4GUKA

New crystal form structure of human ncs1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
185
structure length
183
Chain Sequence
SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal calcium sensor 1
publication title new crystal form structure of human NCS1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 73
structure length 183
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA02
2LP3A 2ZN9A 1MHOA 1UHJA 1QVIY 3O4YA 3OB2B 1F55A 1GGZA 4E68A 4CLNA 1BR1B 1R2UA 2QACA 4PHJA 3I5HC 1B8RA 1TOPA 2L51A 2HPSA 1RJVA 1UUSA 1F8HA 1TN4A 2KI6D 1S6CA 2JOJA 4AQIA 1S6JA 1CFCA 1QV1A 2FCDA 1QX2A 1UURA 2JTZA 1WRZA 2NXQA 1OOJA 1UHHA 3KO0A 1XVJA 3DVMA 4NDDA 4PDZA 1BF5A 2BL0B 1WDCB 4HSZA 1JF0A 2WCBA 1L7ZA 3EK8A 1Q80A 5HKZA 2F33A 2HF5A 1OE9B 1KFXL 1C7WA 2L50A 1QJTA 1KWOC 1DVIA 3FWBA 4M2PA 1DT7B 2CTNA 4F0ZB 4TNCA 5CPVA 1Y1AA 2DOQA 3I5HB 2AMIA 1DJHA 1KFUL 1QV0A 2LVKA 2ZKMX 1G8IA 3PM8A 3PALA 2M49B 2MHHA 3DF0A 2CCMA 4I5JA 1NX2A 2BBNA 1BOCA 2KAVA 3CZTX 1PVAA 2D8NA 4USLA 2M97A 1ALWA 1B9AA 4GGFC 1CDMA 4JPZB 1KK7Z 1CLBA 1AJ4A 1CLLA 1JWDA 1CDNA 3IQQA 2I94A 3FS7A 2LHIA 3K21A 1ZUZA 2KI6C 1M63B 3ZWHA 1KWOB 1RK9A 2M7LA 3CR2A 1G4YR 1B7TY 2FCEA 1XO5A 1N65A 1W7IB 1DJXA 2I2RE 1EG3A 4YRUA 3GOFA 3LK1A 2ZNDA 1JBAA 4MZLA 4UPGA 2BKHB 1H8BA 1XK4C 1IRJA 1TNQA 5BPJA 2Q4UA 1L2OC 5CSJA 5J3XA 3SG4A 1J7OA 1MXLC 3AAJA 1LVCD 2V53A 1WLMA 5DKRA 1YRUB 4OKHA 1CMGA 1IGVA 2H2KA 1KSMA 3IF7A 3VGOA 4GAOA 1U5IA 5PALA 2F2OA 4OCIA 2F3YA 1RROA 2O60A 2LVJA 1SY9A 2VRGA 3CLNA 3I5IC 1B4CA 1JC2A 2KHNA 1WLZA 2KYFA 2Y1MA 3JVTB 1DJWA 1F4QA 1U5IB 3SIAA 1RECA 5JJGA 5HYDA 2PRUA 3HX4A 3SG2A 5KU1A 1K8UA 2F8PA 2K8MB 2ZRTA 4DS7A 1BJFA 1NCXA 2BCAA 1M31A 2KDHA 1BU3A 1A75A 1NSHA 1YUTA 4MVFA 2COLB 2HETA 2KFFA 1PSBA 3KPXA 1F54A 2ZN8A 3A4UB 4MLWA 5F6TA 1KCYA 2FOTA 2NCPA 2L0PA 3I5IB 2P6BB 1PRWA 2K61A 4ETOA 5JOLA 2CBLA 2NZ0A 2KNEA 2LUCA 1NUBA 2LP2A 1FF1A 3SJSA 1LXFC 2GV5A 2M29A 1DGVA 3EVVA 1SKTA 5AEQA 2MBXA 1ODBA 1CM1A 4ZCVA 4MN0A 1JFJA 2K0JA 3PFVA 4JWQA 1YTZC 1H4BA 1A4PA 1BR4B 4N1GA 1QLKA 4N5XA 1QATA 3CR5X 1EG4A 1QXPA 2B1UA 1NCZA 1XFXO 4YI9A 1OMRA 3BXKA 4R1EA 3RLZA 3KF9A 1DJIA 1KFUS 4ICBA 4CFQA 1WRKA 1LKJA 1LA0A 2R2IA 4BY5A 1E8AA 4I5LB 2M1UA 1LINA 1A2XA 1ALVA 1JF2A 1K93D 3D10A 4FTGA 2KQYA 4P5OE 4YBHB 5I8NA 2JQ6A 1GJYA 2EC6C 1K95A 1QIWA 1Y1UA 1YVLA 1S5GZ 4YGAA 5HLOA 1D1OA 2H61C 3OX6A 4GFTA 1KK7Y 1OZSA 1F70A 2BECA 2FJUB 2LM5A 4MBEA 4XJKA 4GBAA 4PHKA 5IBWA 1K9KA 3OP0A 1CFDA 2L2EA 1TIZA 2OPOA 5KSZA 1CM4A 1S1EA 1SCMC 4MRXA 1YVHA 1UWOA 4NDCA 4PE4A 3TDUA 2LVIA 5ER5A 1TNXA 2A4JA 1FW4A 1QX5B 4PE1A 1YUUA 2H61A 3GK2A 1CDPA 3GK1A 4M2OA 3EVUA 4U8DA 4XJKB 1CFFA 1B1GA 1QTXA 2LMVA 2L4HA 3LL8B 1QIVA 1IJ5A 2BCXA 2M8UA 2GGZA 1SR6C 4BY4A 1K2HA 5B8IB 3VRNA 1OMVA 2OTGC 1B8CA 1DF0A 1FI5A 1QASA 4P2YB 2G2BA 3EK4A 1AP4A 1OQPA 1EH2A 2CT9A 1XFYO 2LAPA 2WNDA 2NCOA 1GQMA 5K89A 1SCMB 1DF0B 1F4OA 3WXAA 4DIRA 2K7DA 1C07A 1Y0VH 4NDBA 1J7PA 1QVIZ 1K94A 1OMDA 1SK6D 2EHBA 4CFRA 2JNXA 2KOTA 2Y4QA 4GGFA 5AERA 2JT3A 2NLNA 2KFGA 4IL1A 1ZOTB 4JQ0D 4OVNF 2I7AA 2LUXA 1SRAA 2RGIA 4I5NB 1SR6B 1K96A 4WQ2A 2OTGB 4C0KA 2BE6A 2LLUA 3LLEA 2JTTA 3WNXB 1IWQA 1Y1XA 4C0LA 1PK0D 1EL4A 1QS7A 2MJWB 2E6WA 3BUMB 3KHEA 3TS5C 5ER4X 2Q91A 3NXAA 1OZOA 1J7RA 3FWCA 2AUCA 4C0JA 5CSFA 1XFWO 2BE4A 1N2DA 1XK4A 2F2PA 3CGAA 3SG5A 2LNKA 2JU0A 3BOWA 2TN4A 2MAZA 4D1EA 3AKBA 1S3PA 2K7OA 5AXIA 1DTLA 1KQMC 1L2OB 1YURA 2LLSA 1TTXA 1V1FA 2QPTA 2OS8C 1X02A 3BOWB 1RWYA 1XA5A 2JPTA 3PN7C 1PVBA 4GUKA 3TS5B 2KGBC 2JULA 2KYCA 3VROA 1WY9A 5AANA 1CB1A 1AJ5A 3SG6A 1DJGA 1W7JB 3D0YA 1XFUO 2M3WA 4QJ5B 4PE0A 2JXCA 3I5GC 1CFPA 5GQQC 3RM1A 1B47A 3CS1A 3CR4X 3BUOB 1YR5A 4MZKA 5I2LA 1BLQA 1NX3A 1B7TZ 1CDLA 4HREE 4YGBB 4M2QA 5HKYA 2L4IA 2EGDA 3D0YB 4A4BA 1KQMB 3BUNB 3SIBA 4QJ4B 1IKUA 2ZRSA 1YX7A 1ZMZA 3EKHA 5G08A 2OS8B 1NPQA 1LA3A 1AHRA 3PN7B 2M9GA 5DKNA 2K7CA 5CSNA 2IS9A 2JT8A 2M0RA 3I5FC 3KEVA 1A29A 5D69A 4MSPA 2ZNEA 1B8LA 1K90D 5D7FA 5HKWA 3SG3A 3I5GB 1SMGA 1QX7A 4Q04A 3FIAA 3A8RA 3C1VA 4I5KA 2JT0A 3TUYC 1PULA 4GPLB 1CNPA 2JWWA 1M45A 1BMOA 5HLVA 3BUXB 1XFVO 1R6PA 1NCYA 3NSIA 4WQ3A 4YI8A 3CTNA 5FYXA 2E30A 3NSLA 2BCBA 2ISDA 1RTP1 2G9BA 1DGUA 1K9PA 3DD4A 3H4SE 4MZJA 4PCWA 1VRKA 1ZACA 2KI4C 3I5FB 1IG5A 1CLMA 1J1DA 1JUOA 2MLEC 2LHLA 5I2OA 2WOSA 1C7VA 3O78A 1Y6WA 3GK4X 2JZIA 2PMYA 2Y5IA 4NQGA 2LLTA 1KQVA 3EK7A 4A4CA 2HQWA 2JC2A 4XYNA 3JTDC 3WHUB 2M1KB 3AKAA 3TUYB 2EC6B 1SL8A 4ORBB 4GGNA 3O2PA 4FQOA 2KBIA 3IQOA 1BT6A 1KSOA 1K9UA 1FI6A 1SYMA 2KI4B 4ORAB 1AK8A 4L9MA 1J55A 1IH0A 5KTYA 1JFKA 1MQ1A 3NSOA 2PVBA 3OX5A 4DRWA 3M0WA 1YRTB 1PALA 4PHNA 1A03A 1SCVA 2ZFDA 4ZCUA 3OB1B 2K2FA 3ICBA 3JTDB 5DKQA 3BQ3A 1V1GA 1J7QA 4YGCB 1DMOA 3PSRA 3TDIA 4N1FA 1S36A 4WRIA 1RFJA 2LMUA 2SCPA 3DVKA 4CPVA 2MA2A 1PSRA 1MR8A 3HCMA 2L98A 3DF0B 2LMTA 3DVEA 1SW8A 1XYDA 1UHKA 2JRFA 2KBMA 4DUQA 2LANA 1WRLA 2CNPA 2K2AA 1G33A 3LK0A 3JVTC 1BODA 3AAKA 5AFPA 2LE9B 1IJ6A 1CKKA 3NSKA 4OV2A 3CWGA 3TZ1A 2L5XB 2LCPA 3DVJA 3PLFB 3PATA 3BUWB 1IQ5A 1NX0A 4CIDA 3QRXA 2O5GA 1TCOB 1JSAA 1HQVA 2M7NA 3EVRA 3EKJA 1SL7A 3SG7A 1KK8C 1AVSA 2F3ZA 3VRPA 3ZNIA 1NYAA 2K7BA 1HT9A 4PALA 2WC8A 3E3RA 2KQ6A 4HRHA 2JXLA 1EXRA 1YX8A 3OHMB 4PE7A 3VRQA 1TNPA 5TNCA 1CMFA 2AAOA 2KAXA 1DJZA 1NP8A 1TCFA 1FPWA 2MRDA 3VRRA 2LV7A 1AUIB 1QLSA 1SBJA 2HQ8A 2Y1NA 1M46A 1S5GY 1XFZO 2KAYA 1SNLA 1MUXA 2KSPA 2GGMA 2PALA 3BYAA 1NIWA 2WCEA 2KGRA 1IQ3A 2BKIB 1KK8B 1DJYA 1UP5A 4OR9B 4MEWA 1NWDA 2I18A 1UHIA 1M39A 4PHMA 3O6BA 1CTRA 4QJ3B 1YUSA 3LCPC 2MLFC 1A75B 1S26D 1TNWA 1OSAA 2KFHA 1BG1A 2LC5A 2LVVA 1MF8B 1SPYA 1J1EA 3F45A 1UHNA 1ZFSA 1EJ3A 2SASA 1N0YA 5I2QA 4HRGA 3MSEB 1F71A 5CSIA 2PASA 1KFXS 2CXJA 3TDZA 4MRYA 2WCFA 1MWNA 1FBVA 2WORA 1GGWA 1MXEA 4AOMA 1NX1A 4YGEB 4GNKB 1TRFA 1S6IA 2BL0C 1WDCC 2PSRA 4ORCB 4DCKA 4AQJA 3WHTB 2BBMA 1SL9A 4YGDB 2JNFA
chains in the Genus database with same CATH superfamily
2LP3A 3S0AA 2ZN9A 1MHOA 1UHJA 1QVIY 3O4YA 2WCHA 3OB2B 1F55A 1GGZA 4E68A 4CLNA 1BR1B 1R2UA 2QACA 4PHJA 3I5HC 1B8RA 1TOPA 2L51A 2HPSA 3CZ2A 1RJVA 1UUSA 1F8HA 1TN4A 2KI6D 1S6CA 2JOJA 3FE9A 1S6JA 4AQIA 3R1PA 1CFCA 1QV1A 2FCDA 3D77A 1QX2A 3DYEA 1UURA 2JTZA 1WRZA 2NXQA 2PYQA 3NHIA 1OOJA 1UHHA 3L47A 3KO0A 1XVJA 3DVMA 4NDDA 4PDZA 1BF5A 2BL0B 1WDCB 4HSZA 1JF0A 2WCKA 2WCBA 1L7ZA 3EK8A 1Q80A 5HKZA 2F33A 2HF5A 1OE9B 2ERBA 1KFXL 1C7WA 2L50A 1QJTA 1KWOC 1DVIA 3FWBA 4M2PA 3R72A 1DT7B 2CTNA 4F0ZB 4TNCA 5CPVA 1Y1AA 2DOQA 3I5HB 2AMIA 1DJHA 1KFUL 1QV0A 2LVKA 2ZKMX 1G8IA 3PM8A 3PALA 2M49B 2MHHA 3DF0A 2CCMA 4I5JA 1NX2A 2BBNA 1BOCA 2KAVA 3CZTX 5HL1A 1PVAA 2D8NA 4USLA 2M97A 3CYZA 1ALWA 1B9AA 4GGFC 1CDMA 4JPZB 1KK7Z 2L2CA 1CLBA 1AJ4A 1CLLA 1JWDA 1CDNA 3IQQA 2I94A 1LS8A 2LHIA 3FS7A 1GM0A 3K21A 1ZUZA 2KI6C 1M63B 3FE8A 1DEKA 3ZWHA 1KWOB 1RK9A 2M7LA 3B6XA 1G4YR 3CR2A 1B7TY 2FCEA 1XO5A 1N65A 1W7IB 1DJXA 2I2RE 1EG3A 4YRUA 3GOFA 3LK1A 2ZNDA 1JBAA 4MZLA 4UPGA 2BKHB 1H8BA 1XK4C 1IRJA 1TNQA 5BPJA 2Q4UA 1L2OC 5CSJA 5J3XA 3SG4A 1J7OA 1MXLC 3AAJA 1LVCD 2V53A 1WLMA 5DKRA 1YRUB 4OKHA 1CMGA 1IGVA 2H2KA 1KSMA 3IF7A 3VGOA 4GAOA 3SS5A 1U5IA 5PALA 2F2OA 4OCIA 2F3YA 1RROA 2O60A 2LVJA 1SY9A 2VRGA 3CLNA 3I5IC 1B4CA 1JC2A 2KHNA 1WLZA 2KYFA 3DY9A 2Y1MA 2QEHA 3JVTB 1DJWA 1F4QA 1U5IB 3SIAA 1RECA 5JJGA 5HYDA 2PRUA 3HX4A 3SG2A 5KU1A 1K8UA 2F8PA 2K8MB 2WCLA 2ZRTA 4DS7A 1BJFA 4FQTA 1NCXA 2BCAA 1M31A 2KDHA 3R1VA 3OBVA 4F7FA 1BU3A 1A75A 1NSHA 1YUTA 4MVFA 2COLB 2HETA 2KFFA 1PSBA 3KPXA 1F54A 2ZN8A 3A4UB 4MLWA 5F6TA 1KCYA 2FOTA 2NCPA 2L0PA 3I5IB 2P6BB 1PRWA 3D78A 2K61A 4ETOA 5JOLA 3Q8IA 1DC1A 2CBLA 2NZ0A 2KNEA 2LUCA 1NUBA 2LP2A 3DZTA 1FF1A 3SJSA 1LXFC 2GV5A 2M29A 2WC6A 3RZSA 1DGVA 3EVVA 1SKTA 5AEQA 2BNXA 1ODBA 2MBXA 1CM1A 3BJHA 4ZCVA 4MN0A 1JFJA 2K0JA 3PFVA 4JWQA 1YTZC 3BFBA 1A4PA 1H4BA 1BR4B 4N1GA 1QLKA 4N5XA 2KPHA 1DQEA 1W9ZA 1QATA 3CR5X 2KLDA 1TUZA 1EG4A 1QXPA 2B1UA 1NCZA 1XFXO 2FJYA 2K60A 4YI9A 1OMRA 3BXKA 2QDIA 4R1EA 3RLZA 3KF9A 3OGNA 1DJIA 3PM2A 1KFUS 4ICBA 3SS3A 4CFQA 5DICA 1WRKA 1LKJA 1LA0A 2R2IA 4BY5A 1TWOA 1E8AA 4I5LB 2QEVA 2M1UA 1LINA 1A2XA 1ALVA 1JF2A 1K93D 3D10A 4FTGA 2KQYA 4P5OE 4YBHB 5I8NA 3S0BA 2JQ6A 1GJYA 2EC6C 1K95A 1QIWA 1Y1UA 1YVLA 1S5GZ 4YGAA 5HLOA 1D1OA 2H61C 3OX6A 4GFTA 1KK7Y 1OZSA 3BFHA 1F70A 2BECA 2FJUB 2LM5A 2YGUA 4MBEA 4GBAA 4PHKA 4XJKA 1K9KA 5D3OA 3OP0A 3UNWA 5IBWA 1CFDA 2L2EA 1TIZA 2OPOA 5KSZA 1CM4A 1S1EA 3CDNA 1XFRA 1SCMC 4MRXA 1YVHA 1UWOA 4NDCA 4PE4A 3TDUA 2LVIA 5ER5A 1TNXA 2A4JA 1FW4A 1QX5B 4PE1A 1YUUA 2H61A 3GK2A 1CDPA 3GK1A 4M2OA 3EVUA 4U8DA 4XJKB 3IVTA 1CFFA 1B1GA 1QTXA 2LMVA 2L4HA 3LL8B 1QIVA 1IJ5A 2BCXA 2M8UA 2GGZA 1SR6C 4BY4A 1K2HA 5B8IB 3VRNA 1OMVA 2OTGC 1B8CA 1DF0A 1FI5A 1QASA 4P2YB 2G2BA 3EK4A 1AP4A 1OQPA 1EH2A 2CT9A 1XFYO 2LAPA 2WNDA 2NCOA 2H8VA 1GQMA 5K89A 1Z4HA 5I94A 1SCMB 3NGVA 1DF0B 1F4OA 3WXAA 4DIRA 2K7DA 1C07A 1Y0VH 2GTEA 4NDBA 1J7PA 1QVIZ 3CZ1A 1K94A 1OMDA 1SK6D 2EHBA 4CFRA 2JNXA 1OOHA 2KOTA 2Y4QA 4GGFA 5AERA 2JT3A 2NLNA 2KFGA 4IL1A 1ZOTB 4JQ0D 4OVNF 2I7AA 2LUXA 1SRAA 4IJ7A 3D75A 2RGIA 4I5NB 1SR6B 1K96A 4WQ2A 2OTGB 4C0KA 3EG5B 2BE6A 2LLUA 3LLEA 2JTTA 3WNXB 1IWQA 3BFAA 1Y1XA 4C0LA 1PK0D 1EL4A 1QS7A 2MJWB 2E6WA 3BUMB 3KHEA 3TS5C 5ER4X 2Q91A 3NXAA 1OZOA 1J7RA 3FWCA 1T14A 2AUCA 2P71A 5CSFA 1XFWO 2BE4A 5FI7A 4C0JA 1N2DA 1XK4A 1Z2CB 2F2PA 3CGAA 2LNKA 3SG5A 2WCMA 2JU0A 3BOWA 2TN4A 2MAZA 4D1EA 3AKBA 1S3PA 4KYNA 2K7OA 5AXIA 1DTLA 1KQMC 1L2OB 1YURA 2LLSA 1TTXA 1V1FA 2QPTA 2OS8C 1X02A 3BOWB 1RWYA 1XA5A 2JPTA 3PN7C 1PVBA 4GUKA 3B88A 3S0DA 3TS5B 2KGBC 2JULA 2KYCA 5FI6A 3VROA 1OOFA 1WY9A 5AANA 4JKTA 1CB1A 1AJ5A 3D76A 3SG6A 1DJGA 1W7JB 3S0FA 3D0YA 1XFUO 2M3WA 4QJ5B 4PE0A 2JXCA 3I5GC 1P28A 1CFPA 5GQQC 3RM1A 1B47A 3CS1A 3CR4X 3BUOB 1YR5A 4MZKA 5I2LA 1BLQA 1NX3A 1B7TZ 2QEBA 1CDLA 3NHTA 4HREE 4YGBB 4INXA 4M2QA 5HKYA 2L4IA 2EGDA 3D0YB 4A4BA 1KQMB 3BUNB 3SIBA 4QJ4B 1IKUA 4PT1A 2ZRSA 1YX7A 1ZMZA 3EKHA 5G08A 2OS8B 1NPQA 1LA3A 1AHRA 3PN7B 2M9GA 5DKNA 2K7CA 5CSNA 2IS9A 2JT8A 2M0RA 3I5FC 3KEVA 1A29A 5D69A 4MSPA 2ZNEA 1B8LA 1K90D 3CZ0A 5D7FA 5HKWA 3SG3A 3I5GB 1SMGA 1QX7A 4Q04A 1OOIX 3A8RA 3C1VA 3FIAA 4I5KA 3WHUB 3B87A 2JT0A 3TUYC 2P70A 2JPOA 1PULA 4GPLB 1CNPA 1DELA 2JWWA 1M45A 1BMOA 5HLVA 3UO9A 3BUXB 1XFVO 1R6PA 1NCYA 3NSIA 2WC5A 4WQ3A 4YI8A 3K1EA 3CTNA 5FYXA 2E30A 3FE6A 3NSLA 2BCBA 2ISDA 1RTP1 2G9BA 1DGUA 1K9PA 3DD4A 3H4SE 4MZJA 4OZDA 4PCWA 1VRKA 1ZACA 2KI4C 3I5FB 1IG5A 1CLMA 1J1DA 1JUOA 2MLEC 2LHLA 1QWVA 3N7HA 5I2OA 2WOSA 1C7VA 2L5YA 3O78A 1Y6WA 3GK4X 2JZIA 2PMYA 2Y5IA 4NQGA 3B7AA 2LLTA 1KQVA 3EK7A 4A4CA 1OOGA 2HQWA 2JC2A 3JTDC 3L4AA 4XYNA 2M1KB 3AKAA 5FI2A 3TUYB 2EC6B 3V2LA 1SL8A 4ORBB 4GGNA 3O2PA 4FQOA 2KBIA 3IQOA 1BT6A 1KSOA 1K9UA 1FI6A 1SYMA 2KI4B 4ORAB 1AK8A 1C3YA 4L9MA 2QEOA 1J55A 1IH0A 5KTYA 1JFKA 1MQ1A 3NSOA 2PVBA 3OX5A 4DRWA 2KLEA 2PQLA 3M0WA 1YRTB 1PALA 4PHNA 3S0GA 1A03A 1SSEB 1SCVA 2ZFDA 4ZCUA 3OB1B 2K2FA 3ICBA 3JTDB 3L4LA 5DKQA 3VB1A 3BQ3A 1V1GA 1J7QA 3DXLA 4YGCB 1ORGA 1DMOA 5EL2A 3PSRA 3TDIA 3B86A 1S36A 4N1FA 4WRIA 1RFJA 2LMUA 2SCPA 3DVKA 4CPVA 2MA2A 4INWA 1PSRA 1MR8A 3HCMA 2L98A 3DF0B 2LMTA 3DVEA 1SW8A 1XYDA 1UHKA 2JRFA 2KBMA 4DUQA 2LANA 1WRLA 2CNPA 2K2AA 1G33A 3LK0A 3JVTC 1BODA 3AAKA 5AFPA 2LE9B 1IJ6A 1CKKA 3NSKA 4OV2A 3CWGA 3TZ1A 2L5XB 2LCPA 2WCJA 3DVJA 3PLFB 3PATA 3BUWB 1IQ5A 1NX0A 3D74A 4CIDA 3QRXA 2O5GA 1TCOB 1JSAA 1HQVA 2M7NA 3EVRA 3EKJA 1SL7A 3SG7A 1KK8C 1AVSA 2F3ZA 3VRPA 3ZNIA 1NYAA 2K7BA 1HT9A 4PALA 2WC8A 3E3RA 1TUJA 2KQ6A 4HRHA 2JXLA 1EXRA 1YX8A 3OHMB 4PE7A 3VRQA 1TNPA 5TNCA 1CMFA 2AAOA 3SS4A 2KAXA 1DJZA 1NP8A 1TCFA 1FPWA 2MRDA 3VRRA 2LV7A 1AUIB 1QLSA 1IIOA 1SBJA 2HQ8A 2Y1NA 1M46A 1S5GY 1XFZO 2KAYA 1SNLA 1MUXA 2KSPA 2GGMA 2PALA 3BYAA 1NIWA 2WCEA 2KGRA 3PJIA 1IQ3A 3QMEA 1KK8B 2BKIB 1DJYA 1UP5A 4OR9B 3S0EA 4MEWA 1NWDA 2I18A 1OW4A 1UHIA 1M39A 4PHMA 3O6BA 1CTRA 3D73A 4JD9A 1YUSA 3LCPC 3R1OA 4QJ3B 2MLFC 1A75B 1S26D 1TNWA 1OSAA 2KFHA 1BG1A 2LC5A 2LVVA 1MF8B 1SPYA 1J1EA 3F45A 1UHNA 1ZFSA 1EJ3A 2SASA 2BAPA 1N0YA 5I2QA 4HRGA 3MSEB 3O4XA 1F71A 5CSIA 2PASA 3CABA 1KFXS 2CXJA 3TDZA 4MRYA 2WCFA 1MWNA 1FBVA 2WORA 1GGWA 1MXEA 4AOMA 1NX1A 4YGEB 4GNKB 1C3ZA 1TRFA 1S6IA 2BL0C 1WDCC 2PSRA 4ORCB 4DCKA 4AQJA 3WHTB 2BBMA 1SL9A 4YGDB 2JNFA
chains in the Genus database with same CATH topology
2LP3A 2ZN9A 1MHOA 1UHJA 1QVIY 3O4YA 3OB2B 1F55A 1GGZA 4E68A 4CLNA 1BR1B 1R2UA 2QACA 4PHJA 3I5HC 1B8RA 1TOPA 2L51A 2HPSA 1RJVA 1UUSA 1F8HA 1TN4A 2KI6D 1S6CA 2JOJA 4AQIA 1S6JA 1CFCA 1QV1A 2FCDA 1QX2A 1UURA 2JTZA 1WRZA 2NXQA 1OOJA 1UHHA 3KO0A 1XVJA 3DVMA 4NDDA 4PDZA 1BF5A 2BL0B 1WDCB 4HSZA 1JF0A 2WCBA 1L7ZA 3EK8A 1Q80A 5HKZA 2F33A 2HF5A 1OE9B 1KFXL 1C7WA 2L50A 1QJTA 1KWOC 1DVIA 3FWBA 4M2PA 1DT7B 2CTNA 4F0ZB 4TNCA 5CPVA 1Y1AA 2DOQA 3I5HB 2AMIA 1DJHA 1KFUL 1QV0A 2LVKA 2ZKMX 1G8IA 3PM8A 3PALA 2M49B 2MHHA 3DF0A 2CCMA 4I5JA 1NX2A 2BBNA 1BOCA 2KAVA 3CZTX 1PVAA 2D8NA 4USLA 2M97A 1ALWA 1B9AA 4GGFC 1CDMA 4JPZB 1KK7Z 1CLBA 1AJ4A 1CLLA 1JWDA 1CDNA 3IQQA 2I94A 3FS7A 2LHIA 3K21A 1ZUZA 2KI6C 1M63B 3ZWHA 1KWOB 1RK9A 2M7LA 3CR2A 1G4YR 1B7TY 2FCEA 1XO5A 1N65A 1W7IB 1DJXA 2I2RE 1EG3A 4YRUA 3GOFA 3LK1A 2ZNDA 1JBAA 4MZLA 4UPGA 2BKHB 1H8BA 1XK4C 1IRJA 1TNQA 5BPJA 2Q4UA 1L2OC 5CSJA 5J3XA 3SG4A 1J7OA 1MXLC 3AAJA 1LVCD 2V53A 1WLMA 5DKRA 1YRUB 4OKHA 1CMGA 1IGVA 2H2KA 1KSMA 3IF7A 3VGOA 4GAOA 1U5IA 5PALA 2F2OA 4OCIA 2F3YA 1RROA 2O60A 2LVJA 1SY9A 2VRGA 3CLNA 3I5IC 1B4CA 1JC2A 2KHNA 1WLZA 2KYFA 2Y1MA 3JVTB 1DJWA 1F4QA 1U5IB 3SIAA 1RECA 5JJGA 5HYDA 2PRUA 3HX4A 3SG2A 5KU1A 1K8UA 2F8PA 2K8MB 2ZRTA 4DS7A 1BJFA 1NCXA 2BCAA 1M31A 2KDHA 1BU3A 1A75A 1NSHA 1YUTA 4MVFA 2COLB 2HETA 2KFFA 1PSBA 3KPXA 1F54A 2ZN8A 3A4UB 4MLWA 5F6TA 1KCYA 2FOTA 2NCPA 2L0PA 3I5IB 2P6BB 1PRWA 2K61A 4ETOA 5JOLA 2CBLA 2NZ0A 2KNEA 2LUCA 1NUBA 2LP2A 1FF1A 3SJSA 1LXFC 2GV5A 2M29A 1DGVA 3EVVA 1SKTA 5AEQA 2MBXA 1ODBA 1CM1A 4ZCVA 4MN0A 1JFJA 2K0JA 3PFVA 4JWQA 1YTZC 1H4BA 1A4PA 1BR4B 4N1GA 1QLKA 4N5XA 1QATA 3CR5X 1EG4A 1QXPA 2B1UA 1NCZA 1XFXO 4YI9A 1OMRA 3BXKA 4R1EA 3RLZA 3KF9A 1DJIA 1KFUS 4ICBA 4CFQA 1WRKA 1LKJA 1LA0A 2R2IA 4BY5A 1E8AA 4I5LB 2M1UA 1LINA 1A2XA 1ALVA 1JF2A 1K93D 3D10A 4FTGA 2KQYA 4P5OE 4YBHB 5I8NA 2JQ6A 1GJYA 2EC6C 1K95A 1QIWA 1Y1UA 1YVLA 1S5GZ 4YGAA 5HLOA 1D1OA 2H61C 3OX6A 4GFTA 1KK7Y 1OZSA 1F70A 2BECA 2FJUB 2LM5A 4MBEA 4XJKA 4GBAA 4PHKA 5IBWA 1K9KA 3OP0A 1CFDA 2L2EA 1TIZA 2OPOA 5KSZA 1CM4A 1S1EA 1SCMC 4MRXA 1YVHA 1UWOA 4NDCA 4PE4A 3TDUA 2LVIA 5ER5A 1TNXA 2A4JA 1FW4A 1QX5B 4PE1A 1YUUA 2H61A 3GK2A 1CDPA 3GK1A 4M2OA 3EVUA 4U8DA 4XJKB 1CFFA 1B1GA 1QTXA 2LMVA 2L4HA 3LL8B 1QIVA 1IJ5A 2BCXA 2M8UA 2GGZA 1SR6C 4BY4A 1K2HA 5B8IB 3VRNA 1OMVA 2OTGC 1B8CA 1DF0A 1FI5A 1QASA 4P2YB 2G2BA 3EK4A 1AP4A 1OQPA 1EH2A 2CT9A 1XFYO 2LAPA 2WNDA 2NCOA 1GQMA 5K89A 1SCMB 1DF0B 1F4OA 3WXAA 4DIRA 2K7DA 1C07A 1Y0VH 4NDBA 1J7PA 1QVIZ 1K94A 1OMDA 1SK6D 2EHBA 4CFRA 2JNXA 2KOTA 2Y4QA 4GGFA 5AERA 2JT3A 2NLNA 2KFGA 4IL1A 1ZOTB 4JQ0D 4OVNF 2I7AA 2LUXA 1SRAA 2RGIA 4I5NB 1SR6B 1K96A 4WQ2A 2OTGB 4C0KA 2BE6A 2LLUA 3LLEA 2JTTA 3WNXB 1IWQA 1Y1XA 4C0LA 1PK0D 1EL4A 1QS7A 2MJWB 2E6WA 3BUMB 3KHEA 3TS5C 5ER4X 2Q91A 3NXAA 1OZOA 1J7RA 3FWCA 2AUCA 4C0JA 5CSFA 1XFWO 2BE4A 1N2DA 1XK4A 2F2PA 3CGAA 3SG5A 2LNKA 2JU0A 3BOWA 2TN4A 2MAZA 4D1EA 3AKBA 1S3PA 2K7OA 5AXIA 1DTLA 1KQMC 1L2OB 1YURA 2LLSA 1TTXA 1V1FA 2QPTA 2OS8C 1X02A 3BOWB 1RWYA 1XA5A 2JPTA 3PN7C 1PVBA 4GUKA 3TS5B 2KGBC 2JULA 2KYCA 3VROA 1WY9A 5AANA 1CB1A 1AJ5A 3SG6A 1DJGA 1W7JB 3D0YA 1XFUO 2M3WA 4QJ5B 4PE0A 2JXCA 3I5GC 1CFPA 5GQQC 3RM1A 1B47A 3CS1A 3CR4X 3BUOB 1YR5A 4MZKA 5I2LA 1BLQA 1NX3A 1B7TZ 1CDLA 4HREE 4YGBB 4M2QA 5HKYA 2L4IA 2EGDA 3D0YB 4A4BA 1KQMB 3BUNB 3SIBA 4QJ4B 1IKUA 2ZRSA 1YX7A 1ZMZA 3EKHA 5G08A 2OS8B 1NPQA 1LA3A 1AHRA 3PN7B 2M9GA 5DKNA 2K7CA 5CSNA 2IS9A 2JT8A 2M0RA 3I5FC 3KEVA 1A29A 5D69A 4MSPA 2ZNEA 1B8LA 1K90D 5D7FA 5HKWA 3SG3A 3I5GB 1SMGA 1QX7A 4Q04A 3FIAA 3A8RA 3C1VA 4I5KA 2JT0A 3TUYC 1PULA 4GPLB 1CNPA 2JWWA 1M45A 1BMOA 5HLVA 3BUXB 1XFVO 1R6PA 1NCYA 3NSIA 4WQ3A 4YI8A 3CTNA 5FYXA 2E30A 3NSLA 2BCBA 2ISDA 1RTP1 2G9BA 1DGUA 1K9PA 3DD4A 3H4SE 4MZJA 4PCWA 1VRKA 1ZACA 2KI4C 3I5FB 1IG5A 1CLMA 1J1DA 1JUOA 2MLEC 2LHLA 5I2OA 2WOSA 1C7VA 3O78A 1Y6WA 3GK4X 2JZIA 2PMYA 2Y5IA 4NQGA 2LLTA 1KQVA 3EK7A 4A4CA 2HQWA 2JC2A 4XYNA 3JTDC 3WHUB 2M1KB 3AKAA 3TUYB 2EC6B 1SL8A 4ORBB 4GGNA 3O2PA 4FQOA 2KBIA 3IQOA 1BT6A 1KSOA 1K9UA 1FI6A 1SYMA 2KI4B 4ORAB 1AK8A 4L9MA 1J55A 1IH0A 5KTYA 1JFKA 1MQ1A 3NSOA 2PVBA 3OX5A 4DRWA 3M0WA 1YRTB 1PALA 4PHNA 1A03A 1SCVA 2ZFDA 4ZCUA 3OB1B 2K2FA 3ICBA 3JTDB 5DKQA 3BQ3A 1V1GA 1J7QA 4YGCB 1DMOA 3PSRA 3TDIA 4N1FA 1S36A 4WRIA 1RFJA 2LMUA 2SCPA 3DVKA 4CPVA 2MA2A 1PSRA 1MR8A 3HCMA 2L98A 3DF0B 2LMTA 3DVEA 1SW8A 1XYDA 1UHKA 2JRFA 2KBMA 4DUQA 2LANA 1WRLA 2CNPA 2K2AA 1G33A 3LK0A 3JVTC 1BODA 3AAKA 5AFPA 2LE9B 1IJ6A 1CKKA 3NSKA 4OV2A 3CWGA 3TZ1A 2L5XB 2LCPA 3DVJA 3PLFB 3PATA 3BUWB 1IQ5A 1NX0A 4CIDA 3QRXA 2O5GA 1TCOB 1JSAA 1HQVA 2M7NA 3EVRA 3EKJA 1SL7A 3SG7A 1KK8C 1AVSA 2F3ZA 3VRPA 3ZNIA 1NYAA 2K7BA 1HT9A 4PALA 2WC8A 3E3RA 2KQ6A 4HRHA 2JXLA 1EXRA 1YX8A 3OHMB 4PE7A 3VRQA 1TNPA 5TNCA 1CMFA 2AAOA 2KAXA 1DJZA 1NP8A 1TCFA 1FPWA 2MRDA 3VRRA 2LV7A 1AUIB 1QLSA 1SBJA 2HQ8A 2Y1NA 1M46A 1S5GY 1XFZO 2KAYA 1SNLA 1MUXA 2KSPA 2GGMA 2PALA 3BYAA 1NIWA 2WCEA 2KGRA 1IQ3A 2BKIB 1KK8B 1DJYA 1UP5A 4OR9B 4MEWA 1NWDA 2I18A 1UHIA 1M39A 4PHMA 3O6BA 1CTRA 4QJ3B 1YUSA 3LCPC 2MLFC 1A75B 1S26D 1TNWA 1OSAA 2KFHA 1BG1A 2LC5A 2LVVA 1MF8B 1SPYA 1J1EA 3F45A 1UHNA 1ZFSA 1EJ3A 2SASA 1N0YA 5I2QA 4HRGA 3MSEB 1F71A 5CSIA 2PASA 1KFXS 2CXJA 3TDZA 4MRYA 2WCFA 1MWNA 1FBVA 2WORA 1GGWA 1MXEA 4AOMA 1NX1A 4YGEB 4GNKB 1TRFA 1S6IA 2BL0C 1WDCC 2PSRA 4ORCB 4DCKA 4AQJA 3WHTB 2BBMA 1SL9A 4YGDB 2JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP3 A;  2ZN9 A;  1MHO A;  1UHJ A;  1QVI Y;  3O4Y A;  3OB2 B;  1F55 A;  1GGZ A;  4E68 A;  4CLN A;  1BR1 B;  1R2U A;  2QAC A;  4PHJ A;  3I5H C;  1B8R A;  1TOP A;  2L51 A;  2HPS A;  1RJV A;  1UUS A;  1F8H A;  1TN4 A;  2KI6 D;  1S6C A;  2JOJ A;  4AQI A;  1S6J A;  1CFC A;  1QV1 A;  2FCD A;  1QX2 A;  1UUR A;  2JTZ A;  1WRZ A;  2NXQ A;  1OOJ A;  1UHH A;  3KO0 A;  1XVJ A;  3DVM A;  4NDD A;  4PDZ A;  1BF5 A;  2BL0 B;  1WDC B;  4HSZ A;  1JF0 A;  2WCB A;  1L7Z A;  3EK8 A;  1Q80 A;  5HKZ A;  2F33 A;  2HF5 A;  1OE9 B;  1KFX L;  1C7W A;  2L50 A;  1QJT A;  1KWO C;  1DVI A;  3FWB A;  4M2P A;  1DT7 B;  2CTN A;  4F0Z B;  4TNC A;  5CPV A;  1Y1A A;  2DOQ A;  3I5H B;  2AMI A;  1DJH A;  1KFU L;  1QV0 A;  2LVK A;  2ZKM X;  1G8I A;  3PM8 A;  3PAL A;  2M49 B;  2MHH A;  3DF0 A;  2CCM A;  4I5J A;  1NX2 A;  2BBN A;  1BOC A;  2KAV A;  3CZT X;  1PVA A;  2D8N A;  4USL A;  2M97 A;  1ALW A;  1B9A A;  4GGF C;  1CDM A;  4JPZ B;  1KK7 Z;  1CLB A;  1AJ4 A;  1CLL A;  1JWD A;  1CDN A;  3IQQ A;  2I94 A;  3FS7 A;  2LHI A;  3K21 A;  1ZUZ A;  2KI6 C;  1M63 B;  3ZWH A;  1KWO B;  1RK9 A;  2M7L A;  3CR2 A;  1G4Y R;  1B7T Y;  2FCE A;  1XO5 A;  1N65 A;  1W7I B;  1DJX A;  2I2R E;  1EG3 A;  4YRU A;  3GOF A;  3LK1 A;  2ZND A;  1JBA A;  4MZL A;  4UPG A;  2BKH B;  1H8B A;  1XK4 C;  1IRJ A;  1TNQ A;  5BPJ A;  2Q4U A;  1L2O C;  5CSJ A;  5J3X A;  3SG4 A;  1J7O A;  1MXL C;  3AAJ A;  1LVC D;  2V53 A;  1WLM A;  5DKR A;  1YRU B;  4OKH A;  1CMG A;  1IGV A;  2H2K A;  1KSM A;  3IF7 A;  3VGO A;  4GAO A;  1U5I A;  5PAL A;  2F2O A;  4OCI A;  2F3Y A;  1RRO A;  2O60 A;  2LVJ A;  1SY9 A;  2VRG A;  3CLN A;  3I5I C;  1B4C A;  1JC2 A;  2KHN A;  1WLZ A;  2KYF A;  2Y1M A;  3JVT B;  1DJW A;  1F4Q A;  1U5I B;  3SIA A;  1REC A;  5JJG A;  5HYD A;  2PRU A;  3HX4 A;  3SG2 A;  5KU1 A;  1K8U A;  2F8P A;  2K8M B;  2ZRT A;  4DS7 A;  1BJF A;  1NCX A;  2BCA A;  1M31 A;  2KDH A;  1BU3 A;  1A75 A;  1NSH A;  1YUT A;  4MVF A;  2COL B;  2HET A;  2KFF A;  1PSB A;  3KPX A;  1F54 A;  2ZN8 A;  3A4U B;  4MLW A;  5F6T A;  1KCY A;  2FOT A;  2NCP A;  2L0P A;  3I5I B;  2P6B B;  1PRW A;  2K61 A;  4ETO A;  5JOL A;  2CBL A;  2NZ0 A;  2KNE A;  2LUC A;  1NUB A;  2LP2 A;  1FF1 A;  3SJS A;  1LXF C;  2GV5 A;  2M29 A;  1DGV A;  3EVV A;  1SKT A;  5AEQ A;  2MBX A;  1ODB A;  1CM1 A;  4ZCV A;  4MN0 A;  1JFJ A;  2K0J A;  3PFV A;  4JWQ A;  1YTZ C;  1H4B A;  1A4P A;  1BR4 B;  4N1G A;  1QLK A;  4N5X A;  1QAT A;  3CR5 X;  1EG4 A;  1QXP A;  2B1U A;  1NCZ A;  1XFX O;  4YI9 A;  1OMR A;  3BXK A;  4R1E A;  3RLZ A;  3KF9 A;  1DJI A;  1KFU S;  4ICB A;  4CFQ A;  1WRK A;  1LKJ A;  1LA0 A;  2R2I A;  4BY5 A;  1E8A A;  4I5L B;  2M1U A;  1LIN A;  1A2X A;  1ALV A;  1JF2 A;  1K93 D;  3D10 A;  4FTG A;  2KQY A;  4P5O E;  4YBH B;  5I8N A;  2JQ6 A;  1GJY A;  2EC6 C;  1K95 A;  1QIW A;  1Y1U A;  1YVL A;  1S5G Z;  4YGA A;  5HLO A;  1D1O A;  2H61 C;  3OX6 A;  4GFT A;  1KK7 Y;  1OZS A;  1F70 A;  2BEC A;  2FJU B;  2LM5 A;  4MBE A;  4XJK A;  4GBA A;  4PHK A;  5IBW A;  1K9K A;  3OP0 A;  1CFD A;  2L2E A;  1TIZ A;  2OPO A;  5KSZ A;  1CM4 A;  1S1E A;  1SCM C;  4MRX A;  1YVH A;  1UWO A;  4NDC A;  4PE4 A;  3TDU A;  2LVI A;  5ER5 A;  1TNX A;  2A4J A;  1FW4 A;  1QX5 B;  4PE1 A;  1YUU A;  2H61 A;  3GK2 A;  1CDP A;  3GK1 A;  4M2O A;  3EVU A;  4U8D A;  4XJK B;  1CFF A;  1B1G A;  1QTX A;  2LMV A;  2L4H A;  3LL8 B;  1QIV A;  1IJ5 A;  2BCX A;  2M8U A;  2GGZ A;  1SR6 C;  4BY4 A;  1K2H A;  5B8I B;  3VRN A;  1OMV A;  2OTG C;  1B8C A;  1DF0 A;  1FI5 A;  1QAS A;  4P2Y B;  2G2B A;  3EK4 A;  1AP4 A;  1OQP A;  1EH2 A;  2CT9 A;  1XFY O;  2LAP A;  2WND A;  2NCO A;  1GQM A;  5K89 A;  1SCM B;  1DF0 B;  1F4O A;  3WXA A;  4DIR A;  2K7D A;  1C07 A;  1Y0V H;  4NDB A;  1J7P A;  1QVI Z;  1K94 A;  1OMD A;  1SK6 D;  2EHB A;  4CFR A;  2JNX A;  2KOT A;  2Y4Q A;  4GGF A;  5AER A;  2JT3 A;  2NLN A;  2KFG A;  4IL1 A;  1ZOT B;  4JQ0 D;  4OVN F;  2I7A A;  2LUX A;  1SRA A;  2RGI A;  4I5N B;  1SR6 B;  1K96 A;  4WQ2 A;  2OTG B;  4C0K A;  2BE6 A;  2LLU A;  3LLE A;  2JTT A;  3WNX B;  1IWQ A;  1Y1X A;  4C0L A;  1PK0 D;  1EL4 A;  1QS7 A;  2MJW B;  2E6W A;  3BUM B;  3KHE A;  3TS5 C;  5ER4 X;  2Q91 A;  3NXA A;  1OZO A;  1J7R A;  3FWC A;  2AUC A;  4C0J A;  5CSF A;  1XFW O;  2BE4 A;  1N2D A;  1XK4 A;  2F2P A;  3CGA A;  3SG5 A;  2LNK A;  2JU0 A;  3BOW A;  2TN4 A;  2MAZ A;  4D1E A;  3AKB A;  1S3P A;  2K7O A;  5AXI A;  1DTL A;  1KQM C;  1L2O B;  1YUR A;  2LLS A;  1TTX A;  1V1F A;  2QPT A;  2OS8 C;  1X02 A;  3BOW B;  1RWY A;  1XA5 A;  2JPT A;  3PN7 C;  1PVB A;  4GUK A;  3TS5 B;  2KGB C;  2JUL A;  2KYC A;  3VRO A;  1WY9 A;  5AAN A;  1CB1 A;  1AJ5 A;  3SG6 A;  1DJG A;  1W7J B;  3D0Y A;  1XFU O;  2M3W A;  4QJ5 B;  4PE0 A;  2JXC A;  3I5G C;  1CFP A;  5GQQ C;  3RM1 A;  1B47 A;  3CS1 A;  3CR4 X;  3BUO B;  1YR5 A;  4MZK A;  5I2L A;  1BLQ A;  1NX3 A;  1B7T Z;  1CDL A;  4HRE E;  4YGB B;  4M2Q A;  5HKY A;  2L4I A;  2EGD A;  3D0Y B;  4A4B A;  1KQM B;  3BUN B;  3SIB A;  4QJ4 B;  1IKU A;  2ZRS A;  1YX7 A;  1ZMZ A;  3EKH A;  5G08 A;  2OS8 B;  1NPQ A;  1LA3 A;  1AHR A;  3PN7 B;  2M9G A;  5DKN A;  2K7C A;  5CSN A;  2IS9 A;  2JT8 A;  2M0R A;  3I5F C;  3KEV A;  1A29 A;  5D69 A;  4MSP A;  2ZNE A;  1B8L A;  1K90 D;  5D7F A;  5HKW A;  3SG3 A;  3I5G B;  1SMG A;  1QX7 A;  4Q04 A;  3FIA A;  3A8R A;  3C1V A;  4I5K A;  2JT0 A;  3TUY C;  1PUL A;  4GPL B;  1CNP A;  2JWW A;  1M45 A;  1BMO A;  5HLV A;  3BUX B;  1XFV O;  1R6P A;  1NCY A;  3NSI A;  4WQ3 A;  4YI8 A;  3CTN A;  5FYX A;  2E30 A;  3NSL A;  2BCB A;  2ISD A;  1RTP 1;  2G9B A;  1DGU A;  1K9P A;  3DD4 A;  3H4S E;  4MZJ A;  4PCW A;  1VRK A;  1ZAC A;  2KI4 C;  3I5F B;  1IG5 A;  1CLM A;  1J1D A;  1JUO A;  2MLE C;  2LHL A;  5I2O A;  2WOS A;  1C7V A;  3O78 A;  1Y6W A;  3GK4 X;  2JZI A;  2PMY A;  2Y5I A;  4NQG A;  2LLT A;  1KQV A;  3EK7 A;  4A4C A;  2HQW A;  2JC2 A;  4XYN A;  3JTD C;  3WHU B;  2M1K B;  3AKA A;  3TUY B;  2EC6 B;  1SL8 A;  4ORB B;  4GGN A;  3O2P A;  4FQO A;  2KBI A;  3IQO A;  1BT6 A;  1KSO A;  1K9U A;  1FI6 A;  1SYM A;  2KI4 B;  4ORA B;  1AK8 A;  4L9M A;  1J55 A;  1IH0 A;  5KTY A;  1JFK A;  1MQ1 A;  3NSO A;  2PVB A;  3OX5 A;  4DRW A;  3M0W A;  1YRT B;  1PAL A;  4PHN A;  1A03 A;  1SCV A;  2ZFD A;  4ZCU A;  3OB1 B;  2K2F A;  3ICB A;  3JTD B;  5DKQ A;  3BQ3 A;  1V1G A;  1J7Q A;  4YGC B;  1DMO A;  3PSR A;  3TDI A;  4N1F A;  1S36 A;  4WRI A;  1RFJ A;  2LMU A;  2SCP A;  3DVK A;  4CPV A;  2MA2 A;  1PSR A;  1MR8 A;  3HCM A;  2L98 A;  3DF0 B;  2LMT A;  3DVE A;  1SW8 A;  1XYD A;  1UHK A;  2JRF A;  2KBM A;  4DUQ A;  2LAN A;  1WRL A;  2CNP A;  2K2A A;  1G33 A;  3LK0 A;  3JVT C;  1BOD A;  3AAK A;  5AFP A;  2LE9 B;  1IJ6 A;  1CKK A;  3NSK A;  4OV2 A;  3CWG A;  3TZ1 A;  2L5X B;  2LCP A;  3DVJ A;  3PLF B;  3PAT A;  3BUW B;  1IQ5 A;  1NX0 A;  4CID A;  3QRX A;  2O5G A;  1TCO B;  1JSA A;  1HQV A;  2M7N A;  3EVR A;  3EKJ A;  1SL7 A;  3SG7 A;  1KK8 C;  1AVS A;  2F3Z A;  3VRP A;  3ZNI A;  1NYA A;  2K7B A;  1HT9 A;  4PAL A;  2WC8 A;  3E3R A;  2KQ6 A;  4HRH A;  2JXL A;  1EXR A;  1YX8 A;  3OHM B;  4PE7 A;  3VRQ A;  1TNP A;  5TNC A;  1CMF A;  2AAO A;  2KAX A;  1DJZ A;  1NP8 A;  1TCF A;  1FPW A;  2MRD A;  3VRR A;  2LV7 A;  1AUI B;  1QLS A;  1SBJ A;  2HQ8 A;  2Y1N A;  1M46 A;  1S5G Y;  1XFZ O;  2KAY A;  1SNL A;  1MUX A;  2KSP A;  2GGM A;  2PAL A;  3BYA A;  1NIW A;  2WCE A;  2KGR A;  1IQ3 A;  2BKI B;  1KK8 B;  1DJY A;  1UP5 A;  4OR9 B;  4MEW A;  1NWD A;  2I18 A;  1UHI A;  1M39 A;  4PHM A;  3O6B A;  1CTR A;  4QJ3 B;  1YUS A;  3LCP C;  2MLF C;  1A75 B;  1S26 D;  1TNW A;  1OSA A;  2KFH A;  1BG1 A;  2LC5 A;  2LVV A;  1MF8 B;  1SPY A;  1J1E A;  3F45 A;  1UHN A;  1ZFS A;  1EJ3 A;  2SAS A;  1N0Y A;  5I2Q A;  4HRG A;  3MSE B;  1F71 A;  5CSI A;  2PAS A;  1KFX S;  2CXJ A;  3TDZ A;  4MRY A;  2WCF A;  1MWN A;  1FBV A;  2WOR A;  1GGW A;  1MXE A;  4AOM A;  1NX1 A;  4YGE B;  4GNK B;  1TRF A;  1S6I A;  2BL0 C;  1WDC C;  2PSR A;  4ORC B;  4DCK A;  4AQJ A;  3WHT B;  2BBM A;  1SL9 A;  4YGD B;  2JNF A; 
#chains in the Genus database with same CATH topology
 2LP3 A;  3S0A A;  2ZN9 A;  1MHO A;  1UHJ A;  1QVI Y;  3O4Y A;  2WCH A;  3OB2 B;  1F55 A;  1GGZ A;  4E68 A;  4CLN A;  1BR1 B;  1R2U A;  2QAC A;  4PHJ A;  3I5H C;  1B8R A;  1TOP A;  2L51 A;  2HPS A;  3CZ2 A;  1RJV A;  1UUS A;  1F8H A;  1TN4 A;  2KI6 D;  1S6C A;  2JOJ A;  3FE9 A;  1S6J A;  4AQI A;  3R1P A;  1CFC A;  1QV1 A;  2FCD A;  3D77 A;  1QX2 A;  3DYE A;  1UUR A;  2JTZ A;  1WRZ A;  2NXQ A;  2PYQ A;  3NHI A;  1OOJ A;  1UHH A;  3L47 A;  3KO0 A;  1XVJ A;  3DVM A;  4NDD A;  4PDZ A;  1BF5 A;  2BL0 B;  1WDC B;  4HSZ A;  1JF0 A;  2WCK A;  2WCB A;  1L7Z A;  3EK8 A;  1Q80 A;  5HKZ A;  2F33 A;  2HF5 A;  1OE9 B;  2ERB A;  1KFX L;  1C7W A;  2L50 A;  1QJT A;  1KWO C;  1DVI A;  3FWB A;  4M2P A;  3R72 A;  1DT7 B;  2CTN A;  4F0Z B;  4TNC A;  5CPV A;  1Y1A A;  2DOQ A;  3I5H B;  2AMI A;  1DJH A;  1KFU L;  1QV0 A;  2LVK A;  2ZKM X;  1G8I A;  3PM8 A;  3PAL A;  2M49 B;  2MHH A;  3DF0 A;  2CCM A;  4I5J A;  1NX2 A;  2BBN A;  1BOC A;  2KAV A;  3CZT X;  5HL1 A;  1PVA A;  2D8N A;  4USL A;  2M97 A;  3CYZ A;  1ALW A;  1B9A A;  4GGF C;  1CDM A;  4JPZ B;  1KK7 Z;  2L2C A;  1CLB A;  1AJ4 A;  1CLL A;  1JWD A;  1CDN A;  3IQQ A;  2I94 A;  1LS8 A;  2LHI A;  3FS7 A;  1GM0 A;  3K21 A;  1ZUZ A;  2KI6 C;  1M63 B;  3FE8 A;  1DEK A;  3ZWH A;  1KWO B;  1RK9 A;  2M7L A;  3B6X A;  1G4Y R;  3CR2 A;  1B7T Y;  2FCE A;  1XO5 A;  1N65 A;  1W7I B;  1DJX A;  2I2R E;  1EG3 A;  4YRU A;  3GOF A;  3LK1 A;  2ZND A;  1JBA A;  4MZL A;  4UPG A;  2BKH B;  1H8B A;  1XK4 C;  1IRJ A;  1TNQ A;  5BPJ A;  2Q4U A;  1L2O C;  5CSJ A;  5J3X A;  3SG4 A;  1J7O A;  1MXL C;  3AAJ A;  1LVC D;  2V53 A;  1WLM A;  5DKR A;  1YRU B;  4OKH A;  1CMG A;  1IGV A;  2H2K A;  1KSM A;  3IF7 A;  3VGO A;  4GAO A;  3SS5 A;  1U5I A;  5PAL A;  2F2O A;  4OCI A;  2F3Y A;  1RRO A;  2O60 A;  2LVJ A;  1SY9 A;  2VRG A;  3CLN A;  3I5I C;  1B4C A;  1JC2 A;  2KHN A;  1WLZ A;  2KYF A;  3DY9 A;  2Y1M A;  2QEH A;  3JVT B;  1DJW A;  1F4Q A;  1U5I B;  3SIA A;  1REC A;  5JJG A;  5HYD A;  2PRU A;  3HX4 A;  3SG2 A;  5KU1 A;  1K8U A;  2F8P A;  2K8M B;  2WCL A;  2ZRT A;  4DS7 A;  1BJF A;  4FQT A;  1NCX A;  2BCA A;  1M31 A;  2KDH A;  3R1V A;  3OBV A;  4F7F A;  1BU3 A;  1A75 A;  1NSH A;  1YUT A;  4MVF A;  2COL B;  2HET A;  2KFF A;  1PSB A;  3KPX A;  1F54 A;  2ZN8 A;  3A4U B;  4MLW A;  5F6T A;  1KCY A;  2FOT A;  2NCP A;  2L0P A;  3I5I B;  2P6B B;  1PRW A;  3D78 A;  2K61 A;  4ETO A;  5JOL A;  3Q8I A;  1DC1 A;  2CBL A;  2NZ0 A;  2KNE A;  2LUC A;  1NUB A;  2LP2 A;  3DZT A;  1FF1 A;  3SJS A;  1LXF C;  2GV5 A;  2M29 A;  2WC6 A;  3RZS A;  1DGV A;  3EVV A;  1SKT A;  5AEQ A;  2BNX A;  1ODB A;  2MBX A;  1CM1 A;  3BJH A;  4ZCV A;  4MN0 A;  1JFJ A;  2K0J A;  3PFV A;  4JWQ A;  1YTZ C;  3BFB A;  1A4P A;  1H4B A;  1BR4 B;  4N1G A;  1QLK A;  4N5X A;  2KPH A;  1DQE A;  1W9Z A;  1QAT A;  3CR5 X;  2KLD A;  1TUZ A;  1EG4 A;  1QXP A;  2B1U A;  1NCZ A;  1XFX O;  2FJY A;  2K60 A;  4YI9 A;  1OMR A;  3BXK A;  2QDI A;  4R1E A;  3RLZ A;  3KF9 A;  3OGN A;  1DJI A;  3PM2 A;  1KFU S;  4ICB A;  3SS3 A;  4CFQ A;  5DIC A;  1WRK A;  1LKJ A;  1LA0 A;  2R2I A;  4BY5 A;  1TWO A;  1E8A A;  4I5L B;  2QEV A;  2M1U A;  1LIN A;  1A2X A;  1ALV A;  1JF2 A;  1K93 D;  3D10 A;  4FTG A;  2KQY A;  4P5O E;  4YBH B;  5I8N A;  3S0B A;  2JQ6 A;  1GJY A;  2EC6 C;  1K95 A;  1QIW A;  1Y1U A;  1YVL A;  1S5G Z;  4YGA A;  5HLO A;  1D1O A;  2H61 C;  3OX6 A;  4GFT A;  1KK7 Y;  1OZS A;  3BFH A;  1F70 A;  2BEC A;  2FJU B;  2LM5 A;  2YGU A;  4MBE A;  4GBA A;  4PHK A;  4XJK A;  1K9K A;  5D3O A;  3OP0 A;  3UNW A;  5IBW A;  1CFD A;  2L2E A;  1TIZ A;  2OPO A;  5KSZ A;  1CM4 A;  1S1E A;  3CDN A;  1XFR A;  1SCM C;  4MRX A;  1YVH A;  1UWO A;  4NDC A;  4PE4 A;  3TDU A;  2LVI A;  5ER5 A;  1TNX A;  2A4J A;  1FW4 A;  1QX5 B;  4PE1 A;  1YUU A;  2H61 A;  3GK2 A;  1CDP A;  3GK1 A;  4M2O A;  3EVU A;  4U8D A;  4XJK B;  3IVT A;  1CFF A;  1B1G A;  1QTX A;  2LMV A;  2L4H A;  3LL8 B;  1QIV A;  1IJ5 A;  2BCX A;  2M8U A;  2GGZ A;  1SR6 C;  4BY4 A;  1K2H A;  5B8I B;  3VRN A;  1OMV A;  2OTG C;  1B8C A;  1DF0 A;  1FI5 A;  1QAS A;  4P2Y B;  2G2B A;  3EK4 A;  1AP4 A;  1OQP A;  1EH2 A;  2CT9 A;  1XFY O;  2LAP A;  2WND A;  2NCO A;  2H8V A;  1GQM A;  5K89 A;  1Z4H A;  5I94 A;  1SCM B;  3NGV A;  1DF0 B;  1F4O A;  3WXA A;  4DIR A;  2K7D A;  1C07 A;  1Y0V H;  2GTE A;  4NDB A;  1J7P A;  1QVI Z;  3CZ1 A;  1K94 A;  1OMD A;  1SK6 D;  2EHB A;  4CFR A;  2JNX A;  1OOH A;  2KOT A;  2Y4Q A;  4GGF A;  5AER A;  2JT3 A;  2NLN A;  2KFG A;  4IL1 A;  1ZOT B;  4JQ0 D;  4OVN F;  2I7A A;  2LUX A;  1SRA A;  4IJ7 A;  3D75 A;  2RGI A;  4I5N B;  1SR6 B;  1K96 A;  4WQ2 A;  2OTG B;  4C0K A;  3EG5 B;  2BE6 A;  2LLU A;  3LLE A;  2JTT A;  3WNX B;  1IWQ A;  3BFA A;  1Y1X A;  4C0L A;  1PK0 D;  1EL4 A;  1QS7 A;  2MJW B;  2E6W A;  3BUM B;  3KHE A;  3TS5 C;  5ER4 X;  2Q91 A;  3NXA A;  1OZO A;  1J7R A;  3FWC A;  1T14 A;  2AUC A;  2P71 A;  5CSF A;  1XFW O;  2BE4 A;  5FI7 A;  4C0J A;  1N2D A;  1XK4 A;  1Z2C B;  2F2P A;  3CGA A;  2LNK A;  3SG5 A;  2WCM A;  2JU0 A;  3BOW A;  2TN4 A;  2MAZ A;  4D1E A;  3AKB A;  1S3P A;  4KYN A;  2K7O A;  5AXI A;  1DTL A;  1KQM C;  1L2O B;  1YUR A;  2LLS A;  1TTX A;  1V1F A;  2QPT A;  2OS8 C;  1X02 A;  3BOW B;  1RWY A;  1XA5 A;  2JPT A;  3PN7 C;  1PVB A;  4GUK A;  3B88 A;  3S0D A;  3TS5 B;  2KGB C;  2JUL A;  2KYC A;  5FI6 A;  3VRO A;  1OOF A;  1WY9 A;  5AAN A;  4JKT A;  1CB1 A;  1AJ5 A;  3D76 A;  3SG6 A;  1DJG A;  1W7J B;  3S0F A;  3D0Y A;  1XFU O;  2M3W A;  4QJ5 B;  4PE0 A;  2JXC A;  3I5G C;  1P28 A;  1CFP A;  5GQQ C;  3RM1 A;  1B47 A;  3CS1 A;  3CR4 X;  3BUO B;  1YR5 A;  4MZK A;  5I2L A;  1BLQ A;  1NX3 A;  1B7T Z;  2QEB A;  1CDL A;  3NHT A;  4HRE E;  4YGB B;  4INX A;  4M2Q A;  5HKY A;  2L4I A;  2EGD A;  3D0Y B;  4A4B A;  1KQM B;  3BUN B;  3SIB A;  4QJ4 B;  1IKU A;  4PT1 A;  2ZRS A;  1YX7 A;  1ZMZ A;  3EKH A;  5G08 A;  2OS8 B;  1NPQ A;  1LA3 A;  1AHR A;  3PN7 B;  2M9G A;  5DKN A;  2K7C A;  5CSN A;  2IS9 A;  2JT8 A;  2M0R A;  3I5F C;  3KEV A;  1A29 A;  5D69 A;  4MSP A;  2ZNE A;  1B8L A;  1K90 D;  3CZ0 A;  5D7F A;  5HKW A;  3SG3 A;  3I5G B;  1SMG A;  1QX7 A;  4Q04 A;  1OOI X;  3A8R A;  3C1V A;  3FIA A;  4I5K A;  3WHU B;  3B87 A;  2JT0 A;  3TUY C;  2P70 A;  2JPO A;  1PUL A;  4GPL B;  1CNP A;  1DEL A;  2JWW A;  1M45 A;  1BMO A;  5HLV A;  3UO9 A;  3BUX B;  1XFV O;  1R6P A;  1NCY A;  3NSI A;  2WC5 A;  4WQ3 A;  4YI8 A;  3K1E A;  3CTN A;  5FYX A;  2E30 A;  3FE6 A;  3NSL A;  2BCB A;  2ISD A;  1RTP 1;  2G9B A;  1DGU A;  1K9P A;  3DD4 A;  3H4S E;  4MZJ A;  4OZD A;  4PCW A;  1VRK A;  1ZAC A;  2KI4 C;  3I5F B;  1IG5 A;  1CLM A;  1J1D A;  1JUO A;  2MLE C;  2LHL A;  1QWV A;  3N7H A;  5I2O A;  2WOS A;  1C7V A;  2L5Y A;  3O78 A;  1Y6W A;  3GK4 X;  2JZI A;  2PMY A;  2Y5I A;  4NQG A;  3B7A A;  2LLT A;  1KQV A;  3EK7 A;  4A4C A;  1OOG A;  2HQW A;  2JC2 A;  3JTD C;  3L4A A;  4XYN A;  2M1K B;  3AKA A;  5FI2 A;  3TUY B;  2EC6 B;  3V2L A;  1SL8 A;  4ORB B;  4GGN A;  3O2P A;  4FQO A;  2KBI A;  3IQO A;  1BT6 A;  1KSO A;  1K9U A;  1FI6 A;  1SYM A;  2KI4 B;  4ORA B;  1AK8 A;  1C3Y A;  4L9M A;  2QEO A;  1J55 A;  1IH0 A;  5KTY A;  1JFK A;  1MQ1 A;  3NSO A;  2PVB A;  3OX5 A;  4DRW A;  2KLE A;  2PQL A;  3M0W A;  1YRT B;  1PAL A;  4PHN A;  3S0G A;  1A03 A;  1SSE B;  1SCV A;  2ZFD A;  4ZCU A;  3OB1 B;  2K2F A;  3ICB A;  3JTD B;  3L4L A;  5DKQ A;  3VB1 A;  3BQ3 A;  1V1G A;  1J7Q A;  3DXL A;  4YGC B;  1ORG A;  1DMO A;  5EL2 A;  3PSR A;  3TDI A;  3B86 A;  1S36 A;  4N1F A;  4WRI A;  1RFJ A;  2LMU A;  2SCP A;  3DVK A;  4CPV A;  2MA2 A;  4INW A;  1PSR A;  1MR8 A;  3HCM A;  2L98 A;  3DF0 B;  2LMT A;  3DVE A;  1SW8 A;  1XYD A;  1UHK A;  2JRF A;  2KBM A;  4DUQ A;  2LAN A;  1WRL A;  2CNP A;  2K2A A;  1G33 A;  3LK0 A;  3JVT C;  1BOD A;  3AAK A;  5AFP A;  2LE9 B;  1IJ6 A;  1CKK A;  3NSK A;  4OV2 A;  3CWG A;  3TZ1 A;  2L5X B;  2LCP A;  2WCJ A;  3DVJ A;  3PLF B;  3PAT A;  3BUW B;  1IQ5 A;  1NX0 A;  3D74 A;  4CID A;  3QRX A;  2O5G A;  1TCO B;  1JSA A;  1HQV A;  2M7N A;  3EVR A;  3EKJ A;  1SL7 A;  3SG7 A;  1KK8 C;  1AVS A;  2F3Z A;  3VRP A;  3ZNI A;  1NYA A;  2K7B A;  1HT9 A;  4PAL A;  2WC8 A;  3E3R A;  1TUJ A;  2KQ6 A;  4HRH A;  2JXL A;  1EXR A;  1YX8 A;  3OHM B;  4PE7 A;  3VRQ A;  1TNP A;  5TNC A;  1CMF A;  2AAO A;  3SS4 A;  2KAX A;  1DJZ A;  1NP8 A;  1TCF A;  1FPW A;  2MRD A;  3VRR A;  2LV7 A;  1AUI B;  1QLS A;  1IIO A;  1SBJ A;  2HQ8 A;  2Y1N A;  1M46 A;  1S5G Y;  1XFZ O;  2KAY A;  1SNL A;  1MUX A;  2KSP A;  2GGM A;  2PAL A;  3BYA A;  1NIW A;  2WCE A;  2KGR A;  3PJI A;  1IQ3 A;  3QME A;  1KK8 B;  2BKI B;  1DJY A;  1UP5 A;  4OR9 B;  3S0E A;  4MEW A;  1NWD A;  2I18 A;  1OW4 A;  1UHI A;  1M39 A;  4PHM A;  3O6B A;  1CTR A;  3D73 A;  4JD9 A;  1YUS A;  3LCP C;  3R1O A;  4QJ3 B;  2MLF C;  1A75 B;  1S26 D;  1TNW A;  1OSA A;  2KFH A;  1BG1 A;  2LC5 A;  2LVV A;  1MF8 B;  1SPY A;  1J1E A;  3F45 A;  1UHN A;  1ZFS A;  1EJ3 A;  2SAS A;  2BAP A;  1N0Y A;  5I2Q A;  4HRG A;  3MSE B;  3O4X A;  1F71 A;  5CSI A;  2PAS A;  3CAB A;  1KFX S;  2CXJ A;  3TDZ A;  4MRY A;  2WCF A;  1MWN A;  1FBV A;  2WOR A;  1GGW A;  1MXE A;  4AOM A;  1NX1 A;  4YGE B;  4GNK B;  1C3Z A;  1TRF A;  1S6I A;  2BL0 C;  1WDC C;  2PSR A;  4ORC B;  4DCK A;  4AQJ A;  3WHT B;  2BBM A;  1SL9 A;  4YGD B;  2JNF A; 
#chains in the Genus database with same CATH homology
 2LP3 A;  2ZN9 A;  1MHO A;  1UHJ A;  1QVI Y;  3O4Y A;  3OB2 B;  1F55 A;  1GGZ A;  4E68 A;  4CLN A;  1BR1 B;  1R2U A;  2QAC A;  4PHJ A;  3I5H C;  1B8R A;  1TOP A;  2L51 A;  2HPS A;  1RJV A;  1UUS A;  1F8H A;  1TN4 A;  2KI6 D;  1S6C A;  2JOJ A;  4AQI A;  1S6J A;  1CFC A;  1QV1 A;  2FCD A;  1QX2 A;  1UUR A;  2JTZ A;  1WRZ A;  2NXQ A;  1OOJ A;  1UHH A;  3KO0 A;  1XVJ A;  3DVM A;  4NDD A;  4PDZ A;  1BF5 A;  2BL0 B;  1WDC B;  4HSZ A;  1JF0 A;  2WCB A;  1L7Z A;  3EK8 A;  1Q80 A;  5HKZ A;  2F33 A;  2HF5 A;  1OE9 B;  1KFX L;  1C7W A;  2L50 A;  1QJT A;  1KWO C;  1DVI A;  3FWB A;  4M2P A;  1DT7 B;  2CTN A;  4F0Z B;  4TNC A;  5CPV A;  1Y1A A;  2DOQ A;  3I5H B;  2AMI A;  1DJH A;  1KFU L;  1QV0 A;  2LVK A;  2ZKM X;  1G8I A;  3PM8 A;  3PAL A;  2M49 B;  2MHH A;  3DF0 A;  2CCM A;  4I5J A;  1NX2 A;  2BBN A;  1BOC A;  2KAV A;  3CZT X;  1PVA A;  2D8N A;  4USL A;  2M97 A;  1ALW A;  1B9A A;  4GGF C;  1CDM A;  4JPZ B;  1KK7 Z;  1CLB A;  1AJ4 A;  1CLL A;  1JWD A;  1CDN A;  3IQQ A;  2I94 A;  3FS7 A;  2LHI A;  3K21 A;  1ZUZ A;  2KI6 C;  1M63 B;  3ZWH A;  1KWO B;  1RK9 A;  2M7L A;  3CR2 A;  1G4Y R;  1B7T Y;  2FCE A;  1XO5 A;  1N65 A;  1W7I B;  1DJX A;  2I2R E;  1EG3 A;  4YRU A;  3GOF A;  3LK1 A;  2ZND A;  1JBA A;  4MZL A;  4UPG A;  2BKH B;  1H8B A;  1XK4 C;  1IRJ A;  1TNQ A;  5BPJ A;  2Q4U A;  1L2O C;  5CSJ A;  5J3X A;  3SG4 A;  1J7O A;  1MXL C;  3AAJ A;  1LVC D;  2V53 A;  1WLM A;  5DKR A;  1YRU B;  4OKH A;  1CMG A;  1IGV A;  2H2K A;  1KSM A;  3IF7 A;  3VGO A;  4GAO A;  1U5I A;  5PAL A;  2F2O A;  4OCI A;  2F3Y A;  1RRO A;  2O60 A;  2LVJ A;  1SY9 A;  2VRG A;  3CLN A;  3I5I C;  1B4C A;  1JC2 A;  2KHN A;  1WLZ A;  2KYF A;  2Y1M A;  3JVT B;  1DJW A;  1F4Q A;  1U5I B;  3SIA A;  1REC A;  5JJG A;  5HYD A;  2PRU A;  3HX4 A;  3SG2 A;  5KU1 A;  1K8U A;  2F8P A;  2K8M B;  2ZRT A;  4DS7 A;  1BJF A;  1NCX A;  2BCA A;  1M31 A;  2KDH A;  1BU3 A;  1A75 A;  1NSH A;  1YUT A;  4MVF A;  2COL B;  2HET A;  2KFF A;  1PSB A;  3KPX A;  1F54 A;  2ZN8 A;  3A4U B;  4MLW A;  5F6T A;  1KCY A;  2FOT A;  2NCP A;  2L0P A;  3I5I B;  2P6B B;  1PRW A;  2K61 A;  4ETO A;  5JOL A;  2CBL A;  2NZ0 A;  2KNE A;  2LUC A;  1NUB A;  2LP2 A;  1FF1 A;  3SJS A;  1LXF C;  2GV5 A;  2M29 A;  1DGV A;  3EVV A;  1SKT A;  5AEQ A;  2MBX A;  1ODB A;  1CM1 A;  4ZCV A;  4MN0 A;  1JFJ A;  2K0J A;  3PFV A;  4JWQ A;  1YTZ C;  1H4B A;  1A4P A;  1BR4 B;  4N1G A;  1QLK A;  4N5X A;  1QAT A;  3CR5 X;  1EG4 A;  1QXP A;  2B1U A;  1NCZ A;  1XFX O;  4YI9 A;  1OMR A;  3BXK A;  4R1E A;  3RLZ A;  3KF9 A;  1DJI A;  1KFU S;  4ICB A;  4CFQ A;  1WRK A;  1LKJ A;  1LA0 A;  2R2I A;  4BY5 A;  1E8A A;  4I5L B;  2M1U A;  1LIN A;  1A2X A;  1ALV A;  1JF2 A;  1K93 D;  3D10 A;  4FTG A;  2KQY A;  4P5O E;  4YBH B;  5I8N A;  2JQ6 A;  1GJY A;  2EC6 C;  1K95 A;  1QIW A;  1Y1U A;  1YVL A;  1S5G Z;  4YGA A;  5HLO A;  1D1O A;  2H61 C;  3OX6 A;  4GFT A;  1KK7 Y;  1OZS A;  1F70 A;  2BEC A;  2FJU B;  2LM5 A;  4MBE A;  4XJK A;  4GBA A;  4PHK A;  5IBW A;  1K9K A;  3OP0 A;  1CFD A;  2L2E A;  1TIZ A;  2OPO A;  5KSZ A;  1CM4 A;  1S1E A;  1SCM C;  4MRX A;  1YVH A;  1UWO A;  4NDC A;  4PE4 A;  3TDU A;  2LVI A;  5ER5 A;  1TNX A;  2A4J A;  1FW4 A;  1QX5 B;  4PE1 A;  1YUU A;  2H61 A;  3GK2 A;  1CDP A;  3GK1 A;  4M2O A;  3EVU A;  4U8D A;  4XJK B;  1CFF A;  1B1G A;  1QTX A;  2LMV A;  2L4H A;  3LL8 B;  1QIV A;  1IJ5 A;  2BCX A;  2M8U A;  2GGZ A;  1SR6 C;  4BY4 A;  1K2H A;  5B8I B;  3VRN A;  1OMV A;  2OTG C;  1B8C A;  1DF0 A;  1FI5 A;  1QAS A;  4P2Y B;  2G2B A;  3EK4 A;  1AP4 A;  1OQP A;  1EH2 A;  2CT9 A;  1XFY O;  2LAP A;  2WND A;  2NCO A;  1GQM A;  5K89 A;  1SCM B;  1DF0 B;  1F4O A;  3WXA A;  4DIR A;  2K7D A;  1C07 A;  1Y0V H;  4NDB A;  1J7P A;  1QVI Z;  1K94 A;  1OMD A;  1SK6 D;  2EHB A;  4CFR A;  2JNX A;  2KOT A;  2Y4Q A;  4GGF A;  5AER A;  2JT3 A;  2NLN A;  2KFG A;  4IL1 A;  1ZOT B;  4JQ0 D;  4OVN F;  2I7A A;  2LUX A;  1SRA A;  2RGI A;  4I5N B;  1SR6 B;  1K96 A;  4WQ2 A;  2OTG B;  4C0K A;  2BE6 A;  2LLU A;  3LLE A;  2JTT A;  3WNX B;  1IWQ A;  1Y1X A;  4C0L A;  1PK0 D;  1EL4 A;  1QS7 A;  2MJW B;  2E6W A;  3BUM B;  3KHE A;  3TS5 C;  5ER4 X;  2Q91 A;  3NXA A;  1OZO A;  1J7R A;  3FWC A;  2AUC A;  4C0J A;  5CSF A;  1XFW O;  2BE4 A;  1N2D A;  1XK4 A;  2F2P A;  3CGA A;  3SG5 A;  2LNK A;  2JU0 A;  3BOW A;  2TN4 A;  2MAZ A;  4D1E A;  3AKB A;  1S3P A;  2K7O A;  5AXI A;  1DTL A;  1KQM C;  1L2O B;  1YUR A;  2LLS A;  1TTX A;  1V1F A;  2QPT A;  2OS8 C;  1X02 A;  3BOW B;  1RWY A;  1XA5 A;  2JPT A;  3PN7 C;  1PVB A;  4GUK A;  3TS5 B;  2KGB C;  2JUL A;  2KYC A;  3VRO A;  1WY9 A;  5AAN A;  1CB1 A;  1AJ5 A;  3SG6 A;  1DJG A;  1W7J B;  3D0Y A;  1XFU O;  2M3W A;  4QJ5 B;  4PE0 A;  2JXC A;  3I5G C;  1CFP A;  5GQQ C;  3RM1 A;  1B47 A;  3CS1 A;  3CR4 X;  3BUO B;  1YR5 A;  4MZK A;  5I2L A;  1BLQ A;  1NX3 A;  1B7T Z;  1CDL A;  4HRE E;  4YGB B;  4M2Q A;  5HKY A;  2L4I A;  2EGD A;  3D0Y B;  4A4B A;  1KQM B;  3BUN B;  3SIB A;  4QJ4 B;  1IKU A;  2ZRS A;  1YX7 A;  1ZMZ A;  3EKH A;  5G08 A;  2OS8 B;  1NPQ A;  1LA3 A;  1AHR A;  3PN7 B;  2M9G A;  5DKN A;  2K7C A;  5CSN A;  2IS9 A;  2JT8 A;  2M0R A;  3I5F C;  3KEV A;  1A29 A;  5D69 A;  4MSP A;  2ZNE A;  1B8L A;  1K90 D;  5D7F A;  5HKW A;  3SG3 A;  3I5G B;  1SMG A;  1QX7 A;  4Q04 A;  3FIA A;  3A8R A;  3C1V A;  4I5K A;  2JT0 A;  3TUY C;  1PUL A;  4GPL B;  1CNP A;  2JWW A;  1M45 A;  1BMO A;  5HLV A;  3BUX B;  1XFV O;  1R6P A;  1NCY A;  3NSI A;  4WQ3 A;  4YI8 A;  3CTN A;  5FYX A;  2E30 A;  3NSL A;  2BCB A;  2ISD A;  1RTP 1;  2G9B A;  1DGU A;  1K9P A;  3DD4 A;  3H4S E;  4MZJ A;  4PCW A;  1VRK A;  1ZAC A;  2KI4 C;  3I5F B;  1IG5 A;  1CLM A;  1J1D A;  1JUO A;  2MLE C;  2LHL A;  5I2O A;  2WOS A;  1C7V A;  3O78 A;  1Y6W A;  3GK4 X;  2JZI A;  2PMY A;  2Y5I A;  4NQG A;  2LLT A;  1KQV A;  3EK7 A;  4A4C A;  2HQW A;  2JC2 A;  4XYN A;  3JTD C;  3WHU B;  2M1K B;  3AKA A;  3TUY B;  2EC6 B;  1SL8 A;  4ORB B;  4GGN A;  3O2P A;  4FQO A;  2KBI A;  3IQO A;  1BT6 A;  1KSO A;  1K9U A;  1FI6 A;  1SYM A;  2KI4 B;  4ORA B;  1AK8 A;  4L9M A;  1J55 A;  1IH0 A;  5KTY A;  1JFK A;  1MQ1 A;  3NSO A;  2PVB A;  3OX5 A;  4DRW A;  3M0W A;  1YRT B;  1PAL A;  4PHN A;  1A03 A;  1SCV A;  2ZFD A;  4ZCU A;  3OB1 B;  2K2F A;  3ICB A;  3JTD B;  5DKQ A;  3BQ3 A;  1V1G A;  1J7Q A;  4YGC B;  1DMO A;  3PSR A;  3TDI A;  4N1F A;  1S36 A;  4WRI A;  1RFJ A;  2LMU A;  2SCP A;  3DVK A;  4CPV A;  2MA2 A;  1PSR A;  1MR8 A;  3HCM A;  2L98 A;  3DF0 B;  2LMT A;  3DVE A;  1SW8 A;  1XYD A;  1UHK A;  2JRF A;  2KBM A;  4DUQ A;  2LAN A;  1WRL A;  2CNP A;  2K2A A;  1G33 A;  3LK0 A;  3JVT C;  1BOD A;  3AAK A;  5AFP A;  2LE9 B;  1IJ6 A;  1CKK A;  3NSK A;  4OV2 A;  3CWG A;  3TZ1 A;  2L5X B;  2LCP A;  3DVJ A;  3PLF B;  3PAT A;  3BUW B;  1IQ5 A;  1NX0 A;  4CID A;  3QRX A;  2O5G A;  1TCO B;  1JSA A;  1HQV A;  2M7N A;  3EVR A;  3EKJ A;  1SL7 A;  3SG7 A;  1KK8 C;  1AVS A;  2F3Z A;  3VRP A;  3ZNI A;  1NYA A;  2K7B A;  1HT9 A;  4PAL A;  2WC8 A;  3E3R A;  2KQ6 A;  4HRH A;  2JXL A;  1EXR A;  1YX8 A;  3OHM B;  4PE7 A;  3VRQ A;  1TNP A;  5TNC A;  1CMF A;  2AAO A;  2KAX A;  1DJZ A;  1NP8 A;  1TCF A;  1FPW A;  2MRD A;  3VRR A;  2LV7 A;  1AUI B;  1QLS A;  1SBJ A;  2HQ8 A;  2Y1N A;  1M46 A;  1S5G Y;  1XFZ O;  2KAY A;  1SNL A;  1MUX A;  2KSP A;  2GGM A;  2PAL A;  3BYA A;  1NIW A;  2WCE A;  2KGR A;  1IQ3 A;  2BKI B;  1KK8 B;  1DJY A;  1UP5 A;  4OR9 B;  4MEW A;  1NWD A;  2I18 A;  1UHI A;  1M39 A;  4PHM A;  3O6B A;  1CTR A;  4QJ3 B;  1YUS A;  3LCP C;  2MLF C;  1A75 B;  1S26 D;  1TNW A;  1OSA A;  2KFH A;  1BG1 A;  2LC5 A;  2LVV A;  1MF8 B;  1SPY A;  1J1E A;  3F45 A;  1UHN A;  1ZFS A;  1EJ3 A;  2SAS A;  1N0Y A;  5I2Q A;  4HRG A;  3MSE B;  1F71 A;  5CSI A;  2PAS A;  1KFX S;  2CXJ A;  3TDZ A;  4MRY A;  2WCF A;  1MWN A;  1FBV A;  2WOR A;  1GGW A;  1MXE A;  4AOM A;  1NX1 A;  4YGE B;  4GNK B;  1TRF A;  1S6I A;  2BL0 C;  1WDC C;  2PSR A;  4ORC B;  4DCK A;  4AQJ A;  3WHT B;  2BBM A;  1SL9 A;  4YGD B;  2JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...