA 1K9KA 4PHJA 1RFJA 2FCEA 1JC2A 1DEKA 2JZIA 4C0JA 1XFWO 1DQEA 2BAPA 1IJ6A 4DUQA 1A29A 1J1EA 3LK1A 4ICBA 1CLLA 1R2UA 2KAXA 2P71A 4YGCB 3JTDC 2I2RE 3SG2A 3BUWB 1UWOA 4PHKA 4GGFA 1IKUA 1FI6A 1MUXA 2MA2A 1ORGA 2NLNA 3DD4A 1M45A 4MVFA 4XJKA 2L2EA 2LMVA 2H8VA 2NXQA 3E3RA 2K2FA 1KFXL 1YVLA 1NCXA 2KI6D 3IQOA 2LM5A 3SJSA 1XFXO 1OOIX 1SY9A 1B8CA 1IH0A 1Y1UA 2BKIB 1SYMA 4GAOA 2SCPA 1NPQA 2KGRA 1IQ5A 4KYNA 3BUNB 2V53A 1NX2A 3BOWA 4I5NB 2P6BB 1KQMB 1N2DA 3S0FA 2MLFC 4Q04A 5HKZA 1A75B 1M39A 2JWWA 3H4SE 1N65A 3ICBA 1QV1A 3PLFB 1TNWA 1M31A 3BUXB 1F4OA 2OTGC 1UHKA 4GFTA 3CTNA 2WCHA 3CR2A 4PHMA 1JFKA 1QIWA 3Q8IA 2L5XB 2M8UA 1KCYA 1IG5A 1GJYA 1OE9B 1AJ5A 1G4YR 1KSOA 2R2IA 1JF2A 4QJ3B 3RM1A 1GGWA 1Q80A 2BCXA 1RROA 2F3YA 1S6CA 1KFUS 1L2OC 2M7LA 3CGAA 1K96A 1KSMA 1X02A 2PQLA 2BECA 1K8UA 5FYXA 2KI4C 1ZFSA 3D78A 2WC5A 5HLOA 1DJZA 2BCBA 1ZACA 1WRZA 1C7VA 4ZCUA 2KI6C 2M0RA 1XFZO 3SIAA 3A8RA 2WCJA 4AQJA 3A4UB 3PM8A 3R1PA 2ISDA 1PRWA 4PHNA 3RLZA 3SG7A 2AMIA 1YRTB 1BJFA 1LA0A 1LXFC 3EK8A 1S36A 1XVJA 5I2LA 1JFJA 3R72A 3QRXA 1F71A 2KAYA 2EC6C 2JRFA 1QVIY 1YX7A 4MBEA 4PCWA 2G2BA 1IWQA 3DXLA 2KGBC 3I5GC 1YTZC 2QPTA 3BFAA 2F2OA 3WHUB 1SCMC 1MHOA 3FE8A 4DIRA 3EVUA 1QTXA 2JT0A 1OOGA 4OZDA 1DJXA 5D7FA 1NP8A 2PSRA 1V1GA 3NSLA 2HPSA 3MSEB 1BU3A 2COLB 2EGDA 3D73A 5HL1A 1NUBA 2DOQA 3D75A 1CFDA 2HETA 5CSFA 4INWA 1J55A 4MN0A 4BY5A 1LA3A 1NSHA 4C0LA 3DVJA 1EG3A 2VRGA 3VRPA 1CMFA 1E8AA 3TDUA 1A03A 3NSKA 4INXA 2LHLA 3O4XA 2EC6B 2PVBA 3VGOA 2LMTA 1JUOA 1XFYO 2Y5IA 3DF0B 1FBVA 1K2HA 3I5HB 2H61A 3D77A 3BUOB 1EXRA 1NWDA 1RWYA 3O6BA 3OGNA 4WQ2A 1PVAA 2PMYA 2PYQA 5HYDA 4YGDB 5I2QA 1H4BA 3TUYB 3CABA 3O2PA 3PFVA 3BUMB 1XFRA 4HREE 1T14A 1C3ZA 1YVHA 1YUTA 5AFPA 4JPZB 1J7OA 1MQ1A 1PULA 2I7AA 3L4AA 2KHNA 4N5XA 1IRJA 3FE9A 4UPGA 4HSZA 1NX0A 2K2AA 4I5LB 1SCMB 4ORAB 1S6IA 2JT3A 4L9MA 1Y6WA 3C1VA 3K21A 4YGBB 3KEVA 5AEQA 4CPVA 1BR4B 1F70A 2JTZA 2KSPA 1PVBA 3DVMA 1KK8C 2M3WA 3BFHA 4CIDA 3FWBA 3R1VA 5PALA 4FQTA 3UNWA 2GV5A 1B9AA 2M9GA 2P70A 3DZTA 3GK1A 3I5IB 2ZRTA 3FS7A 4GNKB 1DF0B 4N1FA 5J3XA 1SRAA 2KFFA 3BOWB 4HRHA 3D0YB 2FJUB 1A4PA 1OZOA 3QMEA 2WC6A 3EKJA 1DTLA 1NCYA 3NXAA 4R1EA 3JVTB 4YBHB 3B86A 5CSNA 1TNXA 1PALA 2L4HA 3B7AA 2PRUA 3EG5B 1SMGA 3CLNA 1SL8A 1WLZA 4JKTA 1EG4A 1KK7Y 1L2OB 5TNCA 1J7PA 3OB2B 1DJIA 2WOSA 3NSIA 1RK9A 2L98A 2HQ8A 3PN7B 1U5IA 1UHJA 1CFFA 5ER4X 1LS8A 5K89A 2F8PA 3M0WA 1DMOA 1EH2A 1QWVA 2OS8C 1C3YA 4PALA 1WRKA 5DKRA 2GGZA 2ZN9A 4GUKA 2M7NA 1WY9A 4WQ3A 3VRNA 1W7JB 1CFPA 1VRKA 2BCAA 2L50A 1AP4A 1XYDA 5DKNA 1QXPA 2JPOA 3CZ0A 3UO9A 1SR6C 5I2OA 1CKKA 3HCMA 2WC8A 2LP2A 3IVTA 2KQYA 4PE0A 1SL7A 1MWNA 3S0GA 3DVKA 2M97A 1TN4A 1DJYA 1KFXS 4AQIA 1DT7B 2KDHA 2WORA 3AKBA 2PALA 4YI8A 1EL4A 3AAKA 1OZSA 1SCVA 3CWGA 3ZWHA 1AK8A 2F2PA 1GQMA 2M49B 2I18A 5JJGA 1ZMZA 1FI5A 2KFGA 4WRIA 3TS5B 2CBLA 1AJ4A 4U8DA 1UUSA 1SPYA 3OBVA 3B6XA 1SNLA 2D8NA 1JF0A 2LLSA 3FIAA 2Q4UA 1Z4HA 1WDCC 3I5HC 3NGVA 3LLEA 1R6PA 1OSAA 1SR6B 2K7OA 2KLEA 2TN4A 2K7CA 3N7HA 3O78A 5FI2A 2LC5A 1ZUZA 4F7FA 3OP0A 5CSIA 3S0BA 3SG4A 1DGVA 1F8HA 1C7WA 2OS8B 1AHRA 1BMOA 3L47A 5F6TA 1SK6D 2LE9B 3S0AA 3DVEA 1XK4C 3NSOA 1P28A 1PK0D 4DRWA 4M2OA 1QX2A 1DVIA 2LV7A 3GK2A 4PE1A 3CR4X 2JTTA 2HQWA 2LLUA 5IBWA 3TDZA 1OMDA 3FE6A 1K9PA 1L7ZA 2FOTA 2MRDA 2Y1MA 2MHHA 1NX3A 3SG5A 3BJHA 1JBAA 3DYEA 4F0ZB 2AUCA 2Q91A 4DCKA 2L4IA 1DC1A 1NIWA 1KK7Z 2JPTA 2LVJA 2JU0A 5ER5A 5DICA 2JXLA 1XO5A 4NQGA 4OCIA 4XYNA 2OPOA 1OOFA 3CDNA 1B8LA 1Y1AA 4C0KA 4PT1A 3D74A 3D0YA 1KK8B 4MLWA 1SSEB 1QLSA 1DF0A 2NCOA 1GGZA 5B8IB 4A4CA 2M29A 2B1UA 5KTYA 1KWOC 4HRGA 4NDDA 3IF7A 2WNDA 1SW8A 2JNXA 1QIVA 1TCOB 1OOHA 3L4LA 5CSJA 1KFUL 2WCKA 2L51A 1QX7A 1QJTA 3I5FC 4MZLA 3SG3A 4YGAA 1TUZA 1B1GA 2BNXA 1NCZA 1IQ3A 1OMRA 1OW4A 1OMVA 5KU1A 1TIZA 4A4BA 1NYAA 1XFVO 3CS1A 2O5GA 4MEWA 3V2LA 1KQVA 3AAJA 5AANA 3KO0A 1F55A 1K94A 1MF8B 1JWDA 1CDMA 2KAVA 3CZTX 3I5GB 4FTGA 3CZ1A 1S1EA 2RGIA 1B47A 5BPJA 3D76A 1WRLA 2ZKMX 5CPVA 2QDIA 1BLQA 1W9ZA 1K90D 3WNXB 1HQVA 2O60A 1D1OA 5EL2A 2BBMA 2QEBA 4GBAA 3NHTA 1BOCA 2WCEA
chains in the Genus database with same CATH topology
5JOLA 1PSRA 1N0YA 4XJKB 4P2YB 1QX5B 3BQ3A 3EVVA 2LVIA 1S26D 3LL8B 1B7TY 3VRQA 1DGUA 2KOTA 1YUUA 2LP3A 1J7RA 1PSBA 1SBJA 1RTP1 4P5OE 3F45A 4D1EA 2EHBA 3GOFA 1K93D 2E30A 3BXKA 4IL1A 2OTGB 2LCPA 2BE6A 2CNPA 4AOMA 1CLBA 1M63B 1TNQA 1BR1B 1Y1XA 2L0PA 3BYAA 2CXJA 2PASA 2BE4A 3LK0A 5I8NA 1BODA 2K0JA 1QVIZ 3WHTB 2H2KA 1DJGA 1CB1A 1W7IB 3IQQA 2MJWB 2JQ6A 5HKWA 4N1GA 1J7QA 4GPLB 1IJ5A 2LANA 2M1UA 2NCPA 1EJ3A 2ZFDA 1CDPA 5G08A 2JT8A 3JTDB 1LKJA 4E68A 2BKHB 3ZNIA 1CMGA 3PATA 1U5IB 2K7DA 3AKAA 4YGEB 1G8IA 3PN7C 1FW4A 3SIBA 2KBMA 1CM1A 2LUCA 4DS7A 3PSRA 5KSZA 2JC2A 1SKTA 3GK4X 2WCBA 4I5JA 4PDZA 2JNFA 3JVTC 2HF5A 2BBNA 3OB1B 4M2QA 1YURA 1XK4A 2WCFA 1TTXA 3PALA 2I94A 5D69A 1KQMC 2BL0B 1RECA 2M1KB 4JWQA 2BL0C 3FWCA 3EVRA 3WXAA 4MZJA 1B4CA 1AUIB 4MRYA 5GQQC 2LMUA 1TCFA 1RJVA 1V1FA 1TRFA 2JOJA 1K9UA 2KNEA 2ZNEA 4QJ4B 5HKYA 1S5GY 3TDIA 3HX4A 1S3PA 2K8MB 2ZRSA 2K61A 1CTRA 1QV0A 1S5GZ 1UP5A 2JXCA 3D10A 4GGNA 1B7TZ 3OX5A 4CFRA 2Y4QA 1IGVA 1K95A 1XA5A 1F54A 1J1DA 4I5KA 2KI4B 3TS5C 4YI9A 4PE4A 2F33A 1LVCD 1ODBA 1WLMA 1YR5A 2QACA 1JSAA 3EK4A 1FPWA 1MR8A 3KF9A 3OX6A 2SASA 1UURA 1WDCB 2CTNA 3DF0A 1KWOB 1DJHA 4GGFC 1LINA 1UHNA 1CDLA 2MLEC 4TNCA 2CCMA 2GGMA 1FF1A 1YRUB 4MRXA 3EKHA 1OOJA 2A4JA 1BF5A 4OKHA 4ORCB 1AVSA 2MAZA 1QLKA 3OHMB 4ETOA 4NDCA 2LVVA 1MXLC 2Y1NA 1ALVA 2ZNDA 1XFUO 4FQOA 1CLMA 2KBIA 3I5IC 4M2PA 3KHEA 2LVKA 2F3ZA 4CFQA 4YRUA 1OQPA 2FCDA 2E6WA 5AERA 4ORBB 2H61C 3TZ1A 1SL9A 1A75A 3SG6A 2KYFA 2G9BA 4MSPA 4JQ0D 1Y0VH 1F4QA 1QATA 2KYCA 3O4YA 1H8BA 1YX8A 2AAOA 4USLA 1CNPA 4OVNF 3VROA 1QS7A 1CDNA 2LNKA 1MXEA 2LHIA 1A2XA 2KFHA 2IS9A 4OR9B 1BG1A 1ZOTB 1TNPA 4ZCVA 1YUSA 1QASA 4CLNA 2CT9A 1TOPA 2LUXA 1C07A 4QJ5B 2JULA 5AXIA 3EK7A 5DKQA 3CR5X 1B8RA 2MBXA 2LAPA 2KQ6A 3TUYC 1M46A 1UHIA 4NDBA 4OV2A 1UHHA 1G33A 3VRRA 4MZKA 1DJWA 4BY4A 4PE7A 1CFCA 1CM4A 3I5FB 1S6JA 2ZN8A 3LCPC 1ALWA 1HT9A 1NX1A 2NZ0A 5HLVA 2K7BA 2LLTA 1BT6A 3KPXA 1K9KA 4PHJA 1RFJA 2FCEA 1JC2A 2JZIA 4C0JA 1XFWO 1IJ6A 4DUQA 1A29A 1J1EA 3LK1A 4ICBA 1CLLA 1R2UA 2KAXA 4YGCB 3SG2A 3JTDC 2I2RE 3BUWB 1UWOA 4PHKA 4GGFA 1IKUA 1FI6A 1MUXA 2MA2A 4MVFA 2NLNA 3DD4A 1M45A 4XJKA 2L2EA 2LMVA 3E3RA 2NXQA 2K2FA 1KFXL 1YVLA 1NCXA 2KI6D 3IQOA 2LM5A 3SJSA 1XFXO 1SY9A 1B8CA 1IH0A 1Y1UA 2BKIB 1SYMA 4GAOA 2SCPA 1NPQA 2KGRA 1IQ5A 3BUNB 2V53A 1NX2A 3BOWA 4I5NB 2P6BB 1KQMB 1N2DA 2MLFC 4Q04A 5HKZA 1A75B 1M39A 2JWWA 3H4SE 1N65A 3ICBA 1QV1A 3PLFB 1TNWA 1M31A 3BUXB 1F4OA 2OTGC 1UHKA 4GFTA 3CTNA 4PHMA 3CR2A 1JFKA 1QIWA 2L5XB 2M8UA 1KCYA 1IG5A 1GJYA 1OE9B 1AJ5A 1G4YR 1KSOA 2R2IA 1JF2A 4QJ3B 3RM1A 1GGWA 1Q80A 2BCXA 1RROA 2F3YA 1S6CA 1KFUS 1L2OC 2M7LA 3CGAA 1K96A 1KSMA 1X02A 2BECA 1K8UA 5FYXA 2KI4C 1ZFSA 5HLOA 1DJZA 2BCBA 1ZACA 1WRZA 1C7VA 4ZCUA 2KI6C 2M0RA 1XFZO 3SIAA 3A8RA 4AQJA 3A4UB 3PM8A 2ISDA 3RLZA 1PRWA 4PHNA 3SG7A 2AMIA 1YRTB 1BJFA 1LA0A 1LXFC 3EK8A 1S36A 1XVJA 5I2LA 1JFJA 3QRXA 1F71A 2KAYA 2EC6C 2JRFA 1QVIY 1YX7A 4MBEA 4PCWA 2G2BA 1IWQA 2KGBC 3I5GC 1YTZC 2QPTA 2F2OA 3WHUB 1SCMC 1MHOA 4DIRA 3EVUA 1QTXA 2JT0A 1DJXA 5D7FA 1NP8A 2PSRA 1V1GA 3NSLA 2HPSA 3MSEB 1BU3A 2COLB 2EGDA 1NUBA 2DOQA 1CFDA 2HETA 5CSFA 4MN0A 1J55A 4BY5A 1LA3A 1NSHA 4C0LA 3DVJA 1EG3A 2VRGA 3VRPA 1CMFA 1E8AA 3TDUA 1A03A 3NSKA 2LHLA 2EC6B 2PVBA 3VGOA 2LMTA 1JUOA 1XFYO 2Y5IA 3DF0B 1FBVA 1K2HA 3I5HB 2H61A 3BUOB 1EXRA 1NWDA 1RWYA 3O6BA 4WQ2A 1PVAA 2PMYA 5HYDA 4YGDB 5I2QA 1H4BA 3TUYB 4HREE 3O2PA 3PFVA 3BUMB 1J7OA 1YVHA 5AFPA 1YUTA 4JPZB 1MQ1A 1PULA 2I7AA 4N5XA 2KHNA 1IRJA 4UPGA 4HSZA 1NX0A 2K2AA 4I5LB 1SCMB 4ORAB 1S6IA 2JT3A 4L9MA 1Y6WA 3C1VA 3K21A 4YGBB 3KEVA 5AEQA 4CPVA 1BR4B 1F70A 2JTZA 2KSPA 1PVBA 3DVMA 1KK8C 2M3WA 4CIDA 3FWBA 5PALA 2GV5A 1B9AA 2M9GA 3I5IB 4GNKB 3GK1A 4N1FA 2ZRTA 3FS7A 5J3XA 1DF0B 1SRAA 2KFFA 3BOWB 4HRHA 3D0YB 2FJUB 1A4PA 1OZOA 3EKJA 1DTLA 1NCYA 3NXAA 4R1EA 3JVTB 4YBHB 5CSNA 1TNXA 1PALA 2L4HA 2PRUA 1SMGA 3CLNA 1SL8A 1WLZA 1EG4A 1KK7Y 1L2OB 5TNCA 1J7PA 3OB2B 1DJIA 2WOSA 3NSIA 1RK9A 2L98A 2HQ8A 3PN7B 1U5IA 1UHJA 1CFFA 5ER4X 5K89A 2F8PA 3M0WA 1DMOA 1EH2A 2OS8C 4PALA 1WRKA 5DKRA 2GGZA 2ZN9A 4GUKA 2M7NA 1WY9A 4WQ3A 3VRNA 1W7JB 1CFPA 1VRKA 2BCAA 2L50A 1AP4A 1XYDA 5DKNA 1QXPA 1SR6C 5I2OA 1CKKA 3HCMA 2WC8A 2LP2A 4PE0A 2KQYA 1SL7A 1MWNA 3DVKA 2M97A 1TN4A 1DJYA 1KFXS 4AQIA 1DT7B 2KDHA 2WORA 3AKBA 2PALA 4YI8A 1EL4A 3AAKA 1OZSA 1SCVA 3CWGA 3ZWHA 1AK8A 2F2PA 1GQMA 2M49B 2I18A 5JJGA 1ZMZA 1FI5A 2KFGA 4WRIA 3TS5B 2CBLA 1AJ4A 4U8DA 1UUSA 1SPYA 1SNLA 2D8NA 1JF0A 2LLSA 3FIAA 2Q4UA 1WDCC 3I5HC 3LLEA 1R6PA 1OSAA 1SR6B 2K7OA 2TN4A 2K7CA 3O78A 2LC5A 1ZUZA 3OP0A 5CSIA 3SG4A 1DGVA 1F8HA 1C7WA 2OS8B 1AHRA 1BMOA 5F6TA 1SK6D 2LE9B 3DVEA 1XK4C 3NSOA 1PK0D 4DRWA 4M2OA 1QX2A 1DVIA 2LV7A 3GK2A 4PE1A 3CR4X 2JTTA 2HQWA 2LLUA 5IBWA 3TDZA 1OMDA 1K9PA 1L7ZA 2FOTA 2MRDA 2Y1MA 2MHHA 1NX3A 3SG5A 1JBAA 4F0ZB 2AUCA 2Q91A 4DCKA 2L4IA 1NIWA 1KK7Z 2JPTA 2LVJA 2JU0A 5ER5A 2JXLA 1XO5A 4NQGA 4OCIA 4XYNA 2OPOA 1B8LA 1Y1AA 4C0KA 3D0YA 1KK8B 4MLWA 2NCOA 1QLSA 1DF0A 1GGZA 5B8IB 4A4CA 2M29A 2B1UA 5KTYA 1KWOC 4HRGA 4NDDA 3IF7A 2WNDA 1SW8A 2JNXA 1QIVA 1TCOB 5CSJA 1KFUL 2L51A 1QX7A 1QJTA 3I5FC 4MZLA 3SG3A 4YGAA 1B1GA 1NCZA 1IQ3A 1OMRA 1OMVA 5KU1A 1TIZA 4A4BA 1NYAA 1XFVO 3CS1A 2O5GA 4MEWA 1KQVA 3AAJA 5AANA 3KO0A 1F55A 1K94A 1MF8B 1JWDA 1CDMA 2KAVA 3CZTX 3I5GB 4FTGA 1S1EA 2RGIA 1B47A 5BPJA 5CPVA 1WRLA 2ZKMX 1BLQA 1K90D 3WNXB 1HQVA 2O60A 1D1OA 2BBMA 4GBAA 1BOCA 2WCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JOL A;  1PSR A;  1N0Y A;  4XJK B;  4P2Y B;  1QX5 B;  3BQ3 A;  3EVV A;  2LVI A;  1S26 D;  3LL8 B;  1B7T Y;  3VRQ A;  1DGU A;  2KOT A;  1YUU A;  2LP3 A;  1J7R A;  1PSB A;  1SBJ A;  1RTP 1;  4P5O E;  3F45 A;  4D1E A;  2EHB A;  3GOF A;  1K93 D;  2E30 A;  3BXK A;  4IL1 A;  2OTG B;  2LCP A;  2BE6 A;  2CNP A;  4AOM A;  1CLB A;  1M63 B;  1TNQ A;  1BR1 B;  1Y1X A;  2L0P A;  3BYA A;  2CXJ A;  2PAS A;  2BE4 A;  3LK0 A;  5I8N A;  1BOD A;  2K0J A;  1QVI Z;  3WHT B;  2H2K A;  1DJG A;  1CB1 A;  1W7I B;  3IQQ A;  2MJW B;  2JQ6 A;  5HKW A;  4N1G A;  1J7Q A;  4GPL B;  1IJ5 A;  2LAN A;  2M1U A;  2NCP A;  1EJ3 A;  2ZFD A;  1CDP A;  5G08 A;  2JT8 A;  3JTD B;  1LKJ A;  4E68 A;  2BKH B;  3ZNI A;  1CMG A;  3PAT A;  1U5I B;  2K7D A;  3AKA A;  4YGE B;  1G8I A;  3PN7 C;  1FW4 A;  3SIB A;  2KBM A;  1CM1 A;  2LUC A;  4DS7 A;  3PSR A;  5KSZ A;  2JC2 A;  1SKT A;  3GK4 X;  2WCB A;  4I5J A;  4PDZ A;  2JNF A;  3JVT C;  2HF5 A;  2BBN A;  3OB1 B;  4M2Q A;  1YUR A;  1XK4 A;  2WCF A;  1TTX A;  3PAL A;  2I94 A;  5D69 A;  1KQM C;  2BL0 B;  1REC A;  2M1K B;  4JWQ A;  2BL0 C;  3FWC A;  3EVR A;  3WXA A;  4MZJ A;  1B4C A;  1AUI B;  4MRY A;  5GQQ C;  2LMU A;  1TCF A;  1RJV A;  1V1F A;  1TRF A;  2JOJ A;  1K9U A;  2KNE A;  2ZNE A;  4QJ4 B;  5HKY A;  1S5G Y;  3TDI A;  3HX4 A;  1S3P A;  2K8M B;  2ZRS A;  2K61 A;  1CTR A;  1QV0 A;  1S5G Z;  1UP5 A;  2JXC A;  3D10 A;  4GGN A;  1B7T Z;  3OX5 A;  4CFR A;  2Y4Q A;  1IGV A;  1K95 A;  1XA5 A;  1F54 A;  1J1D A;  4I5K A;  2KI4 B;  3TS5 C;  4YI9 A;  4PE4 A;  2F33 A;  1LVC D;  1ODB A;  1WLM A;  1YR5 A;  2QAC A;  1JSA A;  3EK4 A;  1FPW A;  1MR8 A;  3KF9 A;  3OX6 A;  2SAS A;  1UUR A;  1WDC B;  2CTN A;  3DF0 A;  1KWO B;  1DJH A;  4GGF C;  1LIN A;  1UHN A;  1CDL A;  2MLE C;  4TNC A;  2CCM A;  2GGM A;  1FF1 A;  1YRU B;  4MRX A;  3EKH A;  1OOJ A;  2A4J A;  1BF5 A;  4OKH A;  4ORC B;  1AVS A;  2MAZ A;  1QLK A;  3OHM B;  4ETO A;  4NDC A;  2LVV A;  1MXL C;  2Y1N A;  1ALV A;  2ZND A;  1XFU O;  4FQO A;  1CLM A;  2KBI A;  3I5I C;  4M2P A;  3KHE A;  2LVK A;  2F3Z A;  4CFQ A;  4YRU A;  1OQP A;  2FCD A;  2E6W A;  5AER A;  4ORB B;  2H61 C;  3TZ1 A;  1SL9 A;  1A75 A;  3SG6 A;  2KYF A;  2G9B A;  4MSP A;  4JQ0 D;  1Y0V H;  1F4Q A;  1QAT A;  2KYC A;  3O4Y A;  1H8B A;  1YX8 A;  2AAO A;  4USL A;  1CNP A;  4OVN F;  3VRO A;  1QS7 A;  1CDN A;  2LNK A;  1MXE A;  2LHI A;  1A2X A;  2KFH A;  2IS9 A;  4OR9 B;  1BG1 A;  1ZOT B;  1TNP A;  4ZCV A;  1YUS A;  1QAS A;  4CLN A;  2CT9 A;  1TOP A;  2LUX A;  1C07 A;  4QJ5 B;  2JUL A;  5AXI A;  3EK7 A;  5DKQ A;  3CR5 X;  1B8R A;  2MBX A;  2LAP A;  2KQ6 A;  3TUY C;  1M46 A;  1UHI A;  4NDB A;  4OV2 A;  1UHH A;  1G33 A;  3VRR A;  4MZK A;  1DJW A;  4BY4 A;  4PE7 A;  1CFC A;  1CM4 A;  3I5F B;  1S6J A;  2ZN8 A;  3LCP C;  1ALW A;  1HT9 A;  1NX1 A;  2NZ0 A;  5HLV A;  2K7B A;  2LLT A;  1BT6 A;  3KPX A;  1K9K A;  4PHJ A;  1RFJ A;  2FCE A;  1JC2 A;  2JZI A;  4C0J A;  1XFW O;  1IJ6 A;  4DUQ A;  1A29 A;  1J1E A;  3LK1 A;  4ICB A;  1CLL A;  1R2U A;  2KAX A;  4YGC B;  3SG2 A;  3JTD C;  2I2R E;  3BUW B;  1UWO A;  4PHK A;  4GGF A;  1IKU A;  1FI6 A;  1MUX A;  2MA2 A;  4MVF A;  2NLN A;  3DD4 A;  1M45 A;  4XJK A;  2L2E A;  2LMV A;  3E3R A;  2NXQ A;  2K2F A;  1KFX L;  1YVL A;  1NCX A;  2KI6 D;  3IQO A;  2LM5 A;  3SJS A;  1XFX O;  1SY9 A;  1B8C A;  1IH0 A;  1Y1U A;  2BKI B;  1SYM A;  4GAO A;  2SCP A;  1NPQ A;  2KGR A;  1IQ5 A;  3BUN B;  2V53 A;  1NX2 A;  3BOW A;  4I5N B;  2P6B B;  1KQM B;  1N2D A;  2MLF C;  4Q04 A;  5HKZ A;  1A75 B;  1M39 A;  2JWW A;  3H4S E;  1N65 A;  3ICB A;  1QV1 A;  3PLF B;  1TNW A;  1M31 A;  3BUX B;  1F4O A;  2OTG C;  1UHK A;  4GFT A;  3CTN A;  4PHM A;  3CR2 A;  1JFK A;  1QIW A;  2L5X B;  2M8U A;  1KCY A;  1IG5 A;  1GJY A;  1OE9 B;  1AJ5 A;  1G4Y R;  1KSO A;  2R2I A;  1JF2 A;  4QJ3 B;  3RM1 A;  1GGW A;  1Q80 A;  2BCX A;  1RRO A;  2F3Y A;  1S6C A;  1KFU S;  1L2O C;  2M7L A;  3CGA A;  1K96 A;  1KSM A;  1X02 A;  2BEC A;  1K8U A;  5FYX A;  2KI4 C;  1ZFS A;  5HLO A;  1DJZ A;  2BCB A;  1ZAC A;  1WRZ A;  1C7V A;  4ZCU A;  2KI6 C;  2M0R A;  1XFZ O;  3SIA A;  3A8R A;  4AQJ A;  3A4U B;  3PM8 A;  2ISD A;  3RLZ A;  1PRW A;  4PHN A;  3SG7 A;  2AMI A;  1YRT B;  1BJF A;  1LA0 A;  1LXF C;  3EK8 A;  1S36 A;  1XVJ A;  5I2L A;  1JFJ A;  3QRX A;  1F71 A;  2KAY A;  2EC6 C;  2JRF A;  1QVI Y;  1YX7 A;  4MBE A;  4PCW A;  2G2B A;  1IWQ A;  2KGB C;  3I5G C;  1YTZ C;  2QPT A;  2F2O A;  3WHU B;  1SCM C;  1MHO A;  4DIR A;  3EVU A;  1QTX A;  2JT0 A;  1DJX A;  5D7F A;  1NP8 A;  2PSR A;  1V1G A;  3NSL A;  2HPS A;  3MSE B;  1BU3 A;  2COL B;  2EGD A;  1NUB A;  2DOQ A;  1CFD A;  2HET A;  5CSF A;  4MN0 A;  1J55 A;  4BY5 A;  1LA3 A;  1NSH A;  4C0L A;  3DVJ A;  1EG3 A;  2VRG A;  3VRP A;  1CMF A;  1E8A A;  3TDU A;  1A03 A;  3NSK A;  2LHL A;  2EC6 B;  2PVB A;  3VGO A;  2LMT A;  1JUO A;  1XFY O;  2Y5I A;  3DF0 B;  1FBV A;  1K2H A;  3I5H B;  2H61 A;  3BUO B;  1EXR A;  1NWD A;  1RWY A;  3O6B A;  4WQ2 A;  1PVA A;  2PMY A;  5HYD A;  4YGD B;  5I2Q A;  1H4B A;  3TUY B;  4HRE E;  3O2P A;  3PFV A;  3BUM B;  1J7O A;  1YVH A;  5AFP A;  1YUT A;  4JPZ B;  1MQ1 A;  1PUL A;  2I7A A;  4N5X A;  2KHN A;  1IRJ A;  4UPG A;  4HSZ A;  1NX0 A;  2K2A A;  4I5L B;  1SCM B;  4ORA B;  1S6I A;  2JT3 A;  4L9M A;  1Y6W A;  3C1V A;  3K21 A;  4YGB B;  3KEV A;  5AEQ A;  4CPV A;  1BR4 B;  1F70 A;  2JTZ A;  2KSP A;  1PVB A;  3DVM A;  1KK8 C;  2M3W A;  4CID A;  3FWB A;  5PAL A;  2GV5 A;  1B9A A;  2M9G A;  3I5I B;  4GNK B;  3GK1 A;  4N1F A;  2ZRT A;  3FS7 A;  5J3X A;  1DF0 B;  1SRA A;  2KFF A;  3BOW B;  4HRH A;  3D0Y B;  2FJU B;  1A4P A;  1OZO A;  3EKJ A;  1DTL A;  1NCY A;  3NXA A;  4R1E A;  3JVT B;  4YBH B;  5CSN A;  1TNX A;  1PAL A;  2L4H A;  2PRU A;  1SMG A;  3CLN A;  1SL8 A;  1WLZ A;  1EG4 A;  1KK7 Y;  1L2O B;  5TNC A;  1J7P A;  3OB2 B;  1DJI A;  2WOS A;  3NSI A;  1RK9 A;  2L98 A;  2HQ8 A;  3PN7 B;  1U5I A;  1UHJ A;  1CFF A;  5ER4 X;  5K89 A;  2F8P A;  3M0W A;  1DMO A;  1EH2 A;  2OS8 C;  4PAL A;  1WRK A;  5DKR A;  2GGZ A;  2ZN9 A;  4GUK A;  2M7N A;  1WY9 A;  4WQ3 A;  3VRN A;  1W7J B;  1CFP A;  1VRK A;  2BCA A;  2L50 A;  1AP4 A;  1XYD A;  5DKN A;  1QXP A;  1SR6 C;  5I2O A;  1CKK A;  3HCM A;  2WC8 A;  2LP2 A;  4PE0 A;  2KQY A;  1SL7 A;  1MWN A;  3DVK A;  2M97 A;  1TN4 A;  1DJY A;  1KFX S;  4AQI A;  1DT7 B;  2KDH A;  2WOR A;  3AKB A;  2PAL A;  4YI8 A;  1EL4 A;  3AAK A;  1OZS A;  1SCV A;  3CWG A;  3ZWH A;  1AK8 A;  2F2P A;  1GQM A;  2M49 B;  2I18 A;  5JJG A;  1ZMZ A;  1FI5 A;  2KFG A;  4WRI A;  3TS5 B;  2CBL A;  1AJ4 A;  4U8D A;  1UUS A;  1SPY A;  1SNL A;  2D8N A;  1JF0 A;  2LLS A;  3FIA A;  2Q4U A;  1WDC C;  3I5H C;  3LLE A;  1R6P A;  1OSA A;  1SR6 B;  2K7O A;  2TN4 A;  2K7C A;  3O78 A;  2LC5 A;  1ZUZ A;  3OP0 A;  5CSI A;  3SG4 A;  1DGV A;  1F8H A;  1C7W A;  2OS8 B;  1AHR A;  1BMO A;  5F6T A;  1SK6 D;  2LE9 B;  3DVE A;  1XK4 C;  3NSO A;  1PK0 D;  4DRW A;  4M2O A;  1QX2 A;  1DVI A;  2LV7 A;  3GK2 A;  4PE1 A;  3CR4 X;  2JTT A;  2HQW A;  2LLU A;  5IBW A;  3TDZ A;  1OMD A;  1K9P A;  1L7Z A;  2FOT A;  2MRD A;  2Y1M A;  2MHH A;  1NX3 A;  3SG5 A;  1JBA A;  4F0Z B;  2AUC A;  2Q91 A;  4DCK A;  2L4I A;  1NIW A;  1KK7 Z;  2JPT A;  2LVJ A;  2JU0 A;  5ER5 A;  2JXL A;  1XO5 A;  4NQG A;  4OCI A;  4XYN A;  2OPO A;  1B8L A;  1Y1A A;  4C0K A;  3D0Y A;  1KK8 B;  4MLW A;  2NCO A;  1QLS A;  1DF0 A;  1GGZ A;  5B8I B;  4A4C A;  2M29 A;  2B1U A;  5KTY A;  1KWO C;  4HRG A;  4NDD A;  3IF7 A;  2WND A;  1SW8 A;  2JNX A;  1QIV A;  1TCO B;  5CSJ A;  1KFU L;  2L51 A;  1QX7 A;  1QJT A;  3I5F C;  4MZL A;  3SG3 A;  4YGA A;  1B1G A;  1NCZ A;  1IQ3 A;  1OMR A;  1OMV A;  5KU1 A;  1TIZ A;  4A4B A;  1NYA A;  1XFV O;  3CS1 A;  2O5G A;  4MEW A;  1KQV A;  3AAJ A;  5AAN A;  3KO0 A;  1F55 A;  1K94 A;  1MF8 B;  1JWD A;  1CDM A;  2KAV A;  3CZT X;  3I5G B;  4FTG A;  1S1E A;  2RGI A;  1B47 A;  5BPJ A;  5CPV A;  1WRL A;  2ZKM X;  1BLQ A;  1K90 D;  3WNX B;  1HQV A;  2O60 A;  1D1O A;  2BBM A;  4GBA A;  1BOC A;  2WCE A; 
#chains in the Genus database with same CATH topology
 5JOL A;  1PSR A;  1N0Y A;  4XJK B;  4P2Y B;  1QX5 B;  5FI6 A;  3BQ3 A;  3EVV A;  2LVI A;  2WCM A;  1S26 D;  3LL8 B;  1B7T Y;  3S0E A;  3SS5 A;  3VRQ A;  1DGU A;  2KOT A;  1YUU A;  2LP3 A;  2GTE A;  1J7R A;  1PSB A;  1SBJ A;  2L2C A;  3NHI A;  1RTP 1;  4P5O E;  3F45 A;  4D1E A;  2EHB A;  3GOF A;  1K93 D;  2E30 A;  3BXK A;  2FJY A;  4IL1 A;  2OTG B;  3DY9 A;  5I94 A;  2LCP A;  3PM2 A;  2BE6 A;  2CNP A;  4AOM A;  1CLB A;  1M63 B;  1TWO A;  1TNQ A;  1BR1 B;  1Y1X A;  3SS3 A;  2L0P A;  3BYA A;  2CXJ A;  2PAS A;  2BE4 A;  3LK0 A;  5I8N A;  1BOD A;  2K0J A;  1QVI Z;  2QEH A;  3WHT B;  2H2K A;  1GM0 A;  1DJG A;  2WCL A;  1CB1 A;  1W7I B;  3IQQ A;  2MJW B;  2JQ6 A;  5HKW A;  4N1G A;  1J7Q A;  4GPL B;  4IJ7 A;  1IJ5 A;  2LAN A;  2M1U A;  2NCP A;  1EJ3 A;  2ZFD A;  1CDP A;  5G08 A;  2JT8 A;  3JTD B;  1LKJ A;  4E68 A;  2BKH B;  3ZNI A;  1CMG A;  3PAT A;  1U5I B;  2K7D A;  3AKA A;  4YGE B;  1G8I A;  3PN7 C;  1FW4 A;  3SIB A;  2KBM A;  1CM1 A;  2LUC A;  4DS7 A;  3PSR A;  1DEL A;  5KSZ A;  2L5Y A;  3CYZ A;  2JC2 A;  1SKT A;  3GK4 X;  2WCB A;  3PJI A;  4I5J A;  4PDZ A;  2JNF A;  3JVT C;  2HF5 A;  2BBN A;  3OB1 B;  4M2Q A;  2QEV A;  1YUR A;  1XK4 A;  2WCF A;  1TTX A;  3PAL A;  2I94 A;  5D69 A;  1KQM C;  2BL0 B;  5FI7 A;  1REC A;  2M1K B;  4JWQ A;  3B87 A;  2BL0 C;  3FWC A;  3EVR A;  5D3O A;  3WXA A;  4MZJ A;  1B4C A;  1AUI B;  4MRY A;  5GQQ C;  3B88 A;  2LMU A;  1TCF A;  1RJV A;  1V1F A;  1TRF A;  2JOJ A;  1K9U A;  2KNE A;  2ZNE A;  4QJ4 B;  5HKY A;  1S5G Y;  3TDI A;  3HX4 A;  1S3P A;  4JD9 A;  2K8M B;  2ZRS A;  2K61 A;  1CTR A;  1QV0 A;  1S5G Z;  1UP5 A;  2JXC A;  3D10 A;  4GGN A;  1B7T Z;  3OX5 A;  4CFR A;  2Y4Q A;  3SS4 A;  1IGV A;  1K95 A;  2KPH A;  1XA5 A;  1F54 A;  1J1D A;  4I5K A;  2KI4 B;  3TS5 C;  4YI9 A;  3RZS A;  4PE4 A;  1LVC D;  1ODB A;  1WLM A;  2F33 A;  1YR5 A;  2QAC A;  3S0D A;  1JSA A;  3EK4 A;  1FPW A;  1MR8 A;  3KF9 A;  3OX6 A;  2SAS A;  1UUR A;  1WDC B;  2CTN A;  3DF0 A;  1KWO B;  1DJH A;  4GGF C;  1LIN A;  1UHN A;  1CDL A;  2MLE C;  4TNC A;  2CCM A;  2GGM A;  1FF1 A;  1YRU B;  4MRX A;  2ERB A;  3EKH A;  1OOJ A;  2A4J A;  1BF5 A;  4OKH A;  4ORC B;  3R1O A;  1AVS A;  2MAZ A;  1QLK A;  3OHM B;  4ETO A;  4NDC A;  2LVV A;  1MXL C;  2Y1N A;  1ALV A;  2ZND A;  1XFU O;  4FQO A;  1CLM A;  2KBI A;  3I5I C;  4M2P A;  3KHE A;  2LVK A;  2F3Z A;  4CFQ A;  4YRU A;  1OQP A;  2FCD A;  2E6W A;  5AER A;  4ORB B;  2H61 C;  3TZ1 A;  1SL9 A;  1A75 A;  3SG6 A;  1TUJ A;  2KYF A;  2G9B A;  4MSP A;  4JQ0 D;  1Y0V H;  1F4Q A;  1QAT A;  2KYC A;  3O4Y A;  3BFB A;  1H8B A;  3K1E A;  1YX8 A;  2AAO A;  4USL A;  1CNP A;  4OVN F;  3VRO A;  1QS7 A;  2YGU A;  1CDN A;  2LNK A;  1MXE A;  2LHI A;  1A2X A;  2KFH A;  2IS9 A;  4OR9 B;  1BG1 A;  1ZOT B;  1TNP A;  4ZCV A;  1YUS A;  1QAS A;  1Z2C B;  4CLN A;  2CT9 A;  1TOP A;  2LUX A;  1C07 A;  4QJ5 B;  2JUL A;  5AXI A;  3EK7 A;  2QEO A;  5DKQ A;  3CR5 X;  1B8R A;  2MBX A;  2LAP A;  2KQ6 A;  3TUY C;  1M46 A;  1UHI A;  4NDB A;  4OV2 A;  1UHH A;  1G33 A;  3CZ2 A;  4MZK A;  3VRR A;  1IIO A;  1DJW A;  4BY4 A;  4PE7 A;  1CFC A;  2K60 A;  1CM4 A;  3I5F B;  1S6J A;  2ZN8 A;  3LCP C;  3VB1 A;  1ALW A;  1HT9 A;  1NX1 A;  2NZ0 A;  5HLV A;  2K7B A;  2LLT A;  1BT6 A;  2KLD A;  3KPX A;  1K9K A;  4PHJ A;  1RFJ A;  2FCE A;  1JC2 A;  1DEK A;  2JZI A;  4C0J A;  1XFW O;  1DQE A;  2BAP A;  1IJ6 A;  4DUQ A;  1A29 A;  1J1E A;  3LK1 A;  4ICB A;  1CLL A;  1R2U A;  2KAX A;  2P71 A;  4YGC B;  3JTD C;  2I2R E;  3SG2 A;  3BUW B;  1UWO A;  4PHK A;  4GGF A;  1IKU A;  1FI6 A;  1MUX A;  2MA2 A;  1ORG A;  2NLN A;  3DD4 A;  1M45 A;  4MVF A;  4XJK A;  2L2E A;  2LMV A;  2H8V A;  2NXQ A;  3E3R A;  2K2F A;  1KFX L;  1YVL A;  1NCX A;  2KI6 D;  3IQO A;  2LM5 A;  3SJS A;  1XFX O;  1OOI X;  1SY9 A;  1B8C A;  1IH0 A;  1Y1U A;  2BKI B;  1SYM A;  4GAO A;  2SCP A;  1NPQ A;  2KGR A;  1IQ5 A;  4KYN A;  3BUN B;  2V53 A;  1NX2 A;  3BOW A;  4I5N B;  2P6B B;  1KQM B;  1N2D A;  3S0F A;  2MLF C;  4Q04 A;  5HKZ A;  1A75 B;  1M39 A;  2JWW A;  3H4S E;  1N65 A;  3ICB A;  1QV1 A;  3PLF B;  1TNW A;  1M31 A;  3BUX B;  1F4O A;  2OTG C;  1UHK A;  4GFT A;  3CTN A;  2WCH A;  3CR2 A;  4PHM A;  1JFK A;  1QIW A;  3Q8I A;  2L5X B;  2M8U A;  1KCY A;  1IG5 A;  1GJY A;  1OE9 B;  1AJ5 A;  1G4Y R;  1KSO A;  2R2I A;  1JF2 A;  4QJ3 B;  3RM1 A;  1GGW A;  1Q80 A;  2BCX A;  1RRO A;  2F3Y A;  1S6C A;  1KFU S;  1L2O C;  2M7L A;  3CGA A;  1K96 A;  1KSM A;  1X02 A;  2PQL A;  2BEC A;  1K8U A;  5FYX A;  2KI4 C;  1ZFS A;  3D78 A;  2WC5 A;  5HLO A;  1DJZ A;  2BCB A;  1ZAC A;  1WRZ A;  1C7V A;  4ZCU A;  2KI6 C;  2M0R A;  1XFZ O;  3SIA A;  3A8R A;  2WCJ A;  4AQJ A;  3A4U B;  3PM8 A;  3R1P A;  2ISD A;  1PRW A;  4PHN A;  3RLZ A;  3SG7 A;  2AMI A;  1YRT B;  1BJF A;  1LA0 A;  1LXF C;  3EK8 A;  1S36 A;  1XVJ A;  5I2L A;  1JFJ A;  3R72 A;  3QRX A;  1F71 A;  2KAY A;  2EC6 C;  2JRF A;  1QVI Y;  1YX7 A;  4MBE A;  4PCW A;  2G2B A;  1IWQ A;  3DXL A;  2KGB C;  3I5G C;  1YTZ C;  2QPT A;  3BFA A;  2F2O A;  3WHU B;  1SCM C;  1MHO A;  3FE8 A;  4DIR A;  3EVU A;  1QTX A;  2JT0 A;  1OOG A;  4OZD A;  1DJX A;  5D7F A;  1NP8 A;  2PSR A;  1V1G A;  3NSL A;  2HPS A;  3MSE B;  1BU3 A;  2COL B;  2EGD A;  3D73 A;  5HL1 A;  1NUB A;  2DOQ A;  3D75 A;  1CFD A;  2HET A;  5CSF A;  4INW A;  1J55 A;  4MN0 A;  4BY5 A;  1LA3 A;  1NSH A;  4C0L A;  3DVJ A;  1EG3 A;  2VRG A;  3VRP A;  1CMF A;  1E8A A;  3TDU A;  1A03 A;  3NSK A;  4INX A;  2LHL A;  3O4X A;  2EC6 B;  2PVB A;  3VGO A;  2LMT A;  1JUO A;  1XFY O;  2Y5I A;  3DF0 B;  1FBV A;  1K2H A;  3I5H B;  2H61 A;  3D77 A;  3BUO B;  1EXR A;  1NWD A;  1RWY A;  3O6B A;  3OGN A;  4WQ2 A;  1PVA A;  2PMY A;  2PYQ A;  5HYD A;  4YGD B;  5I2Q A;  1H4B A;  3TUY B;  3CAB A;  3O2P A;  3PFV A;  3BUM B;  1XFR A;  4HRE E;  1T14 A;  1C3Z A;  1YVH A;  1YUT A;  5AFP A;  4JPZ B;  1J7O A;  1MQ1 A;  1PUL A;  2I7A A;  3L4A A;  2KHN A;  4N5X A;  1IRJ A;  3FE9 A;  4UPG A;  4HSZ A;  1NX0 A;  2K2A A;  4I5L B;  1SCM B;  4ORA B;  1S6I A;  2JT3 A;  4L9M A;  1Y6W A;  3C1V A;  3K21 A;  4YGB B;  3KEV A;  5AEQ A;  4CPV A;  1BR4 B;  1F70 A;  2JTZ A;  2KSP A;  1PVB A;  3DVM A;  1KK8 C;  2M3W A;  3BFH A;  4CID A;  3FWB A;  3R1V A;  5PAL A;  4FQT A;  3UNW A;  2GV5 A;  1B9A A;  2M9G A;  2P70 A;  3DZT A;  3GK1 A;  3I5I B;  2ZRT A;  3FS7 A;  4GNK B;  1DF0 B;  4N1F A;  5J3X A;  1SRA A;  2KFF A;  3BOW B;  4HRH A;  3D0Y B;  2FJU B;  1A4P A;  1OZO A;  3QME A;  2WC6 A;  3EKJ A;  1DTL A;  1NCY A;  3NXA A;  4R1E A;  3JVT B;  4YBH B;  3B86 A;  5CSN A;  1TNX A;  1PAL A;  2L4H A;  3B7A A;  2PRU A;  3EG5 B;  1SMG A;  3CLN A;  1SL8 A;  1WLZ A;  4JKT A;  1EG4 A;  1KK7 Y;  1L2O B;  5TNC A;  1J7P A;  3OB2 B;  1DJI A;  2WOS A;  3NSI A;  1RK9 A;  2L98 A;  2HQ8 A;  3PN7 B;  1U5I A;  1UHJ A;  1CFF A;  5ER4 X;  1LS8 A;  5K89 A;  2F8P A;  3M0W A;  1DMO A;  1EH2 A;  1QWV A;  2OS8 C;  1C3Y A;  4PAL A;  1WRK A;  5DKR A;  2GGZ A;  2ZN9 A;  4GUK A;  2M7N A;  1WY9 A;  4WQ3 A;  3VRN A;  1W7J B;  1CFP A;  1VRK A;  2BCA A;  2L50 A;  1AP4 A;  1XYD A;  5DKN A;  1QXP A;  2JPO A;  3CZ0 A;  3UO9 A;  1SR6 C;  5I2O A;  1CKK A;  3HCM A;  2WC8 A;  2LP2 A;  3IVT A;  2KQY A;  4PE0 A;  1SL7 A;  1MWN A;  3S0G A;  3DVK A;  2M97 A;  1TN4 A;  1DJY A;  1KFX S;  4AQI A;  1DT7 B;  2KDH A;  2WOR A;  3AKB A;  2PAL A;  4YI8 A;  1EL4 A;  3AAK A;  1OZS A;  1SCV A;  3CWG A;  3ZWH A;  1AK8 A;  2F2P A;  1GQM A;  2M49 B;  2I18 A;  5JJG A;  1ZMZ A;  1FI5 A;  2KFG A;  4WRI A;  3TS5 B;  2CBL A;  1AJ4 A;  4U8D A;  1UUS A;  1SPY A;  3OBV A;  3B6X A;  1SNL A;  2D8N A;  1JF0 A;  2LLS A;  3FIA A;  2Q4U A;  1Z4H A;  1WDC C;  3I5H C;  3NGV A;  3LLE A;  1R6P A;  1OSA A;  1SR6 B;  2K7O A;  2KLE A;  2TN4 A;  2K7C A;  3N7H A;  3O78 A;  5FI2 A;  2LC5 A;  1ZUZ A;  4F7F A;  3OP0 A;  5CSI A;  3S0B A;  3SG4 A;  1DGV A;  1F8H A;  1C7W A;  2OS8 B;  1AHR A;  1BMO A;  3L47 A;  5F6T A;  1SK6 D;  2LE9 B;  3S0A A;  3DVE A;  1XK4 C;  3NSO A;  1P28 A;  1PK0 D;  4DRW A;  4M2O A;  1QX2 A;  1DVI A;  2LV7 A;  3GK2 A;  4PE1 A;  3CR4 X;  2JTT A;  2HQW A;  2LLU A;  5IBW A;  3TDZ A;  1OMD A;  3FE6 A;  1K9P A;  1L7Z A;  2FOT A;  2MRD A;  2Y1M A;  2MHH A;  1NX3 A;  3SG5 A;  3BJH A;  1JBA A;  3DYE A;  4F0Z B;  2AUC A;  2Q91 A;  4DCK A;  2L4I A;  1DC1 A;  1NIW A;  1KK7 Z;  2JPT A;  2LVJ A;  2JU0 A;  5ER5 A;  5DIC A;  2JXL A;  1XO5 A;  4NQG A;  4OCI A;  4XYN A;  2OPO A;  1OOF A;  3CDN A;  1B8L A;  1Y1A A;  4C0K A;  4PT1 A;  3D74 A;  3D0Y A;  1KK8 B;  4MLW A;  1SSE B;  1QLS A;  1DF0 A;  2NCO A;  1GGZ A;  5B8I B;  4A4C A;  2M29 A;  2B1U A;  5KTY A;  1KWO C;  4HRG A;  4NDD A;  3IF7 A;  2WND A;  1SW8 A;  2JNX A;  1QIV A;  1TCO B;  1OOH A;  3L4L A;  5CSJ A;  1KFU L;  2WCK A;  2L51 A;  1QX7 A;  1QJT A;  3I5F C;  4MZL A;  3SG3 A;  4YGA A;  1TUZ A;  1B1G A;  2BNX A;  1NCZ A;  1IQ3 A;  1OMR A;  1OW4 A;  1OMV A;  5KU1 A;  1TIZ A;  4A4B A;  1NYA A;  1XFV O;  3CS1 A;  2O5G A;  4MEW A;  3V2L A;  1KQV A;  3AAJ A;  5AAN A;  3KO0 A;  1F55 A;  1K94 A;  1MF8 B;  1JWD A;  1CDM A;  2KAV A;  3CZT X;  3I5G B;  4FTG A;  3CZ1 A;  1S1E A;  2RGI A;  1B47 A;  5BPJ A;  3D76 A;  1WRL A;  2ZKM X;  5CPV A;  2QDI A;  1BLQ A;  1W9Z A;  1K90 D;  3WNX B;  1HQV A;  2O60 A;  1D1O A;  5EL2 A;  2BBM A;  2QEB A;  4GBA A;  3NHT A;  1BOC A;  2WCE A; 
#chains in the Genus database with same CATH homology
 5JOL A;  1PSR A;  1N0Y A;  4XJK B;  4P2Y B;  1QX5 B;  3BQ3 A;  3EVV A;  2LVI A;  1S26 D;  3LL8 B;  1B7T Y;  3VRQ A;  1DGU A;  2KOT A;  1YUU A;  2LP3 A;  1J7R A;  1PSB A;  1SBJ A;  1RTP 1;  4P5O E;  3F45 A;  4D1E A;  2EHB A;  3GOF A;  1K93 D;  2E30 A;  3BXK A;  4IL1 A;  2OTG B;  2LCP A;  2BE6 A;  2CNP A;  4AOM A;  1CLB A;  1M63 B;  1TNQ A;  1BR1 B;  1Y1X A;  2L0P A;  3BYA A;  2CXJ A;  2PAS A;  2BE4 A;  3LK0 A;  5I8N A;  1BOD A;  2K0J A;  1QVI Z;  3WHT B;  2H2K A;  1DJG A;  1CB1 A;  1W7I B;  3IQQ A;  2MJW B;  2JQ6 A;  5HKW A;  4N1G A;  1J7Q A;  4GPL B;  1IJ5 A;  2LAN A;  2M1U A;  2NCP A;  1EJ3 A;  2ZFD A;  1CDP A;  5G08 A;  2JT8 A;  3JTD B;  1LKJ A;  4E68 A;  2BKH B;  3ZNI A;  1CMG A;  3PAT A;  1U5I B;  2K7D A;  3AKA A;  4YGE B;  1G8I A;  3PN7 C;  1FW4 A;  3SIB A;  2KBM A;  1CM1 A;  2LUC A;  4DS7 A;  3PSR A;  5KSZ A;  2JC2 A;  1SKT A;  3GK4 X;  2WCB A;  4I5J A;  4PDZ A;  2JNF A;  3JVT C;  2HF5 A;  2BBN A;  3OB1 B;  4M2Q A;  1YUR A;  1XK4 A;  2WCF A;  1TTX A;  3PAL A;  2I94 A;  5D69 A;  1KQM C;  2BL0 B;  1REC A;  2M1K B;  4JWQ A;  2BL0 C;  3FWC A;  3EVR A;  3WXA A;  4MZJ A;  1B4C A;  1AUI B;  4MRY A;  5GQQ C;  2LMU A;  1TCF A;  1RJV A;  1V1F A;  1TRF A;  2JOJ A;  1K9U A;  2KNE A;  2ZNE A;  4QJ4 B;  5HKY A;  1S5G Y;  3TDI A;  3HX4 A;  1S3P A;  2K8M B;  2ZRS A;  2K61 A;  1CTR A;  1QV0 A;  1S5G Z;  1UP5 A;  2JXC A;  3D10 A;  4GGN A;  1B7T Z;  3OX5 A;  4CFR A;  2Y4Q A;  1IGV A;  1K95 A;  1XA5 A;  1F54 A;  1J1D A;  4I5K A;  2KI4 B;  3TS5 C;  4YI9 A;  4PE4 A;  2F33 A;  1LVC D;  1ODB A;  1WLM A;  1YR5 A;  2QAC A;  1JSA A;  3EK4 A;  1FPW A;  1MR8 A;  3KF9 A;  3OX6 A;  2SAS A;  1UUR A;  1WDC B;  2CTN A;  3DF0 A;  1KWO B;  1DJH A;  4GGF C;  1LIN A;  1UHN A;  1CDL A;  2MLE C;  4TNC A;  2CCM A;  2GGM A;  1FF1 A;  1YRU B;  4MRX A;  3EKH A;  1OOJ A;  2A4J A;  1BF5 A;  4OKH A;  4ORC B;  1AVS A;  2MAZ A;  1QLK A;  3OHM B;  4ETO A;  4NDC A;  2LVV A;  1MXL C;  2Y1N A;  1ALV A;  2ZND A;  1XFU O;  4FQO A;  1CLM A;  2KBI A;  3I5I C;  4M2P A;  3KHE A;  2LVK A;  2F3Z A;  4CFQ A;  4YRU A;  1OQP A;  2FCD A;  2E6W A;  5AER A;  4ORB B;  2H61 C;  3TZ1 A;  1SL9 A;  1A75 A;  3SG6 A;  2KYF A;  2G9B A;  4MSP A;  4JQ0 D;  1Y0V H;  1F4Q A;  1QAT A;  2KYC A;  3O4Y A;  1H8B A;  1YX8 A;  2AAO A;  4USL A;  1CNP A;  4OVN F;  3VRO A;  1QS7 A;  1CDN A;  2LNK A;  1MXE A;  2LHI A;  1A2X A;  2KFH A;  2IS9 A;  4OR9 B;  1BG1 A;  1ZOT B;  1TNP A;  4ZCV A;  1YUS A;  1QAS A;  4CLN A;  2CT9 A;  1TOP A;  2LUX A;  1C07 A;  4QJ5 B;  2JUL A;  5AXI A;  3EK7 A;  5DKQ A;  3CR5 X;  1B8R A;  2MBX A;  2LAP A;  2KQ6 A;  3TUY C;  1M46 A;  1UHI A;  4NDB A;  4OV2 A;  1UHH A;  1G33 A;  3VRR A;  4MZK A;  1DJW A;  4BY4 A;  4PE7 A;  1CFC A;  1CM4 A;  3I5F B;  1S6J A;  2ZN8 A;  3LCP C;  1ALW A;  1HT9 A;  1NX1 A;  2NZ0 A;  5HLV A;  2K7B A;  2LLT A;  1BT6 A;  3KPX A;  1K9K A;  4PHJ A;  1RFJ A;  2FCE A;  1JC2 A;  2JZI A;  4C0J A;  1XFW O;  1IJ6 A;  4DUQ A;  1A29 A;  1J1E A;  3LK1 A;  4ICB A;  1CLL A;  1R2U A;  2KAX A;  4YGC B;  3SG2 A;  3JTD C;  2I2R E;  3BUW B;  1UWO A;  4PHK A;  4GGF A;  1IKU A;  1FI6 A;  1MUX A;  2MA2 A;  4MVF A;  2NLN A;  3DD4 A;  1M45 A;  4XJK A;  2L2E A;  2LMV A;  3E3R A;  2NXQ A;  2K2F A;  1KFX L;  1YVL A;  1NCX A;  2KI6 D;  3IQO A;  2LM5 A;  3SJS A;  1XFX O;  1SY9 A;  1B8C A;  1IH0 A;  1Y1U A;  2BKI B;  1SYM A;  4GAO A;  2SCP A;  1NPQ A;  2KGR A;  1IQ5 A;  3BUN B;  2V53 A;  1NX2 A;  3BOW A;  4I5N B;  2P6B B;  1KQM B;  1N2D A;  2MLF C;  4Q04 A;  5HKZ A;  1A75 B;  1M39 A;  2JWW A;  3H4S E;  1N65 A;  3ICB A;  1QV1 A;  3PLF B;  1TNW A;  1M31 A;  3BUX B;  1F4O A;  2OTG C;  1UHK A;  4GFT A;  3CTN A;  4PHM A;  3CR2 A;  1JFK A;  1QIW A;  2L5X B;  2M8U A;  1KCY A;  1IG5 A;  1GJY A;  1OE9 B;  1AJ5 A;  1G4Y R;  1KSO A;  2R2I A;  1JF2 A;  4QJ3 B;  3RM1 A;  1GGW A;  1Q80 A;  2BCX A;  1RRO A;  2F3Y A;  1S6C A;  1KFU S;  1L2O C;  2M7L A;  3CGA A;  1K96 A;  1KSM A;  1X02 A;  2BEC A;  1K8U A;  5FYX A;  2KI4 C;  1ZFS A;  5HLO A;  1DJZ A;  2BCB A;  1ZAC A;  1WRZ A;  1C7V A;  4ZCU A;  2KI6 C;  2M0R A;  1XFZ O;  3SIA A;  3A8R A;  4AQJ A;  3A4U B;  3PM8 A;  2ISD A;  3RLZ A;  1PRW A;  4PHN A;  3SG7 A;  2AMI A;  1YRT B;  1BJF A;  1LA0 A;  1LXF C;  3EK8 A;  1S36 A;  1XVJ A;  5I2L A;  1JFJ A;  3QRX A;  1F71 A;  2KAY A;  2EC6 C;  2JRF A;  1QVI Y;  1YX7 A;  4MBE A;  4PCW A;  2G2B A;  1IWQ A;  2KGB C;  3I5G C;  1YTZ C;  2QPT A;  2F2O A;  3WHU B;  1SCM C;  1MHO A;  4DIR A;  3EVU A;  1QTX A;  2JT0 A;  1DJX A;  5D7F A;  1NP8 A;  2PSR A;  1V1G A;  3NSL A;  2HPS A;  3MSE B;  1BU3 A;  2COL B;  2EGD A;  1NUB A;  2DOQ A;  1CFD A;  2HET A;  5CSF A;  4MN0 A;  1J55 A;  4BY5 A;  1LA3 A;  1NSH A;  4C0L A;  3DVJ A;  1EG3 A;  2VRG A;  3VRP A;  1CMF A;  1E8A A;  3TDU A;  1A03 A;  3NSK A;  2LHL A;  2EC6 B;  2PVB A;  3VGO A;  2LMT A;  1JUO A;  1XFY O;  2Y5I A;  3DF0 B;  1FBV A;  1K2H A;  3I5H B;  2H61 A;  3BUO B;  1EXR A;  1NWD A;  1RWY A;  3O6B A;  4WQ2 A;  1PVA A;  2PMY A;  5HYD A;  4YGD B;  5I2Q A;  1H4B A;  3TUY B;  4HRE E;  3O2P A;  3PFV A;  3BUM B;  1J7O A;  1YVH A;  5AFP A;  1YUT A;  4JPZ B;  1MQ1 A;  1PUL A;  2I7A A;  4N5X A;  2KHN A;  1IRJ A;  4UPG A;  4HSZ A;  1NX0 A;  2K2A A;  4I5L B;  1SCM B;  4ORA B;  1S6I A;  2JT3 A;  4L9M A;  1Y6W A;  3C1V A;  3K21 A;  4YGB B;  3KEV A;  5AEQ A;  4CPV A;  1BR4 B;  1F70 A;  2JTZ A;  2KSP A;  1PVB A;  3DVM A;  1KK8 C;  2M3W A;  4CID A;  3FWB A;  5PAL A;  2GV5 A;  1B9A A;  2M9G A;  3I5I B;  4GNK B;  3GK1 A;  4N1F A;  2ZRT A;  3FS7 A;  5J3X A;  1DF0 B;  1SRA A;  2KFF A;  3BOW B;  4HRH A;  3D0Y B;  2FJU B;  1A4P A;  1OZO A;  3EKJ A;  1DTL A;  1NCY A;  3NXA A;  4R1E A;  3JVT B;  4YBH B;  5CSN A;  1TNX A;  1PAL A;  2L4H A;  2PRU A;  1SMG A;  3CLN A;  1SL8 A;  1WLZ A;  1EG4 A;  1KK7 Y;  1L2O B;  5TNC A;  1J7P A;  3OB2 B;  1DJI A;  2WOS A;  3NSI A;  1RK9 A;  2L98 A;  2HQ8 A;  3PN7 B;  1U5I A;  1UHJ A;  1CFF A;  5ER4 X;  5K89 A;  2F8P A;  3M0W A;  1DMO A;  1EH2 A;  2OS8 C;  4PAL A;  1WRK A;  5DKR A;  2GGZ A;  2ZN9 A;  4GUK A;  2M7N A;  1WY9 A;  4WQ3 A;  3VRN A;  1W7J B;  1CFP A;  1VRK A;  2BCA A;  2L50 A;  1AP4 A;  1XYD A;  5DKN A;  1QXP A;  1SR6 C;  5I2O A;  1CKK A;  3HCM A;  2WC8 A;  2LP2 A;  4PE0 A;  2KQY A;  1SL7 A;  1MWN A;  3DVK A;  2M97 A;  1TN4 A;  1DJY A;  1KFX S;  4AQI A;  1DT7 B;  2KDH A;  2WOR A;  3AKB A;  2PAL A;  4YI8 A;  1EL4 A;  3AAK A;  1OZS A;  1SCV A;  3CWG A;  3ZWH A;  1AK8 A;  2F2P A;  1GQM A;  2M49 B;  2I18 A;  5JJG A;  1ZMZ A;  1FI5 A;  2KFG A;  4WRI A;  3TS5 B;  2CBL A;  1AJ4 A;  4U8D A;  1UUS A;  1SPY A;  1SNL A;  2D8N A;  1JF0 A;  2LLS A;  3FIA A;  2Q4U A;  1WDC C;  3I5H C;  3LLE A;  1R6P A;  1OSA A;  1SR6 B;  2K7O A;  2TN4 A;  2K7C A;  3O78 A;  2LC5 A;  1ZUZ A;  3OP0 A;  5CSI A;  3SG4 A;  1DGV A;  1F8H A;  1C7W A;  2OS8 B;  1AHR A;  1BMO A;  5F6T A;  1SK6 D;  2LE9 B;  3DVE A;  1XK4 C;  3NSO A;  1PK0 D;  4DRW A;  4M2O A;  1QX2 A;  1DVI A;  2LV7 A;  3GK2 A;  4PE1 A;  3CR4 X;  2JTT A;  2HQW A;  2LLU A;  5IBW A;  3TDZ A;  1OMD A;  1K9P A;  1L7Z A;  2FOT A;  2MRD A;  2Y1M A;  2MHH A;  1NX3 A;  3SG5 A;  1JBA A;  4F0Z B;  2AUC A;  2Q91 A;  4DCK A;  2L4I A;  1NIW A;  1KK7 Z;  2JPT A;  2LVJ A;  2JU0 A;  5ER5 A;  2JXL A;  1XO5 A;  4NQG A;  4OCI A;  4XYN A;  2OPO A;  1B8L A;  1Y1A A;  4C0K A;  3D0Y A;  1KK8 B;  4MLW A;  2NCO A;  1QLS A;  1DF0 A;  1GGZ A;  5B8I B;  4A4C A;  2M29 A;  2B1U A;  5KTY A;  1KWO C;  4HRG A;  4NDD A;  3IF7 A;  2WND A;  1SW8 A;  2JNX A;  1QIV A;  1TCO B;  5CSJ A;  1KFU L;  2L51 A;  1QX7 A;  1QJT A;  3I5F C;  4MZL A;  3SG3 A;  4YGA A;  1B1G A;  1NCZ A;  1IQ3 A;  1OMR A;  1OMV A;  5KU1 A;  1TIZ A;  4A4B A;  1NYA A;  1XFV O;  3CS1 A;  2O5G A;  4MEW A;  1KQV A;  3AAJ A;  5AAN A;  3KO0 A;  1F55 A;  1K94 A;  1MF8 B;  1JWD A;  1CDM A;  2KAV A;  3CZT X;  3I5G B;  4FTG A;  1S1E A;  2RGI A;  1B47 A;  5BPJ A;  5CPV A;  1WRL A;  2ZKM X;  1BLQ A;  1K90 D;  3WNX B;  1HQV A;  2O60 A;  1D1O A;  2BBM A;  4GBA A;  1BOC A;  2WCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...