4GUKA

New crystal form structure of human ncs1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
185
structure length
183
Chain Sequence
b'SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal calcium sensor 1
publication title new crystal form structure of human NCS1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 73
structure length 183
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gukA02
4A4CA 1Y0VH 1SL8A 4ORCB 1NX2A 5PALA 1BF5A 4OKHA 2HQWA 1XFVO 3IQQA 4GAOA 2FCEA 2GV5A 1AP4A 1GQMA 2O60A 1PSBA 1S1EA 3SG5A 3TUYB 4YRUA 1J1EA 3LK1A 1B8LA 4MRYA 1NP8A 2JXCA 2L4IA 3TDUA 1CNPA 4HRHA 2F2OA 2HETA 2JOJA 2K7CA 1CDLA 2EHBA 1EJ3A 1TCOB 1UHIA 2JZIA 2H61C 2KAXA 1SMGA 5HKZA 4JQ0D 1F71A 3KO0A 3JTDC 1Q80A 1IJ5A 2JPTA 1UWOA 3PFVA 3PN7C 4GGFA 4A4BA 1K9UA 1CDNA 2F3ZA 2K2AA 2MLEC 2MRDA 2JNFA 1KK8C 3KPXA 4FQOA 1YTZC 4PHJA 1B8CA 4XYNA 1UHKA 2K7BA 4MZKA 2NLNA 1SYMA 1WRLA 2F2PA 1OMVA 1RJVA 1LINA 4YBHB 2VRGA 3SG6A 1TN4A 2NCOA 3SIAA 4GGFC 2BECA 2K61A 3I5FB 5AERA 1KSOA 1CLLA 4YGDB 1RECA 2LVKA 2ZN9A 1H4BA 3VRRA 1EG3A 1DGVA 1LXFC 1YR5A 1B4CA 1DJGA 3SG2A 1TNXA 2KFHA 1G33A 2WORA 4AQJA 2CNPA 2KGBC 2KOTA 3NXAA 5G08A 3WHTB 1QASA 2ZRSA 2ZN8A 1OE9B 2DOQA 1QX2A 3BYAA 2M3WA 4AOMA 1CFFA 3GK2A 1OZOA 4PDZA 5J3XA 1WDCC 2BE6A 2BE4A 1FBVA 2BBMA 1PVAA 2MAZA 4MLWA 1DTLA 2EC6C 1K90D 3AAJA 1SRAA 3DVKA 4MVFA 2E6WA 1XFWO 1NYAA 2SASA 2BBNA 1F70A 5AFPA 2M8UA 3CWGA 1A75B 4BY5A 2Y1NA 3PALA 1DT7B 1IG5A 3KF9A 2KHNA 3EK7A 2KI6C 3PM8A 2PSRA 1KFXS 1TIZA 3CTNA 4NDCA 1JF0A 3SIBA 4BY4A 1S36A 1QXPA 1S5GY 1RFJA 2GGMA 3I5GB 4PHNA 2CCMA 1WY9A 2SCPA 2B1UA 4PHKA 3IQOA 1S5GZ 1FPWA 3QRXA 2LP2A 1W7IB 1XFYO 2HF5A 1SCMC 4CPVA 1SBJA 1C7WA 1XK4A 4GBAA 2RGIA 4PCWA 5CSJA 4OVNF 1R6PA 4QJ3B 1S3PA 3AKBA 1NX1A 1S6JA 2F3YA 3BUMB 4UPGA 2CBLA 2CTNA 2KYFA 1XK4C 4PHMA 4F0ZB 3DF0B 4WQ3A 2CXJA 1A29A 3LK0A 4CFQA 3BXKA 4GFTA 2LNKA 1U5IA 1PRWA 1SL7A 1M31A 3RM1A 2OTGC 3O78A 1CMGA 1SCVA 3DD4A 5F6TA 1CM4A 4JPZB 2F8PA 1MQ1A 3CS1A 4YI9A 2ZRTA 1RK9A 1K9KA 1KQMC 4NQGA 4WRIA 1KWOB 2ZNEA 1XVJA 3BOWB 5CPVA 4TNCA 3MSEB 5ER5A 1TNWA 1NSHA 1TNQA 2AMIA 2KGRA 1H8BA 1DJHA 2KI4C 3KHEA 4NDDA 3ICBA 1XFXO 3PLFB 2PVBA 4GPLB 4XJKB 1KFUS 2JTZA 1CFPA 2LMUA 1M46A 3CZTX 1AJ5A 2BCXA 3NSKA 2WOSA 2JT8A 1MWNA 2LM5A 1YUTA 2OS8B 2K2FA 2MLFC 1YUUA 1PVBA 1N0YA 4P2YB 1ZUZA 1JFKA 1ODBA 3NSLA 2L50A 1K95A 1CDPA 1XA5A 4MSPA 4MZLA 5D7FA 1MXEA 2I7AA 3WNXB 4M2OA 1HT9A 4PALA 1KFUL 1CB1A 1UHJA 1ALVA 1A75A 5AXIA 4C0KA 1JBAA 1AHRA 1L2OB 1OQPA 3HCMA 4GUKA 2MJWB 1XFZO 3O4YA 5AANA 4PE4A 1YURA 1OZSA 1DJIA 1DJWA 1QX5B 2H2KA 1AVSA 2NXQA 3CGAA 1SKTA 1ZFSA 4L9MA 3OB1B 3A4UB 1M63B 2OTGB 1K2HA 5I2OA 3I5HC 2MBXA 4IL1A 2JULA 3OHMB 2FJUB 4CIDA 1SK6D 1OMDA 2Y1MA 5TNCA 4N5XA 2L5XB 5IBWA 3GK1A 2EGDA 3FWCA 3TS5B 4DUQA 3JVTB 1UUSA 2LMTA 3DVMA 1TTXA 1QLKA 3IF7A 3BUOB 4HREE 2WCBA 4QJ4B 1KSMA 3O2PA 1M45A 1DF0B 2A4JA 1MHOA 4R1EA 4C0JA 1BU3A 1CM1A 1ALWA 1RROA 1A4PA 2L98A 4FTGA 4ZCUA 4ETOA 2TN4A 1BLQA 2KQYA 2KAVA 5B8IB 1QX7A 2HPSA 2LCPA 1IRJA 1GJYA 1SR6C 3DVEA 4QJ5B 2I94A 1IQ3A 1SNLA 3ZWHA 4YGEB 5KTYA 5HYDA 4YGAA 2Y5IA 1F55A 2MA2A 1CLBA 1K8UA 1J1DA 1GGZA 3LL8B 2Q4UA 2JNXA 2KBMA 3BOWA 1A03A 2L2EA 2KI6D 3EVVA 1S26D 2L0PA 4MRXA 4ZCVA 1QTXA 1G4YR 1ZOTB 3A8RA 1YVHA 1LVCD 3TDIA 2FCDA 2BL0C 5HLOA 2LC5A 3EVRA 2JRFA 2ISDA 3JTDB 3C1VA 1BR1B 3PN7B 1NPQA 2I2RE 2Q91A 2COLB 1NCYA 2AUCA 4PE0A 1KK8B 2LUCA 1UP5A 1AJ4A 1DJXA 2JQ6A 3LLEA 1Y1XA 2M7NA 1VRKA 2LE9B 4NDBA 3LCPC 2M9GA 2JU0A 2KSPA 1LA3A 1PALA 2BKHB 3CLNA 4WQ2A 4HSZA 2KFFA 2PALA 3VRNA 3TUYC 1J7RA 1V1GA 1XO5A 1YUSA 2NCPA 5ER4X 3VROA 2KYCA 4YGCB 3ZNIA 4E68A 1IKUA 1AUIB 2LHIA 3GOFA 1RWYA 1TCFA 1WDCB 2LLTA 5I8NA 4U8DA 1IWQA 4C0LA 1PULA 2EC6B 1G8IA 1JFJA 1AK8A 4HRGA 4OR9B 2LV7A 2L51A 4ICBA 1WLZA 3K21A 1A2XA 4P5OE 1MR8A 1WRZA 4ORAB 1J55A 1J7QA 1B8RA 1QS7A 1R2UA 2NZ0A 1LKJA 1KCYA 3OX6A 3FWBA 1BR4B 1M39A 4N1FA 4I5NB 1YX8A 5JOLA 5I2LA 3SG4A 2ZNDA 1CFDA 1K94A 3I5FC 2JWWA 3AAKA 3VGOA 1EH2A 1YRTB 1DF0A 1K93D 2K8MB 1QV0A 1YX7A 1KK7Y 3BUNB 4DRWA 1Y6WA 1C07A 5DKRA 3EKJA 3TZ1A 2LAPA 5HKWA 2K7OA 1YVLA 2WNDA 4JWQA 1KK7Z 5JJGA 1SCMB 1DMOA 2M1KB 2WC8A 1DJZA 3D10A 1V1FA 1NUBA 3I5IC 1PSRA 5HKYA 5CSNA 3OX5A 1CFCA 2K0JA 4MBEA 1KQVA 2KNEA 3AKAA 1B9AA 2LLSA 3VRQA 3PSRA 1S6IA 4M2PA 1B47A 2BCAA 1BJFA 2H61A 1SW8A 2WCFA 1FI6A 3E3RA 4I5JA 2LUXA 2LVIA 1XYDA 4MEWA 5HLVA 1UHHA 1JC2A 1NIWA 2O5GA 2LMVA 1F54A 1ZACA 1F4QA 4CLNA 3D0YB 2CT9A 2G9BA 3OP0A 1OOJA 1JUOA 1KQMB 2M97A 2BCBA 1E8AA 1CTRA 5DKNA 2QACA 1FW4A 3I5GC 4M2QA 1U5IB 1DVIA 1PK0D 2KFGA 2JT0A 2ZKMX 3M0WA 4PE1A 1QLSA 2G2BA 1S6CA 2KI4B 3HX4A 1EG4A 5GQQC 1JF2A 1OMRA 2LLUA 1FF1A 2I18A 4MZJA 3EVUA 1B1GA 3DF0A 4Q04A 1QIVA 2HQ8A 2LVJA 1MUXA 4GGNA 4I5LB 3FS7A 5DKQA 1EXRA 1SPYA 1K9PA 2MHHA 1UHNA 3F45A 5I2QA 4DS7A 4ORBB 2R2IA 3SG7A 1F4OA 4YI8A 5FYXA 3DVJA 1WLMA 1QATA 2V53A 3I5IB 2K7DA 1BMOA 3PATA 2E30A 5KSZA 1UURA 1K96A 3O6BA 4CFRA 1NWDA 1HQVA 5AEQA 1C7VA 1J7PA 4XJKA 1B7TY 1L7ZA 3VRPA 5CSFA 1KWOC 1NX3A 2JT3A 4USLA 3SJSA 2KDHA 1B7TZ 3BQ3A 3EK4A 1MXLC 2LVVA 4YGBB 3I5HB 3SG3A 4PE7A 3WXAA 1CDMA 1JSAA 2LP3A 1CKKA 2F33A 2KBIA 1BT6A 1D1OA 1IGVA 2LANA 1BG1A 1BODA 1J7OA 1W7JB 3CR4X 5CSIA 1NCZA 2AAOA 2L4HA 2OS8C 1DGUA 2PRUA 3NSOA 4I5KA 1TNPA 4D1EA 2ZFDA 1N2DA 1TRFA 2PASA 3RLZA 3KEVA 1QVIY 2M7LA 5D69A 3EKHA 5K89A 1BOCA 1NX0A 1XFUO 2Y4QA 2JTTA 1QV1A 5KU1A 1DJYA 1QVIZ 1IQ5A 3GK4X 1CLMA 1F8HA 3FIAA 1SL9A 3WHUB 1N65A 1Y1AA 4MN0A 2JXLA 1SR6B 1JWDA 2QPTA 1NCXA 1YRUB 1X02A 2M1UA 1L2OC 2WCEA 2PMYA 1KFXL 1Y1UA 4GNKB 4AQIA 2BKIB 2KQ6A 5BPJA 1WRKA 2GGZA 3D0YA 2M29A 1GGWA 1IJ6A 2LHLA 2P6BB 1FI5A 1EL4A 4DCKA 3CR5X 3CR2A 1TOPA 4N1GA 3BUXB 1ZMZA 1SY9A 1LA0A 4OCIA 1IH0A 1QJTA 3BUWB 2FOTA 3H4SE 2BL0B 1OSAA 2D8NA 2JC2A 2IS9A 1CMFA 1QIWA 4DIRA 3TDZA 1MF8B 2KAYA 3OB2B 2M49B 3EK8A 2M0RA 3TS5C 4OV2A 3JVTC 3NSIA 1RTP1 2OPOA
chains in the Genus database with same CATH superfamily
4A4CA 1Y0VH 1SL8A 1Z4HA 1NX2A 4ORCB 5PALA 4INWA 1BF5A 4OKHA 2HQWA 1XFVO 3IQQA 4GAOA 2FCEA 2GV5A 1AP4A 1GQMA 2O60A 1PSBA 1S1EA 3SS3A 3SG5A 3TUYB 3S0BA 4YRUA 1J1EA 3LK1A 1B8LA 4MRYA 1NP8A 2JXCA 1P28A 2L4IA 3B6XA 4HRHA 4PT1A 3TDUA 1CNPA 2F2OA 2HETA 2JOJA 2K7CA 1CDLA 2EHBA 1EJ3A 1TCOB 1UHIA 2JZIA 2H61C 2KAXA 1SMGA 4IJ7A 1GM0A 5HKZA 4JQ0D 1F71A 3KO0A 3JTDC 1Q80A 1IJ5A 2JPTA 1UWOA 3PFVA 3PN7C 4GGFA 1BOCA 4A4BA 1K9UA 1LS8A 2F3ZA 2K2AA 2MLEC 2MRDA 1CDNA 2JNFA 1KK8C 2WCJA 3KPXA 1YTZC 4FQOA 4PHJA 1B8CA 4XYNA 3OBVA 1UHKA 2K7BA 4MZKA 1ORGA 2NLNA 1SYMA 1WRLA 2F2PA 1OMVA 1RJVA 1LINA 4YBHB 2VRGA 3SG6A 1TN4A 2NCOA 3SIAA 4GGFC 2BECA 2K61A 3I5FB 5EL2A 5AERA 1KSOA 1CLLA 4YGDB 1RECA 2LVKA 2ZN9A 1H4BA 3VRRA 1TUJA 1EG3A 3R1VA 1DGVA 1LXFC 1YR5A 3BFAA 1B4CA 1DJGA 3SG2A 1TNXA 2KFHA 1G33A 2WORA 4AQJA 2CNPA 2KGBC 2KOTA 3NXAA 5G08A 3WHTB 1QASA 2ZRSA 2ZN8A 1OE9B 2DOQA 1QX2A 2PYQA 2M3WA 3BYAA 3SS4A 4AOMA 1CFFA 3IVTA 3GK2A 1OZOA 3O4XA 4PDZA 5J3XA 1WDCC 2BE6A 2BE4A 3V2LA 1FBVA 2BBMA 1PVAA 2MAZA 2WCLA 2FJYA 1DTLA 2EC6C 4MLWA 1K90D 3AAJA 1SRAA 3DVKA 4MVFA 2E6WA 1XFWO 1NYAA 2SASA 2BBNA 1F70A 5AFPA 2M8UA 3PM2A 3CWGA 1A75B 4BY5A 2Y1NA 3PALA 1DT7B 4F7FA 1IG5A 3KF9A 2KHNA 3EK7A 2KI6C 3PM8A 2BAPA 2PSRA 1KFXS 1TIZA 3CTNA 4NDCA 1JF0A 3SIBA 4BY4A 1S36A 1QXPA 1S5GY 1RFJA 2GGMA 3I5GB 4PHNA 1WY9A 2CCMA 2SCPA 2B1UA 4PHKA 3IQOA 1S5GZ 1FPWA 3QRXA 2LP2A 1W7IB 1XFYO 2HF5A 1DEKA 1SCMC 4CPVA 1SBJA 3BJHA 1C7WA 2L2CA 1XK4A 3CYZA 1C3ZA 4GBAA 2RGIA 4PCWA 5CSJA 5FI7A 4OVNF 1R6PA 4QJ3B 1S3PA 3AKBA 1NX1A 1S6JA 2QDIA 2F3YA 3BUMB 4UPGA 2CBLA 2CTNA 2KYFA 3D74A 1XK4C 4PHMA 4F0ZB 3DF0B 3R1PA 4WQ3A 2CXJA 1A29A 3LK0A 3B88A 4CFQA 3BXKA 4GFTA 3EG5B 2LNKA 1U5IA 1PRWA 1SL7A 1M31A 3RM1A 2OTGC 3O78A 1CMGA 1SCVA 3DD4A 5F6TA 1CM4A 4JPZB 2F8PA 1MQ1A 3CS1A 4YI9A 2ZRTA 1RK9A 1K9KA 1KQMC 4NQGA 4WRIA 1KWOB 2ZNEA 1XVJA 3BOWB 5CPVA 4TNCA 3MSEB 5ER5A 1TNWA 1NSHA 1TNQA 1OOHA 3S0FA 2AMIA 2KGRA 1TWOA 3S0EA 1DJHA 2KI4C 3KHEA 1H8BA 4NDDA 1DELA 2ERBA 3ICBA 1XFXO 3PLFB 2PVBA 4GPLB 4XJKB 1KFUS 2JTZA 1CFPA 2LMUA 1M46A 3CZTX 1AJ5A 2BCXA 3NSKA 2WOSA 2JT8A 1MWNA 2LM5A 1YUTA 3DYEA 2OS8B 2K2FA 2MLFC 1YUUA 1PVBA 1N0YA 3SS5A 4P2YB 1TUZA 1ZUZA 1JFKA 1ODBA 3NSLA 3NHTA 3OGNA 2L50A 1K95A 1CDPA 2K60A 3R72A 5FI6A 1XA5A 4MSPA 4MZLA 5D7FA 1MXEA 2I7AA 3WNXB 4M2OA 1HT9A 3FE9A 4PALA 1KFUL 1CB1A 3B87A 1UHJA 1ALVA 1A75A 5AXIA 4C0KA 1JBAA 2WC5A 1AHRA 1L2OB 1OQPA 3HCMA 4GUKA 2MJWB 1XFZO 3K1EA 3O4YA 5AANA 4PE4A 1YURA 1OZSA 1DJIA 1DJWA 1QX5B 2H2KA 3D75A 1AVSA 2NXQA 3CGAA 1SKTA 1ZFSA 4L9MA 3OB1B 3A4UB 1M63B 2OTGB 1K2HA 5I2OA 3Q8IA 3I5HC 2MBXA 4IL1A 2JULA 2WCHA 3OHMB 2FJUB 4CIDA 1SK6D 1OMDA 4OZDA 2Y1MA 5TNCA 4N5XA 2L5XB 3PJIA 5IBWA 3GK1A 2EGDA 3FWCA 3TS5B 4DUQA 3JVTB 1UUSA 2LMTA 3DVMA 1TTXA 1QLKA 3IF7A 3BUOB 4HREE 2WCBA 4QJ4B 1KSMA 3O2PA 1M45A 1DF0B 2A4JA 1MHOA 2GTEA 4R1EA 4C0JA 1BU3A 1CM1A 1ALWA 1RROA 1A4PA 2L98A 2WCKA 4FTGA 4ZCUA 2TN4A 4ETOA 1BLQA 2KQYA 2KAVA 5B8IB 1QX7A 2HPSA 2LCPA 3DZTA 2WCMA 1IRJA 1GJYA 1SR6C 2JPOA 3DVEA 4QJ5B 2I94A 4INXA 1SNLA 1IQ3A 3ZWHA 4YGEB 5KTYA 5HYDA 4YGAA 2Y5IA 1F55A 2MA2A 1CLBA 1K8UA 1GGZA 1J1DA 3LL8B 2Q4UA 2JNXA 2KBMA 3BOWA 1A03A 2L2EA 2KI6D 3EVVA 1S26D 2L0PA 4MRXA 4ZCVA 1QTXA 1G4YR 1ZOTB 3A8RA 1YVHA 1LVCD 3TDIA 2FCDA 2BL0C 5HLOA 2LC5A 3EVRA 2JRFA 3QMEA 2ISDA 3JTDB 3C1VA 3CZ2A 1BR1B 3PN7B 1NPQA 2I2RE 2Q91A 2COLB 1NCYA 2AUCA 4PE0A 1KK8B 4JKTA 2LUCA 1UP5A 1AJ4A 1DJXA 2JQ6A 3LLEA 1Y1XA 2M7NA 1VRKA 2L5YA 2LE9B 4NDBA 1XFRA 3LCPC 2M9GA 2JU0A 3D77A 2KSPA 1LA3A 1PALA 2BKHB 3CLNA 4WQ2A 3UNWA 2P71A 2KFFA 2PALA 4HSZA 3VRNA 3TUYC 1J7RA 1V1GA 1XO5A 1YUSA 2NCPA 3L4LA 5ER4X 1C3YA 3VROA 2KYCA 4YGCB 3ZNIA 4E68A 1IKUA 1AUIB 2LHIA 1OOFA 3GOFA 1RWYA 1SSEB 1TCFA 1WDCB 2LLTA 3BFBA 5I8NA 4U8DA 1IWQA 4C0LA 1PULA 2EC6B 1G8IA 1JFJA 1AK8A 4HRGA 4OR9B 2LV7A 2L51A 4ICBA 1WLZA 3BFHA 2QEBA 3K21A 1A2XA 4P5OE 1MR8A 1WRZA 4ORAB 1J55A 1J7QA 1B8RA 1QS7A 1R2UA 2NZ0A 1LKJA 1KCYA 3OX6A 3FWBA 1BR4B 1M39A 4N1FA 4I5NB 1YX8A 5JOLA 5I2LA 3SG4A 2ZNDA 1CFDA 1K94A 3I5FC 2JWWA 3AAKA 3VGOA 1EH2A 1Z2CB 1YRTB 1DF0A 1K93D 2K8MB 1QV0A 1YX7A 1KK7Y 3BUNB 4DRWA 1Y6WA 1C07A 5DKRA 3EKJA 3TZ1A 2LAPA 5HKWA 2K7OA 1YVLA 2QEOA 2WNDA 4JWQA 1KK7Z 5JJGA 3R1OA 1SCMB 1DMOA 2M1KB 2WC8A 1DJZA 3D10A 1V1FA 1NUBA 3I5IC 1PSRA 5HKYA 5CSNA 3OX5A 1CFCA 3D78A 2K0JA 4MBEA 1KQVA 2KNEA 5DICA 3AKAA 1B9AA 2LLSA 3CZ0A 3DXLA 3VRQA 3PSRA 1S6IA 4M2PA 1B47A 2BCAA 1BJFA 2H61A 1SW8A 2WCFA 1FI6A 3E3RA 4I5JA 5HL1A 2KLDA 1OOIX 2LVIA 2LUXA 1XYDA 2KLEA 4MEWA 5HLVA 5D3OA 1UHHA 1JC2A 1NIWA 2H8VA 2O5GA 2LMVA 1F54A 1ZACA 1F4QA 4CLNA 3D0YB 2CT9A 2G9BA 3OP0A 1OOJA 1JUOA 1KQMB 2M97A 2BCBA 5FI2A 1E8AA 1CTRA 5DKNA 2QACA 3FE8A 1FW4A 2PQLA 3I5GC 4M2QA 1U5IB 2QEVA 1DVIA 1PK0D 2KFGA 2JT0A 2ZKMX 3M0WA 4PE1A 1QLSA 2G2BA 1S6CA 2KI4B 3HX4A 1EG4A 5GQQC 1JF2A 5BPJA 2WC6A 1OMRA 3FE6A 3S0DA 2LLUA 1FF1A 2I18A 4MZJA 3EVUA 1DQEA 3DF0A 4Q04A 1B1GA 1QIVA 2HQ8A 2LVJA 1MUXA 4GGNA 4I5LB 3FS7A 5DKQA 1EXRA 1IIOA 1SPYA 1K9PA 2MHHA 1UHNA 3F45A 5I2QA 4DS7A 4ORBB 3UO9A 2R2IA 3D73A 3SG7A 3S0GA 1F4OA 3D76A 4YI8A 5FYXA 3DVJA 1WLMA 1QATA 2V53A 3I5IB 3L4AA 2K7DA 1BMOA 3PATA 2E30A 5KSZA 1UURA 1K96A 3NGVA 3O6BA 4CFRA 1NWDA 2KPHA 1HQVA 5AEQA 1C7VA 1J7PA 4XJKA 1B7TY 1L7ZA 3VRPA 5CSFA 1KWOC 1NX3A 1DC1A 2JT3A 4USLA 3SJSA 3DY9A 2KDHA 1B7TZ 3BQ3A 4KYNA 3EK4A 3B7AA 1MXLC 2LVVA 4FQTA 4YGBB 3I5HB 3SG3A 4PE7A 3WXAA 1CDMA 1JSAA 2LP3A 1CKKA 2F33A 2KBIA 1BT6A 1OW4A 1D1OA 4JD9A 1IGVA 2LANA 3L47A 5I94A 1BG1A 1BODA 1J7OA 1W7JB 3CR4X 5CSIA 1NCZA 2AAOA 2L4HA 3CABA 2OS8C 1DGUA 2PRUA 3NSOA 4I5KA 1TNPA 4D1EA 2ZFDA 1N2DA 1TRFA 2PASA 3RLZA 3KEVA 1QVIY 2M7LA 5D69A 3EKHA 2YGUA 3CDNA 5K89A 1NX0A 1XFUO 2Y4QA 1T14A 2JTTA 2QEHA 1OOGA 1QV1A 5KU1A 1DJYA 1QVIZ 1IQ5A 3GK4X 1CLMA 3B86A 1F8HA 3FIAA 1SL9A 3WHUB 1N65A 1QWVA 1Y1AA 4MN0A 2JXLA 1SR6B 1JWDA 2QPTA 1NCXA 1YRUB 1X02A 2M1UA 1L2OC 2WCEA 2PMYA 1KFXL 1Y1UA 4GNKB 4AQIA 2BKIB 2KQ6A 2BNXA 1WRKA 2GGZA 3D0YA 2M29A 1GGWA 1IJ6A 2LHLA 2P6BB 2P70A 1EL4A 1FI5A 4DCKA 3CR5X 3CR2A 1TOPA 4N1GA 3BUXB 3N7HA 1ZMZA 1SY9A 1LA0A 4OCIA 1IH0A 1QJTA 3BUWB 2FOTA 3H4SE 3VB1A 2BL0B 3NHIA 1OSAA 2D8NA 1W9ZA 2JC2A 2IS9A 1CMFA 1QIWA 4DIRA 3CZ1A 3TDZA 1MF8B 2KAYA 3OB2B 2M49B 3EK8A 2M0RA 3TS5C 4OV2A 3JVTC 3NSIA 3RZSA 3S0AA 1RTP1 2OPOA
chains in the Genus database with same CATH topology
4A4CA 1Y0VH 1SL8A 4ORCB 1NX2A 5PALA 1BF5A 4OKHA 2HQWA 1XFVO 3IQQA 4GAOA 2FCEA 2GV5A 1AP4A 1GQMA 2O60A 1PSBA 1S1EA 3SG5A 3TUYB 4YRUA 1J1EA 3LK1A 1B8LA 4MRYA 1NP8A 2JXCA 2L4IA 3TDUA 1CNPA 4HRHA 2F2OA 2HETA 2JOJA 2K7CA 1CDLA 2EHBA 1EJ3A 1TCOB 1UHIA 2JZIA 2H61C 2KAXA 1SMGA 5HKZA 4JQ0D 1F71A 3KO0A 3JTDC 1Q80A 1IJ5A 2JPTA 1UWOA 3PFVA 3PN7C 4GGFA 4A4BA 1K9UA 1CDNA 2F3ZA 2K2AA 2MLEC 2MRDA 2JNFA 1KK8C 3KPXA 4FQOA 1YTZC 4PHJA 1B8CA 4XYNA 1UHKA 2K7BA 4MZKA 2NLNA 1SYMA 1WRLA 2F2PA 1OMVA 1RJVA 1LINA 4YBHB 2VRGA 3SG6A 1TN4A 2NCOA 3SIAA 4GGFC 2BECA 2K61A 3I5FB 5AERA 1KSOA 1CLLA 4YGDB 1RECA 2LVKA 2ZN9A 1H4BA 3VRRA 1EG3A 1DGVA 1LXFC 1YR5A 1B4CA 1DJGA 3SG2A 1TNXA 2KFHA 1G33A 2WORA 4AQJA 2CNPA 2KGBC 2KOTA 3NXAA 5G08A 3WHTB 1QASA 2ZRSA 2ZN8A 1OE9B 2DOQA 1QX2A 3BYAA 2M3WA 4AOMA 1CFFA 3GK2A 1OZOA 4PDZA 5J3XA 1WDCC 2BE6A 2BE4A 1FBVA 2BBMA 1PVAA 2MAZA 4MLWA 1DTLA 2EC6C 1K90D 3AAJA 1SRAA 3DVKA 4MVFA 2E6WA 1XFWO 1NYAA 2SASA 2BBNA 1F70A 5AFPA 2M8UA 3CWGA 1A75B 4BY5A 2Y1NA 3PALA 1DT7B 1IG5A 3KF9A 2KHNA 3EK7A 2KI6C 3PM8A 2PSRA 1KFXS 1TIZA 3CTNA 4NDCA 1JF0A 3SIBA 4BY4A 1S36A 1QXPA 1S5GY 1RFJA 2GGMA 3I5GB 4PHNA 2CCMA 1WY9A 2SCPA 2B1UA 4PHKA 3IQOA 1S5GZ 1FPWA 3QRXA 2LP2A 1W7IB 1XFYO 2HF5A 1SCMC 4CPVA 1SBJA 1C7WA 1XK4A 4GBAA 2RGIA 4PCWA 5CSJA 4OVNF 1R6PA 4QJ3B 1S3PA 3AKBA 1NX1A 1S6JA 2F3YA 3BUMB 4UPGA 2CBLA 2CTNA 2KYFA 1XK4C 4PHMA 4F0ZB 3DF0B 4WQ3A 2CXJA 1A29A 3LK0A 4CFQA 3BXKA 4GFTA 2LNKA 1U5IA 1PRWA 1SL7A 1M31A 3RM1A 2OTGC 3O78A 1CMGA 1SCVA 3DD4A 5F6TA 1CM4A 4JPZB 2F8PA 1MQ1A 3CS1A 4YI9A 2ZRTA 1RK9A 1K9KA 1KQMC 4NQGA 4WRIA 1KWOB 2ZNEA 1XVJA 3BOWB 5CPVA 4TNCA 3MSEB 5ER5A 1TNWA 1NSHA 1TNQA 2AMIA 2KGRA 1H8BA 1DJHA 2KI4C 3KHEA 4NDDA 3ICBA 1XFXO 3PLFB 2PVBA 4GPLB 4XJKB 1KFUS 2JTZA 1CFPA 2LMUA 1M46A 3CZTX 1AJ5A 2BCXA 3NSKA 2WOSA 2JT8A 1MWNA 2LM5A 1YUTA 2OS8B 2K2FA 2MLFC 1YUUA 1PVBA 1N0YA 4P2YB 1ZUZA 1JFKA 1ODBA 3NSLA 2L50A 1K95A 1CDPA 1XA5A 4MSPA 4MZLA 5D7FA 1MXEA 2I7AA 3WNXB 4M2OA 1HT9A 4PALA 1KFUL 1CB1A 1UHJA 1ALVA 1A75A 5AXIA 4C0KA 1JBAA 1AHRA 1L2OB 1OQPA 3HCMA 4GUKA 2MJWB 1XFZO 3O4YA 5AANA 4PE4A 1YURA 1OZSA 1DJIA 1DJWA 1QX5B 2H2KA 1AVSA 2NXQA 3CGAA 1SKTA 1ZFSA 4L9MA 3OB1B 3A4UB 1M63B 2OTGB 1K2HA 5I2OA 3I5HC 2MBXA 4IL1A 2JULA 3OHMB 2FJUB 4CIDA 1SK6D 1OMDA 2Y1MA 5TNCA 4N5XA 2L5XB 5IBWA 3GK1A 2EGDA 3FWCA 3TS5B 4DUQA 3JVTB 1UUSA 2LMTA 3DVMA 1TTXA 1QLKA 3IF7A 3BUOB 4HREE 2WCBA 4QJ4B 1KSMA 3O2PA 1M45A 1DF0B 2A4JA 1MHOA 4R1EA 4C0JA 1BU3A 1CM1A 1ALWA 1RROA 1A4PA 2L98A 4FTGA 4ZCUA 4ETOA 2TN4A 1BLQA 2KQYA 2KAVA 5B8IB 1QX7A 2HPSA 2LCPA 1IRJA 1GJYA 1SR6C 3DVEA 4QJ5B 2I94A 1IQ3A 1SNLA 3ZWHA 4YGEB 5KTYA 5HYDA 4YGAA 2Y5IA 1F55A 2MA2A 1CLBA 1K8UA 1J1DA 1GGZA 3LL8B 2Q4UA 2JNXA 2KBMA 3BOWA 1A03A 2L2EA 2KI6D 3EVVA 1S26D 2L0PA 4MRXA 4ZCVA 1QTXA 1G4YR 1ZOTB 3A8RA 1YVHA 1LVCD 3TDIA 2FCDA 2BL0C 5HLOA 2LC5A 3EVRA 2JRFA 2ISDA 3JTDB 3C1VA 1BR1B 3PN7B 1NPQA 2I2RE 2Q91A 2COLB 1NCYA 2AUCA 4PE0A 1KK8B 2LUCA 1UP5A 1AJ4A 1DJXA 2JQ6A 3LLEA 1Y1XA 2M7NA 1VRKA 2LE9B 4NDBA 3LCPC 2M9GA 2JU0A 2KSPA 1LA3A 1PALA 2BKHB 3CLNA 4WQ2A 4HSZA 2KFFA 2PALA 3VRNA 3TUYC 1J7RA 1V1GA 1XO5A 1YUSA 2NCPA 5ER4X 3VROA 2KYCA 4YGCB 3ZNIA 4E68A 1IKUA 1AUIB 2LHIA 3GOFA 1RWYA 1TCFA 1WDCB 2LLTA 5I8NA 4U8DA 1IWQA 4C0LA 1PULA 2EC6B 1G8IA 1JFJA 1AK8A 4HRGA 4OR9B 2LV7A 2L51A 4ICBA 1WLZA 3K21A 1A2XA 4P5OE 1MR8A 1WRZA 4ORAB 1J55A 1J7QA 1B8RA 1QS7A 1R2UA 2NZ0A 1LKJA 1KCYA 3OX6A 3FWBA 1BR4B 1M39A 4N1FA 4I5NB 1YX8A 5JOLA 5I2LA 3SG4A 2ZNDA 1CFDA 1K94A 3I5FC 2JWWA 3AAKA 3VGOA 1EH2A 1YRTB 1DF0A 1K93D 2K8MB 1QV0A 1YX7A 1KK7Y 3BUNB 4DRWA 1Y6WA 1C07A 5DKRA 3EKJA 3TZ1A 2LAPA 5HKWA 2K7OA 1YVLA 2WNDA 4JWQA 1KK7Z 5JJGA 1SCMB 1DMOA 2M1KB 2WC8A 1DJZA 3D10A 1V1FA 1NUBA 3I5IC 1PSRA 5HKYA 5CSNA 3OX5A 1CFCA 2K0JA 4MBEA 1KQVA 2KNEA 3AKAA 1B9AA 2LLSA 3VRQA 3PSRA 1S6IA 4M2PA 1B47A 2BCAA 1BJFA 2H61A 1SW8A 2WCFA 1FI6A 3E3RA 4I5JA 2LUXA 2LVIA 1XYDA 4MEWA 5HLVA 1UHHA 1JC2A 1NIWA 2O5GA 2LMVA 1F54A 1ZACA 1F4QA 4CLNA 3D0YB 2CT9A 2G9BA 3OP0A 1OOJA 1JUOA 1KQMB 2M97A 2BCBA 1E8AA 1CTRA 5DKNA 2QACA 1FW4A 3I5GC 4M2QA 1U5IB 1DVIA 1PK0D 2KFGA 2JT0A 2ZKMX 3M0WA 4PE1A 1QLSA 2G2BA 1S6CA 2KI4B 3HX4A 1EG4A 5GQQC 1JF2A 1OMRA 2LLUA 1FF1A 2I18A 4MZJA 3EVUA 1B1GA 3DF0A 4Q04A 1QIVA 2HQ8A 2LVJA 1MUXA 4GGNA 4I5LB 3FS7A 5DKQA 1EXRA 1SPYA 1K9PA 2MHHA 1UHNA 3F45A 5I2QA 4DS7A 4ORBB 2R2IA 3SG7A 1F4OA 4YI8A 5FYXA 3DVJA 1WLMA 1QATA 2V53A 3I5IB 2K7DA 1BMOA 3PATA 2E30A 5KSZA 1UURA 1K96A 3O6BA 4CFRA 1NWDA 1HQVA 5AEQA 1C7VA 1J7PA 4XJKA 1B7TY 1L7ZA 3VRPA 5CSFA 1KWOC 1NX3A 2JT3A 4USLA 3SJSA 2KDHA 1B7TZ 3BQ3A 3EK4A 1MXLC 2LVVA 4YGBB 3I5HB 3SG3A 4PE7A 3WXAA 1CDMA 1JSAA 2LP3A 1CKKA 2F33A 2KBIA 1BT6A 1D1OA 1IGVA 2LANA 1BG1A 1BODA 1J7OA 1W7JB 3CR4X 5CSIA 1NCZA 2AAOA 2L4HA 2OS8C 1DGUA 2PRUA 3NSOA 4I5KA 1TNPA 4D1EA 2ZFDA 1N2DA 1TRFA 2PASA 3RLZA 3KEVA 1QVIY 2M7LA 5D69A 3EKHA 5K89A 1BOCA 1NX0A 1XFUO 2Y4QA 2JTTA 1QV1A 5KU1A 1DJYA 1QVIZ 1IQ5A 3GK4X 1CLMA 1F8HA 3FIAA 1SL9A 3WHUB 1N65A 1Y1AA 4MN0A 2JXLA 1SR6B 1JWDA 2QPTA 1NCXA 1YRUB 1X02A 2M1UA 1L2OC 2WCEA 2PMYA 1KFXL 1Y1UA 4GNKB 4AQIA 2BKIB 2KQ6A 5BPJA 1WRKA 2GGZA 3D0YA 2M29A 1GGWA 1IJ6A 2LHLA 2P6BB 1FI5A 1EL4A 4DCKA 3CR5X 3CR2A 1TOPA 4N1GA 3BUXB 1ZMZA 1SY9A 1LA0A 4OCIA 1IH0A 1QJTA 3BUWB 2FOTA 3H4SE 2BL0B 1OSAA 2D8NA 2JC2A 2IS9A 1CMFA 1QIWA 4DIRA 3TDZA 1MF8B 2KAYA 3OB2B 2M49B 3EK8A 2M0RA 3TS5C 4OV2A 3JVTC 3NSIA 1RTP1 2OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  1Y0V H;  1SL8 A;  4ORC B;  1NX2 A;  5PAL A;  1BF5 A;  4OKH A;  2HQW A;  1XFV O;  3IQQ A;  4GAO A;  2FCE A;  2GV5 A;  1AP4 A;  1GQM A;  2O60 A;  1PSB A;  1S1E A;  3SG5 A;  3TUY B;  4YRU A;  1J1E A;  3LK1 A;  1B8L A;  4MRY A;  1NP8 A;  2JXC A;  2L4I A;  3TDU A;  1CNP A;  4HRH A;  2F2O A;  2HET A;  2JOJ A;  2K7C A;  1CDL A;  2EHB A;  1EJ3 A;  1TCO B;  1UHI A;  2JZI A;  2H61 C;  2KAX A;  1SMG A;  5HKZ A;  4JQ0 D;  1F71 A;  3KO0 A;  3JTD C;  1Q80 A;  1IJ5 A;  2JPT A;  1UWO A;  3PFV A;  3PN7 C;  4GGF A;  4A4B A;  1K9U A;  1CDN A;  2F3Z A;  2K2A A;  2MLE C;  2MRD A;  2JNF A;  1KK8 C;  3KPX A;  4FQO A;  1YTZ C;  4PHJ A;  1B8C A;  4XYN A;  1UHK A;  2K7B A;  4MZK A;  2NLN A;  1SYM A;  1WRL A;  2F2P A;  1OMV A;  1RJV A;  1LIN A;  4YBH B;  2VRG A;  3SG6 A;  1TN4 A;  2NCO A;  3SIA A;  4GGF C;  2BEC A;  2K61 A;  3I5F B;  5AER A;  1KSO A;  1CLL A;  4YGD B;  1REC A;  2LVK A;  2ZN9 A;  1H4B A;  3VRR A;  1EG3 A;  1DGV A;  1LXF C;  1YR5 A;  1B4C A;  1DJG A;  3SG2 A;  1TNX A;  2KFH A;  1G33 A;  2WOR A;  4AQJ A;  2CNP A;  2KGB C;  2KOT A;  3NXA A;  5G08 A;  3WHT B;  1QAS A;  2ZRS A;  2ZN8 A;  1OE9 B;  2DOQ A;  1QX2 A;  3BYA A;  2M3W A;  4AOM A;  1CFF A;  3GK2 A;  1OZO A;  4PDZ A;  5J3X A;  1WDC C;  2BE6 A;  2BE4 A;  1FBV A;  2BBM A;  1PVA A;  2MAZ A;  4MLW A;  1DTL A;  2EC6 C;  1K90 D;  3AAJ A;  1SRA A;  3DVK A;  4MVF A;  2E6W A;  1XFW O;  1NYA A;  2SAS A;  2BBN A;  1F70 A;  5AFP A;  2M8U A;  3CWG A;  1A75 B;  4BY5 A;  2Y1N A;  3PAL A;  1DT7 B;  1IG5 A;  3KF9 A;  2KHN A;  3EK7 A;  2KI6 C;  3PM8 A;  2PSR A;  1KFX S;  1TIZ A;  3CTN A;  4NDC A;  1JF0 A;  3SIB A;  4BY4 A;  1S36 A;  1QXP A;  1S5G Y;  1RFJ A;  2GGM A;  3I5G B;  4PHN A;  2CCM A;  1WY9 A;  2SCP A;  2B1U A;  4PHK A;  3IQO A;  1S5G Z;  1FPW A;  3QRX A;  2LP2 A;  1W7I B;  1XFY O;  2HF5 A;  1SCM C;  4CPV A;  1SBJ A;  1C7W A;  1XK4 A;  4GBA A;  2RGI A;  4PCW A;  5CSJ A;  4OVN F;  1R6P A;  4QJ3 B;  1S3P A;  3AKB A;  1NX1 A;  1S6J A;  2F3Y A;  3BUM B;  4UPG A;  2CBL A;  2CTN A;  2KYF A;  1XK4 C;  4PHM A;  4F0Z B;  3DF0 B;  4WQ3 A;  2CXJ A;  1A29 A;  3LK0 A;  4CFQ A;  3BXK A;  4GFT A;  2LNK A;  1U5I A;  1PRW A;  1SL7 A;  1M31 A;  3RM1 A;  2OTG C;  3O78 A;  1CMG A;  1SCV A;  3DD4 A;  5F6T A;  1CM4 A;  4JPZ B;  2F8P A;  1MQ1 A;  3CS1 A;  4YI9 A;  2ZRT A;  1RK9 A;  1K9K A;  1KQM C;  4NQG A;  4WRI A;  1KWO B;  2ZNE A;  1XVJ A;  3BOW B;  5CPV A;  4TNC A;  3MSE B;  5ER5 A;  1TNW A;  1NSH A;  1TNQ A;  2AMI A;  2KGR A;  1H8B A;  1DJH A;  2KI4 C;  3KHE A;  4NDD A;  3ICB A;  1XFX O;  3PLF B;  2PVB A;  4GPL B;  4XJK B;  1KFU S;  2JTZ A;  1CFP A;  2LMU A;  1M46 A;  3CZT X;  1AJ5 A;  2BCX A;  3NSK A;  2WOS A;  2JT8 A;  1MWN A;  2LM5 A;  1YUT A;  2OS8 B;  2K2F A;  2MLF C;  1YUU A;  1PVB A;  1N0Y A;  4P2Y B;  1ZUZ A;  1JFK A;  1ODB A;  3NSL A;  2L50 A;  1K95 A;  1CDP A;  1XA5 A;  4MSP A;  4MZL A;  5D7F A;  1MXE A;  2I7A A;  3WNX B;  4M2O A;  1HT9 A;  4PAL A;  1KFU L;  1CB1 A;  1UHJ A;  1ALV A;  1A75 A;  5AXI A;  4C0K A;  1JBA A;  1AHR A;  1L2O B;  1OQP A;  3HCM A;  4GUK A;  2MJW B;  1XFZ O;  3O4Y A;  5AAN A;  4PE4 A;  1YUR A;  1OZS A;  1DJI A;  1DJW A;  1QX5 B;  2H2K A;  1AVS A;  2NXQ A;  3CGA A;  1SKT A;  1ZFS A;  4L9M A;  3OB1 B;  3A4U B;  1M63 B;  2OTG B;  1K2H A;  5I2O A;  3I5H C;  2MBX A;  4IL1 A;  2JUL A;  3OHM B;  2FJU B;  4CID A;  1SK6 D;  1OMD A;  2Y1M A;  5TNC A;  4N5X A;  2L5X B;  5IBW A;  3GK1 A;  2EGD A;  3FWC A;  3TS5 B;  4DUQ A;  3JVT B;  1UUS A;  2LMT A;  3DVM A;  1TTX A;  1QLK A;  3IF7 A;  3BUO B;  4HRE E;  2WCB A;  4QJ4 B;  1KSM A;  3O2P A;  1M45 A;  1DF0 B;  2A4J A;  1MHO A;  4R1E A;  4C0J A;  1BU3 A;  1CM1 A;  1ALW A;  1RRO A;  1A4P A;  2L98 A;  4FTG A;  4ZCU A;  4ETO A;  2TN4 A;  1BLQ A;  2KQY A;  2KAV A;  5B8I B;  1QX7 A;  2HPS A;  2LCP A;  1IRJ A;  1GJY A;  1SR6 C;  3DVE A;  4QJ5 B;  2I94 A;  1IQ3 A;  1SNL A;  3ZWH A;  4YGE B;  5KTY A;  5HYD A;  4YGA A;  2Y5I A;  1F55 A;  2MA2 A;  1CLB A;  1K8U A;  1J1D A;  1GGZ A;  3LL8 B;  2Q4U A;  2JNX A;  2KBM A;  3BOW A;  1A03 A;  2L2E A;  2KI6 D;  3EVV A;  1S26 D;  2L0P A;  4MRX A;  4ZCV A;  1QTX A;  1G4Y R;  1ZOT B;  3A8R A;  1YVH A;  1LVC D;  3TDI A;  2FCD A;  2BL0 C;  5HLO A;  2LC5 A;  3EVR A;  2JRF A;  2ISD A;  3JTD B;  3C1V A;  1BR1 B;  3PN7 B;  1NPQ A;  2I2R E;  2Q91 A;  2COL B;  1NCY A;  2AUC A;  4PE0 A;  1KK8 B;  2LUC A;  1UP5 A;  1AJ4 A;  1DJX A;  2JQ6 A;  3LLE A;  1Y1X A;  2M7N A;  1VRK A;  2LE9 B;  4NDB A;  3LCP C;  2M9G A;  2JU0 A;  2KSP A;  1LA3 A;  1PAL A;  2BKH B;  3CLN A;  4WQ2 A;  4HSZ A;  2KFF A;  2PAL A;  3VRN A;  3TUY C;  1J7R A;  1V1G A;  1XO5 A;  1YUS A;  2NCP A;  5ER4 X;  3VRO A;  2KYC A;  4YGC B;  3ZNI A;  4E68 A;  1IKU A;  1AUI B;  2LHI A;  3GOF A;  1RWY A;  1TCF A;  1WDC B;  2LLT A;  5I8N A;  4U8D A;  1IWQ A;  4C0L A;  1PUL A;  2EC6 B;  1G8I A;  1JFJ A;  1AK8 A;  4HRG A;  4OR9 B;  2LV7 A;  2L51 A;  4ICB A;  1WLZ A;  3K21 A;  1A2X A;  4P5O E;  1MR8 A;  1WRZ A;  4ORA B;  1J55 A;  1J7Q A;  1B8R A;  1QS7 A;  1R2U A;  2NZ0 A;  1LKJ A;  1KCY A;  3OX6 A;  3FWB A;  1BR4 B;  1M39 A;  4N1F A;  4I5N B;  1YX8 A;  5JOL A;  5I2L A;  3SG4 A;  2ZND A;  1CFD A;  1K94 A;  3I5F C;  2JWW A;  3AAK A;  3VGO A;  1EH2 A;  1YRT B;  1DF0 A;  1K93 D;  2K8M B;  1QV0 A;  1YX7 A;  1KK7 Y;  3BUN B;  4DRW A;  1Y6W A;  1C07 A;  5DKR A;  3EKJ A;  3TZ1 A;  2LAP A;  5HKW A;  2K7O A;  1YVL A;  2WND A;  4JWQ A;  1KK7 Z;  5JJG A;  1SCM B;  1DMO A;  2M1K B;  2WC8 A;  1DJZ A;  3D10 A;  1V1F A;  1NUB A;  3I5I C;  1PSR A;  5HKY A;  5CSN A;  3OX5 A;  1CFC A;  2K0J A;  4MBE A;  1KQV A;  2KNE A;  3AKA A;  1B9A A;  2LLS A;  3VRQ A;  3PSR A;  1S6I A;  4M2P A;  1B47 A;  2BCA A;  1BJF A;  2H61 A;  1SW8 A;  2WCF A;  1FI6 A;  3E3R A;  4I5J A;  2LUX A;  2LVI A;  1XYD A;  4MEW A;  5HLV A;  1UHH A;  1JC2 A;  1NIW A;  2O5G A;  2LMV A;  1F54 A;  1ZAC A;  1F4Q A;  4CLN A;  3D0Y B;  2CT9 A;  2G9B A;  3OP0 A;  1OOJ A;  1JUO A;  1KQM B;  2M97 A;  2BCB A;  1E8A A;  1CTR A;  5DKN A;  2QAC A;  1FW4 A;  3I5G C;  4M2Q A;  1U5I B;  1DVI A;  1PK0 D;  2KFG A;  2JT0 A;  2ZKM X;  3M0W A;  4PE1 A;  1QLS A;  2G2B A;  1S6C A;  2KI4 B;  3HX4 A;  1EG4 A;  5GQQ C;  1JF2 A;  1OMR A;  2LLU A;  1FF1 A;  2I18 A;  4MZJ A;  3EVU A;  1B1G A;  3DF0 A;  4Q04 A;  1QIV A;  2HQ8 A;  2LVJ A;  1MUX A;  4GGN A;  4I5L B;  3FS7 A;  5DKQ A;  1EXR A;  1SPY A;  1K9P A;  2MHH A;  1UHN A;  3F45 A;  5I2Q A;  4DS7 A;  4ORB B;  2R2I A;  3SG7 A;  1F4O A;  4YI8 A;  5FYX A;  3DVJ A;  1WLM A;  1QAT A;  2V53 A;  3I5I B;  2K7D A;  1BMO A;  3PAT A;  2E30 A;  5KSZ A;  1UUR A;  1K96 A;  3O6B A;  4CFR A;  1NWD A;  1HQV A;  5AEQ A;  1C7V A;  1J7P A;  4XJK A;  1B7T Y;  1L7Z A;  3VRP A;  5CSF A;  1KWO C;  1NX3 A;  2JT3 A;  4USL A;  3SJS A;  2KDH A;  1B7T Z;  3BQ3 A;  3EK4 A;  1MXL C;  2LVV A;  4YGB B;  3I5H B;  3SG3 A;  4PE7 A;  3WXA A;  1CDM A;  1JSA A;  2LP3 A;  1CKK A;  2F33 A;  2KBI A;  1BT6 A;  1D1O A;  1IGV A;  2LAN A;  1BG1 A;  1BOD A;  1J7O A;  1W7J B;  3CR4 X;  5CSI A;  1NCZ A;  2AAO A;  2L4H A;  2OS8 C;  1DGU A;  2PRU A;  3NSO A;  4I5K A;  1TNP A;  4D1E A;  2ZFD A;  1N2D A;  1TRF A;  2PAS A;  3RLZ A;  3KEV A;  1QVI Y;  2M7L A;  5D69 A;  3EKH A;  5K89 A;  1BOC A;  1NX0 A;  1XFU O;  2Y4Q A;  2JTT A;  1QV1 A;  5KU1 A;  1DJY A;  1QVI Z;  1IQ5 A;  3GK4 X;  1CLM A;  1F8H A;  3FIA A;  1SL9 A;  3WHU B;  1N65 A;  1Y1A A;  4MN0 A;  2JXL A;  1SR6 B;  1JWD A;  2QPT A;  1NCX A;  1YRU B;  1X02 A;  2M1U A;  1L2O C;  2WCE A;  2PMY A;  1KFX L;  1Y1U A;  4GNK B;  4AQI A;  2BKI B;  2KQ6 A;  5BPJ A;  1WRK A;  2GGZ A;  3D0Y A;  2M29 A;  1GGW A;  1IJ6 A;  2LHL A;  2P6B B;  1FI5 A;  1EL4 A;  4DCK A;  3CR5 X;  3CR2 A;  1TOP A;  4N1G A;  3BUX B;  1ZMZ A;  1SY9 A;  1LA0 A;  4OCI A;  1IH0 A;  1QJT A;  3BUW B;  2FOT A;  3H4S E;  2BL0 B;  1OSA A;  2D8N A;  2JC2 A;  2IS9 A;  1CMF A;  1QIW A;  4DIR A;  3TDZ A;  1MF8 B;  2KAY A;  3OB2 B;  2M49 B;  3EK8 A;  2M0R A;  3TS5 C;  4OV2 A;  3JVT C;  3NSI A;  1RTP 1;  2OPO A; 
#chains in the Genus database with same CATH topology
 4A4C A;  1Y0V H;  1SL8 A;  1Z4H A;  1NX2 A;  4ORC B;  5PAL A;  4INW A;  1BF5 A;  4OKH A;  2HQW A;  1XFV O;  3IQQ A;  4GAO A;  2FCE A;  2GV5 A;  1AP4 A;  1GQM A;  2O60 A;  1PSB A;  1S1E A;  3SS3 A;  3SG5 A;  3TUY B;  3S0B A;  4YRU A;  1J1E A;  3LK1 A;  1B8L A;  4MRY A;  1NP8 A;  2JXC A;  1P28 A;  2L4I A;  3B6X A;  4HRH A;  4PT1 A;  3TDU A;  1CNP A;  2F2O A;  2HET A;  2JOJ A;  2K7C A;  1CDL A;  2EHB A;  1EJ3 A;  1TCO B;  1UHI A;  2JZI A;  2H61 C;  2KAX A;  1SMG A;  4IJ7 A;  1GM0 A;  5HKZ A;  4JQ0 D;  1F71 A;  3KO0 A;  3JTD C;  1Q80 A;  1IJ5 A;  2JPT A;  1UWO A;  3PFV A;  3PN7 C;  4GGF A;  1BOC A;  4A4B A;  1K9U A;  1LS8 A;  2F3Z A;  2K2A A;  2MLE C;  2MRD A;  1CDN A;  2JNF A;  1KK8 C;  2WCJ A;  3KPX A;  1YTZ C;  4FQO A;  4PHJ A;  1B8C A;  4XYN A;  3OBV A;  1UHK A;  2K7B A;  4MZK A;  1ORG A;  2NLN A;  1SYM A;  1WRL A;  2F2P A;  1OMV A;  1RJV A;  1LIN A;  4YBH B;  2VRG A;  3SG6 A;  1TN4 A;  2NCO A;  3SIA A;  4GGF C;  2BEC A;  2K61 A;  3I5F B;  5EL2 A;  5AER A;  1KSO A;  1CLL A;  4YGD B;  1REC A;  2LVK A;  2ZN9 A;  1H4B A;  3VRR A;  1TUJ A;  1EG3 A;  3R1V A;  1DGV A;  1LXF C;  1YR5 A;  3BFA A;  1B4C A;  1DJG A;  3SG2 A;  1TNX A;  2KFH A;  1G33 A;  2WOR A;  4AQJ A;  2CNP A;  2KGB C;  2KOT A;  3NXA A;  5G08 A;  3WHT B;  1QAS A;  2ZRS A;  2ZN8 A;  1OE9 B;  2DOQ A;  1QX2 A;  2PYQ A;  2M3W A;  3BYA A;  3SS4 A;  4AOM A;  1CFF A;  3IVT A;  3GK2 A;  1OZO A;  3O4X A;  4PDZ A;  5J3X A;  1WDC C;  2BE6 A;  2BE4 A;  3V2L A;  1FBV A;  2BBM A;  1PVA A;  2MAZ A;  2WCL A;  2FJY A;  1DTL A;  2EC6 C;  4MLW A;  1K90 D;  3AAJ A;  1SRA A;  3DVK A;  4MVF A;  2E6W A;  1XFW O;  1NYA A;  2SAS A;  2BBN A;  1F70 A;  5AFP A;  2M8U A;  3PM2 A;  3CWG A;  1A75 B;  4BY5 A;  2Y1N A;  3PAL A;  1DT7 B;  4F7F A;  1IG5 A;  3KF9 A;  2KHN A;  3EK7 A;  2KI6 C;  3PM8 A;  2BAP A;  2PSR A;  1KFX S;  1TIZ A;  3CTN A;  4NDC A;  1JF0 A;  3SIB A;  4BY4 A;  1S36 A;  1QXP A;  1S5G Y;  1RFJ A;  2GGM A;  3I5G B;  4PHN A;  1WY9 A;  2CCM A;  2SCP A;  2B1U A;  4PHK A;  3IQO A;  1S5G Z;  1FPW A;  3QRX A;  2LP2 A;  1W7I B;  1XFY O;  2HF5 A;  1DEK A;  1SCM C;  4CPV A;  1SBJ A;  3BJH A;  1C7W A;  2L2C A;  1XK4 A;  3CYZ A;  1C3Z A;  4GBA A;  2RGI A;  4PCW A;  5CSJ A;  5FI7 A;  4OVN F;  1R6P A;  4QJ3 B;  1S3P A;  3AKB A;  1NX1 A;  1S6J A;  2QDI A;  2F3Y A;  3BUM B;  4UPG A;  2CBL A;  2CTN A;  2KYF A;  3D74 A;  1XK4 C;  4PHM A;  4F0Z B;  3DF0 B;  3R1P A;  4WQ3 A;  2CXJ A;  1A29 A;  3LK0 A;  3B88 A;  4CFQ A;  3BXK A;  4GFT A;  3EG5 B;  2LNK A;  1U5I A;  1PRW A;  1SL7 A;  1M31 A;  3RM1 A;  2OTG C;  3O78 A;  1CMG A;  1SCV A;  3DD4 A;  5F6T A;  1CM4 A;  4JPZ B;  2F8P A;  1MQ1 A;  3CS1 A;  4YI9 A;  2ZRT A;  1RK9 A;  1K9K A;  1KQM C;  4NQG A;  4WRI A;  1KWO B;  2ZNE A;  1XVJ A;  3BOW B;  5CPV A;  4TNC A;  3MSE B;  5ER5 A;  1TNW A;  1NSH A;  1TNQ A;  1OOH A;  3S0F A;  2AMI A;  2KGR A;  1TWO A;  3S0E A;  1DJH A;  2KI4 C;  3KHE A;  1H8B A;  4NDD A;  1DEL A;  2ERB A;  3ICB A;  1XFX O;  3PLF B;  2PVB A;  4GPL B;  4XJK B;  1KFU S;  2JTZ A;  1CFP A;  2LMU A;  1M46 A;  3CZT X;  1AJ5 A;  2BCX A;  3NSK A;  2WOS A;  2JT8 A;  1MWN A;  2LM5 A;  1YUT A;  3DYE A;  2OS8 B;  2K2F A;  2MLF C;  1YUU A;  1PVB A;  1N0Y A;  3SS5 A;  4P2Y B;  1TUZ A;  1ZUZ A;  1JFK A;  1ODB A;  3NSL A;  3NHT A;  3OGN A;  2L50 A;  1K95 A;  1CDP A;  2K60 A;  3R72 A;  5FI6 A;  1XA5 A;  4MSP A;  4MZL A;  5D7F A;  1MXE A;  2I7A A;  3WNX B;  4M2O A;  1HT9 A;  3FE9 A;  4PAL A;  1KFU L;  1CB1 A;  3B87 A;  1UHJ A;  1ALV A;  1A75 A;  5AXI A;  4C0K A;  1JBA A;  2WC5 A;  1AHR A;  1L2O B;  1OQP A;  3HCM A;  4GUK A;  2MJW B;  1XFZ O;  3K1E A;  3O4Y A;  5AAN A;  4PE4 A;  1YUR A;  1OZS A;  1DJI A;  1DJW A;  1QX5 B;  2H2K A;  3D75 A;  1AVS A;  2NXQ A;  3CGA A;  1SKT A;  1ZFS A;  4L9M A;  3OB1 B;  3A4U B;  1M63 B;  2OTG B;  1K2H A;  5I2O A;  3Q8I A;  3I5H C;  2MBX A;  4IL1 A;  2JUL A;  2WCH A;  3OHM B;  2FJU B;  4CID A;  1SK6 D;  1OMD A;  4OZD A;  2Y1M A;  5TNC A;  4N5X A;  2L5X B;  3PJI A;  5IBW A;  3GK1 A;  2EGD A;  3FWC A;  3TS5 B;  4DUQ A;  3JVT B;  1UUS A;  2LMT A;  3DVM A;  1TTX A;  1QLK A;  3IF7 A;  3BUO B;  4HRE E;  2WCB A;  4QJ4 B;  1KSM A;  3O2P A;  1M45 A;  1DF0 B;  2A4J A;  1MHO A;  2GTE A;  4R1E A;  4C0J A;  1BU3 A;  1CM1 A;  1ALW A;  1RRO A;  1A4P A;  2L98 A;  2WCK A;  4FTG A;  4ZCU A;  2TN4 A;  4ETO A;  1BLQ A;  2KQY A;  2KAV A;  5B8I B;  1QX7 A;  2HPS A;  2LCP A;  3DZT A;  2WCM A;  1IRJ A;  1GJY A;  1SR6 C;  2JPO A;  3DVE A;  4QJ5 B;  2I94 A;  4INX A;  1SNL A;  1IQ3 A;  3ZWH A;  4YGE B;  5KTY A;  5HYD A;  4YGA A;  2Y5I A;  1F55 A;  2MA2 A;  1CLB A;  1K8U A;  1GGZ A;  1J1D A;  3LL8 B;  2Q4U A;  2JNX A;  2KBM A;  3BOW A;  1A03 A;  2L2E A;  2KI6 D;  3EVV A;  1S26 D;  2L0P A;  4MRX A;  4ZCV A;  1QTX A;  1G4Y R;  1ZOT B;  3A8R A;  1YVH A;  1LVC D;  3TDI A;  2FCD A;  2BL0 C;  5HLO A;  2LC5 A;  3EVR A;  2JRF A;  3QME A;  2ISD A;  3JTD B;  3C1V A;  3CZ2 A;  1BR1 B;  3PN7 B;  1NPQ A;  2I2R E;  2Q91 A;  2COL B;  1NCY A;  2AUC A;  4PE0 A;  1KK8 B;  4JKT A;  2LUC A;  1UP5 A;  1AJ4 A;  1DJX A;  2JQ6 A;  3LLE A;  1Y1X A;  2M7N A;  1VRK A;  2L5Y A;  2LE9 B;  4NDB A;  1XFR A;  3LCP C;  2M9G A;  2JU0 A;  3D77 A;  2KSP A;  1LA3 A;  1PAL A;  2BKH B;  3CLN A;  4WQ2 A;  3UNW A;  2P71 A;  2KFF A;  2PAL A;  4HSZ A;  3VRN A;  3TUY C;  1J7R A;  1V1G A;  1XO5 A;  1YUS A;  2NCP A;  3L4L A;  5ER4 X;  1C3Y A;  3VRO A;  2KYC A;  4YGC B;  3ZNI A;  4E68 A;  1IKU A;  1AUI B;  2LHI A;  1OOF A;  3GOF A;  1RWY A;  1SSE B;  1TCF A;  1WDC B;  2LLT A;  3BFB A;  5I8N A;  4U8D A;  1IWQ A;  4C0L A;  1PUL A;  2EC6 B;  1G8I A;  1JFJ A;  1AK8 A;  4HRG A;  4OR9 B;  2LV7 A;  2L51 A;  4ICB A;  1WLZ A;  3BFH A;  2QEB A;  3K21 A;  1A2X A;  4P5O E;  1MR8 A;  1WRZ A;  4ORA B;  1J55 A;  1J7Q A;  1B8R A;  1QS7 A;  1R2U A;  2NZ0 A;  1LKJ A;  1KCY A;  3OX6 A;  3FWB A;  1BR4 B;  1M39 A;  4N1F A;  4I5N B;  1YX8 A;  5JOL A;  5I2L A;  3SG4 A;  2ZND A;  1CFD A;  1K94 A;  3I5F C;  2JWW A;  3AAK A;  3VGO A;  1EH2 A;  1Z2C B;  1YRT B;  1DF0 A;  1K93 D;  2K8M B;  1QV0 A;  1YX7 A;  1KK7 Y;  3BUN B;  4DRW A;  1Y6W A;  1C07 A;  5DKR A;  3EKJ A;  3TZ1 A;  2LAP A;  5HKW A;  2K7O A;  1YVL A;  2QEO A;  2WND A;  4JWQ A;  1KK7 Z;  5JJG A;  3R1O A;  1SCM B;  1DMO A;  2M1K B;  2WC8 A;  1DJZ A;  3D10 A;  1V1F A;  1NUB A;  3I5I C;  1PSR A;  5HKY A;  5CSN A;  3OX5 A;  1CFC A;  3D78 A;  2K0J A;  4MBE A;  1KQV A;  2KNE A;  5DIC A;  3AKA A;  1B9A A;  2LLS A;  3CZ0 A;  3DXL A;  3VRQ A;  3PSR A;  1S6I A;  4M2P A;  1B47 A;  2BCA A;  1BJF A;  2H61 A;  1SW8 A;  2WCF A;  1FI6 A;  3E3R A;  4I5J A;  5HL1 A;  2KLD A;  1OOI X;  2LVI A;  2LUX A;  1XYD A;  2KLE A;  4MEW A;  5HLV A;  5D3O A;  1UHH A;  1JC2 A;  1NIW A;  2H8V A;  2O5G A;  2LMV A;  1F54 A;  1ZAC A;  1F4Q A;  4CLN A;  3D0Y B;  2CT9 A;  2G9B A;  3OP0 A;  1OOJ A;  1JUO A;  1KQM B;  2M97 A;  2BCB A;  5FI2 A;  1E8A A;  1CTR A;  5DKN A;  2QAC A;  3FE8 A;  1FW4 A;  2PQL A;  3I5G C;  4M2Q A;  1U5I B;  2QEV A;  1DVI A;  1PK0 D;  2KFG A;  2JT0 A;  2ZKM X;  3M0W A;  4PE1 A;  1QLS A;  2G2B A;  1S6C A;  2KI4 B;  3HX4 A;  1EG4 A;  5GQQ C;  1JF2 A;  5BPJ A;  2WC6 A;  1OMR A;  3FE6 A;  3S0D A;  2LLU A;  1FF1 A;  2I18 A;  4MZJ A;  3EVU A;  1DQE A;  3DF0 A;  4Q04 A;  1B1G A;  1QIV A;  2HQ8 A;  2LVJ A;  1MUX A;  4GGN A;  4I5L B;  3FS7 A;  5DKQ A;  1EXR A;  1IIO A;  1SPY A;  1K9P A;  2MHH A;  1UHN A;  3F45 A;  5I2Q A;  4DS7 A;  4ORB B;  3UO9 A;  2R2I A;  3D73 A;  3SG7 A;  3S0G A;  1F4O A;  3D76 A;  4YI8 A;  5FYX A;  3DVJ A;  1WLM A;  1QAT A;  2V53 A;  3I5I B;  3L4A A;  2K7D A;  1BMO A;  3PAT A;  2E30 A;  5KSZ A;  1UUR A;  1K96 A;  3NGV A;  3O6B A;  4CFR A;  1NWD A;  2KPH A;  1HQV A;  5AEQ A;  1C7V A;  1J7P A;  4XJK A;  1B7T Y;  1L7Z A;  3VRP A;  5CSF A;  1KWO C;  1NX3 A;  1DC1 A;  2JT3 A;  4USL A;  3SJS A;  3DY9 A;  2KDH A;  1B7T Z;  3BQ3 A;  4KYN A;  3EK4 A;  3B7A A;  1MXL C;  2LVV A;  4FQT A;  4YGB B;  3I5H B;  3SG3 A;  4PE7 A;  3WXA A;  1CDM A;  1JSA A;  2LP3 A;  1CKK A;  2F33 A;  2KBI A;  1BT6 A;  1OW4 A;  1D1O A;  4JD9 A;  1IGV A;  2LAN A;  3L47 A;  5I94 A;  1BG1 A;  1BOD A;  1J7O A;  1W7J B;  3CR4 X;  5CSI A;  1NCZ A;  2AAO A;  2L4H A;  3CAB A;  2OS8 C;  1DGU A;  2PRU A;  3NSO A;  4I5K A;  1TNP A;  4D1E A;  2ZFD A;  1N2D A;  1TRF A;  2PAS A;  3RLZ A;  3KEV A;  1QVI Y;  2M7L A;  5D69 A;  3EKH A;  2YGU A;  3CDN A;  5K89 A;  1NX0 A;  1XFU O;  2Y4Q A;  1T14 A;  2JTT A;  2QEH A;  1OOG A;  1QV1 A;  5KU1 A;  1DJY A;  1QVI Z;  1IQ5 A;  3GK4 X;  1CLM A;  3B86 A;  1F8H A;  3FIA A;  1SL9 A;  3WHU B;  1N65 A;  1QWV A;  1Y1A A;  4MN0 A;  2JXL A;  1SR6 B;  1JWD A;  2QPT A;  1NCX A;  1YRU B;  1X02 A;  2M1U A;  1L2O C;  2WCE A;  2PMY A;  1KFX L;  1Y1U A;  4GNK B;  4AQI A;  2BKI B;  2KQ6 A;  2BNX A;  1WRK A;  2GGZ A;  3D0Y A;  2M29 A;  1GGW A;  1IJ6 A;  2LHL A;  2P6B B;  2P70 A;  1EL4 A;  1FI5 A;  4DCK A;  3CR5 X;  3CR2 A;  1TOP A;  4N1G A;  3BUX B;  3N7H A;  1ZMZ A;  1SY9 A;  1LA0 A;  4OCI A;  1IH0 A;  1QJT A;  3BUW B;  2FOT A;  3H4S E;  3VB1 A;  2BL0 B;  3NHI A;  1OSA A;  2D8N A;  1W9Z A;  2JC2 A;  2IS9 A;  1CMF A;  1QIW A;  4DIR A;  3CZ1 A;  3TDZ A;  1MF8 B;  2KAY A;  3OB2 B;  2M49 B;  3EK8 A;  2M0R A;  3TS5 C;  4OV2 A;  3JVT C;  3NSI A;  3RZS A;  3S0A A;  1RTP 1;  2OPO A; 
#chains in the Genus database with same CATH homology
 4A4C A;  1Y0V H;  1SL8 A;  4ORC B;  1NX2 A;  5PAL A;  1BF5 A;  4OKH A;  2HQW A;  1XFV O;  3IQQ A;  4GAO A;  2FCE A;  2GV5 A;  1AP4 A;  1GQM A;  2O60 A;  1PSB A;  1S1E A;  3SG5 A;  3TUY B;  4YRU A;  1J1E A;  3LK1 A;  1B8L A;  4MRY A;  1NP8 A;  2JXC A;  2L4I A;  3TDU A;  1CNP A;  4HRH A;  2F2O A;  2HET A;  2JOJ A;  2K7C A;  1CDL A;  2EHB A;  1EJ3 A;  1TCO B;  1UHI A;  2JZI A;  2H61 C;  2KAX A;  1SMG A;  5HKZ A;  4JQ0 D;  1F71 A;  3KO0 A;  3JTD C;  1Q80 A;  1IJ5 A;  2JPT A;  1UWO A;  3PFV A;  3PN7 C;  4GGF A;  4A4B A;  1K9U A;  1CDN A;  2F3Z A;  2K2A A;  2MLE C;  2MRD A;  2JNF A;  1KK8 C;  3KPX A;  4FQO A;  1YTZ C;  4PHJ A;  1B8C A;  4XYN A;  1UHK A;  2K7B A;  4MZK A;  2NLN A;  1SYM A;  1WRL A;  2F2P A;  1OMV A;  1RJV A;  1LIN A;  4YBH B;  2VRG A;  3SG6 A;  1TN4 A;  2NCO A;  3SIA A;  4GGF C;  2BEC A;  2K61 A;  3I5F B;  5AER A;  1KSO A;  1CLL A;  4YGD B;  1REC A;  2LVK A;  2ZN9 A;  1H4B A;  3VRR A;  1EG3 A;  1DGV A;  1LXF C;  1YR5 A;  1B4C A;  1DJG A;  3SG2 A;  1TNX A;  2KFH A;  1G33 A;  2WOR A;  4AQJ A;  2CNP A;  2KGB C;  2KOT A;  3NXA A;  5G08 A;  3WHT B;  1QAS A;  2ZRS A;  2ZN8 A;  1OE9 B;  2DOQ A;  1QX2 A;  3BYA A;  2M3W A;  4AOM A;  1CFF A;  3GK2 A;  1OZO A;  4PDZ A;  5J3X A;  1WDC C;  2BE6 A;  2BE4 A;  1FBV A;  2BBM A;  1PVA A;  2MAZ A;  4MLW A;  1DTL A;  2EC6 C;  1K90 D;  3AAJ A;  1SRA A;  3DVK A;  4MVF A;  2E6W A;  1XFW O;  1NYA A;  2SAS A;  2BBN A;  1F70 A;  5AFP A;  2M8U A;  3CWG A;  1A75 B;  4BY5 A;  2Y1N A;  3PAL A;  1DT7 B;  1IG5 A;  3KF9 A;  2KHN A;  3EK7 A;  2KI6 C;  3PM8 A;  2PSR A;  1KFX S;  1TIZ A;  3CTN A;  4NDC A;  1JF0 A;  3SIB A;  4BY4 A;  1S36 A;  1QXP A;  1S5G Y;  1RFJ A;  2GGM A;  3I5G B;  4PHN A;  2CCM A;  1WY9 A;  2SCP A;  2B1U A;  4PHK A;  3IQO A;  1S5G Z;  1FPW A;  3QRX A;  2LP2 A;  1W7I B;  1XFY O;  2HF5 A;  1SCM C;  4CPV A;  1SBJ A;  1C7W A;  1XK4 A;  4GBA A;  2RGI A;  4PCW A;  5CSJ A;  4OVN F;  1R6P A;  4QJ3 B;  1S3P A;  3AKB A;  1NX1 A;  1S6J A;  2F3Y A;  3BUM B;  4UPG A;  2CBL A;  2CTN A;  2KYF A;  1XK4 C;  4PHM A;  4F0Z B;  3DF0 B;  4WQ3 A;  2CXJ A;  1A29 A;  3LK0 A;  4CFQ A;  3BXK A;  4GFT A;  2LNK A;  1U5I A;  1PRW A;  1SL7 A;  1M31 A;  3RM1 A;  2OTG C;  3O78 A;  1CMG A;  1SCV A;  3DD4 A;  5F6T A;  1CM4 A;  4JPZ B;  2F8P A;  1MQ1 A;  3CS1 A;  4YI9 A;  2ZRT A;  1RK9 A;  1K9K A;  1KQM C;  4NQG A;  4WRI A;  1KWO B;  2ZNE A;  1XVJ A;  3BOW B;  5CPV A;  4TNC A;  3MSE B;  5ER5 A;  1TNW A;  1NSH A;  1TNQ A;  2AMI A;  2KGR A;  1H8B A;  1DJH A;  2KI4 C;  3KHE A;  4NDD A;  3ICB A;  1XFX O;  3PLF B;  2PVB A;  4GPL B;  4XJK B;  1KFU S;  2JTZ A;  1CFP A;  2LMU A;  1M46 A;  3CZT X;  1AJ5 A;  2BCX A;  3NSK A;  2WOS A;  2JT8 A;  1MWN A;  2LM5 A;  1YUT A;  2OS8 B;  2K2F A;  2MLF C;  1YUU A;  1PVB A;  1N0Y A;  4P2Y B;  1ZUZ A;  1JFK A;  1ODB A;  3NSL A;  2L50 A;  1K95 A;  1CDP A;  1XA5 A;  4MSP A;  4MZL A;  5D7F A;  1MXE A;  2I7A A;  3WNX B;  4M2O A;  1HT9 A;  4PAL A;  1KFU L;  1CB1 A;  1UHJ A;  1ALV A;  1A75 A;  5AXI A;  4C0K A;  1JBA A;  1AHR A;  1L2O B;  1OQP A;  3HCM A;  4GUK A;  2MJW B;  1XFZ O;  3O4Y A;  5AAN A;  4PE4 A;  1YUR A;  1OZS A;  1DJI A;  1DJW A;  1QX5 B;  2H2K A;  1AVS A;  2NXQ A;  3CGA A;  1SKT A;  1ZFS A;  4L9M A;  3OB1 B;  3A4U B;  1M63 B;  2OTG B;  1K2H A;  5I2O A;  3I5H C;  2MBX A;  4IL1 A;  2JUL A;  3OHM B;  2FJU B;  4CID A;  1SK6 D;  1OMD A;  2Y1M A;  5TNC A;  4N5X A;  2L5X B;  5IBW A;  3GK1 A;  2EGD A;  3FWC A;  3TS5 B;  4DUQ A;  3JVT B;  1UUS A;  2LMT A;  3DVM A;  1TTX A;  1QLK A;  3IF7 A;  3BUO B;  4HRE E;  2WCB A;  4QJ4 B;  1KSM A;  3O2P A;  1M45 A;  1DF0 B;  2A4J A;  1MHO A;  4R1E A;  4C0J A;  1BU3 A;  1CM1 A;  1ALW A;  1RRO A;  1A4P A;  2L98 A;  4FTG A;  4ZCU A;  4ETO A;  2TN4 A;  1BLQ A;  2KQY A;  2KAV A;  5B8I B;  1QX7 A;  2HPS A;  2LCP A;  1IRJ A;  1GJY A;  1SR6 C;  3DVE A;  4QJ5 B;  2I94 A;  1IQ3 A;  1SNL A;  3ZWH A;  4YGE B;  5KTY A;  5HYD A;  4YGA A;  2Y5I A;  1F55 A;  2MA2 A;  1CLB A;  1K8U A;  1J1D A;  1GGZ A;  3LL8 B;  2Q4U A;  2JNX A;  2KBM A;  3BOW A;  1A03 A;  2L2E A;  2KI6 D;  3EVV A;  1S26 D;  2L0P A;  4MRX A;  4ZCV A;  1QTX A;  1G4Y R;  1ZOT B;  3A8R A;  1YVH A;  1LVC D;  3TDI A;  2FCD A;  2BL0 C;  5HLO A;  2LC5 A;  3EVR A;  2JRF A;  2ISD A;  3JTD B;  3C1V A;  1BR1 B;  3PN7 B;  1NPQ A;  2I2R E;  2Q91 A;  2COL B;  1NCY A;  2AUC A;  4PE0 A;  1KK8 B;  2LUC A;  1UP5 A;  1AJ4 A;  1DJX A;  2JQ6 A;  3LLE A;  1Y1X A;  2M7N A;  1VRK A;  2LE9 B;  4NDB A;  3LCP C;  2M9G A;  2JU0 A;  2KSP A;  1LA3 A;  1PAL A;  2BKH B;  3CLN A;  4WQ2 A;  4HSZ A;  2KFF A;  2PAL A;  3VRN A;  3TUY C;  1J7R A;  1V1G A;  1XO5 A;  1YUS A;  2NCP A;  5ER4 X;  3VRO A;  2KYC A;  4YGC B;  3ZNI A;  4E68 A;  1IKU A;  1AUI B;  2LHI A;  3GOF A;  1RWY A;  1TCF A;  1WDC B;  2LLT A;  5I8N A;  4U8D A;  1IWQ A;  4C0L A;  1PUL A;  2EC6 B;  1G8I A;  1JFJ A;  1AK8 A;  4HRG A;  4OR9 B;  2LV7 A;  2L51 A;  4ICB A;  1WLZ A;  3K21 A;  1A2X A;  4P5O E;  1MR8 A;  1WRZ A;  4ORA B;  1J55 A;  1J7Q A;  1B8R A;  1QS7 A;  1R2U A;  2NZ0 A;  1LKJ A;  1KCY A;  3OX6 A;  3FWB A;  1BR4 B;  1M39 A;  4N1F A;  4I5N B;  1YX8 A;  5JOL A;  5I2L A;  3SG4 A;  2ZND A;  1CFD A;  1K94 A;  3I5F C;  2JWW A;  3AAK A;  3VGO A;  1EH2 A;  1YRT B;  1DF0 A;  1K93 D;  2K8M B;  1QV0 A;  1YX7 A;  1KK7 Y;  3BUN B;  4DRW A;  1Y6W A;  1C07 A;  5DKR A;  3EKJ A;  3TZ1 A;  2LAP A;  5HKW A;  2K7O A;  1YVL A;  2WND A;  4JWQ A;  1KK7 Z;  5JJG A;  1SCM B;  1DMO A;  2M1K B;  2WC8 A;  1DJZ A;  3D10 A;  1V1F A;  1NUB A;  3I5I C;  1PSR A;  5HKY A;  5CSN A;  3OX5 A;  1CFC A;  2K0J A;  4MBE A;  1KQV A;  2KNE A;  3AKA A;  1B9A A;  2LLS A;  3VRQ A;  3PSR A;  1S6I A;  4M2P A;  1B47 A;  2BCA A;  1BJF A;  2H61 A;  1SW8 A;  2WCF A;  1FI6 A;  3E3R A;  4I5J A;  2LUX A;  2LVI A;  1XYD A;  4MEW A;  5HLV A;  1UHH A;  1JC2 A;  1NIW A;  2O5G A;  2LMV A;  1F54 A;  1ZAC A;  1F4Q A;  4CLN A;  3D0Y B;  2CT9 A;  2G9B A;  3OP0 A;  1OOJ A;  1JUO A;  1KQM B;  2M97 A;  2BCB A;  1E8A A;  1CTR A;  5DKN A;  2QAC A;  1FW4 A;  3I5G C;  4M2Q A;  1U5I B;  1DVI A;  1PK0 D;  2KFG A;  2JT0 A;  2ZKM X;  3M0W A;  4PE1 A;  1QLS A;  2G2B A;  1S6C A;  2KI4 B;  3HX4 A;  1EG4 A;  5GQQ C;  1JF2 A;  1OMR A;  2LLU A;  1FF1 A;  2I18 A;  4MZJ A;  3EVU A;  1B1G A;  3DF0 A;  4Q04 A;  1QIV A;  2HQ8 A;  2LVJ A;  1MUX A;  4GGN A;  4I5L B;  3FS7 A;  5DKQ A;  1EXR A;  1SPY A;  1K9P A;  2MHH A;  1UHN A;  3F45 A;  5I2Q A;  4DS7 A;  4ORB B;  2R2I A;  3SG7 A;  1F4O A;  4YI8 A;  5FYX A;  3DVJ A;  1WLM A;  1QAT A;  2V53 A;  3I5I B;  2K7D A;  1BMO A;  3PAT A;  2E30 A;  5KSZ A;  1UUR A;  1K96 A;  3O6B A;  4CFR A;  1NWD A;  1HQV A;  5AEQ A;  1C7V A;  1J7P A;  4XJK A;  1B7T Y;  1L7Z A;  3VRP A;  5CSF A;  1KWO C;  1NX3 A;  2JT3 A;  4USL A;  3SJS A;  2KDH A;  1B7T Z;  3BQ3 A;  3EK4 A;  1MXL C;  2LVV A;  4YGB B;  3I5H B;  3SG3 A;  4PE7 A;  3WXA A;  1CDM A;  1JSA A;  2LP3 A;  1CKK A;  2F33 A;  2KBI A;  1BT6 A;  1D1O A;  1IGV A;  2LAN A;  1BG1 A;  1BOD A;  1J7O A;  1W7J B;  3CR4 X;  5CSI A;  1NCZ A;  2AAO A;  2L4H A;  2OS8 C;  1DGU A;  2PRU A;  3NSO A;  4I5K A;  1TNP A;  4D1E A;  2ZFD A;  1N2D A;  1TRF A;  2PAS A;  3RLZ A;  3KEV A;  1QVI Y;  2M7L A;  5D69 A;  3EKH A;  5K89 A;  1BOC A;  1NX0 A;  1XFU O;  2Y4Q A;  2JTT A;  1QV1 A;  5KU1 A;  1DJY A;  1QVI Z;  1IQ5 A;  3GK4 X;  1CLM A;  1F8H A;  3FIA A;  1SL9 A;  3WHU B;  1N65 A;  1Y1A A;  4MN0 A;  2JXL A;  1SR6 B;  1JWD A;  2QPT A;  1NCX A;  1YRU B;  1X02 A;  2M1U A;  1L2O C;  2WCE A;  2PMY A;  1KFX L;  1Y1U A;  4GNK B;  4AQI A;  2BKI B;  2KQ6 A;  5BPJ A;  1WRK A;  2GGZ A;  3D0Y A;  2M29 A;  1GGW A;  1IJ6 A;  2LHL A;  2P6B B;  1FI5 A;  1EL4 A;  4DCK A;  3CR5 X;  3CR2 A;  1TOP A;  4N1G A;  3BUX B;  1ZMZ A;  1SY9 A;  1LA0 A;  4OCI A;  1IH0 A;  1QJT A;  3BUW B;  2FOT A;  3H4S E;  2BL0 B;  1OSA A;  2D8N A;  2JC2 A;  2IS9 A;  1CMF A;  1QIW A;  4DIR A;  3TDZ A;  1MF8 B;  2KAY A;  3OB2 B;  2M49 B;  3EK8 A;  2M0R A;  3TS5 C;  4OV2 A;  3JVT C;  3NSI A;  1RTP 1;  2OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...