3BFBA

Crystal structure of a pheromone binding protein from apis mellifera in complex with the 9-keto-2(e)-decenoic acid
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bfbA00
1LS8A 1OOIX 1OOHA 2WC6A 4OZDA 3DY9A 1C3ZA 5DICA 3R1OA 2WCKA 2GTEA 2L2CA 3BFHA 4INWA 4PT1A 3CDNA 2QEHA 4FQTA 3NGVA 3B86A 3NHIA 2JPOA 2P70A 3D77A 1GM0A 3FE9A 3B88A 5EL2A 1T14A 1QWVA 3PJIA 1P28A 1XFRA 2QEVA 3D73A 3BFBA 3L47A 2QDIA 2H8VA 3D76A 2WCHA 3VB1A 2KPHA 3BFAA 3V2LA 3S0AA 4F7FA 1ORGA 3FE6A 3S0GA 3S0BA 2FJYA 1TUJA 2WCLA 3R72A 3RZSA 3Q8IA 2WCJA 3CYZA 3B6XA 4INXA 1OOGA 1OW4A 3QMEA 3S0FA 3DXLA 2WC5A 3S0EA 3DZTA 1DQEA 2WCMA 3OGNA 3FE8A 3B87A 3BJHA 2QEBA 3CABA 2QEOA 3DYEA 2PQLA 2P71A 3S0DA 3D74A 3NHTA 3D78A 3CZ2A 1OOFA 4JD9A 3R1PA 3L4AA 3K1EA 3D75A 3N7HA 1TWOA 3B7AA 3CZ1A 3L4LA 2ERBA 3R1VA 3CZ0A 1C3YA
chains in the Genus database with same CATH superfamily
2ZNDA 1XFZO 1WDCC 3DVJA 1KFUS 1U5IA 3DY9A 1J7QA 1CNPA 3VRRA 1C7WA 1AJ4A 1M46A 1VRKA 4M2OA 4CFRA 2R2IA 2AAOA 3PFVA 4PT1A 1UP5A 3CDNA 4BY4A 4Q04A 4FQTA 2M1KB 3CS1A 1KQVA 1CDPA 1YRTB 3DVKA 1UHKA 2E6WA 4GNKB 4N1GA 4MVFA 4UPGA 1GJYA 1OMVA 2LVVA 3BYAA 2ZFDA 2KAYA 2I18A 4MSPA 2KI6C 2EC6B 4YGAA 1MXEA 5EL2A 1T14A 2H2KA 1B7TY 1QWVA 3NSKA 5JJGA 4CLNA 3H4SE 1H8BA 4GBAA 3SIBA 4GGFC 4M2QA 4NQGA 1DF0B 2O5GA 3EVUA 2BCAA 3K21A 2M7LA 1W9ZA 2BCXA 5CPVA 3PM8A 2KPHA 2M9GA 2M8UA 2WC8A 4BY5A 3S0AA 1NX0A 1OMRA 5CSIA 2JQ6A 1XFWO 2KAXA 3OP0A 3S0GA 3BUOB 4U8DA 1AUIB 3EVRA 5AEQA 1TCFA 4DCKA 1BOCA 2WCJA 4PHMA 1G33A 4YGEB 1RJVA 1E8AA 2EC6C 1K96A 1MR8A 2OTGB 3FS7A 2AMIA 1S36A 1S3PA 1KK8B 1K90D 2KGBC 4HSZA 2YGUA 1A29A 1BLQA 2KFGA 1K9KA 3GK4X 4P5OE 1UHJA 2L98A 3F45A 3BQ3A 1HT9A 2JTTA 2M7NA 3DZTA 2KFHA 5CSFA 5DKQA 3NSLA 4QJ5B 3AAKA 3PSRA 1JF2A 2QEBA 3CABA 3BUNB 3CWGA 2HQ8A 1DMOA 1TNXA 2KFFA 3TS5C 2O60A 3NSIA 3SG2A 1K9PA 2BCBA 1LINA 2QEOA 1CM4A 3KEVA 3SS3A 1CLLA 3SG3A 2OTGC 1KK8C 2Y4QA 3NHTA 1CLBA 1Q80A 1PSBA 1SMGA 1C7VA 3CR5X 1WRLA 1RROA 1DJXA 1N0YA 4CPVA 1Y1UA 1UWOA 3R1PA 3VRQA 5AERA 2KAVA 2KHNA 2JWWA 3GK2A 3K1EA 1UHNA 1MUXA 2L51A 1XVJA 2MA2A 1S5GZ 1XFVO 2BL0B 2JXCA 2JT8A 2D8NA 1IH0A 1EL4A 2FOTA 4MZLA 2K0JA 2L4IA 2LVJA 4PE7A 2AUCA 4P2YB 2M29A 4HRHA 5PALA 3LL8B 1QJTA 1ZACA 1R2UA 1IGVA 1LA3A 4ORAB 4JQ0D 1LS8A 1N2DA 4GPLB 4ZCVA 4OZDA 1CMFA 2SASA 5HYDA 4DRWA 1DGVA 1NPQA 2OPOA 3R1OA 2JULA 5G08A 1QV0A 1QASA 4MRYA 1KCYA 3IQQA 4HREE 4FTGA 2JNFA 1M39A 2GTEA 3BFHA 1SNLA 2ZRTA 1EH2A 2QEHA 1DJGA 2PRUA 1NX3A 1JF0A 2BL0C 1XA5A 2EHBA 2ZRSA 1YUSA 2Y1NA 1B47A 2RGIA 1QXPA 2JPOA 5HL1A 2QPTA 3D77A 3PATA 2KDHA 1PRWA 1IIOA 1QX7A 4I5JA 1A75B 1MF8B 3O4YA 1DT7B 1F8HA 5KU1A 1GM0A 2E30A 4GAOA 3EKHA 2LM5A 3I5GB 1IRJA 2Y1MA 2K61A 1J7RA 1JSAA 3D73A 1P28A 2QEVA 3I5IB 3L47A 3PJIA 3BFBA 1J1EA 2QDIA 4GGFA 4OKHA 4A4BA 1EJ3A 4DUQA 2L5XB 1D1OA 2HQWA 2BKIB 2KYFA 2WCHA 5HLOA 4C0LA 2ZN8A 3RLZA 3WHTB 4E68A 2EGDA 1BF5A 2LNKA 2M49B 1GGWA 2G9BA 1G8IA 2FCDA 3BFAA 1SL7A 1OOJA 1Y0VH 5BPJA 1DGUA 1CFCA 4F7FA 3E3RA 1PULA 1IJ6A 1B9AA 2LP2A 2A4JA 1YUTA 2B1UA 3JVTB 1SW8A 1CM1A 3R72A 1FI6A 2BECA 1W7JB 4F0ZB 3CYZA 2LVKA 1NYAA 1NP8A 1IQ3A 3I5GC 3TDIA 2L50A 2PMYA 1TN4A 3QRXA 1UHIA 1OMDA 2FCEA 1G4YR 1TUZA 3KPXA 1B7TZ 1OW4A 3I5IC 3O2PA 3QMEA 5CSJA 1DF0A 2COLB 2OS8B 4MRXA 1DVIA 1WLMA 2CT9A 1KK7Y 2LCPA 3DXLA 3IF7A 3S0EA 1DJHA 2F33A 1DQEA 1QATA 4M2PA 1BG1A 2LUXA 4CFQA 3EK7A 3OGNA 1YTZC 1TNQA 2WCBA 1XFYO 2ZNEA 3AKAA 3BUMB 3FE8A 1ZFSA 1NIWA 3JVTC 2KQ6A 2M0RA 2MBXA 1KFXL 4C0JA 1GGZA 1OQPA 1ALWA 2LHIA 5I8NA 4PE1A 1UHHA 4OVNF 3TS5B 2KOTA 1NSHA 1A2XA 5HKYA 3DD4A 1MHOA 2P71A 3DYEA 5TNCA 1K94A 2BBMA 1DJYA 4OCIA 1DJIA 2JNXA 1SRAA 3D74A 3CZTX 2OS8C 3D78A 2JU0A 4PHJA 3SIAA 1DC1A 4GFTA 2NLNA 3CZ2A 1OOFA 1B8RA 2I2RE 2P6BB 4JD9A 1MWNA 2I7AA 3L4AA 2FJUB 2K7OA 2JPTA 4GGNA 3N7HA 4MLWA 5HKWA 1ALVA 1TWOA 3KF9A 1CB1A 2F2OA 1V1FA 4MBEA 2Y5IA 1SL9A 1H4BA 5AANA 3JTDB 1SK6D 3BUWB 1KSMA 1DELA 1XFXO 3R1VA 4IL1A 1BT6A 3WXAA 2Q91A 1LVCD 4NDDA 2L5YA 4JPZB 4YI9A 1OOIX 3DVMA 1C3ZA 3AKBA 1L7ZA 5DICA 2LE9B 4FQOA 1HQVA 1JBAA 4IJ7A 2ISDA 1BMOA 1F4QA 2KYCA 3OB1B 4PALA 4WQ3A 1SR6B 4YGBB 1CFFA 1BU3A 5FI7A 4OV2A 1M45A 1F54A 1XK4C 3ICBA 1S6CA 3HX4A 4D1EA 1EG4A 2F3ZA 3OB2B 3PALA 2JZIA 2BAPA 1AP4A 2JT3A 3NHIA 2KLEA 3NSOA 2BNXA 2H61C 4XJKB 3UO9A 4PE0A 5KSZA 1F55A 3JTDC 5AFPA 1KWOB 1NX2A 1WRKA 3AAJA 1AVSA 2KQYA 1A4PA 2LVIA 2NXQA 3IQOA 1XFRA 3O78A 1DTLA 5HKZA 1B4CA 3D76A 1F4OA 5FYXA 1EXRA 1FPWA 2CXJA 5D7FA 2LLTA 3VB1A 1CKKA 1QVIY 1CMGA 1SR6C 5I2OA 1YVHA 2KGRA 3FIAA 1K8UA 2CNPA 3V2LA 1S5GY 2LLSA 1TOPA 3FE6A 1F71A 1RWYA 4AOMA 1YX7A 2WCLA 1YR5A 1YURA 1TRFA 5HLVA 2JC2A 1A75A 2HETA 2MLFC 1R6PA 3ZNIA 2KI6D 3BOWB 1KWOC 1SKTA 1XO5A 4WQ2A 1WY9A 3B6XA 4R1EA 1QV1A 2GGMA 2ZKMX 3WHUB 1IKUA 2JOJA 4INXA 1CFPA 1OOGA 1IG5A 3MSEB 1JUOA 1NUBA 2LUCA 1BR1B 1DEKA 3OBVA 4I5LB 4ICBA 1DJWA 3EKJA 4PE4A 2LMTA 2BE4A 1PVAA 1AJ5A 2PALA 5D3OA 2BE6A 3DF0B 3ZWHA 2WCMA 1MXLC 3BUXB 3O6BA 1CDNA 2KI4B 3SG4A 3KO0A 1ZOTB 2PSRA 2LLUA 3CR2A 1SSEB 1TNPA 1EG3A 1KFUL 2KBIA 2LAPA 3OX6A 4A4CA 2NCOA 3FWBA 1AHRA 1BODA 2MJWB 3D0YB 1LA0A 1YVLA 2PQLA 4KYNA 4I5NB 1TNWA 2L2EA 3BXKA 3PN7B 3M0WA 2PVBA 1JFJA 4NDCA 1NCXA 1OZOA 1U5IB 1PSRA 1Y6WA 1RECA 1PALA 3VRPA 1KK7Z 2HPSA 3EK4A 2LMVA 3TZ1A 1FI5A 2LMUA 2K8MB 3PLFB 2F3YA 2KI4C 1CDLA 4ORBB 1OE9B 3HCMA 2WOSA 1NCZA 1ODBA 1S6IA 1B8LA 1XYDA 4N1FA 2VRGA 2MRDA 4QJ4B 1TIZA 2JTZA 3B7AA 1LXFC 2DOQA 3CTNA 3CZ1A 3OX5A 5JOLA 1Z2CB 3SS5A 4C0KA 2IS9A 1ZMZA 3LCPC 3SG6A 4TNCA 1QIWA 2SCPA 3L4LA 3OHMB 1YRUB 1J7PA 4MZKA 3CZ0A 1RTP1 3CR4X 5DKNA 3PN7C 1S1EA 1M63B 2K7CA 1KFXS 4OR9B 2WC6A 1OOHA 2GV5A 1JWDA 2MLEC 4MEWA 1S26D 2KSPA 3A8RA 3EK8A 1CFDA 4YRUA 2WCKA 2WORA 1NCYA 2M97A 3O4XA 4ORCB 2K7DA 3SG7A 3SJSA 5IBWA 1NX1A 2L2CA 1CTRA 4CIDA 3SS4A 1QX5B 4INWA 1XK4A 2LV7A 2LHLA 3GOFA 3NGVA 3WNXB 3B86A 2WCFA 4ZCUA 1SYMA 1QIVA 3TUYB 1LKJA 1SL8A 2H61A 1KSOA 2P70A 2K2AA 2Q4UA 3GK1A 3I5HB 1IJ5A 2JXLA 1SCVA 3FE9A 2KNEA 1S6JA 3B88A 2LANA 1QS7A 3VROA 1C07A 2WNDA 5B8IB 1J7OA 2H8VA 4AQIA 4PHKA 1Y1XA 2KBMA 3LK0A 1ZUZA 1PK0D 2HF5A 4PHNA 4YGDB 1JC2A 1FW4A 1ORGA 2ZN9A 4DIRA 5DKRA 3S0BA 4ETOA 1SPYA 1FF1A 2FJYA 1TUJA 3TUYC 1DJZA 1V1GA 2CCMA 3I5HC 1RK9A 2M3WA 4XJKA 3UNWA 1W7IB 3RZSA 5ER4X 3Q8IA 4GUKA 2V53A 4YGCB 1AK8A 1BR4B 1CLMA 3I5FB 2NZ0A 2LP3A 3RM1A 5D69A 4AQJA 2K2FA 3TDZA 2F2PA 2JRFA 1OZSA 2BBNA 4NDBA 3VRNA 5FI2A 1NWDA 5I94A 2WCEA 1FBVA 3PM2A 3S0FA 3EVVA 2PYQA 2BKHB 5KTYA 1KQMB 5I2LA 2WC5A 1IWQA 2G2BA 3VGOA 1SBJA 2LC5A 2TN4A 1K9UA 1QVIZ 2M1UA 1J55A 2GGZA 1L2OB 4JKTA 1F70A 2MHHA 5I2QA 4HRGA 1TCOB 1BJFA 1SCMB 3B87A 4YI8A 1MQ1A 2CTNA 4L9MA 2K7BA 1M31A 4I5KA 4WRIA 1B8CA 1UURA 3BJHA 3EG5B 4N5XA 3D10A 3BOWA 2JT0A 1K2HA 2KLDA 5CSNA 3I5FC 5ER5A 1WRZA 1QTXA 2NCPA 1GQMA 1K93D 1PVBA 1YX8A 1WDCB 2K60A 1OSAA 2QACA 4PDZA 3S0DA 1SY9A 1Y1AA 3TDUA 3CLNA 5GQQC 1X02A 4QJ3B 4MZJA 1WLZA 1CDMA 1KQMC 4XYNA 1Z4HA 3A4UB 3FWCA 1QLKA 1RFJA 3DF0A 1B1GA 4PCWA 1IQ5A 5AXIA 3SG5A 1L2OC 2L4HA 2F8PA 1QX2A 5F6TA 5J3XA 3D75A 1YUUA 3IVTA 3NXAA 1QLSA 1SCMC 3CGAA 2L0PA 3LK1A 1J1DA 4USLA 5K89A 1TTXA 2CBLA 4DS7A 1N65A 4JWQA 5FI6A 1K95A 2MAZA 2PASA 4MN0A 1XFUO 3D0YA 3C1VA 2I94A 3DVEA 3LLEA 2ERBA 1A03A 4YBHB 3KHEA 1UUSA 1JFKA 1C3YA
chains in the Genus database with same CATH topology
1LS8A 1OOIX 1OOHA 2WC6A 4OZDA 3DY9A 1C3ZA 5DICA 3R1OA 2WCKA 2GTEA 2L2CA 3BFHA 4INWA 4PT1A 3CDNA 2QEHA 4FQTA 3NGVA 3B86A 3NHIA 2JPOA 2P70A 3D77A 1GM0A 3FE9A 3B88A 5EL2A 1T14A 1QWVA 3PJIA 1P28A 1XFRA 2QEVA 3D73A 3BFBA 3L47A 2QDIA 2H8VA 3D76A 2WCHA 3VB1A 2KPHA 3BFAA 3V2LA 3S0AA 4F7FA 1ORGA 3FE6A 3S0GA 3S0BA 2FJYA 1TUJA 2WCLA 3R72A 3RZSA 3Q8IA 2WCJA 3CYZA 3B6XA 4INXA 1OOGA 1OW4A 3QMEA 3S0FA 3DXLA 2WC5A 3S0EA 3DZTA 1DQEA 2WCMA 3OGNA 3FE8A 3B87A 3BJHA 2QEBA 3CABA 2QEOA 3DYEA 2PQLA 2P71A 3S0DA 3D74A 3NHTA 3D78A 3CZ2A 1OOFA 4JD9A 3R1PA 3L4AA 3K1EA 3D75A 3N7HA 1TWOA 3B7AA 3CZ1A 3L4LA 2ERBA 3R1VA 3CZ0A 1C3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS8 A;  1OOI X;  1OOH A;  2WC6 A;  4OZD A;  3DY9 A;  1C3Z A;  5DIC A;  3R1O A;  2WCK A;  2GTE A;  2L2C A;  3BFH A;  4INW A;  4PT1 A;  3CDN A;  2QEH A;  4FQT A;  3NGV A;  3B86 A;  3NHI A;  2JPO A;  2P70 A;  3D77 A;  1GM0 A;  3FE9 A;  3B88 A;  5EL2 A;  1T14 A;  1QWV A;  3PJI A;  1P28 A;  1XFR A;  2QEV A;  3D73 A;  3BFB A;  3L47 A;  2QDI A;  2H8V A;  3D76 A;  2WCH A;  3VB1 A;  2KPH A;  3BFA A;  3V2L A;  3S0A A;  4F7F A;  1ORG A;  3FE6 A;  3S0G A;  3S0B A;  2FJY A;  1TUJ A;  2WCL A;  3R72 A;  3RZS A;  3Q8I A;  2WCJ A;  3CYZ A;  3B6X A;  4INX A;  1OOG A;  1OW4 A;  3QME A;  3S0F A;  3DXL A;  2WC5 A;  3S0E A;  3DZT A;  1DQE A;  2WCM A;  3OGN A;  3FE8 A;  3B87 A;  3BJH A;  2QEB A;  3CAB A;  2QEO A;  3DYE A;  2PQL A;  2P71 A;  3S0D A;  3D74 A;  3NHT A;  3D78 A;  3CZ2 A;  1OOF A;  4JD9 A;  3R1P A;  3L4A A;  3K1E A;  3D75 A;  3N7H A;  1TWO A;  3B7A A;  3CZ1 A;  3L4L A;  2ERB A;  3R1V A;  3CZ0 A;  1C3Y A; 
#chains in the Genus database with same CATH topology
 2ZND A;  1XFZ O;  1WDC C;  3DVJ A;  1KFU S;  1U5I A;  3DY9 A;  1J7Q A;  1CNP A;  3VRR A;  1C7W A;  1AJ4 A;  1M46 A;  1VRK A;  4M2O A;  4CFR A;  2R2I A;  2AAO A;  3PFV A;  4PT1 A;  1UP5 A;  3CDN A;  4BY4 A;  4Q04 A;  4FQT A;  2M1K B;  3CS1 A;  1KQV A;  1CDP A;  1YRT B;  3DVK A;  1UHK A;  2E6W A;  4GNK B;  4N1G A;  4MVF A;  4UPG A;  1GJY A;  1OMV A;  2LVV A;  3BYA A;  2ZFD A;  2KAY A;  2I18 A;  4MSP A;  2KI6 C;  2EC6 B;  4YGA A;  1MXE A;  5EL2 A;  1T14 A;  2H2K A;  1B7T Y;  1QWV A;  3NSK A;  5JJG A;  4CLN A;  3H4S E;  1H8B A;  4GBA A;  3SIB A;  4GGF C;  4M2Q A;  4NQG A;  1DF0 B;  2O5G A;  3EVU A;  2BCA A;  3K21 A;  2M7L A;  1W9Z A;  2BCX A;  5CPV A;  3PM8 A;  2KPH A;  2M9G A;  2M8U A;  2WC8 A;  4BY5 A;  3S0A A;  1NX0 A;  1OMR A;  5CSI A;  2JQ6 A;  1XFW O;  2KAX A;  3OP0 A;  3S0G A;  3BUO B;  4U8D A;  1AUI B;  3EVR A;  5AEQ A;  1TCF A;  4DCK A;  1BOC A;  2WCJ A;  4PHM A;  1G33 A;  4YGE B;  1RJV A;  1E8A A;  2EC6 C;  1K96 A;  1MR8 A;  2OTG B;  3FS7 A;  2AMI A;  1S36 A;  1S3P A;  1KK8 B;  1K90 D;  2KGB C;  4HSZ A;  2YGU A;  1A29 A;  1BLQ A;  2KFG A;  1K9K A;  3GK4 X;  4P5O E;  1UHJ A;  2L98 A;  3F45 A;  3BQ3 A;  1HT9 A;  2JTT A;  2M7N A;  3DZT A;  2KFH A;  5CSF A;  5DKQ A;  3NSL A;  4QJ5 B;  3AAK A;  3PSR A;  1JF2 A;  2QEB A;  3CAB A;  3BUN B;  3CWG A;  2HQ8 A;  1DMO A;  1TNX A;  2KFF A;  3TS5 C;  2O60 A;  3NSI A;  3SG2 A;  1K9P A;  2BCB A;  1LIN A;  2QEO A;  1CM4 A;  3KEV A;  3SS3 A;  1CLL A;  3SG3 A;  2OTG C;  1KK8 C;  2Y4Q A;  3NHT A;  1CLB A;  1Q80 A;  1PSB A;  1SMG A;  1C7V A;  3CR5 X;  1WRL A;  1RRO A;  1DJX A;  1N0Y A;  4CPV A;  1Y1U A;  1UWO A;  3R1P A;  3VRQ A;  5AER A;  2KAV A;  2KHN A;  2JWW A;  3GK2 A;  3K1E A;  1UHN A;  1MUX A;  2L51 A;  1XVJ A;  2MA2 A;  1S5G Z;  1XFV O;  2BL0 B;  2JXC A;  2JT8 A;  2D8N A;  1IH0 A;  1EL4 A;  2FOT A;  4MZL A;  2K0J A;  2L4I A;  2LVJ A;  4PE7 A;  2AUC A;  4P2Y B;  2M29 A;  4HRH A;  5PAL A;  3LL8 B;  1QJT A;  1ZAC A;  1R2U A;  1IGV A;  1LA3 A;  4ORA B;  4JQ0 D;  1LS8 A;  1N2D A;  4GPL B;  4ZCV A;  4OZD A;  1CMF A;  2SAS A;  5HYD A;  4DRW A;  1DGV A;  1NPQ A;  2OPO A;  3R1O A;  2JUL A;  5G08 A;  1QV0 A;  1QAS A;  4MRY A;  1KCY A;  3IQQ A;  4HRE E;  4FTG A;  2JNF A;  1M39 A;  2GTE A;  3BFH A;  1SNL A;  2ZRT A;  1EH2 A;  2QEH A;  1DJG A;  2PRU A;  1NX3 A;  1JF0 A;  2BL0 C;  1XA5 A;  2EHB A;  2ZRS A;  1YUS A;  2Y1N A;  1B47 A;  2RGI A;  1QXP A;  2JPO A;  5HL1 A;  2QPT A;  3D77 A;  3PAT A;  2KDH A;  1PRW A;  1IIO A;  1QX7 A;  4I5J A;  1A75 B;  1MF8 B;  3O4Y A;  1DT7 B;  1F8H A;  5KU1 A;  1GM0 A;  2E30 A;  4GAO A;  3EKH A;  2LM5 A;  3I5G B;  1IRJ A;  2Y1M A;  2K61 A;  1J7R A;  1JSA A;  3D73 A;  1P28 A;  2QEV A;  3I5I B;  3L47 A;  3PJI A;  3BFB A;  1J1E A;  2QDI A;  4GGF A;  4OKH A;  4A4B A;  1EJ3 A;  4DUQ A;  2L5X B;  1D1O A;  2HQW A;  2BKI B;  2KYF A;  2WCH A;  5HLO A;  4C0L A;  2ZN8 A;  3RLZ A;  3WHT B;  4E68 A;  2EGD A;  1BF5 A;  2LNK A;  2M49 B;  1GGW A;  2G9B A;  1G8I A;  2FCD A;  3BFA A;  1SL7 A;  1OOJ A;  1Y0V H;  5BPJ A;  1DGU A;  1CFC A;  4F7F A;  3E3R A;  1PUL A;  1IJ6 A;  1B9A A;  2LP2 A;  2A4J A;  1YUT A;  2B1U A;  3JVT B;  1SW8 A;  1CM1 A;  3R72 A;  1FI6 A;  2BEC A;  1W7J B;  4F0Z B;  3CYZ A;  2LVK A;  1NYA A;  1NP8 A;  1IQ3 A;  3I5G C;  3TDI A;  2L50 A;  2PMY A;  1TN4 A;  3QRX A;  1UHI A;  1OMD A;  2FCE A;  1G4Y R;  1TUZ A;  3KPX A;  1B7T Z;  1OW4 A;  3I5I C;  3O2P A;  3QME A;  5CSJ A;  1DF0 A;  2COL B;  2OS8 B;  4MRX A;  1DVI A;  1WLM A;  2CT9 A;  1KK7 Y;  2LCP A;  3DXL A;  3IF7 A;  3S0E A;  1DJH A;  2F33 A;  1DQE A;  1QAT A;  4M2P A;  1BG1 A;  2LUX A;  4CFQ A;  3EK7 A;  3OGN A;  1YTZ C;  1TNQ A;  2WCB A;  1XFY O;  2ZNE A;  3AKA A;  3BUM B;  3FE8 A;  1ZFS A;  1NIW A;  3JVT C;  2KQ6 A;  2M0R A;  2MBX A;  1KFX L;  4C0J A;  1GGZ A;  1OQP A;  1ALW A;  2LHI A;  5I8N A;  4PE1 A;  1UHH A;  4OVN F;  3TS5 B;  2KOT A;  1NSH A;  1A2X A;  5HKY A;  3DD4 A;  1MHO A;  2P71 A;  3DYE A;  5TNC A;  1K94 A;  2BBM A;  1DJY A;  4OCI A;  1DJI A;  2JNX A;  1SRA A;  3D74 A;  3CZT X;  2OS8 C;  3D78 A;  2JU0 A;  4PHJ A;  3SIA A;  1DC1 A;  4GFT A;  2NLN A;  3CZ2 A;  1OOF A;  1B8R A;  2I2R E;  2P6B B;  4JD9 A;  1MWN A;  2I7A A;  3L4A A;  2FJU B;  2K7O A;  2JPT A;  4GGN A;  3N7H A;  4MLW A;  5HKW A;  1ALV A;  1TWO A;  3KF9 A;  1CB1 A;  2F2O A;  1V1F A;  4MBE A;  2Y5I A;  1SL9 A;  1H4B A;  5AAN A;  3JTD B;  1SK6 D;  3BUW B;  1KSM A;  1DEL A;  1XFX O;  3R1V A;  4IL1 A;  1BT6 A;  3WXA A;  2Q91 A;  1LVC D;  4NDD A;  2L5Y A;  4JPZ B;  4YI9 A;  1OOI X;  3DVM A;  1C3Z A;  3AKB A;  1L7Z A;  5DIC A;  2LE9 B;  4FQO A;  1HQV A;  1JBA A;  4IJ7 A;  2ISD A;  1BMO A;  1F4Q A;  2KYC A;  3OB1 B;  4PAL A;  4WQ3 A;  1SR6 B;  4YGB B;  1CFF A;  1BU3 A;  5FI7 A;  4OV2 A;  1M45 A;  1F54 A;  1XK4 C;  3ICB A;  1S6C A;  3HX4 A;  4D1E A;  1EG4 A;  2F3Z A;  3OB2 B;  3PAL A;  2JZI A;  2BAP A;  1AP4 A;  2JT3 A;  3NHI A;  2KLE A;  3NSO A;  2BNX A;  2H61 C;  4XJK B;  3UO9 A;  4PE0 A;  5KSZ A;  1F55 A;  3JTD C;  5AFP A;  1KWO B;  1NX2 A;  1WRK A;  3AAJ A;  1AVS A;  2KQY A;  1A4P A;  2LVI A;  2NXQ A;  3IQO A;  1XFR A;  3O78 A;  1DTL A;  5HKZ A;  1B4C A;  3D76 A;  1F4O A;  5FYX A;  1EXR A;  1FPW A;  2CXJ A;  5D7F A;  2LLT A;  3VB1 A;  1CKK A;  1QVI Y;  1CMG A;  1SR6 C;  5I2O A;  1YVH A;  2KGR A;  3FIA A;  1K8U A;  2CNP A;  3V2L A;  1S5G Y;  2LLS A;  1TOP A;  3FE6 A;  1F71 A;  1RWY A;  4AOM A;  1YX7 A;  2WCL A;  1YR5 A;  1YUR A;  1TRF A;  5HLV A;  2JC2 A;  1A75 A;  2HET A;  2MLF C;  1R6P A;  3ZNI A;  2KI6 D;  3BOW B;  1KWO C;  1SKT A;  1XO5 A;  4WQ2 A;  1WY9 A;  3B6X A;  4R1E A;  1QV1 A;  2GGM A;  2ZKM X;  3WHU B;  1IKU A;  2JOJ A;  4INX A;  1CFP A;  1OOG A;  1IG5 A;  3MSE B;  1JUO A;  1NUB A;  2LUC A;  1BR1 B;  1DEK A;  3OBV A;  4I5L B;  4ICB A;  1DJW A;  3EKJ A;  4PE4 A;  2LMT A;  2BE4 A;  1PVA A;  1AJ5 A;  2PAL A;  5D3O A;  2BE6 A;  3DF0 B;  3ZWH A;  2WCM A;  1MXL C;  3BUX B;  3O6B A;  1CDN A;  2KI4 B;  3SG4 A;  3KO0 A;  1ZOT B;  2PSR A;  2LLU A;  3CR2 A;  1SSE B;  1TNP A;  1EG3 A;  1KFU L;  2KBI A;  2LAP A;  3OX6 A;  4A4C A;  2NCO A;  3FWB A;  1AHR A;  1BOD A;  2MJW B;  3D0Y B;  1LA0 A;  1YVL A;  2PQL A;  4KYN A;  4I5N B;  1TNW A;  2L2E A;  3BXK A;  3PN7 B;  3M0W A;  2PVB A;  1JFJ A;  4NDC A;  1NCX A;  1OZO A;  1U5I B;  1PSR A;  1Y6W A;  1REC A;  1PAL A;  3VRP A;  1KK7 Z;  2HPS A;  3EK4 A;  2LMV A;  3TZ1 A;  1FI5 A;  2LMU A;  2K8M B;  3PLF B;  2F3Y A;  2KI4 C;  1CDL A;  4ORB B;  1OE9 B;  3HCM A;  2WOS A;  1NCZ A;  1ODB A;  1S6I A;  1B8L A;  1XYD A;  4N1F A;  2VRG A;  2MRD A;  4QJ4 B;  1TIZ A;  2JTZ A;  3B7A A;  1LXF C;  2DOQ A;  3CTN A;  3CZ1 A;  3OX5 A;  5JOL A;  1Z2C B;  3SS5 A;  4C0K A;  2IS9 A;  1ZMZ A;  3LCP C;  3SG6 A;  4TNC A;  1QIW A;  2SCP A;  3L4L A;  3OHM B;  1YRU B;  1J7P A;  4MZK A;  3CZ0 A;  1RTP 1;  3CR4 X;  5DKN A;  3PN7 C;  1S1E A;  1M63 B;  2K7C A;  1KFX S;  4OR9 B;  2WC6 A;  1OOH A;  2GV5 A;  1JWD A;  2MLE C;  4MEW A;  1S26 D;  2KSP A;  3A8R A;  3EK8 A;  1CFD A;  4YRU A;  2WCK A;  2WOR A;  1NCY A;  2M97 A;  3O4X A;  4ORC B;  2K7D A;  3SG7 A;  3SJS A;  5IBW A;  1NX1 A;  2L2C A;  1CTR A;  4CID A;  3SS4 A;  1QX5 B;  4INW A;  1XK4 A;  2LV7 A;  2LHL A;  3GOF A;  3NGV A;  3WNX B;  3B86 A;  2WCF A;  4ZCU A;  1SYM A;  1QIV A;  3TUY B;  1LKJ A;  1SL8 A;  2H61 A;  1KSO A;  2P70 A;  2K2A A;  2Q4U A;  3GK1 A;  3I5H B;  1IJ5 A;  2JXL A;  1SCV A;  3FE9 A;  2KNE A;  1S6J A;  3B88 A;  2LAN A;  1QS7 A;  3VRO A;  1C07 A;  2WND A;  5B8I B;  1J7O A;  2H8V A;  4AQI A;  4PHK A;  1Y1X A;  2KBM A;  3LK0 A;  1ZUZ A;  1PK0 D;  2HF5 A;  4PHN A;  4YGD B;  1JC2 A;  1FW4 A;  1ORG A;  2ZN9 A;  4DIR A;  5DKR A;  3S0B A;  4ETO A;  1SPY A;  1FF1 A;  2FJY A;  1TUJ A;  3TUY C;  1DJZ A;  1V1G A;  2CCM A;  3I5H C;  1RK9 A;  2M3W A;  4XJK A;  3UNW A;  1W7I B;  3RZS A;  5ER4 X;  3Q8I A;  4GUK A;  2V53 A;  4YGC B;  1AK8 A;  1BR4 B;  1CLM A;  3I5F B;  2NZ0 A;  2LP3 A;  3RM1 A;  5D69 A;  4AQJ A;  2K2F A;  3TDZ A;  2F2P A;  2JRF A;  1OZS A;  2BBN A;  4NDB A;  3VRN A;  5FI2 A;  1NWD A;  5I94 A;  2WCE A;  1FBV A;  3PM2 A;  3S0F A;  3EVV A;  2PYQ A;  2BKH B;  5KTY A;  1KQM B;  5I2L A;  2WC5 A;  1IWQ A;  2G2B A;  3VGO A;  1SBJ A;  2LC5 A;  2TN4 A;  1K9U A;  1QVI Z;  2M1U A;  1J55 A;  2GGZ A;  1L2O B;  4JKT A;  1F70 A;  2MHH A;  5I2Q A;  4HRG A;  1TCO B;  1BJF A;  1SCM B;  3B87 A;  4YI8 A;  1MQ1 A;  2CTN A;  4L9M A;  2K7B A;  1M31 A;  4I5K A;  4WRI A;  1B8C A;  1UUR A;  3BJH A;  3EG5 B;  4N5X A;  3D10 A;  3BOW A;  2JT0 A;  1K2H A;  2KLD A;  5CSN A;  3I5F C;  5ER5 A;  1WRZ A;  1QTX A;  2NCP A;  1GQM A;  1K93 D;  1PVB A;  1YX8 A;  1WDC B;  2K60 A;  1OSA A;  2QAC A;  4PDZ A;  3S0D A;  1SY9 A;  1Y1A A;  3TDU A;  3CLN A;  5GQQ C;  1X02 A;  4QJ3 B;  4MZJ A;  1WLZ A;  1CDM A;  1KQM C;  4XYN A;  1Z4H A;  3A4U B;  3FWC A;  1QLK A;  1RFJ A;  3DF0 A;  1B1G A;  4PCW A;  1IQ5 A;  5AXI A;  3SG5 A;  1L2O C;  2L4H A;  2F8P A;  1QX2 A;  5F6T A;  5J3X A;  3D75 A;  1YUU A;  3IVT A;  3NXA A;  1QLS A;  1SCM C;  3CGA A;  2L0P A;  3LK1 A;  1J1D A;  4USL A;  5K89 A;  1TTX A;  2CBL A;  4DS7 A;  1N65 A;  4JWQ A;  5FI6 A;  1K95 A;  2MAZ A;  2PAS A;  4MN0 A;  1XFU O;  3D0Y A;  3C1V A;  2I94 A;  3DVE A;  3LLE A;  2ERB A;  1A03 A;  4YBH B;  3KHE A;  1UUS A;  1JFK A;  1C3Y A; 
#chains in the Genus database with same CATH homology
 1LS8 A;  1OOI X;  1OOH A;  2WC6 A;  4OZD A;  3DY9 A;  1C3Z A;  5DIC A;  3R1O A;  2WCK A;  2GTE A;  2L2C A;  3BFH A;  4INW A;  4PT1 A;  3CDN A;  2QEH A;  4FQT A;  3NGV A;  3B86 A;  3NHI A;  2JPO A;  2P70 A;  3D77 A;  1GM0 A;  3FE9 A;  3B88 A;  5EL2 A;  1T14 A;  1QWV A;  3PJI A;  1P28 A;  1XFR A;  2QEV A;  3D73 A;  3BFB A;  3L47 A;  2QDI A;  2H8V A;  3D76 A;  2WCH A;  3VB1 A;  2KPH A;  3BFA A;  3V2L A;  3S0A A;  4F7F A;  1ORG A;  3FE6 A;  3S0G A;  3S0B A;  2FJY A;  1TUJ A;  2WCL A;  3R72 A;  3RZS A;  3Q8I A;  2WCJ A;  3CYZ A;  3B6X A;  4INX A;  1OOG A;  1OW4 A;  3QME A;  3S0F A;  3DXL A;  2WC5 A;  3S0E A;  3DZT A;  1DQE A;  2WCM A;  3OGN A;  3FE8 A;  3B87 A;  3BJH A;  2QEB A;  3CAB A;  2QEO A;  3DYE A;  2PQL A;  2P71 A;  3S0D A;  3D74 A;  3NHT A;  3D78 A;  3CZ2 A;  1OOF A;  4JD9 A;  3R1P A;  3L4A A;  3K1E A;  3D75 A;  3N7H A;  1TWO A;  3B7A A;  3CZ1 A;  3L4L A;  2ERB A;  3R1V A;  3CZ0 A;  1C3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...