4GUKA

New crystal form structure of human ncs1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
185
structure length
183
Chain Sequence
SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal calcium sensor 1
publication title new crystal form structure of human NCS1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 73
structure length 183
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA02
2LLTA 1JFJA 4OR9B 4DUQA 1TNQA 1CMFA 1FI5A 1FI6A 2L5XB 2LLUA 1CDMA 2L4IA 2OTGB 3I5FC 1YUSA 2R2IA 2BKHB 3C1VA 5PALA 1PSRA 1S3PA 1OQPA 2PMYA 3TS5C 3VRRA 2KFFA 3F45A 4PDZA 1J7OA 1QV1A 1AVSA 2DOQA 2JZIA 5HLOA 2JU0A 3BUWB 1GGZA 2BE6A 1SCMC 3DVMA 1VRKA 2PASA 3DD4A 3DF0B 1TN4A 1A4PA 4CPVA 1D1OA 2COLB 3PFVA 1M39A 5AANA 3SJSA 1PALA 1XFZO 1ZOTB 2LVIA 1K9PA 4GGFC 1NWDA 1YUUA 5CPVA 1A29A 2OS8C 3K21A 4MVFA 2LV7A 2D8NA 4PE7A 2K2FA 4YBHB 5AEQA 2EGDA 2K7OA 3HX4A 2LMTA 3FS7A 1LVCD 1QXPA 2G9BA 2MLFC 1DMOA 3NSLA 3GK4X 1DJXA 3EK8A 5G08A 1DJGA 4AQJA 3I5HC 3IF7A 3GK1A 1W7IB 4XJKA 1HT9A 3ICBA 2K7BA 1NYAA 3KEVA 4MBEA 1MUXA 3NSKA 4GNKB 3PM8A 2KAVA 1TIZA 1DJIA 1A03A 4E68A 1NX0A 1SY9A 2LAPA 5B8IB 4PHJA 4MLWA 1EG3A 1LA3A 1MXEA 1F54A 2JT8A 1KWOC 1DJHA 2JNFA 1LKJA 1UWOA 4QJ5B 2Q4UA 2JC2A 3SG3A 2MJWB 1HQVA 4PE1A 1Q80A 2MHHA 4YGAA 1KQMB 1QV0A 2JNXA 1YVHA 3SG4A 3DVEA 1QASA 5KTYA 1TCFA 1WLMA 4A4BA 2ZRTA 4YGCB 2KBIA 1AK8A 1PSBA 2ZN8A 1BR1B 3ZNIA 1BG1A 1G8IA 2JT0A 1PK0D 1UHNA 1BT6A 1KFUS 4GGNA 5I2OA 1IQ5A 3LK1A 1B8CA 1UUSA 2BECA 3SG2A 1B47A 1N0YA 2PSRA 3AKBA 1RECA 2WCFA 5CSIA 1TNPA 2JRFA 2E6WA 2JQ6A 1RK9A 4I5NB 1KSMA 1Y1UA 2I94A 2KOTA 2GGZA 1G33A 3DVJA 4BY4A 2ZRSA 1M31A 2I2RE 3BQ3A 1CLBA 1SL8A 3OB2B 2CNPA 4MSPA 4C0KA 2RGIA 1SR6B 1CDNA 1DTLA 3AKAA 1F70A 2M1KB 4YI8A 2FCDA 3PALA 4PHMA 5CSNA 1JC2A 3EKJA 1YRUB 3FWCA 2CTNA 4C0LA 3NSOA 1F8HA 2ISDA 1SKTA 1SRAA 5I2QA 2M7LA 2BBMA 4HSZA 1QX5B 2HF5A 4WQ2A 2NCOA 2LVJA 4OKHA 1SCVA 5I8NA 1ZUZA 3O6BA 5CSJA 3D10A 3NXAA 4N5XA 1BJFA 2LLSA 3OB1B 2O60A 2HPSA 1UP5A 3AAJA 1TCOB 2H61C 2M97A 1BLQA 4PCWA 2VRGA 2F8PA 1BOCA 2LUCA 1GQMA 1A2XA 1XFWO 1S1EA 1ODBA 1OZOA 1QATA 2LCPA 2WNDA 3DF0A 1X02A 2F3YA 5FYXA 2LM5A 1LINA 2I7AA 4JWQA 1NX2A 1IQ3A 2K7CA 4HRGA 3JVTB 1FBVA 3JTDB 4GBAA 3WHTB 4C0JA 2L4HA 4MZJA 2MRDA 2LP3A 3SIAA 1OZSA 1CKKA 1CDLA 1JUOA 4DIRA 1MHOA 1C7WA 4YGEB 1S6IA 1UHIA 1DJYA 3LLEA 1JF0A 2I18A 2KQYA 4PHNA 1GJYA 1J7QA 2JPTA 4DRWA 2E30A 1KFXS 2EC6C 3TDUA 1LXFC 1SMGA 2JTZA 3VGOA 3PSRA 1SR6C 2V53A 3AAKA 3PN7B 2NZ0A 1IG5A 2M9GA 1V1FA 2KYFA 4QJ3B 4D1EA 1PULA 2GV5A 1XFXO 1MF8B 3I5IC 4GAOA 2BKIB 4DS7A 1TNXA 5JOLA 1S26D 1K96A 2M7NA 4JQ0D 1Y0VH 1B7TY 4GPLB 1K90D 2KGRA 2LC5A 4U8DA 1A75B 1C7VA 2Y4QA 1NX1A 4OVNF 2NCPA 2L98A 2K7DA 1AJ5A 2EHBA 3CR2A 3EVRA 2O5GA 3GK2A 1OMDA 4N1GA 3ZWHA 2BBNA 1F4QA 1FW4A 1SL7A 3OX5A 3VRQA 4WRIA 4NQGA 1QX2A 2KI4B 2H61A 1BODA 4OV2A 1ZACA 3IQQA 4F0ZB 2BL0B 2K2AA 4M2QA 2L51A 1TRFA 1IRJA 4P5OE 4P2YB 3CZTX 3I5GB 2CXJA 2OTGC 5HYDA 1BU3A 1L2OB 1NPQA 5KSZA 1IH0A 2JXCA 4PALA 1AJ4A 2KQ6A 3PATA 3O2PA 3LCPC 5DKNA 3PLFB 1IGVA 1S6JA 5D69A 1ZMZA 4UPGA 1TTXA 2LUXA 2BE4A 1CTRA 3KF9A 4CLNA 3CWGA 4ORAB 2P6BB 1YURA 5D7FA 1QX7A 1K94A 2KI6D 3O78A 2AMIA 4PHKA 2FOTA 5TNCA 2WC8A 1F4OA 3BUNB 2Y1MA 2QACA 3VRPA 1XFYO 1WDCB 1AP4A 1LA0A 2H2KA 1V1GA 2WCEA 1KK8B 1CMGA 1SYMA 2JOJA 1QTXA 1UHHA 3CTNA 4TNCA 1S5GY 2JXLA 1NUBA 4HRHA 1ALWA 2TN4A 5F6TA 5DKQA 2LHIA 1XYDA 4Q04A 4ICBA 1YTZC 2OPOA 1OE9B 1RWYA 4MZLA 2AAOA 3QRXA 4YRUA 2BL0C 3EK7A 5IBWA 2KFGA 1Y6WA 3EK4A 1EXRA 2Q91A 3OHMB 4FTGA 5AXIA 1J1EA 1MXLC 2KSPA 1N2DA 2AUCA 1J7PA 1RROA 1Y1XA 3FIAA 1PRWA 1U5IB 2LMUA 2B1UA 1N65A 1R6PA 3FWBA 3CR4X 2LANA 1Y1AA 4ORBB 3BUXB 1WRLA 2NLNA 2WORA 3I5FB 4I5LB 1SPYA 2G2BA 1IJ6A 1JFKA 1UURA 4DCKA 3TS5B 1WLZA 1KQMC 1SW8A 1JF2A 2CT9A 2SASA 4ORCB 3VROA 1YX8A 2M1UA 1UHJA 1H4BA 3KPXA 1M45A 2Y5IA 4XYNA 1DF0B 2WCBA 3MSEB 1EJ3A 2KI6C 1NX3A 1EL4A 4BY5A 1CNPA 1BR4B 5CSFA 1S36A 1YX7A 1NCZA 2CCMA 1QVIY 4M2PA 2ZKMX 1QLKA 1GGWA 1CM4A 1K2HA 3OX6A 2OS8B 1A75A 4MZKA 3VRNA 2MAZA 4OCIA 5BPJA 1KQVA 2LE9B 1NCYA 1E8AA 2Y1NA 3WXAA 1MQ1A 1YUTA 2LVVA 1L7ZA 3M0WA 4MRYA 1XFUO 3CGAA 1S5GZ 4L9MA 3TUYB 3I5HB 4USLA 2WOSA 1XA5A 3EVVA 4NDDA 1F71A 1J55A 1DVIA 1WY9A 1JBAA 1KK7Y 3TZ1A 2KAXA 1NCXA 1K93D 3SIBA 1KWOB 1J7RA 3BOWB 1S6CA 3LL8B 4I5KA 5I2LA 2L0PA 3KO0A 4AOMA 1FF1A 1UHKA 1CB1A 1SK6D 4HREE 1YRTB 1RFJA 1CFDA 2CBLA 2JWWA 3D0YB 1XVJA 3BXKA 2MBXA 1RJVA 4CFRA 3GOFA 1IJ5A 2IS9A 1IWQA 2HQWA 4PE0A 1M63B 3JVTC 2ZN9A 2HQ8A 3JTDC 2BCAA 1OOJA 1RTP1 2KHNA 5KU1A 2MA2A 1EG4A 1QJTA 1WRKA 2JTTA 1F55A 1FPWA 5ER4X 1DGUA 4FQOA 5ER5A 1YR5A 3BUOB 1DT7B 3NSIA 1CFFA 1B8RA 1QVIZ 1AUIB 3TDZA 3CR5X 3SG5A 3TUYC 2M0RA 4WQ3A 1MR8A 4QJ4B 2PALA 3PN7C 1B4CA 4JPZB 2JULA 2BCXA 3E3RA 2LMVA 4MRXA 1OSAA 1SL9A 1CFCA 1U5IA 1KFUL 5HKWA 1XFVO 4GUKA 4YGBB 1K9KA 1G4YR 4R1EA 4CIDA 2L50A 2BCBA 2F2OA 1B1GA 1QS7A 1DJWA 1EH2A 1NP8A 1OMVA 2LHLA 2LP2A 2KNEA 1KK7Z 2KYCA 2M49B 3OP0A 4IL1A 1H8BA 1K8UA 1K9UA 2KI4C 2KAYA 2KFHA 1B7TZ 1BMOA 2JT3A 2M3WA 1XK4C 2PRUA 4XJKB 4ZCVA 5HLVA 1CLLA 1NSHA 3DVKA 1DF0A 4YGDB 3RM1A 4M2OA 4AQIA 2HETA 3I5GC 3LK0A 2A4JA 1L2OC 3IQOA 4I5JA 2L2EA 5HKYA 1B8LA 1MWNA 3HCMA 1QIWA 4GGFA 3O4YA 5GQQC 3A8RA 2FCEA 1M46A 2F3ZA 3RLZA 1JWDA 2ZNDA 2GGMA 1PVBA 2M29A 2LVKA 1B9AA 2PVBA 2MLEC 2K8MB 4MN0A 3WHUB 4N1FA 2KGBC 2EC6B 2K61A 4ETOA 5AERA 1KCYA 1YVLA 3KHEA 1NIWA 5HKZA 1OMRA 1R2UA 5K89A 2ZNEA 1TNWA 5DKRA 4A4CA 1SCMB 1CFPA 1ZFSA 4NDBA 1SNLA 3EKHA 3CLNA 3BYAA 1WDCC 4PE4A 3TDIA 2M8UA 5JJGA 2SCPA 1SBJA 3BUMB 1KK8C 1JSAA 3I5IB 1BF5A 3WNXB 1IKUA 1C07A 4NDCA 2LNKA 1J1DA 2F2PA 2FJUB 1WRZA 4YI9A 1TOPA 2QPTA 1XO5A 2KBMA 3BOWA 1ALVA 4ZCUA 2NXQA 1KFXL 3EVUA 1CLMA 5J3XA 3SG7A 2K0JA 2ZFDA 1QLSA 1DGVA 3CS1A 5AFPA 3A4UB 1K95A 1W7JB 1DJZA 3H4SE 1CDPA 4CFQA 2KDHA 1QIVA 4MEWA 1AHRA 3D0YA 4GFTA 1CM1A 3SG6A 1XK4A 2F33A 1KSOA 1PVAA
chains in the Genus database with same CATH superfamily
2LLTA 1JFJA 4OR9B 1LS8A 4DUQA 1TNQA 1CMFA 1FI5A 1FI6A 2L5XB 2LLUA 1CDMA 2L4IA 2OTGB 3I5FC 1YUSA 3UNWA 2R2IA 2BKHB 3C1VA 5PALA 1PSRA 1S3PA 1OQPA 2PMYA 3TS5C 3VRRA 2KFFA 3F45A 4PDZA 3NHIA 1J7OA 3B86A 1QV1A 1AVSA 2DOQA 5FI2A 2JZIA 5HLOA 2JU0A 2L5YA 1GGZA 1TWOA 3BUWB 2BE6A 1SCMC 3DVMA 1VRKA 2PASA 3DD4A 3DF0B 1TN4A 3B6XA 3N7HA 1A4PA 4CPVA 1D1OA 2COLB 3PFVA 1M39A 5AANA 1TUZA 3SJSA 1PALA 1XFZO 1ZOTB 2LVIA 1K9PA 4GGFC 1NWDA 3OGNA 1YUUA 5CPVA 1A29A 2OS8C 3K21A 1OOHA 2LV7A 2D8NA 4MVFA 2K2FA 4PE7A 4YBHB 2EGDA 2K7OA 3HX4A 2LMTA 3D76A 3FS7A 1LVCD 1QXPA 2G9BA 2MLFC 1DMOA 3NSLA 3GK4X 1DJXA 3EK8A 5G08A 1DJGA 3R1VA 4AQJA 3I5HC 3S0EA 3IF7A 3GK1A 1W7IB 4XJKA 1HT9A 3ICBA 2K7BA 1NYAA 3KEVA 4MBEA 1MUXA 3NSKA 4GNKB 3PM8A 2KAVA 1TIZA 1DJIA 1A03A 4E68A 1NX0A 1SY9A 2P71A 2LAPA 1T14A 5B8IB 4PHJA 4MLWA 1EG3A 1LA3A 1MXEA 1F54A 2JT8A 1KWOC 1DJHA 2JNFA 1LKJA 3S0DA 1UWOA 4QJ5B 2Q4UA 2JC2A 3SG3A 2MJWB 1HQVA 3B88A 4PE1A 1Q80A 2MHHA 4YGAA 1KQMB 1QV0A 2JNXA 1YVHA 3SG4A 3DVEA 2KPHA 1QASA 5KTYA 1TCFA 1WLMA 5EL2A 4A4BA 2ZRTA 4YGCB 2KBIA 1AK8A 1PSBA 2ZN8A 1BR1B 3ZNIA 1BG1A 3R1PA 3BFHA 1G8IA 2JT0A 1PK0D 3DXLA 1UHNA 1BT6A 1KFUS 4GGNA 3V2LA 5I2OA 1IQ5A 3LK1A 1B8CA 1UUSA 2BECA 3SG2A 1B47A 1N0YA 2PSRA 3AKBA 1RECA 2WCFA 5CSIA 1TNPA 2JRFA 2E6WA 2JQ6A 1RK9A 4I5NB 1KSMA 1Y1UA 2I94A 2WCHA 3L4LA 2KOTA 2GGZA 1G33A 3L47A 3DVJA 4BY4A 2ZRSA 1M31A 2I2RE 3BQ3A 1CLBA 1SL8A 3OB2B 2CNPA 4MSPA 4C0KA 2RGIA 1SR6B 1W9ZA 1CDNA 1DTLA 3AKAA 3DY9A 1F70A 2M1KB 4YI8A 2FCDA 3PALA 4PHMA 5CSNA 1JC2A 3EKJA 1YRUB 3FWCA 2CTNA 4C0LA 3NSOA 1F8HA 2ISDA 2BAPA 1SKTA 1SRAA 5I2QA 2M7LA 2BBMA 1DC1A 4HSZA 5AEQA 1QX5B 2HF5A 4WQ2A 2NCOA 2H8VA 1SSEB 2LVJA 4OKHA 1SCVA 3D78A 1ZUZA 5I8NA 3O6BA 5CSJA 3D10A 3NXAA 4N5XA 3S0BA 5HL1A 1BJFA 2LLSA 3OB1B 2ERBA 2O60A 2HPSA 1UP5A 3AAJA 1TCOB 2H61C 2M97A 1BLQA 4PCWA 2VRGA 2F8PA 1BOCA 3FE8A 2LUCA 4INWA 1GQMA 1A2XA 1XFWO 1S1EA 1ODBA 1OZOA 1QATA 2LCPA 2WNDA 3DF0A 1X02A 2F3YA 5FYXA 5DICA 2LM5A 1LINA 2I7AA 4JWQA 1NX2A 1IQ3A 2K7CA 4HRGA 3JVTB 1FBVA 3JTDB 4GBAA 3WHTB 4C0JA 1OOIX 3RZSA 2L4HA 4MZJA 2MRDA 2LP3A 3SIAA 1OZSA 1CKKA 1CDLA 1JUOA 4DIRA 1MHOA 1C7WA 2QDIA 1S6IA 1UHIA 4YGEB 1DJYA 3LLEA 1JF0A 2I18A 2KQYA 4PHNA 1GJYA 1J7QA 2JPTA 5FI6A 4DRWA 2E30A 1KFXS 2EC6C 3TDUA 1LXFC 1SMGA 3SS3A 2JTZA 3VGOA 3PSRA 2PYQA 1SR6C 2V53A 3AAKA 3PN7B 2NZ0A 3NGVA 1IG5A 2QEBA 2M9GA 1P28A 1V1FA 2KYFA 4QJ3B 4D1EA 3R1OA 3QMEA 1PULA 2GV5A 1XFXO 1MF8B 3I5IC 1DQEA 4GAOA 5HLVA 2BKIB 4DS7A 1TNXA 5JOLA 1S26D 2KLDA 1K96A 2M7NA 4JQ0D 1Y0VH 1B7TY 4GPLB 1K90D 2KGRA 2LC5A 4U8DA 1A75B 1C7VA 2Y4QA 1NX1A 4OVNF 2NCPA 2L98A 2K7DA 3O4XA 1AJ5A 2EHBA 3CR2A 2WCMA 2O5GA 3EVRA 3GK2A 1OMDA 4N1GA 3ZWHA 2BBNA 1F4QA 1FW4A 1SL7A 1Z2CB 3OX5A 3VRQA 4WRIA 4NQGA 1QX2A 2KI4B 3UO9A 2H61A 1BODA 4OV2A 1ZACA 3D74A 3IQQA 4F0ZB 2BL0B 2K2AA 4M2QA 2L51A 1TRFA 1IRJA 4P5OE 4P2YB 3CZTX 3I5GB 2CXJA 2OTGC 5FI7A 5HYDA 1BU3A 1L2OB 1NPQA 3B7AA 5KSZA 1IH0A 2JXCA 4PALA 1AJ4A 2KQ6A 3PATA 3O2PA 3LCPC 5DKNA 3PLFB 1IGVA 1S6JA 5D69A 1ZMZA 1OW4A 4UPGA 1TTXA 2LUXA 2BE4A 1CTRA 3KF9A 4CLNA 3CWGA 4ORAB 2P6BB 3D73A 1YURA 5D7FA 1QX7A 3NHTA 1K94A 2KI6D 3O78A 2AMIA 4PHKA 2FOTA 5TNCA 2WC8A 1F4OA 5I94A 3BUNB 2Y1MA 2QACA 3VRPA 1XFYO 1WDCB 1AP4A 2WCJA 1LA0A 2H2KA 1V1GA 2WCEA 1KK8B 1CMGA 3CYZA 1SYMA 2JOJA 1QTXA 1UHHA 3CTNA 4TNCA 1S5GY 4OZDA 2JXLA 3CABA 1NUBA 4HRHA 1ALWA 2TN4A 5F6TA 5DKQA 1XFRA 2LHIA 2KLEA 1XYDA 4Q04A 4ICBA 1YTZC 2OPOA 3CZ1A 1OE9B 1RWYA 4MZLA 3CZ0A 2AAOA 3QRXA 4YRUA 2BL0C 3EK7A 5IBWA 2KFGA 1Y6WA 3EK4A 1EXRA 2Q91A 3OHMB 4FTGA 5AXIA 1J1EA 1MXLC 2KSPA 1N2DA 2AUCA 3FE9A 1RROA 1Y1XA 3FIAA 1PRWA 1U5IB 2LMUA 3Q8IA 1J7PA 2B1UA 1N65A 1R6PA 3FWBA 3CR4X 3DYEA 2LANA 1Y1AA 4ORBB 3BUXB 1WRLA 4JKTA 3BFBA 2NLNA 2WORA 3EG5B 3I5FB 4I5LB 1SPYA 2G2BA 1IJ6A 1JFKA 1UURA 4DCKA 3TS5B 1C3ZA 1WLZA 1KQMC 1SW8A 1JF2A 3D75A 2CT9A 2QEOA 2SASA 4ORCB 3VROA 1YX8A 3PM2A 2M1UA 1UHJA 2JPOA 1H4BA 3KPXA 1M45A 2Y5IA 4XYNA 1DF0B 2WCBA 3MSEB 1EJ3A 2KI6C 1NX3A 3VB1A 1EL4A 4BY5A 4PT1A 1CNPA 1BR4B 5CSFA 3L4AA 2QEHA 1S36A 1YX7A 1NCZA 2CCMA 1QVIY 4M2PA 2L2CA 2ZKMX 1QLKA 1GGWA 4F7FA 1CM4A 1QWVA 1K2HA 3OX6A 2OS8B 1A75A 3SS4A 4MZKA 3VRNA 2MAZA 4OCIA 5BPJA 1KQVA 2LE9B 2WCKA 1NCYA 3IVTA 1E8AA 3BFAA 4FQTA 2Y1NA 3WXAA 1MQ1A 1YUTA 2LVVA 1L7ZA 3M0WA 4MRYA 1XFUO 3CGAA 1S5GZ 4L9MA 3TUYB 3I5HB 4USLA 4IJ7A 2WOSA 3OBVA 1XA5A 3EVVA 3CZ2A 4NDDA 1F71A 1J55A 1DVIA 1WY9A 1JBAA 1KK7Y 2WC5A 2FJYA 3TZ1A 2KAXA 3D77A 1NCXA 1K93D 3SIBA 1KWOB 1J7RA 3BOWB 1S6CA 3LL8B 2QEVA 4I5KA 5I2LA 2L0PA 3KO0A 4AOMA 1FF1A 1UHKA 1DEKA 1CB1A 2GTEA 1SK6D 4HREE 1YRTB 1RFJA 1CFDA 2CBLA 2JWWA 3D0YB 1XVJA 3BXKA 2MBXA 1RJVA 4CFRA 3GOFA 1IJ5A 2IS9A 1IWQA 2HQWA 4PE0A 1M63B 3JVTC 2ZN9A 2HQ8A 3JTDC 2BCAA 3SS5A 1OOJA 1RTP1 2KHNA 5KU1A 2MA2A 3CDNA 3PJIA 1EG4A 1QJTA 1WRKA 1GM0A 2JTTA 1F55A 1FPWA 5ER4X 1DGUA 4FQOA 1C3YA 5ER5A 1YR5A 3BUOB 1DT7B 3NSIA 1CFFA 1B8RA 1QVIZ 1AUIB 3TDZA 3CR5X 3SG5A 3TUYC 2M0RA 4WQ3A 1MR8A 4QJ4B 2PALA 2YGUA 3PN7C 1B4CA 4JPZB 2JULA 2BCXA 3E3RA 2LMVA 4MRXA 2PQLA 1OSAA 1SL9A 4INXA 1CFCA 3K1EA 1U5IA 1KFUL 2WC6A 5HKWA 1XFVO 1TUJA 4GUKA 4YGBB 1K9KA 1G4YR 4R1EA 4CIDA 2L50A 2BCBA 2F2OA 1B1GA 1QS7A 1DJWA 3S0FA 1EH2A 1NP8A 1OMVA 2LHLA 2LP2A 3DZTA 2KNEA 1KK7Z 2KYCA 2M49B 3OP0A 4IL1A 1H8BA 1DELA 2BNXA 1K8UA 1K9UA 2KI4C 2KAYA 2KFHA 1B7TZ 1BMOA 2JT3A 2M3WA 1XK4C 1ORGA 2PRUA 4XJKB 4ZCVA 1CLLA 1NSHA 3DVKA 1DF0A 4YGDB 3RM1A 4M2OA 4AQIA 3S0AA 2HETA 3I5GC 1OOGA 3LK0A 2A4JA 1L2OC 3IQOA 4I5JA 2L2EA 5HKYA 1B8LA 1MWNA 3HCMA 1QIWA 4GGFA 1OOFA 3B87A 3O4YA 5GQQC 3A8RA 2FCEA 1M46A 2F3ZA 5D3OA 3RLZA 1JWDA 2ZNDA 2GGMA 1PVBA 2K60A 2M29A 2LVKA 1B9AA 2PVBA 2MLEC 2K8MB 4MN0A 3WHUB 4N1FA 2KGBC 1Z4HA 2EC6B 2K61A 4ETOA 3FE6A 4KYNA 5AERA 1KCYA 1YVLA 3KHEA 1NIWA 5HKZA 1OMRA 1R2UA 5K89A 2ZNEA 1TNWA 5DKRA 4A4CA 1SCMB 1CFPA 1ZFSA 4NDBA 4JD9A 3S0GA 1SNLA 3EKHA 3CLNA 3BYAA 1WDCC 4PE4A 3TDIA 2M8UA 5JJGA 2SCPA 1SBJA 3BUMB 1KK8C 1JSAA 3I5IB 1BF5A 3WNXB 1IKUA 1C07A 4NDCA 2LNKA 1J1DA 2F2PA 2P70A 2FJUB 1WRZA 4YI9A 1TOPA 2QPTA 1XO5A 2KBMA 3BOWA 2WCLA 1ALVA 4ZCUA 1IIOA 2NXQA 1KFXL 3EVUA 1CLMA 5J3XA 3SG7A 2K0JA 2ZFDA 1QLSA 1DGVA 3CS1A 5AFPA 3A4UB 1K95A 1W7JB 1DJZA 3H4SE 1CDPA 4CFQA 2KDHA 1QIVA 4MEWA 3R72A 1AHRA 3D0YA 4GFTA 1CM1A 3BJHA 3SG6A 1XK4A 2F33A 1KSOA 1PVAA
chains in the Genus database with same CATH topology
2LLTA 1JFJA 4OR9B 4DUQA 1TNQA 1CMFA 1FI5A 1FI6A 2L5XB 2LLUA 1CDMA 2L4IA 2OTGB 3I5FC 1YUSA 2R2IA 2BKHB 3C1VA 5PALA 1PSRA 1S3PA 1OQPA 2PMYA 3TS5C 3VRRA 2KFFA 3F45A 4PDZA 1J7OA 1QV1A 1AVSA 2DOQA 2JZIA 5HLOA 2JU0A 3BUWB 1GGZA 2BE6A 1SCMC 3DVMA 1VRKA 2PASA 3DD4A 3DF0B 1TN4A 1A4PA 4CPVA 1D1OA 2COLB 3PFVA 1M39A 5AANA 3SJSA 1PALA 1XFZO 1ZOTB 2LVIA 1K9PA 4GGFC 1NWDA 1YUUA 5CPVA 1A29A 2OS8C 3K21A 4MVFA 2LV7A 2D8NA 4PE7A 2K2FA 4YBHB 5AEQA 2EGDA 2K7OA 3HX4A 2LMTA 3FS7A 1LVCD 1QXPA 2G9BA 2MLFC 1DMOA 3NSLA 3GK4X 1DJXA 3EK8A 5G08A 1DJGA 4AQJA 3I5HC 3IF7A 3GK1A 1W7IB 4XJKA 1HT9A 3ICBA 2K7BA 1NYAA 3KEVA 4MBEA 1MUXA 3NSKA 4GNKB 3PM8A 2KAVA 1TIZA 1DJIA 1A03A 4E68A 1NX0A 1SY9A 2LAPA 5B8IB 4PHJA 4MLWA 1EG3A 1LA3A 1MXEA 1F54A 2JT8A 1KWOC 1DJHA 2JNFA 1LKJA 1UWOA 4QJ5B 2Q4UA 2JC2A 3SG3A 2MJWB 1HQVA 4PE1A 1Q80A 2MHHA 4YGAA 1KQMB 1QV0A 2JNXA 1YVHA 3SG4A 3DVEA 1QASA 5KTYA 1TCFA 1WLMA 4A4BA 2ZRTA 4YGCB 2KBIA 1AK8A 1PSBA 2ZN8A 1BR1B 3ZNIA 1BG1A 1G8IA 2JT0A 1PK0D 1UHNA 1BT6A 1KFUS 4GGNA 5I2OA 1IQ5A 3LK1A 1B8CA 1UUSA 2BECA 3SG2A 1B47A 1N0YA 2PSRA 3AKBA 1RECA 2WCFA 5CSIA 1TNPA 2JRFA 2E6WA 2JQ6A 1RK9A 4I5NB 1KSMA 1Y1UA 2I94A 2KOTA 2GGZA 1G33A 3DVJA 4BY4A 2ZRSA 1M31A 2I2RE 3BQ3A 1CLBA 1SL8A 3OB2B 2CNPA 4MSPA 4C0KA 2RGIA 1SR6B 1CDNA 1DTLA 3AKAA 1F70A 2M1KB 4YI8A 2FCDA 3PALA 4PHMA 5CSNA 1JC2A 3EKJA 1YRUB 3FWCA 2CTNA 4C0LA 3NSOA 1F8HA 2ISDA 1SKTA 1SRAA 5I2QA 2M7LA 2BBMA 4HSZA 1QX5B 2HF5A 4WQ2A 2NCOA 2LVJA 4OKHA 1SCVA 5I8NA 1ZUZA 3O6BA 5CSJA 3D10A 3NXAA 4N5XA 1BJFA 2LLSA 3OB1B 2O60A 2HPSA 1UP5A 3AAJA 1TCOB 2H61C 2M97A 1BLQA 4PCWA 2VRGA 2F8PA 1BOCA 2LUCA 1GQMA 1A2XA 1XFWO 1S1EA 1ODBA 1OZOA 1QATA 2LCPA 2WNDA 3DF0A 1X02A 2F3YA 5FYXA 2LM5A 1LINA 2I7AA 4JWQA 1NX2A 1IQ3A 2K7CA 4HRGA 3JVTB 1FBVA 3JTDB 4GBAA 3WHTB 4C0JA 2L4HA 4MZJA 2MRDA 2LP3A 3SIAA 1OZSA 1CKKA 1CDLA 1JUOA 4DIRA 1MHOA 1C7WA 4YGEB 1S6IA 1UHIA 1DJYA 3LLEA 1JF0A 2I18A 2KQYA 4PHNA 1GJYA 1J7QA 2JPTA 4DRWA 2E30A 1KFXS 2EC6C 3TDUA 1LXFC 1SMGA 2JTZA 3VGOA 3PSRA 1SR6C 2V53A 3AAKA 3PN7B 2NZ0A 1IG5A 2M9GA 1V1FA 2KYFA 4QJ3B 4D1EA 1PULA 2GV5A 1XFXO 1MF8B 3I5IC 4GAOA 2BKIB 4DS7A 1TNXA 5JOLA 1S26D 1K96A 2M7NA 4JQ0D 1Y0VH 1B7TY 4GPLB 1K90D 2KGRA 2LC5A 4U8DA 1A75B 1C7VA 2Y4QA 1NX1A 4OVNF 2NCPA 2L98A 2K7DA 1AJ5A 2EHBA 3CR2A 3EVRA 2O5GA 3GK2A 1OMDA 4N1GA 3ZWHA 2BBNA 1F4QA 1FW4A 1SL7A 3OX5A 3VRQA 4WRIA 4NQGA 1QX2A 2KI4B 2H61A 1BODA 4OV2A 1ZACA 3IQQA 4F0ZB 2BL0B 2K2AA 4M2QA 2L51A 1TRFA 1IRJA 4P5OE 4P2YB 3CZTX 3I5GB 2CXJA 2OTGC 5HYDA 1BU3A 1L2OB 1NPQA 5KSZA 1IH0A 2JXCA 4PALA 1AJ4A 2KQ6A 3PATA 3O2PA 3LCPC 5DKNA 3PLFB 1IGVA 1S6JA 5D69A 1ZMZA 4UPGA 1TTXA 2LUXA 2BE4A 1CTRA 3KF9A 4CLNA 3CWGA 4ORAB 2P6BB 1YURA 5D7FA 1QX7A 1K94A 2KI6D 3O78A 2AMIA 4PHKA 2FOTA 5TNCA 2WC8A 1F4OA 3BUNB 2Y1MA 2QACA 3VRPA 1XFYO 1WDCB 1AP4A 1LA0A 2H2KA 1V1GA 2WCEA 1KK8B 1CMGA 1SYMA 2JOJA 1QTXA 1UHHA 3CTNA 4TNCA 1S5GY 2JXLA 1NUBA 4HRHA 1ALWA 2TN4A 5F6TA 5DKQA 2LHIA 1XYDA 4Q04A 4ICBA 1YTZC 2OPOA 1OE9B 1RWYA 4MZLA 2AAOA 3QRXA 4YRUA 2BL0C 3EK7A 5IBWA 2KFGA 1Y6WA 3EK4A 1EXRA 2Q91A 3OHMB 4FTGA 5AXIA 1J1EA 1MXLC 2KSPA 1N2DA 2AUCA 1J7PA 1RROA 1Y1XA 3FIAA 1PRWA 1U5IB 2LMUA 2B1UA 1N65A 1R6PA 3FWBA 3CR4X 2LANA 1Y1AA 4ORBB 3BUXB 1WRLA 2NLNA 2WORA 3I5FB 4I5LB 1SPYA 2G2BA 1IJ6A 1JFKA 1UURA 4DCKA 3TS5B 1WLZA 1KQMC 1SW8A 1JF2A 2CT9A 2SASA 4ORCB 3VROA 1YX8A 2M1UA 1UHJA 1H4BA 3KPXA 1M45A 2Y5IA 4XYNA 1DF0B 2WCBA 3MSEB 1EJ3A 2KI6C 1NX3A 1EL4A 4BY5A 1CNPA 1BR4B 5CSFA 1S36A 1YX7A 1NCZA 2CCMA 1QVIY 4M2PA 2ZKMX 1QLKA 1GGWA 1CM4A 1K2HA 3OX6A 2OS8B 1A75A 4MZKA 3VRNA 2MAZA 4OCIA 5BPJA 1KQVA 2LE9B 1NCYA 1E8AA 2Y1NA 3WXAA 1MQ1A 1YUTA 2LVVA 1L7ZA 3M0WA 4MRYA 1XFUO 3CGAA 1S5GZ 4L9MA 3TUYB 3I5HB 4USLA 2WOSA 1XA5A 3EVVA 4NDDA 1F71A 1J55A 1DVIA 1WY9A 1JBAA 1KK7Y 3TZ1A 2KAXA 1NCXA 1K93D 3SIBA 1KWOB 1J7RA 3BOWB 1S6CA 3LL8B 4I5KA 5I2LA 2L0PA 3KO0A 4AOMA 1FF1A 1UHKA 1CB1A 1SK6D 4HREE 1YRTB 1RFJA 1CFDA 2CBLA 2JWWA 3D0YB 1XVJA 3BXKA 2MBXA 1RJVA 4CFRA 3GOFA 1IJ5A 2IS9A 1IWQA 2HQWA 4PE0A 1M63B 3JVTC 2ZN9A 2HQ8A 3JTDC 2BCAA 1OOJA 1RTP1 2KHNA 5KU1A 2MA2A 1EG4A 1QJTA 1WRKA 2JTTA 1F55A 1FPWA 5ER4X 1DGUA 4FQOA 5ER5A 1YR5A 3BUOB 1DT7B 3NSIA 1CFFA 1B8RA 1QVIZ 1AUIB 3TDZA 3CR5X 3SG5A 3TUYC 2M0RA 4WQ3A 1MR8A 4QJ4B 2PALA 3PN7C 1B4CA 4JPZB 2JULA 2BCXA 3E3RA 2LMVA 4MRXA 1OSAA 1SL9A 1CFCA 1U5IA 1KFUL 5HKWA 1XFVO 4GUKA 4YGBB 1K9KA 1G4YR 4R1EA 4CIDA 2L50A 2BCBA 2F2OA 1B1GA 1QS7A 1DJWA 1EH2A 1NP8A 1OMVA 2LHLA 2LP2A 2KNEA 1KK7Z 2KYCA 2M49B 3OP0A 4IL1A 1H8BA 1K8UA 1K9UA 2KI4C 2KAYA 2KFHA 1B7TZ 1BMOA 2JT3A 2M3WA 1XK4C 2PRUA 4XJKB 4ZCVA 5HLVA 1CLLA 1NSHA 3DVKA 1DF0A 4YGDB 3RM1A 4M2OA 4AQIA 2HETA 3I5GC 3LK0A 2A4JA 1L2OC 3IQOA 4I5JA 2L2EA 5HKYA 1B8LA 1MWNA 3HCMA 1QIWA 4GGFA 3O4YA 5GQQC 3A8RA 2FCEA 1M46A 2F3ZA 3RLZA 1JWDA 2ZNDA 2GGMA 1PVBA 2M29A 2LVKA 1B9AA 2PVBA 2MLEC 2K8MB 4MN0A 3WHUB 4N1FA 2KGBC 2EC6B 2K61A 4ETOA 5AERA 1KCYA 1YVLA 3KHEA 1NIWA 5HKZA 1OMRA 1R2UA 5K89A 2ZNEA 1TNWA 5DKRA 4A4CA 1SCMB 1CFPA 1ZFSA 4NDBA 1SNLA 3EKHA 3CLNA 3BYAA 1WDCC 4PE4A 3TDIA 2M8UA 5JJGA 2SCPA 1SBJA 3BUMB 1KK8C 1JSAA 3I5IB 1BF5A 3WNXB 1IKUA 1C07A 4NDCA 2LNKA 1J1DA 2F2PA 2FJUB 1WRZA 4YI9A 1TOPA 2QPTA 1XO5A 2KBMA 3BOWA 1ALVA 4ZCUA 2NXQA 1KFXL 3EVUA 1CLMA 5J3XA 3SG7A 2K0JA 2ZFDA 1QLSA 1DGVA 3CS1A 5AFPA 3A4UB 1K95A 1W7JB 1DJZA 3H4SE 1CDPA 4CFQA 2KDHA 1QIVA 4MEWA 1AHRA 3D0YA 4GFTA 1CM1A 3SG6A 1XK4A 2F33A 1KSOA 1PVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLT A;  1JFJ A;  4OR9 B;  4DUQ A;  1TNQ A;  1CMF A;  1FI5 A;  1FI6 A;  2L5X B;  2LLU A;  1CDM A;  2L4I A;  2OTG B;  3I5F C;  1YUS A;  2R2I A;  2BKH B;  3C1V A;  5PAL A;  1PSR A;  1S3P A;  1OQP A;  2PMY A;  3TS5 C;  3VRR A;  2KFF A;  3F45 A;  4PDZ A;  1J7O A;  1QV1 A;  1AVS A;  2DOQ A;  2JZI A;  5HLO A;  2JU0 A;  3BUW B;  1GGZ A;  2BE6 A;  1SCM C;  3DVM A;  1VRK A;  2PAS A;  3DD4 A;  3DF0 B;  1TN4 A;  1A4P A;  4CPV A;  1D1O A;  2COL B;  3PFV A;  1M39 A;  5AAN A;  3SJS A;  1PAL A;  1XFZ O;  1ZOT B;  2LVI A;  1K9P A;  4GGF C;  1NWD A;  1YUU A;  5CPV A;  1A29 A;  2OS8 C;  3K21 A;  4MVF A;  2LV7 A;  2D8N A;  4PE7 A;  2K2F A;  4YBH B;  5AEQ A;  2EGD A;  2K7O A;  3HX4 A;  2LMT A;  3FS7 A;  1LVC D;  1QXP A;  2G9B A;  2MLF C;  1DMO A;  3NSL A;  3GK4 X;  1DJX A;  3EK8 A;  5G08 A;  1DJG A;  4AQJ A;  3I5H C;  3IF7 A;  3GK1 A;  1W7I B;  4XJK A;  1HT9 A;  3ICB A;  2K7B A;  1NYA A;  3KEV A;  4MBE A;  1MUX A;  3NSK A;  4GNK B;  3PM8 A;  2KAV A;  1TIZ A;  1DJI A;  1A03 A;  4E68 A;  1NX0 A;  1SY9 A;  2LAP A;  5B8I B;  4PHJ A;  4MLW A;  1EG3 A;  1LA3 A;  1MXE A;  1F54 A;  2JT8 A;  1KWO C;  1DJH A;  2JNF A;  1LKJ A;  1UWO A;  4QJ5 B;  2Q4U A;  2JC2 A;  3SG3 A;  2MJW B;  1HQV A;  4PE1 A;  1Q80 A;  2MHH A;  4YGA A;  1KQM B;  1QV0 A;  2JNX A;  1YVH A;  3SG4 A;  3DVE A;  1QAS A;  5KTY A;  1TCF A;  1WLM A;  4A4B A;  2ZRT A;  4YGC B;  2KBI A;  1AK8 A;  1PSB A;  2ZN8 A;  1BR1 B;  3ZNI A;  1BG1 A;  1G8I A;  2JT0 A;  1PK0 D;  1UHN A;  1BT6 A;  1KFU S;  4GGN A;  5I2O A;  1IQ5 A;  3LK1 A;  1B8C A;  1UUS A;  2BEC A;  3SG2 A;  1B47 A;  1N0Y A;  2PSR A;  3AKB A;  1REC A;  2WCF A;  5CSI A;  1TNP A;  2JRF A;  2E6W A;  2JQ6 A;  1RK9 A;  4I5N B;  1KSM A;  1Y1U A;  2I94 A;  2KOT A;  2GGZ A;  1G33 A;  3DVJ A;  4BY4 A;  2ZRS A;  1M31 A;  2I2R E;  3BQ3 A;  1CLB A;  1SL8 A;  3OB2 B;  2CNP A;  4MSP A;  4C0K A;  2RGI A;  1SR6 B;  1CDN A;  1DTL A;  3AKA A;  1F70 A;  2M1K B;  4YI8 A;  2FCD A;  3PAL A;  4PHM A;  5CSN A;  1JC2 A;  3EKJ A;  1YRU B;  3FWC A;  2CTN A;  4C0L A;  3NSO A;  1F8H A;  2ISD A;  1SKT A;  1SRA A;  5I2Q A;  2M7L A;  2BBM A;  4HSZ A;  1QX5 B;  2HF5 A;  4WQ2 A;  2NCO A;  2LVJ A;  4OKH A;  1SCV A;  5I8N A;  1ZUZ A;  3O6B A;  5CSJ A;  3D10 A;  3NXA A;  4N5X A;  1BJF A;  2LLS A;  3OB1 B;  2O60 A;  2HPS A;  1UP5 A;  3AAJ A;  1TCO B;  2H61 C;  2M97 A;  1BLQ A;  4PCW A;  2VRG A;  2F8P A;  1BOC A;  2LUC A;  1GQM A;  1A2X A;  1XFW O;  1S1E A;  1ODB A;  1OZO A;  1QAT A;  2LCP A;  2WND A;  3DF0 A;  1X02 A;  2F3Y A;  5FYX A;  2LM5 A;  1LIN A;  2I7A A;  4JWQ A;  1NX2 A;  1IQ3 A;  2K7C A;  4HRG A;  3JVT B;  1FBV A;  3JTD B;  4GBA A;  3WHT B;  4C0J A;  2L4H A;  4MZJ A;  2MRD A;  2LP3 A;  3SIA A;  1OZS A;  1CKK A;  1CDL A;  1JUO A;  4DIR A;  1MHO A;  1C7W A;  4YGE B;  1S6I A;  1UHI A;  1DJY A;  3LLE A;  1JF0 A;  2I18 A;  2KQY A;  4PHN A;  1GJY A;  1J7Q A;  2JPT A;  4DRW A;  2E30 A;  1KFX S;  2EC6 C;  3TDU A;  1LXF C;  1SMG A;  2JTZ A;  3VGO A;  3PSR A;  1SR6 C;  2V53 A;  3AAK A;  3PN7 B;  2NZ0 A;  1IG5 A;  2M9G A;  1V1F A;  2KYF A;  4QJ3 B;  4D1E A;  1PUL A;  2GV5 A;  1XFX O;  1MF8 B;  3I5I C;  4GAO A;  2BKI B;  4DS7 A;  1TNX A;  5JOL A;  1S26 D;  1K96 A;  2M7N A;  4JQ0 D;  1Y0V H;  1B7T Y;  4GPL B;  1K90 D;  2KGR A;  2LC5 A;  4U8D A;  1A75 B;  1C7V A;  2Y4Q A;  1NX1 A;  4OVN F;  2NCP A;  2L98 A;  2K7D A;  1AJ5 A;  2EHB A;  3CR2 A;  3EVR A;  2O5G A;  3GK2 A;  1OMD A;  4N1G A;  3ZWH A;  2BBN A;  1F4Q A;  1FW4 A;  1SL7 A;  3OX5 A;  3VRQ A;  4WRI A;  4NQG A;  1QX2 A;  2KI4 B;  2H61 A;  1BOD A;  4OV2 A;  1ZAC A;  3IQQ A;  4F0Z B;  2BL0 B;  2K2A A;  4M2Q A;  2L51 A;  1TRF A;  1IRJ A;  4P5O E;  4P2Y B;  3CZT X;  3I5G B;  2CXJ A;  2OTG C;  5HYD A;  1BU3 A;  1L2O B;  1NPQ A;  5KSZ A;  1IH0 A;  2JXC A;  4PAL A;  1AJ4 A;  2KQ6 A;  3PAT A;  3O2P A;  3LCP C;  5DKN A;  3PLF B;  1IGV A;  1S6J A;  5D69 A;  1ZMZ A;  4UPG A;  1TTX A;  2LUX A;  2BE4 A;  1CTR A;  3KF9 A;  4CLN A;  3CWG A;  4ORA B;  2P6B B;  1YUR A;  5D7F A;  1QX7 A;  1K94 A;  2KI6 D;  3O78 A;  2AMI A;  4PHK A;  2FOT A;  5TNC A;  2WC8 A;  1F4O A;  3BUN B;  2Y1M A;  2QAC A;  3VRP A;  1XFY O;  1WDC B;  1AP4 A;  1LA0 A;  2H2K A;  1V1G A;  2WCE A;  1KK8 B;  1CMG A;  1SYM A;  2JOJ A;  1QTX A;  1UHH A;  3CTN A;  4TNC A;  1S5G Y;  2JXL A;  1NUB A;  4HRH A;  1ALW A;  2TN4 A;  5F6T A;  5DKQ A;  2LHI A;  1XYD A;  4Q04 A;  4ICB A;  1YTZ C;  2OPO A;  1OE9 B;  1RWY A;  4MZL A;  2AAO A;  3QRX A;  4YRU A;  2BL0 C;  3EK7 A;  5IBW A;  2KFG A;  1Y6W A;  3EK4 A;  1EXR A;  2Q91 A;  3OHM B;  4FTG A;  5AXI A;  1J1E A;  1MXL C;  2KSP A;  1N2D A;  2AUC A;  1J7P A;  1RRO A;  1Y1X A;  3FIA A;  1PRW A;  1U5I B;  2LMU A;  2B1U A;  1N65 A;  1R6P A;  3FWB A;  3CR4 X;  2LAN A;  1Y1A A;  4ORB B;  3BUX B;  1WRL A;  2NLN A;  2WOR A;  3I5F B;  4I5L B;  1SPY A;  2G2B A;  1IJ6 A;  1JFK A;  1UUR A;  4DCK A;  3TS5 B;  1WLZ A;  1KQM C;  1SW8 A;  1JF2 A;  2CT9 A;  2SAS A;  4ORC B;  3VRO A;  1YX8 A;  2M1U A;  1UHJ A;  1H4B A;  3KPX A;  1M45 A;  2Y5I A;  4XYN A;  1DF0 B;  2WCB A;  3MSE B;  1EJ3 A;  2KI6 C;  1NX3 A;  1EL4 A;  4BY5 A;  1CNP A;  1BR4 B;  5CSF A;  1S36 A;  1YX7 A;  1NCZ A;  2CCM A;  1QVI Y;  4M2P A;  2ZKM X;  1QLK A;  1GGW A;  1CM4 A;  1K2H A;  3OX6 A;  2OS8 B;  1A75 A;  4MZK A;  3VRN A;  2MAZ A;  4OCI A;  5BPJ A;  1KQV A;  2LE9 B;  1NCY A;  1E8A A;  2Y1N A;  3WXA A;  1MQ1 A;  1YUT A;  2LVV A;  1L7Z A;  3M0W A;  4MRY A;  1XFU O;  3CGA A;  1S5G Z;  4L9M A;  3TUY B;  3I5H B;  4USL A;  2WOS A;  1XA5 A;  3EVV A;  4NDD A;  1F71 A;  1J55 A;  1DVI A;  1WY9 A;  1JBA A;  1KK7 Y;  3TZ1 A;  2KAX A;  1NCX A;  1K93 D;  3SIB A;  1KWO B;  1J7R A;  3BOW B;  1S6C A;  3LL8 B;  4I5K A;  5I2L A;  2L0P A;  3KO0 A;  4AOM A;  1FF1 A;  1UHK A;  1CB1 A;  1SK6 D;  4HRE E;  1YRT B;  1RFJ A;  1CFD A;  2CBL A;  2JWW A;  3D0Y B;  1XVJ A;  3BXK A;  2MBX A;  1RJV A;  4CFR A;  3GOF A;  1IJ5 A;  2IS9 A;  1IWQ A;  2HQW A;  4PE0 A;  1M63 B;  3JVT C;  2ZN9 A;  2HQ8 A;  3JTD C;  2BCA A;  1OOJ A;  1RTP 1;  2KHN A;  5KU1 A;  2MA2 A;  1EG4 A;  1QJT A;  1WRK A;  2JTT A;  1F55 A;  1FPW A;  5ER4 X;  1DGU A;  4FQO A;  5ER5 A;  1YR5 A;  3BUO B;  1DT7 B;  3NSI A;  1CFF A;  1B8R A;  1QVI Z;  1AUI B;  3TDZ A;  3CR5 X;  3SG5 A;  3TUY C;  2M0R A;  4WQ3 A;  1MR8 A;  4QJ4 B;  2PAL A;  3PN7 C;  1B4C A;  4JPZ B;  2JUL A;  2BCX A;  3E3R A;  2LMV A;  4MRX A;  1OSA A;  1SL9 A;  1CFC A;  1U5I A;  1KFU L;  5HKW A;  1XFV O;  4GUK A;  4YGB B;  1K9K A;  1G4Y R;  4R1E A;  4CID A;  2L50 A;  2BCB A;  2F2O A;  1B1G A;  1QS7 A;  1DJW A;  1EH2 A;  1NP8 A;  1OMV A;  2LHL A;  2LP2 A;  2KNE A;  1KK7 Z;  2KYC A;  2M49 B;  3OP0 A;  4IL1 A;  1H8B A;  1K8U A;  1K9U A;  2KI4 C;  2KAY A;  2KFH A;  1B7T Z;  1BMO A;  2JT3 A;  2M3W A;  1XK4 C;  2PRU A;  4XJK B;  4ZCV A;  5HLV A;  1CLL A;  1NSH A;  3DVK A;  1DF0 A;  4YGD B;  3RM1 A;  4M2O A;  4AQI A;  2HET A;  3I5G C;  3LK0 A;  2A4J A;  1L2O C;  3IQO A;  4I5J A;  2L2E A;  5HKY A;  1B8L A;  1MWN A;  3HCM A;  1QIW A;  4GGF A;  3O4Y A;  5GQQ C;  3A8R A;  2FCE A;  1M46 A;  2F3Z A;  3RLZ A;  1JWD A;  2ZND A;  2GGM A;  1PVB A;  2M29 A;  2LVK A;  1B9A A;  2PVB A;  2MLE C;  2K8M B;  4MN0 A;  3WHU B;  4N1F A;  2KGB C;  2EC6 B;  2K61 A;  4ETO A;  5AER A;  1KCY A;  1YVL A;  3KHE A;  1NIW A;  5HKZ A;  1OMR A;  1R2U A;  5K89 A;  2ZNE A;  1TNW A;  5DKR A;  4A4C A;  1SCM B;  1CFP A;  1ZFS A;  4NDB A;  1SNL A;  3EKH A;  3CLN A;  3BYA A;  1WDC C;  4PE4 A;  3TDI A;  2M8U A;  5JJG A;  2SCP A;  1SBJ A;  3BUM B;  1KK8 C;  1JSA A;  3I5I B;  1BF5 A;  3WNX B;  1IKU A;  1C07 A;  4NDC A;  2LNK A;  1J1D A;  2F2P A;  2FJU B;  1WRZ A;  4YI9 A;  1TOP A;  2QPT A;  1XO5 A;  2KBM A;  3BOW A;  1ALV A;  4ZCU A;  2NXQ A;  1KFX L;  3EVU A;  1CLM A;  5J3X A;  3SG7 A;  2K0J A;  2ZFD A;  1QLS A;  1DGV A;  3CS1 A;  5AFP A;  3A4U B;  1K95 A;  1W7J B;  1DJZ A;  3H4S E;  1CDP A;  4CFQ A;  2KDH A;  1QIV A;  4MEW A;  1AHR A;  3D0Y A;  4GFT A;  1CM1 A;  3SG6 A;  1XK4 A;  2F33 A;  1KSO A;  1PVA A; 
#chains in the Genus database with same CATH topology
 2LLT A;  1JFJ A;  4OR9 B;  1LS8 A;  4DUQ A;  1TNQ A;  1CMF A;  1FI5 A;  1FI6 A;  2L5X B;  2LLU A;  1CDM A;  2L4I A;  2OTG B;  3I5F C;  1YUS A;  3UNW A;  2R2I A;  2BKH B;  3C1V A;  5PAL A;  1PSR A;  1S3P A;  1OQP A;  2PMY A;  3TS5 C;  3VRR A;  2KFF A;  3F45 A;  4PDZ A;  3NHI A;  1J7O A;  3B86 A;  1QV1 A;  1AVS A;  2DOQ A;  5FI2 A;  2JZI A;  5HLO A;  2JU0 A;  2L5Y A;  1GGZ A;  1TWO A;  3BUW B;  2BE6 A;  1SCM C;  3DVM A;  1VRK A;  2PAS A;  3DD4 A;  3DF0 B;  1TN4 A;  3B6X A;  3N7H A;  1A4P A;  4CPV A;  1D1O A;  2COL B;  3PFV A;  1M39 A;  5AAN A;  1TUZ A;  3SJS A;  1PAL A;  1XFZ O;  1ZOT B;  2LVI A;  1K9P A;  4GGF C;  1NWD A;  3OGN A;  1YUU A;  5CPV A;  1A29 A;  2OS8 C;  3K21 A;  1OOH A;  2LV7 A;  2D8N A;  4MVF A;  2K2F A;  4PE7 A;  4YBH B;  2EGD A;  2K7O A;  3HX4 A;  2LMT A;  3D76 A;  3FS7 A;  1LVC D;  1QXP A;  2G9B A;  2MLF C;  1DMO A;  3NSL A;  3GK4 X;  1DJX A;  3EK8 A;  5G08 A;  1DJG A;  3R1V A;  4AQJ A;  3I5H C;  3S0E A;  3IF7 A;  3GK1 A;  1W7I B;  4XJK A;  1HT9 A;  3ICB A;  2K7B A;  1NYA A;  3KEV A;  4MBE A;  1MUX A;  3NSK A;  4GNK B;  3PM8 A;  2KAV A;  1TIZ A;  1DJI A;  1A03 A;  4E68 A;  1NX0 A;  1SY9 A;  2P71 A;  2LAP A;  1T14 A;  5B8I B;  4PHJ A;  4MLW A;  1EG3 A;  1LA3 A;  1MXE A;  1F54 A;  2JT8 A;  1KWO C;  1DJH A;  2JNF A;  1LKJ A;  3S0D A;  1UWO A;  4QJ5 B;  2Q4U A;  2JC2 A;  3SG3 A;  2MJW B;  1HQV A;  3B88 A;  4PE1 A;  1Q80 A;  2MHH A;  4YGA A;  1KQM B;  1QV0 A;  2JNX A;  1YVH A;  3SG4 A;  3DVE A;  2KPH A;  1QAS A;  5KTY A;  1TCF A;  1WLM A;  5EL2 A;  4A4B A;  2ZRT A;  4YGC B;  2KBI A;  1AK8 A;  1PSB A;  2ZN8 A;  1BR1 B;  3ZNI A;  1BG1 A;  3R1P A;  3BFH A;  1G8I A;  2JT0 A;  1PK0 D;  3DXL A;  1UHN A;  1BT6 A;  1KFU S;  4GGN A;  3V2L A;  5I2O A;  1IQ5 A;  3LK1 A;  1B8C A;  1UUS A;  2BEC A;  3SG2 A;  1B47 A;  1N0Y A;  2PSR A;  3AKB A;  1REC A;  2WCF A;  5CSI A;  1TNP A;  2JRF A;  2E6W A;  2JQ6 A;  1RK9 A;  4I5N B;  1KSM A;  1Y1U A;  2I94 A;  2WCH A;  3L4L A;  2KOT A;  2GGZ A;  1G33 A;  3L47 A;  3DVJ A;  4BY4 A;  2ZRS A;  1M31 A;  2I2R E;  3BQ3 A;  1CLB A;  1SL8 A;  3OB2 B;  2CNP A;  4MSP A;  4C0K A;  2RGI A;  1SR6 B;  1W9Z A;  1CDN A;  1DTL A;  3AKA A;  3DY9 A;  1F70 A;  2M1K B;  4YI8 A;  2FCD A;  3PAL A;  4PHM A;  5CSN A;  1JC2 A;  3EKJ A;  1YRU B;  3FWC A;  2CTN A;  4C0L A;  3NSO A;  1F8H A;  2ISD A;  2BAP A;  1SKT A;  1SRA A;  5I2Q A;  2M7L A;  2BBM A;  1DC1 A;  4HSZ A;  5AEQ A;  1QX5 B;  2HF5 A;  4WQ2 A;  2NCO A;  2H8V A;  1SSE B;  2LVJ A;  4OKH A;  1SCV A;  3D78 A;  1ZUZ A;  5I8N A;  3O6B A;  5CSJ A;  3D10 A;  3NXA A;  4N5X A;  3S0B A;  5HL1 A;  1BJF A;  2LLS A;  3OB1 B;  2ERB A;  2O60 A;  2HPS A;  1UP5 A;  3AAJ A;  1TCO B;  2H61 C;  2M97 A;  1BLQ A;  4PCW A;  2VRG A;  2F8P A;  1BOC A;  3FE8 A;  2LUC A;  4INW A;  1GQM A;  1A2X A;  1XFW O;  1S1E A;  1ODB A;  1OZO A;  1QAT A;  2LCP A;  2WND A;  3DF0 A;  1X02 A;  2F3Y A;  5FYX A;  5DIC A;  2LM5 A;  1LIN A;  2I7A A;  4JWQ A;  1NX2 A;  1IQ3 A;  2K7C A;  4HRG A;  3JVT B;  1FBV A;  3JTD B;  4GBA A;  3WHT B;  4C0J A;  1OOI X;  3RZS A;  2L4H A;  4MZJ A;  2MRD A;  2LP3 A;  3SIA A;  1OZS A;  1CKK A;  1CDL A;  1JUO A;  4DIR A;  1MHO A;  1C7W A;  2QDI A;  1S6I A;  1UHI A;  4YGE B;  1DJY A;  3LLE A;  1JF0 A;  2I18 A;  2KQY A;  4PHN A;  1GJY A;  1J7Q A;  2JPT A;  5FI6 A;  4DRW A;  2E30 A;  1KFX S;  2EC6 C;  3TDU A;  1LXF C;  1SMG A;  3SS3 A;  2JTZ A;  3VGO A;  3PSR A;  2PYQ A;  1SR6 C;  2V53 A;  3AAK A;  3PN7 B;  2NZ0 A;  3NGV A;  1IG5 A;  2QEB A;  2M9G A;  1P28 A;  1V1F A;  2KYF A;  4QJ3 B;  4D1E A;  3R1O A;  3QME A;  1PUL A;  2GV5 A;  1XFX O;  1MF8 B;  3I5I C;  1DQE A;  4GAO A;  5HLV A;  2BKI B;  4DS7 A;  1TNX A;  5JOL A;  1S26 D;  2KLD A;  1K96 A;  2M7N A;  4JQ0 D;  1Y0V H;  1B7T Y;  4GPL B;  1K90 D;  2KGR A;  2LC5 A;  4U8D A;  1A75 B;  1C7V A;  2Y4Q A;  1NX1 A;  4OVN F;  2NCP A;  2L98 A;  2K7D A;  3O4X A;  1AJ5 A;  2EHB A;  3CR2 A;  2WCM A;  2O5G A;  3EVR A;  3GK2 A;  1OMD A;  4N1G A;  3ZWH A;  2BBN A;  1F4Q A;  1FW4 A;  1SL7 A;  1Z2C B;  3OX5 A;  3VRQ A;  4WRI A;  4NQG A;  1QX2 A;  2KI4 B;  3UO9 A;  2H61 A;  1BOD A;  4OV2 A;  1ZAC A;  3D74 A;  3IQQ A;  4F0Z B;  2BL0 B;  2K2A A;  4M2Q A;  2L51 A;  1TRF A;  1IRJ A;  4P5O E;  4P2Y B;  3CZT X;  3I5G B;  2CXJ A;  2OTG C;  5FI7 A;  5HYD A;  1BU3 A;  1L2O B;  1NPQ A;  3B7A A;  5KSZ A;  1IH0 A;  2JXC A;  4PAL A;  1AJ4 A;  2KQ6 A;  3PAT A;  3O2P A;  3LCP C;  5DKN A;  3PLF B;  1IGV A;  1S6J A;  5D69 A;  1ZMZ A;  1OW4 A;  4UPG A;  1TTX A;  2LUX A;  2BE4 A;  1CTR A;  3KF9 A;  4CLN A;  3CWG A;  4ORA B;  2P6B B;  3D73 A;  1YUR A;  5D7F A;  1QX7 A;  3NHT A;  1K94 A;  2KI6 D;  3O78 A;  2AMI A;  4PHK A;  2FOT A;  5TNC A;  2WC8 A;  1F4O A;  5I94 A;  3BUN B;  2Y1M A;  2QAC A;  3VRP A;  1XFY O;  1WDC B;  1AP4 A;  2WCJ A;  1LA0 A;  2H2K A;  1V1G A;  2WCE A;  1KK8 B;  1CMG A;  3CYZ A;  1SYM A;  2JOJ A;  1QTX A;  1UHH A;  3CTN A;  4TNC A;  1S5G Y;  4OZD A;  2JXL A;  3CAB A;  1NUB A;  4HRH A;  1ALW A;  2TN4 A;  5F6T A;  5DKQ A;  1XFR A;  2LHI A;  2KLE A;  1XYD A;  4Q04 A;  4ICB A;  1YTZ C;  2OPO A;  3CZ1 A;  1OE9 B;  1RWY A;  4MZL A;  3CZ0 A;  2AAO A;  3QRX A;  4YRU A;  2BL0 C;  3EK7 A;  5IBW A;  2KFG A;  1Y6W A;  3EK4 A;  1EXR A;  2Q91 A;  3OHM B;  4FTG A;  5AXI A;  1J1E A;  1MXL C;  2KSP A;  1N2D A;  2AUC A;  3FE9 A;  1RRO A;  1Y1X A;  3FIA A;  1PRW A;  1U5I B;  2LMU A;  3Q8I A;  1J7P A;  2B1U A;  1N65 A;  1R6P A;  3FWB A;  3CR4 X;  3DYE A;  2LAN A;  1Y1A A;  4ORB B;  3BUX B;  1WRL A;  4JKT A;  3BFB A;  2NLN A;  2WOR A;  3EG5 B;  3I5F B;  4I5L B;  1SPY A;  2G2B A;  1IJ6 A;  1JFK A;  1UUR A;  4DCK A;  3TS5 B;  1C3Z A;  1WLZ A;  1KQM C;  1SW8 A;  1JF2 A;  3D75 A;  2CT9 A;  2QEO A;  2SAS A;  4ORC B;  3VRO A;  1YX8 A;  3PM2 A;  2M1U A;  1UHJ A;  2JPO A;  1H4B A;  3KPX A;  1M45 A;  2Y5I A;  4XYN A;  1DF0 B;  2WCB A;  3MSE B;  1EJ3 A;  2KI6 C;  1NX3 A;  3VB1 A;  1EL4 A;  4BY5 A;  4PT1 A;  1CNP A;  1BR4 B;  5CSF A;  3L4A A;  2QEH A;  1S36 A;  1YX7 A;  1NCZ A;  2CCM A;  1QVI Y;  4M2P A;  2L2C A;  2ZKM X;  1QLK A;  1GGW A;  4F7F A;  1CM4 A;  1QWV A;  1K2H A;  3OX6 A;  2OS8 B;  1A75 A;  3SS4 A;  4MZK A;  3VRN A;  2MAZ A;  4OCI A;  5BPJ A;  1KQV A;  2LE9 B;  2WCK A;  1NCY A;  3IVT A;  1E8A A;  3BFA A;  4FQT A;  2Y1N A;  3WXA A;  1MQ1 A;  1YUT A;  2LVV A;  1L7Z A;  3M0W A;  4MRY A;  1XFU O;  3CGA A;  1S5G Z;  4L9M A;  3TUY B;  3I5H B;  4USL A;  4IJ7 A;  2WOS A;  3OBV A;  1XA5 A;  3EVV A;  3CZ2 A;  4NDD A;  1F71 A;  1J55 A;  1DVI A;  1WY9 A;  1JBA A;  1KK7 Y;  2WC5 A;  2FJY A;  3TZ1 A;  2KAX A;  3D77 A;  1NCX A;  1K93 D;  3SIB A;  1KWO B;  1J7R A;  3BOW B;  1S6C A;  3LL8 B;  2QEV A;  4I5K A;  5I2L A;  2L0P A;  3KO0 A;  4AOM A;  1FF1 A;  1UHK A;  1DEK A;  1CB1 A;  2GTE A;  1SK6 D;  4HRE E;  1YRT B;  1RFJ A;  1CFD A;  2CBL A;  2JWW A;  3D0Y B;  1XVJ A;  3BXK A;  2MBX A;  1RJV A;  4CFR A;  3GOF A;  1IJ5 A;  2IS9 A;  1IWQ A;  2HQW A;  4PE0 A;  1M63 B;  3JVT C;  2ZN9 A;  2HQ8 A;  3JTD C;  2BCA A;  3SS5 A;  1OOJ A;  1RTP 1;  2KHN A;  5KU1 A;  2MA2 A;  3CDN A;  3PJI A;  1EG4 A;  1QJT A;  1WRK A;  1GM0 A;  2JTT A;  1F55 A;  1FPW A;  5ER4 X;  1DGU A;  4FQO A;  1C3Y A;  5ER5 A;  1YR5 A;  3BUO B;  1DT7 B;  3NSI A;  1CFF A;  1B8R A;  1QVI Z;  1AUI B;  3TDZ A;  3CR5 X;  3SG5 A;  3TUY C;  2M0R A;  4WQ3 A;  1MR8 A;  4QJ4 B;  2PAL A;  2YGU A;  3PN7 C;  1B4C A;  4JPZ B;  2JUL A;  2BCX A;  3E3R A;  2LMV A;  4MRX A;  2PQL A;  1OSA A;  1SL9 A;  4INX A;  1CFC A;  3K1E A;  1U5I A;  1KFU L;  2WC6 A;  5HKW A;  1XFV O;  1TUJ A;  4GUK A;  4YGB B;  1K9K A;  1G4Y R;  4R1E A;  4CID A;  2L50 A;  2BCB A;  2F2O A;  1B1G A;  1QS7 A;  1DJW A;  3S0F A;  1EH2 A;  1NP8 A;  1OMV A;  2LHL A;  2LP2 A;  3DZT A;  2KNE A;  1KK7 Z;  2KYC A;  2M49 B;  3OP0 A;  4IL1 A;  1H8B A;  1DEL A;  2BNX A;  1K8U A;  1K9U A;  2KI4 C;  2KAY A;  2KFH A;  1B7T Z;  1BMO A;  2JT3 A;  2M3W A;  1XK4 C;  1ORG A;  2PRU A;  4XJK B;  4ZCV A;  1CLL A;  1NSH A;  3DVK A;  1DF0 A;  4YGD B;  3RM1 A;  4M2O A;  4AQI A;  3S0A A;  2HET A;  3I5G C;  1OOG A;  3LK0 A;  2A4J A;  1L2O C;  3IQO A;  4I5J A;  2L2E A;  5HKY A;  1B8L A;  1MWN A;  3HCM A;  1QIW A;  4GGF A;  1OOF A;  3B87 A;  3O4Y A;  5GQQ C;  3A8R A;  2FCE A;  1M46 A;  2F3Z A;  5D3O A;  3RLZ A;  1JWD A;  2ZND A;  2GGM A;  1PVB A;  2K60 A;  2M29 A;  2LVK A;  1B9A A;  2PVB A;  2MLE C;  2K8M B;  4MN0 A;  3WHU B;  4N1F A;  2KGB C;  1Z4H A;  2EC6 B;  2K61 A;  4ETO A;  3FE6 A;  4KYN A;  5AER A;  1KCY A;  1YVL A;  3KHE A;  1NIW A;  5HKZ A;  1OMR A;  1R2U A;  5K89 A;  2ZNE A;  1TNW A;  5DKR A;  4A4C A;  1SCM B;  1CFP A;  1ZFS A;  4NDB A;  4JD9 A;  3S0G A;  1SNL A;  3EKH A;  3CLN A;  3BYA A;  1WDC C;  4PE4 A;  3TDI A;  2M8U A;  5JJG A;  2SCP A;  1SBJ A;  3BUM B;  1KK8 C;  1JSA A;  3I5I B;  1BF5 A;  3WNX B;  1IKU A;  1C07 A;  4NDC A;  2LNK A;  1J1D A;  2F2P A;  2P70 A;  2FJU B;  1WRZ A;  4YI9 A;  1TOP A;  2QPT A;  1XO5 A;  2KBM A;  3BOW A;  2WCL A;  1ALV A;  4ZCU A;  1IIO A;  2NXQ A;  1KFX L;  3EVU A;  1CLM A;  5J3X A;  3SG7 A;  2K0J A;  2ZFD A;  1QLS A;  1DGV A;  3CS1 A;  5AFP A;  3A4U B;  1K95 A;  1W7J B;  1DJZ A;  3H4S E;  1CDP A;  4CFQ A;  2KDH A;  1QIV A;  4MEW A;  3R72 A;  1AHR A;  3D0Y A;  4GFT A;  1CM1 A;  3BJH A;  3SG6 A;  1XK4 A;  2F33 A;  1KSO A;  1PVA A; 
#chains in the Genus database with same CATH homology
 2LLT A;  1JFJ A;  4OR9 B;  4DUQ A;  1TNQ A;  1CMF A;  1FI5 A;  1FI6 A;  2L5X B;  2LLU A;  1CDM A;  2L4I A;  2OTG B;  3I5F C;  1YUS A;  2R2I A;  2BKH B;  3C1V A;  5PAL A;  1PSR A;  1S3P A;  1OQP A;  2PMY A;  3TS5 C;  3VRR A;  2KFF A;  3F45 A;  4PDZ A;  1J7O A;  1QV1 A;  1AVS A;  2DOQ A;  2JZI A;  5HLO A;  2JU0 A;  3BUW B;  1GGZ A;  2BE6 A;  1SCM C;  3DVM A;  1VRK A;  2PAS A;  3DD4 A;  3DF0 B;  1TN4 A;  1A4P A;  4CPV A;  1D1O A;  2COL B;  3PFV A;  1M39 A;  5AAN A;  3SJS A;  1PAL A;  1XFZ O;  1ZOT B;  2LVI A;  1K9P A;  4GGF C;  1NWD A;  1YUU A;  5CPV A;  1A29 A;  2OS8 C;  3K21 A;  4MVF A;  2LV7 A;  2D8N A;  4PE7 A;  2K2F A;  4YBH B;  5AEQ A;  2EGD A;  2K7O A;  3HX4 A;  2LMT A;  3FS7 A;  1LVC D;  1QXP A;  2G9B A;  2MLF C;  1DMO A;  3NSL A;  3GK4 X;  1DJX A;  3EK8 A;  5G08 A;  1DJG A;  4AQJ A;  3I5H C;  3IF7 A;  3GK1 A;  1W7I B;  4XJK A;  1HT9 A;  3ICB A;  2K7B A;  1NYA A;  3KEV A;  4MBE A;  1MUX A;  3NSK A;  4GNK B;  3PM8 A;  2KAV A;  1TIZ A;  1DJI A;  1A03 A;  4E68 A;  1NX0 A;  1SY9 A;  2LAP A;  5B8I B;  4PHJ A;  4MLW A;  1EG3 A;  1LA3 A;  1MXE A;  1F54 A;  2JT8 A;  1KWO C;  1DJH A;  2JNF A;  1LKJ A;  1UWO A;  4QJ5 B;  2Q4U A;  2JC2 A;  3SG3 A;  2MJW B;  1HQV A;  4PE1 A;  1Q80 A;  2MHH A;  4YGA A;  1KQM B;  1QV0 A;  2JNX A;  1YVH A;  3SG4 A;  3DVE A;  1QAS A;  5KTY A;  1TCF A;  1WLM A;  4A4B A;  2ZRT A;  4YGC B;  2KBI A;  1AK8 A;  1PSB A;  2ZN8 A;  1BR1 B;  3ZNI A;  1BG1 A;  1G8I A;  2JT0 A;  1PK0 D;  1UHN A;  1BT6 A;  1KFU S;  4GGN A;  5I2O A;  1IQ5 A;  3LK1 A;  1B8C A;  1UUS A;  2BEC A;  3SG2 A;  1B47 A;  1N0Y A;  2PSR A;  3AKB A;  1REC A;  2WCF A;  5CSI A;  1TNP A;  2JRF A;  2E6W A;  2JQ6 A;  1RK9 A;  4I5N B;  1KSM A;  1Y1U A;  2I94 A;  2KOT A;  2GGZ A;  1G33 A;  3DVJ A;  4BY4 A;  2ZRS A;  1M31 A;  2I2R E;  3BQ3 A;  1CLB A;  1SL8 A;  3OB2 B;  2CNP A;  4MSP A;  4C0K A;  2RGI A;  1SR6 B;  1CDN A;  1DTL A;  3AKA A;  1F70 A;  2M1K B;  4YI8 A;  2FCD A;  3PAL A;  4PHM A;  5CSN A;  1JC2 A;  3EKJ A;  1YRU B;  3FWC A;  2CTN A;  4C0L A;  3NSO A;  1F8H A;  2ISD A;  1SKT A;  1SRA A;  5I2Q A;  2M7L A;  2BBM A;  4HSZ A;  1QX5 B;  2HF5 A;  4WQ2 A;  2NCO A;  2LVJ A;  4OKH A;  1SCV A;  5I8N A;  1ZUZ A;  3O6B A;  5CSJ A;  3D10 A;  3NXA A;  4N5X A;  1BJF A;  2LLS A;  3OB1 B;  2O60 A;  2HPS A;  1UP5 A;  3AAJ A;  1TCO B;  2H61 C;  2M97 A;  1BLQ A;  4PCW A;  2VRG A;  2F8P A;  1BOC A;  2LUC A;  1GQM A;  1A2X A;  1XFW O;  1S1E A;  1ODB A;  1OZO A;  1QAT A;  2LCP A;  2WND A;  3DF0 A;  1X02 A;  2F3Y A;  5FYX A;  2LM5 A;  1LIN A;  2I7A A;  4JWQ A;  1NX2 A;  1IQ3 A;  2K7C A;  4HRG A;  3JVT B;  1FBV A;  3JTD B;  4GBA A;  3WHT B;  4C0J A;  2L4H A;  4MZJ A;  2MRD A;  2LP3 A;  3SIA A;  1OZS A;  1CKK A;  1CDL A;  1JUO A;  4DIR A;  1MHO A;  1C7W A;  4YGE B;  1S6I A;  1UHI A;  1DJY A;  3LLE A;  1JF0 A;  2I18 A;  2KQY A;  4PHN A;  1GJY A;  1J7Q A;  2JPT A;  4DRW A;  2E30 A;  1KFX S;  2EC6 C;  3TDU A;  1LXF C;  1SMG A;  2JTZ A;  3VGO A;  3PSR A;  1SR6 C;  2V53 A;  3AAK A;  3PN7 B;  2NZ0 A;  1IG5 A;  2M9G A;  1V1F A;  2KYF A;  4QJ3 B;  4D1E A;  1PUL A;  2GV5 A;  1XFX O;  1MF8 B;  3I5I C;  4GAO A;  2BKI B;  4DS7 A;  1TNX A;  5JOL A;  1S26 D;  1K96 A;  2M7N A;  4JQ0 D;  1Y0V H;  1B7T Y;  4GPL B;  1K90 D;  2KGR A;  2LC5 A;  4U8D A;  1A75 B;  1C7V A;  2Y4Q A;  1NX1 A;  4OVN F;  2NCP A;  2L98 A;  2K7D A;  1AJ5 A;  2EHB A;  3CR2 A;  3EVR A;  2O5G A;  3GK2 A;  1OMD A;  4N1G A;  3ZWH A;  2BBN A;  1F4Q A;  1FW4 A;  1SL7 A;  3OX5 A;  3VRQ A;  4WRI A;  4NQG A;  1QX2 A;  2KI4 B;  2H61 A;  1BOD A;  4OV2 A;  1ZAC A;  3IQQ A;  4F0Z B;  2BL0 B;  2K2A A;  4M2Q A;  2L51 A;  1TRF A;  1IRJ A;  4P5O E;  4P2Y B;  3CZT X;  3I5G B;  2CXJ A;  2OTG C;  5HYD A;  1BU3 A;  1L2O B;  1NPQ A;  5KSZ A;  1IH0 A;  2JXC A;  4PAL A;  1AJ4 A;  2KQ6 A;  3PAT A;  3O2P A;  3LCP C;  5DKN A;  3PLF B;  1IGV A;  1S6J A;  5D69 A;  1ZMZ A;  4UPG A;  1TTX A;  2LUX A;  2BE4 A;  1CTR A;  3KF9 A;  4CLN A;  3CWG A;  4ORA B;  2P6B B;  1YUR A;  5D7F A;  1QX7 A;  1K94 A;  2KI6 D;  3O78 A;  2AMI A;  4PHK A;  2FOT A;  5TNC A;  2WC8 A;  1F4O A;  3BUN B;  2Y1M A;  2QAC A;  3VRP A;  1XFY O;  1WDC B;  1AP4 A;  1LA0 A;  2H2K A;  1V1G A;  2WCE A;  1KK8 B;  1CMG A;  1SYM A;  2JOJ A;  1QTX A;  1UHH A;  3CTN A;  4TNC A;  1S5G Y;  2JXL A;  1NUB A;  4HRH A;  1ALW A;  2TN4 A;  5F6T A;  5DKQ A;  2LHI A;  1XYD A;  4Q04 A;  4ICB A;  1YTZ C;  2OPO A;  1OE9 B;  1RWY A;  4MZL A;  2AAO A;  3QRX A;  4YRU A;  2BL0 C;  3EK7 A;  5IBW A;  2KFG A;  1Y6W A;  3EK4 A;  1EXR A;  2Q91 A;  3OHM B;  4FTG A;  5AXI A;  1J1E A;  1MXL C;  2KSP A;  1N2D A;  2AUC A;  1J7P A;  1RRO A;  1Y1X A;  3FIA A;  1PRW A;  1U5I B;  2LMU A;  2B1U A;  1N65 A;  1R6P A;  3FWB A;  3CR4 X;  2LAN A;  1Y1A A;  4ORB B;  3BUX B;  1WRL A;  2NLN A;  2WOR A;  3I5F B;  4I5L B;  1SPY A;  2G2B A;  1IJ6 A;  1JFK A;  1UUR A;  4DCK A;  3TS5 B;  1WLZ A;  1KQM C;  1SW8 A;  1JF2 A;  2CT9 A;  2SAS A;  4ORC B;  3VRO A;  1YX8 A;  2M1U A;  1UHJ A;  1H4B A;  3KPX A;  1M45 A;  2Y5I A;  4XYN A;  1DF0 B;  2WCB A;  3MSE B;  1EJ3 A;  2KI6 C;  1NX3 A;  1EL4 A;  4BY5 A;  1CNP A;  1BR4 B;  5CSF A;  1S36 A;  1YX7 A;  1NCZ A;  2CCM A;  1QVI Y;  4M2P A;  2ZKM X;  1QLK A;  1GGW A;  1CM4 A;  1K2H A;  3OX6 A;  2OS8 B;  1A75 A;  4MZK A;  3VRN A;  2MAZ A;  4OCI A;  5BPJ A;  1KQV A;  2LE9 B;  1NCY A;  1E8A A;  2Y1N A;  3WXA A;  1MQ1 A;  1YUT A;  2LVV A;  1L7Z A;  3M0W A;  4MRY A;  1XFU O;  3CGA A;  1S5G Z;  4L9M A;  3TUY B;  3I5H B;  4USL A;  2WOS A;  1XA5 A;  3EVV A;  4NDD A;  1F71 A;  1J55 A;  1DVI A;  1WY9 A;  1JBA A;  1KK7 Y;  3TZ1 A;  2KAX A;  1NCX A;  1K93 D;  3SIB A;  1KWO B;  1J7R A;  3BOW B;  1S6C A;  3LL8 B;  4I5K A;  5I2L A;  2L0P A;  3KO0 A;  4AOM A;  1FF1 A;  1UHK A;  1CB1 A;  1SK6 D;  4HRE E;  1YRT B;  1RFJ A;  1CFD A;  2CBL A;  2JWW A;  3D0Y B;  1XVJ A;  3BXK A;  2MBX A;  1RJV A;  4CFR A;  3GOF A;  1IJ5 A;  2IS9 A;  1IWQ A;  2HQW A;  4PE0 A;  1M63 B;  3JVT C;  2ZN9 A;  2HQ8 A;  3JTD C;  2BCA A;  1OOJ A;  1RTP 1;  2KHN A;  5KU1 A;  2MA2 A;  1EG4 A;  1QJT A;  1WRK A;  2JTT A;  1F55 A;  1FPW A;  5ER4 X;  1DGU A;  4FQO A;  5ER5 A;  1YR5 A;  3BUO B;  1DT7 B;  3NSI A;  1CFF A;  1B8R A;  1QVI Z;  1AUI B;  3TDZ A;  3CR5 X;  3SG5 A;  3TUY C;  2M0R A;  4WQ3 A;  1MR8 A;  4QJ4 B;  2PAL A;  3PN7 C;  1B4C A;  4JPZ B;  2JUL A;  2BCX A;  3E3R A;  2LMV A;  4MRX A;  1OSA A;  1SL9 A;  1CFC A;  1U5I A;  1KFU L;  5HKW A;  1XFV O;  4GUK A;  4YGB B;  1K9K A;  1G4Y R;  4R1E A;  4CID A;  2L50 A;  2BCB A;  2F2O A;  1B1G A;  1QS7 A;  1DJW A;  1EH2 A;  1NP8 A;  1OMV A;  2LHL A;  2LP2 A;  2KNE A;  1KK7 Z;  2KYC A;  2M49 B;  3OP0 A;  4IL1 A;  1H8B A;  1K8U A;  1K9U A;  2KI4 C;  2KAY A;  2KFH A;  1B7T Z;  1BMO A;  2JT3 A;  2M3W A;  1XK4 C;  2PRU A;  4XJK B;  4ZCV A;  5HLV A;  1CLL A;  1NSH A;  3DVK A;  1DF0 A;  4YGD B;  3RM1 A;  4M2O A;  4AQI A;  2HET A;  3I5G C;  3LK0 A;  2A4J A;  1L2O C;  3IQO A;  4I5J A;  2L2E A;  5HKY A;  1B8L A;  1MWN A;  3HCM A;  1QIW A;  4GGF A;  3O4Y A;  5GQQ C;  3A8R A;  2FCE A;  1M46 A;  2F3Z A;  3RLZ A;  1JWD A;  2ZND A;  2GGM A;  1PVB A;  2M29 A;  2LVK A;  1B9A A;  2PVB A;  2MLE C;  2K8M B;  4MN0 A;  3WHU B;  4N1F A;  2KGB C;  2EC6 B;  2K61 A;  4ETO A;  5AER A;  1KCY A;  1YVL A;  3KHE A;  1NIW A;  5HKZ A;  1OMR A;  1R2U A;  5K89 A;  2ZNE A;  1TNW A;  5DKR A;  4A4C A;  1SCM B;  1CFP A;  1ZFS A;  4NDB A;  1SNL A;  3EKH A;  3CLN A;  3BYA A;  1WDC C;  4PE4 A;  3TDI A;  2M8U A;  5JJG A;  2SCP A;  1SBJ A;  3BUM B;  1KK8 C;  1JSA A;  3I5I B;  1BF5 A;  3WNX B;  1IKU A;  1C07 A;  4NDC A;  2LNK A;  1J1D A;  2F2P A;  2FJU B;  1WRZ A;  4YI9 A;  1TOP A;  2QPT A;  1XO5 A;  2KBM A;  3BOW A;  1ALV A;  4ZCU A;  2NXQ A;  1KFX L;  3EVU A;  1CLM A;  5J3X A;  3SG7 A;  2K0J A;  2ZFD A;  1QLS A;  1DGV A;  3CS1 A;  5AFP A;  3A4U B;  1K95 A;  1W7J B;  1DJZ A;  3H4S E;  1CDP A;  4CFQ A;  2KDH A;  1QIV A;  4MEW A;  1AHR A;  3D0Y A;  4GFT A;  1CM1 A;  3SG6 A;  1XK4 A;  2F33 A;  1KSO A;  1PVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...