1OE9B

Crystal structure of myosin v motor with essential light chain-nucleotide-free
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
139
Chain Sequence
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKYEDYLEGFRVFDGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN VA
publication title A Structural State of the Myosin V Motor without Bound Nucleotide
pubmed doi rcsb
source organism Gallus gallus
molecule tags Atpase/myosin
total genus 43
structure length 139
sequence length 147
ec nomenclature
pdb deposition date 2003-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oe9B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oe9B01
2BL0C 5AXIA 2JT8A 3I5HB 1QX5B 1UURA 2COLB 2WCEA 1ALVA 2KDHA 3EVRA 2PSRA 3PFVA 3VRQA 5K89A 1N65A 1QIWA 3I5HC 1TNQA 2EC6B 3CTNA 1SY9A 2H61C 2L4HA 4P2YB 1UHIA 1M45A 1XFUO 1SRAA 1GJYA 2BBNA 2EC6C 4BY5A 2BBMA 1KK8B 2PASA 1NSHA 2ZRTA 1YRUB 1PSBA 1SCMC 1UUSA 1YR5A 3GK4X 1KK8C 1IJ5A 1K96A 1IRJA 1K90D 3BYAA 4ICBA 5ER4X 4MEWA 2ZNEA 1JSAA 5I8NA 2OPOA 4OR9B 4YGEB 3BXKA 2LHIA 4DUQA 3ICBA 3TZ1A 1QXPA 1NX1A 1AVSA 2BCBA 2ISDA 3EVVA 3SG3A 2GGMA 4N1FA 1BOCA 4WQ3A 1QLKA 1QVIY 2ZNDA 1Q80A 1PVBA 3CR4X 4PCWA 1XK4C 3NSLA 3O4YA 2L51A 1B9AA 1DJHA 1LA0A 1S5GY 4GBAA 2HQWA 2NZ0A 2CT9A 5CSJA 4FQOA 1YRTB 3O2PA 4PDZA 1IH0A 2JTTA 1NP8A 2Y1NA 1DF0B 4PHNA 2HQ8A 4GAOA 3SG5A 3ZWHA 3LCPC 1AJ4A 1CM4A 4MLWA 5KSZA 4CFRA 2CCMA 4XJKA 3PALA 5JOLA 1Y6WA 4YBHB 2LVJA 2JWWA 2KAVA 1TNXA 2B1UA 3CWGA 4YGDB 1YX7A 1CFPA 3F45A 1CDLA 1ZUZA 1XFVO 1MWNA 1LXFC 1DGUA 5PALA 2O5GA 4C0JA 5KU1A 1SL7A 3DVEA 1F71A 1KSMA 1GQMA 1QATA 2BKHB 2ZFDA 1RROA 3D10A 1OOJA 2JOJA 3RM1A 4CLNA 1U5IA 3CR5X 1JFJA 3NXAA 2LUXA 2I18A 2BECA 5G08A 1K9PA 2MLEC 2F2PA 1L2OB 1JF0A 2KI6C 1Y0VH 5AEQA 1FI6A 1QX2A 1K94A 1L2OC 2WNDA 3BUNB 4OV2A 2OTGB 5DKQA 1AUIB 2LUCA 1CB1A 1SR6B 2JU0A 1NX0A 1TN4A 2L2EA 2KFHA 1YURA 2OTGC 4PE7A 1MQ1A 4M2OA 1GGZA 2FCDA 4YGBB 1TCFA 2KBIA 3I5FC 1OMDA 5KTYA 1RTP1 2GV5A 2ZKMX 3PN7B 1AK8A 3OB2B 2F8PA 2M8UA 5HLVA 3BUOB 3MSEB 1J7PA 2MA2A 2D8NA 1XA5A 3AAJA 3I5IB 2PMYA 1WY9A 1SNLA 3E3RA 3GK2A 1J55A 1R6PA 5D7FA 3I5IC 3FIAA 4NDBA 2NCPA 3CLNA 3D0YA 3CR2A 4JQ0D 1FBVA 2HPSA 3DD4A 2M29A 3JVTB 4YI8A 5HKYA 3EKHA 2FJUB 1CMFA 1J1EA 1BU3A 2AAOA 2LMVA 1ODBA 1A75B 2EHBA 3JVTC 3QRXA 1ALWA 2CXJA 2JXLA 5HLOA 2WORA 1K93D 2KOTA 3WXAA 2Y4QA 1IQ5A 2KAXA 1CM1A 2LCPA 3DF0B 1MXEA 2QPTA 1SL9A 4PHJA 1SK6D 2KI4C 4OKHA 3K21A 2K2FA 2M7LA 1LVCD 2IS9A 1C07A 1BT6A 1BODA 1K2HA 1OMVA 3IQOA 1MUXA 4HSZA 1NPQA 3OX6A 1NWDA 3WHUB 2M0RA 1PVAA 2KAYA 4XJKB 1DMOA 1XFYO 4A4CA 1NCZA 1A4PA 1OE9B 1SCMB 2CBLA 2G9BA 2KGBC 2LMTA 1S6IA 4ORBB 2A4JA 3PATA 3TDIA 3WHTB 2WOSA 3AKAA 3BOWA 1N0YA 5I2OA 4JWQA 1WRLA 4HRGA 2F33A 4NDDA 1JWDA 1XO5A 3SIBA 3TUYC 1SYMA 3LL8B 1QASA 2WCFA 4GGFA 4MZLA 3BQ3A 2KHNA 2KI6D 4YGAA 4C0LA 1JC2A 1V1FA 4FTGA 4YI9A 1LKJA 1ZFSA 2P6BB 3EK8A 2JPTA 4MZJA 4I5NB 1PK0D 1AJ5A 4XYNA 3O6BA 4JPZB 1KFUS 1B8CA 2LV7A 3CGAA 2F2OA 2WCBA 1S3PA 3GK1A 2KSPA 1DJZA 2BCAA 2KFGA 1CNPA 2JT0A 2JULA 3TDUA 3KHEA 4DIRA 1DJXA 2SASA 4GNKB 1J7OA 4WQ2A 2JTZA 1NIWA 2K2AA 1VRKA 2Y1MA 2OS8B 3C1VA 4AQJA 3SG6A 1WLZA 1CDNA 3FWBA 1YX8A 1F70A 2HF5A 3CS1A 1YVLA 3NSIA 2OS8C 1MXLC 1KFXS 1CFCA 1OQPA 1CFFA 4GGNA 4Q04A 1QJTA 2ZN8A 4U8DA 1RECA 1L7ZA 2L98A 3DVMA 5AERA 2DOQA 1J1DA 3KPXA 4OVNF 1IG5A 4MRXA 3D0YB 1B8LA 3VRPA 4CIDA 2JZIA 2R2IA 1R2UA 2JNXA 4YGCB 1B1GA 1KQMC 1YUUA 2O60A 2LAPA 1IWQA 4NDCA 5CSIA 4PE1A 3EK7A 4HRHA 1QV1A 5HYDA 5DKRA 5I2LA 1IGVA 1OZOA 1A2XA 2TN4A 3EK4A 2KGRA 1RK9A 2BCXA 1DT7B 2PRUA 1QIVA 4ZCUA 1XFWO 1TNWA 1TRFA 2MLFC 1DJIA 1F54A 5B8IB 3I5FB 5JJGA 1RJVA 3NSKA 1B4CA 2LP2A 1B7TZ 4ORAB 1JFKA 3KO0A 1OZSA 3NSOA 1UHKA 1AP4A 2KBMA 1CDMA 5HKZA 2KYCA 3VRRA 2KQ6A 2LP3A 1S6CA 1K95A 1MF8B 1K9KA 1AHRA 1KWOC 4R1EA 2KQYA 3OP0A 1F8HA 2MJWB 3BOWB 1KFUL 1A29A 4A4BA 1E8AA 4NQGA 1Y1UA 3IF7A 2I2RE 4GFTA 1BF5A 1G8IA 1FI5A 2LM5A 1UWOA 3PSRA 1SKTA 2LLSA 4GGFC 2F3YA 1Y1XA 4OCIA 3BUXB 3VROA 1UP5A 2I7AA 2K7DA 3TS5B 1A03A 2MRDA 1WRKA 1B47A 1Y1AA 3FS7A 4L9MA 3VGOA 1C7WA 2FOTA 3IQQA 1F55A 3OX5A 3TS5C 2KI4B 2G2BA 5AFPA 1K8UA 1ZMZA 3DVJA 4YRUA 1UHJA 2MHHA 1W7IB 1EG4A 1JUOA 1NCYA 3HCMA 2K8MB 3AAKA 3KF9A 3PLFB 1N2DA 1SCVA 2FCEA 4HREE 1HQVA 5J3XA 1QLSA 1QV0A 4MVFA 1H8BA 3LK0A 3ZNIA 5FYXA 3WNXB 1CFDA 2LHLA 3TDZA 2LVKA 4BY4A 4CPVA 1RFJA 2JQ6A 2SCPA 1XVJA 3SG2A 1DTLA 2M7NA 5TNCA 3TUYB 3KEVA 4P5OE 1BR4B 1UHHA 5DKNA 1H4BA 2LNKA 1KCYA 2L5XB 1SBJA 1U5IB 1J7RA 1TIZA 3BUWB 1FF1A 2KFFA 1CKKA 1EH2A 1FPWA 1EXRA 1QX7A 5HKWA 1MR8A 2BE4A 2M9GA 1JBAA 2CTNA 2F3ZA 1M46A 1F4OA 2MAZA 1WLMA 5CSNA 5IBWA 4E68A 1DJWA 1CMGA 3OHMB 4F0ZB 2LVIA 5I2QA 3FWCA 3RLZA 2L4IA 1QVIZ 5CPVA 1KK7Z 2H2KA 1DJYA 1UHNA 1TTXA 1S26D 3A8RA 3GOFA 2L50A 2Y5IA 4PE4A 4I5JA 1S5GZ 2PALA 1XYDA 4I5KA 1PALA 1V1GA 2JC2A 3I5GB 4DS7A 5BPJA 1KQVA 3A4UB 1DJGA 5ER5A 2ZN9A 1S36A 2I94A 4N5XA 4PHKA 3LK1A 1YUSA 3I5GC 1IQ3A 1YTZC 1A75A 2MBXA 2JT3A 1NUBA 2K7CA 2KNEA 1F4QA 1KK7Y 1BLQA 1C7VA 2AUCA 3VRNA 4DCKA 3SG4A 4C0KA 1KQMB 2M49B 4QJ5B 4ORCB 3DF0A 3SIAA 4DRWA 3O78A 2PVBA 2H61A 2E30A 2VRGA 1ZACA 2NXQA 1CTRA 1SW8A 2K7BA 3SG7A 1ZOTB 4ETOA 1TCOB 3AKBA 1S6JA 1WDCB 2Q4UA 1PULA 1PSRA 2RGIA 3M0WA 4M2PA 1YUTA 2EGDA 1NX2A 2M97A 2WC8A 2M1UA 2V53A 3DVKA 4PALA 1WDCC 2LE9B 4GUKA 1NX3A 5AANA 1CLLA 4MZKA 4ZCVA 1TNPA 1BG1A 4USLA 5D69A 3EVUA 1OSAA 4WRIA 1EL4A 1J7QA 2Q91A 1YVHA 1DVIA 1XFZO 1SPYA 1BMOA 1TOPA 1CLMA 1KWOB 3JTDB 4AOMA 4MRYA 1BR1B 1XFXO 2K61A 4IL1A 1B8RA 1BJFA 2NCOA 2LLUA 3JTDC 4I5LB 2JRFA 2ZRSA 1XK4A 1SL8A 1G33A 2LVVA 4MBEA 1M63B 2CNPA 1FW4A 1B7TY 1S1EA 1EJ3A 1NYAA 1LINA 3HX4A 1D1OA 1W7JB 1M39A 4M2QA 4GPLB 1SR6C 1LA3A 4UPGA 1CDPA 4AQIA 2LANA 2E6WA 1DGVA 1KSOA 1IKUA 4D1EA 5GQQC 1DF0A 2M1KB 1SMGA 1IJ6A 2BKIB 1HT9A 3PN7C 1KFXL 4QJ4B 2K7OA 1CLBA 1MHOA 1EG3A 1M31A 1NCXA 2M3WA 1WRZA 3H4SE 1OMRA 2LC5A 4CFQA 2GGZA 4QJ3B 2NLNA 4N1GA 2KYFA 3BUMB 3PM8A 2JNFA 4TNCA 3LLEA 3OB1B 1K9UA 2L0PA 2QACA 2LMUA 4PHMA 2AMIA 1X02A 2JXCA 1QTXA 1RWYA 1GGWA 5F6TA 3SJSA 2BE6A 3EKJA 3CZTX 4MN0A 1PRWA 2HETA 2BL0B 4MSPA 2LLTA 1JF2A 4PE0A 5CSFA 1G4YR 2K0JA 1QS7A
chains in the Genus database with same CATH superfamily
2BL0C 5FI7A 5AXIA 2JT8A 2WC5A 3I5HB 1QX5B 1UURA 2COLB 2WCEA 1ALVA 2KDHA 3EVRA 2PSRA 3PFVA 4INXA 3VRQA 5K89A 5DICA 1N65A 3SS3A 1QIWA 3I5HC 3D78A 1TNQA 2EC6B 3CTNA 1SY9A 2H61C 2L4HA 4P2YB 1UHIA 1M45A 3B87A 1XFUO 1SRAA 1GJYA 2BBNA 2WCLA 3FE6A 2EC6C 4BY5A 3DZTA 2BBMA 5HL1A 1KK8B 2PASA 1NSHA 2ZRTA 1YRUB 1PSBA 1SCMC 1UUSA 1YR5A 3GK4X 1KK8C 1IJ5A 1K96A 1IRJA 1K90D 1Z4HA 2QEOA 3BYAA 4ICBA 5ER4X 4MEWA 3S0AA 2ZNEA 1JSAA 3PJIA 2OPOA 5I8NA 4OR9B 5FI2A 4YGEB 2H8VA 3BXKA 3D73A 2LHIA 4DUQA 3ICBA 3TZ1A 1QXPA 1NX1A 1AVSA 2BCBA 3B86A 3EVVA 2ISDA 3SG3A 1SSEB 2GGMA 4N1FA 4F7FA 2L5YA 1BOCA 4WQ3A 1QLKA 1QVIY 3B88A 2ZNDA 1Q80A 1PVBA 3CR4X 4PCWA 1XK4C 3NSLA 3O4YA 2L51A 1B9AA 1DJHA 1LA0A 1S5GY 4GBAA 2HQWA 2NZ0A 2CT9A 5CSJA 4FQOA 1YRTB 3O2PA 4PDZA 1IH0A 2JTTA 1NP8A 2Y1NA 1DF0B 4PHNA 2HQ8A 4GAOA 3SG5A 3ZWHA 1DC1A 3LCPC 1AJ4A 1CM4A 4MLWA 5KSZA 4CFRA 2CCMA 4XJKA 3PALA 5JOLA 1Y6WA 4YBHB 2LVJA 2JWWA 2KAVA 1TNXA 2B1UA 3CWGA 4YGDB 1YX7A 1CFPA 3F45A 1CDLA 1ZUZA 1XFVO 1MWNA 1LXFC 1DGUA 5PALA 2O5GA 4C0JA 5KU1A 1SL7A 1W9ZA 3DVEA 1F71A 1KSMA 1GQMA 1QATA 2BKHB 2ZFDA 1RROA 3D10A 1OOJA 2JOJA 3RM1A 4CLNA 1U5IA 3CR5X 1JFJA 3NXAA 2LUXA 5FI6A 2I18A 2BECA 5G08A 1K9PA 2MLEC 2F2PA 1L2OB 1JF0A 2KI6C 1Y0VH 5AEQA 1FI6A 1QX2A 1K94A 1TWOA 3R1PA 3S0EA 1L2OC 2WNDA 3BUNB 4OV2A 2OTGB 5DKQA 1AUIB 2P70A 2LUCA 1CB1A 1SR6B 3NGVA 2JU0A 1NX0A 1TN4A 2L2EA 2KFHA 1YURA 2OTGC 4PE7A 1MQ1A 2BNXA 4M2OA 1GGZA 2FCDA 2WCJA 4YGBB 1TCFA 2KBIA 3I5FC 1OMDA 5KTYA 1RTP1 2GV5A 2ZKMX 3PN7B 1AK8A 3OB2B 2F8PA 2M8UA 3NHTA 5HLVA 3BUOB 3MSEB 1KQVA 1J7PA 2MA2A 2D8NA 1XA5A 3AAJA 3I5IB 2PMYA 3S0DA 1T14A 1WY9A 1SNLA 3E3RA 3GK2A 1J55A 1R6PA 5D7FA 3I5IC 3FIAA 4NDBA 2NCPA 2PYQA 3CLNA 3D0YA 3DY9A 3CR2A 4JQ0D 1FBVA 2HPSA 3DD4A 2M29A 3JVTB 4YI8A 5HKYA 3EKHA 2FJUB 1CMFA 1J1EA 1BU3A 2AAOA 2LMVA 3BFHA 1ODBA 1A75B 2EHBA 3JVTC 3QRXA 2FJYA 4JKTA 1ALWA 2CXJA 2JXLA 5HLOA 2WORA 3FE8A 1K93D 2KOTA 3WXAA 2Y4QA 1IQ5A 2KAXA 1CM1A 2LCPA 3CZ0A 1MXEA 2QPTA 3DF0B 1SL9A 4PHJA 1SK6D 2KI4C 4OKHA 3V2LA 1C3YA 3K21A 2K2FA 2M7LA 1LVCD 2IS9A 3L4LA 1C07A 1BT6A 1DMOA 1BODA 1K2HA 1OMVA 3IQOA 1MUXA 4HSZA 1NPQA 3OX6A 1NWDA 3WHUB 2M0RA 1PVAA 2KAYA 3K1EA 4XJKB 1XFYO 4A4CA 1NCZA 1A4PA 1OE9B 1SCMB 2CBLA 2G9BA 2KGBC 2LMTA 1S6IA 4ORBB 2A4JA 3D74A 3PATA 3TDIA 3WHTB 2WOSA 3AKAA 3BOWA 3UNWA 1N0YA 5I2OA 4JWQA 1WRLA 4HRGA 2KLDA 2F33A 4NDDA 1JWDA 1XO5A 3SIBA 3TUYC 1SYMA 3LL8B 1QASA 1OOHA 2WCFA 4GGFA 4MZLA 3BQ3A 1OOIX 3S0FA 2KHNA 3BFAA 2KI6D 3Q8IA 4YGAA 4C0LA 4JD9A 1JC2A 1V1FA 4FTGA 4YI9A 1LKJA 1ZFSA 2P6BB 3EK8A 2JPTA 4MZJA 4I5NB 1PK0D 1AJ5A 4XYNA 3O6BA 4JPZB 1KFUS 3R1OA 1B8CA 2LV7A 3CGAA 2F2OA 2WCBA 1S3PA 3CZ2A 2KSPA 1DJZA 2BCAA 2KFGA 3IVTA 1CNPA 2JT0A 2QEHA 2JULA 3TDUA 3KHEA 1TUZA 4DIRA 1DEKA 1DJXA 1OOGA 2SASA 4GNKB 1J7OA 4WQ2A 2JTZA 1NIWA 2K2AA 1VRKA 2Y1MA 2OS8B 3C1VA 4AQJA 1DELA 3SG6A 1WLZA 1CDNA 3FWBA 1YX8A 1F70A 2HF5A 3CS1A 1YVLA 3NSIA 2OS8C 3UO9A 1MXLC 1KFXS 1CFCA 1OQPA 1CFFA 4GGNA 4Q04A 1QJTA 2ZN8A 4U8DA 1RECA 1L7ZA 2L98A 3D76A 3DVMA 5AERA 2DOQA 1J1DA 3CYZA 4PT1A 3KPXA 4OVNF 1IG5A 3OGNA 2P71A 4MRXA 3D0YB 1B8LA 3VRPA 4CIDA 2JZIA 2R2IA 1R2UA 2JNXA 4YGCB 3S0GA 1KQMC 1YUUA 2GTEA 2O60A 1B1GA 2LAPA 1IWQA 1OOFA 4NDCA 5CSIA 4PE1A 3EK7A 4HRHA 1QV1A 5HYDA 5DKRA 5I2LA 1IGVA 1OZOA 1A2XA 2TN4A 3EK4A 1DQEA 2KGRA 1RK9A 3OBVA 2BCXA 1DT7B 2PRUA 1QIVA 4ZCUA 1XFWO 1TNWA 1TRFA 2MLFC 1DJIA 1F54A 2ERBA 5B8IB 3I5FB 5JJGA 1RJVA 3NSKA 1B4CA 1GM0A 2LP2A 1B7TZ 4ORAB 1JFKA 3KO0A 1OZSA 3NSOA 1UHKA 1AP4A 2KBMA 1CDMA 5HKZA 2KYCA 3VRRA 2KQ6A 2LP3A 1S6CA 1K95A 1MF8B 1IIOA 1K9KA 1AHRA 1KWOC 4R1EA 2KQYA 3OP0A 1F8HA 2MJWB 3BOWB 1KFUL 1A29A 4A4BA 1E8AA 4NQGA 1Y1UA 1ORGA 3IF7A 2I2RE 4GFTA 1LS8A 1BF5A 1G8IA 1FI5A 2LM5A 1UWOA 3PSRA 1SKTA 2LLSA 4GGFC 2F3YA 3VB1A 1Y1XA 3BJHA 4OCIA 3BUXB 3VROA 1UP5A 2QEBA 4PALA 2I7AA 2K7DA 2WCKA 3TS5B 1A03A 2MRDA 1WRKA 1B47A 1Y1AA 3FS7A 4L9MA 3VGOA 1C7WA 2FOTA 1OW4A 3IQQA 1F55A 3OX5A 3SS4A 3TS5C 2KI4B 2G2BA 5AFPA 1K8UA 3NHIA 1ZMZA 3DVJA 4YRUA 1UHJA 2MHHA 1W7IB 1EG4A 1JUOA 1NCYA 3HCMA 2K8MB 3AAKA 3KF9A 3PLFB 1N2DA 1SCVA 2FCEA 3D77A 1HQVA 4HREE 1QLSA 5J3XA 1QV0A 4MVFA 1H8BA 3LK0A 3ZNIA 4IJ7A 5FYXA 3WNXB 1CFDA 2LHLA 3TDZA 2LVKA 4BY4A 4CPVA 1RFJA 2WCMA 2JQ6A 3RZSA 2SCPA 1XVJA 2WCHA 3SG2A 1DTLA 2M7NA 5TNCA 3TUYB 3KEVA 4P5OE 5D3OA 1BR4B 1UHHA 5DKNA 1H4BA 2LNKA 1KCYA 3B6XA 2L5XB 1SBJA 1U5IB 5EL2A 1J7RA 1TIZA 3BUWB 1FF1A 2KFFA 1CKKA 1EH2A 1FPWA 2PQLA 1EXRA 1QX7A 5HKWA 1MR8A 2BE4A 2M9GA 1JBAA 2CTNA 2F3ZA 1M46A 1F4OA 2MAZA 1WLMA 5CSNA 5IBWA 4E68A 1DJWA 1CMGA 3OHMB 4F0ZB 3D75A 4INWA 2LVIA 5I2QA 3FWCA 3RLZA 2L4IA 1QVIZ 5CPVA 1KK7Z 2H2KA 1DJYA 1UHNA 1TUJA 1TTXA 1S26D 3A8RA 2L50A 2Y5IA 3GOFA 3PM2A 4PE4A 4I5JA 1S5GZ 2PALA 3R1VA 4KYNA 1XYDA 4I5KA 1PALA 1V1GA 2JC2A 3I5GB 3QMEA 4DS7A 5BPJA 3A4UB 1XFRA 1DJGA 3R72A 3SS5A 3CABA 5ER5A 2ZN9A 1S36A 2I94A 4N5XA 4PHKA 3LK1A 1YUSA 3I5GC 1IQ3A 1YTZC 4FQTA 1A75A 3L47A 2MBXA 2JT3A 1NUBA 2K7CA 2KNEA 1F4QA 1KK7Y 1BLQA 1C7VA 2AUCA 3VRNA 4DCKA 3SG4A 4C0KA 1KQMB 2M49B 4QJ5B 4ORCB 3DF0A 3SIAA 4DRWA 3O78A 2PVBA 2H61A 2E30A 2VRGA 1ZACA 2NXQA 1CTRA 1SW8A 2K7BA 3SG7A 1ZOTB 2YGUA 4ETOA 1TCOB 3AKBA 3B7AA 3GK1A 1S6JA 1WDCB 2Q4UA 1PULA 1PSRA 2RGIA 3M0WA 4M2PA 1YUTA 1C3ZA 1NX2A 2EGDA 2M97A 2M1UA 2V53A 2K60A 2WC8A 1WDCC 2KLEA 2LE9B 3DVKA 3DXLA 3DYEA 1NX3A 4GUKA 5AANA 1CLLA 4MZKA 4ZCVA 1TNPA 1BG1A 4USLA 5D69A 3EVUA 1OSAA 4WRIA 1EL4A 1J7QA 2Q91A 3BFBA 1YVHA 3EG5B 1DVIA 1XFZO 1SPYA 1BMOA 1TOPA 1CLMA 1KWOB 3JTDB 4AOMA 4MRYA 1BR1B 1XFXO 2K61A 4IL1A 1B8RA 1BJFA 2NCOA 2LLUA 3JTDC 4I5LB 2JRFA 2ZRSA 1XK4A 1SL8A 1G33A 2LVVA 4MBEA 1M63B 2CNPA 1FW4A 1B7TY 3FE9A 1S1EA 1EJ3A 1NYAA 1LINA 3HX4A 1D1OA 1W7JB 1M39A 1QWVA 4M2QA 4GPLB 1SR6C 1LA3A 4UPGA 1CDPA 4AQIA 2LANA 2E6WA 1DGVA 2L2CA 1KSOA 1IKUA 4D1EA 5GQQC 2QEVA 1DF0A 2M1KB 1SMGA 3CDNA 3N7HA 1IJ6A 2BKIB 3S0BA 1HT9A 5I94A 3PN7C 1KFXL 4QJ4B 2K7OA 1CLBA 1Z2CB 4OZDA 1MHOA 1EG3A 1M31A 1NCXA 2M3WA 1WRZA 3H4SE 3O4XA 1OMRA 2LC5A 4CFQA 2GGZA 1P28A 4QJ3B 2NLNA 4N1GA 2KYFA 3BUMB 3PM8A 2JNFA 4TNCA 3LLEA 3OB1B 1K9UA 2JPOA 2L0PA 2QACA 2LMUA 2BAPA 4PHMA 2AMIA 3L4AA 2QDIA 1X02A 2JXCA 3CZ1A 1QTXA 1RWYA 1GGWA 5F6TA 3SJSA 2BE6A 3EKJA 3CZTX 4MN0A 1PRWA 2HETA 2BL0B 4MSPA 2LLTA 2KPHA 2WC6A 1JF2A 4PE0A 5CSFA 1G4YR 2K0JA 1QS7A
chains in the Genus database with same CATH topology
2BL0C 5AXIA 2JT8A 3I5HB 1QX5B 1UURA 2COLB 2WCEA 1ALVA 2KDHA 3EVRA 2PSRA 3PFVA 3VRQA 5K89A 1N65A 1QIWA 3I5HC 1TNQA 2EC6B 3CTNA 1SY9A 2H61C 2L4HA 4P2YB 1UHIA 1M45A 1XFUO 1SRAA 1GJYA 2BBNA 2EC6C 4BY5A 2BBMA 1KK8B 2PASA 1NSHA 2ZRTA 1YRUB 1PSBA 1SCMC 1UUSA 1YR5A 3GK4X 1KK8C 1IJ5A 1K96A 1IRJA 1K90D 3BYAA 4ICBA 5ER4X 4MEWA 2ZNEA 1JSAA 5I8NA 2OPOA 4OR9B 4YGEB 3BXKA 2LHIA 4DUQA 3ICBA 3TZ1A 1QXPA 1NX1A 1AVSA 2BCBA 2ISDA 3EVVA 3SG3A 2GGMA 4N1FA 1BOCA 4WQ3A 1QLKA 1QVIY 2ZNDA 1Q80A 1PVBA 3CR4X 4PCWA 1XK4C 3NSLA 3O4YA 2L51A 1B9AA 1DJHA 1LA0A 1S5GY 4GBAA 2HQWA 2NZ0A 2CT9A 5CSJA 4FQOA 1YRTB 3O2PA 4PDZA 1IH0A 2JTTA 1NP8A 2Y1NA 1DF0B 4PHNA 2HQ8A 4GAOA 3SG5A 3ZWHA 3LCPC 1AJ4A 1CM4A 4MLWA 5KSZA 4CFRA 2CCMA 4XJKA 3PALA 5JOLA 1Y6WA 4YBHB 2LVJA 2JWWA 2KAVA 1TNXA 2B1UA 3CWGA 4YGDB 1YX7A 1CFPA 3F45A 1CDLA 1ZUZA 1XFVO 1MWNA 1LXFC 1DGUA 5PALA 2O5GA 4C0JA 5KU1A 1SL7A 3DVEA 1F71A 1KSMA 1GQMA 1QATA 2BKHB 2ZFDA 1RROA 3D10A 1OOJA 2JOJA 3RM1A 4CLNA 1U5IA 3CR5X 1JFJA 3NXAA 2LUXA 2I18A 2BECA 5G08A 1K9PA 2MLEC 2F2PA 1L2OB 1JF0A 2KI6C 1Y0VH 5AEQA 1FI6A 1QX2A 1K94A 1L2OC 2WNDA 3BUNB 4OV2A 2OTGB 5DKQA 1AUIB 2LUCA 1CB1A 1SR6B 2JU0A 1NX0A 1TN4A 2L2EA 2KFHA 1YURA 2OTGC 4PE7A 1MQ1A 4M2OA 1GGZA 2FCDA 4YGBB 1TCFA 2KBIA 3I5FC 1OMDA 5KTYA 1RTP1 2GV5A 2ZKMX 3PN7B 1AK8A 3OB2B 2F8PA 2M8UA 5HLVA 3BUOB 3MSEB 1J7PA 2MA2A 2D8NA 1XA5A 3AAJA 3I5IB 2PMYA 1WY9A 1SNLA 3E3RA 3GK2A 1J55A 1R6PA 5D7FA 3I5IC 3FIAA 4NDBA 2NCPA 3CLNA 3D0YA 3CR2A 4JQ0D 1FBVA 2HPSA 3DD4A 2M29A 3JVTB 4YI8A 5HKYA 3EKHA 2FJUB 1CMFA 1J1EA 1BU3A 2AAOA 2LMVA 1ODBA 1A75B 2EHBA 3JVTC 3QRXA 1ALWA 2CXJA 2JXLA 5HLOA 2WORA 1K93D 2KOTA 3WXAA 2Y4QA 1IQ5A 2KAXA 1CM1A 2LCPA 3DF0B 1MXEA 2QPTA 1SL9A 4PHJA 1SK6D 2KI4C 4OKHA 3K21A 2K2FA 2M7LA 1LVCD 2IS9A 1C07A 1BT6A 1BODA 1K2HA 1OMVA 3IQOA 1MUXA 4HSZA 1NPQA 3OX6A 1NWDA 3WHUB 2M0RA 1PVAA 2KAYA 4XJKB 1DMOA 1XFYO 4A4CA 1NCZA 1A4PA 1OE9B 1SCMB 2CBLA 2G9BA 2KGBC 2LMTA 1S6IA 4ORBB 2A4JA 3PATA 3TDIA 3WHTB 2WOSA 3AKAA 3BOWA 1N0YA 5I2OA 4JWQA 1WRLA 4HRGA 2F33A 4NDDA 1JWDA 1XO5A 3SIBA 3TUYC 1SYMA 3LL8B 1QASA 2WCFA 4GGFA 4MZLA 3BQ3A 2KHNA 2KI6D 4YGAA 4C0LA 1JC2A 1V1FA 4FTGA 4YI9A 1LKJA 1ZFSA 2P6BB 3EK8A 2JPTA 4MZJA 4I5NB 1PK0D 1AJ5A 4XYNA 3O6BA 4JPZB 1KFUS 1B8CA 2LV7A 3CGAA 2F2OA 2WCBA 1S3PA 3GK1A 2KSPA 1DJZA 2BCAA 2KFGA 1CNPA 2JT0A 2JULA 3TDUA 3KHEA 4DIRA 1DJXA 2SASA 4GNKB 1J7OA 4WQ2A 2JTZA 1NIWA 2K2AA 1VRKA 2Y1MA 2OS8B 3C1VA 4AQJA 3SG6A 1WLZA 1CDNA 3FWBA 1YX8A 1F70A 2HF5A 3CS1A 1YVLA 3NSIA 2OS8C 1MXLC 1KFXS 1CFCA 1OQPA 1CFFA 4GGNA 4Q04A 1QJTA 2ZN8A 4U8DA 1RECA 1L7ZA 2L98A 3DVMA 5AERA 2DOQA 1J1DA 3KPXA 4OVNF 1IG5A 4MRXA 3D0YB 1B8LA 3VRPA 4CIDA 2JZIA 2R2IA 1R2UA 2JNXA 4YGCB 1B1GA 1KQMC 1YUUA 2O60A 2LAPA 1IWQA 4NDCA 5CSIA 4PE1A 3EK7A 4HRHA 1QV1A 5HYDA 5DKRA 5I2LA 1IGVA 1OZOA 1A2XA 2TN4A 3EK4A 2KGRA 1RK9A 2BCXA 1DT7B 2PRUA 1QIVA 4ZCUA 1XFWO 1TNWA 1TRFA 2MLFC 1DJIA 1F54A 5B8IB 3I5FB 5JJGA 1RJVA 3NSKA 1B4CA 2LP2A 1B7TZ 4ORAB 1JFKA 3KO0A 1OZSA 3NSOA 1UHKA 1AP4A 2KBMA 1CDMA 5HKZA 2KYCA 3VRRA 2KQ6A 2LP3A 1S6CA 1K95A 1MF8B 1K9KA 1AHRA 1KWOC 4R1EA 2KQYA 3OP0A 1F8HA 2MJWB 3BOWB 1KFUL 1A29A 4A4BA 1E8AA 4NQGA 1Y1UA 3IF7A 2I2RE 4GFTA 1BF5A 1G8IA 1FI5A 2LM5A 1UWOA 3PSRA 1SKTA 2LLSA 4GGFC 2F3YA 1Y1XA 4OCIA 3BUXB 3VROA 1UP5A 2I7AA 2K7DA 3TS5B 1A03A 2MRDA 1WRKA 1B47A 1Y1AA 3FS7A 4L9MA 3VGOA 1C7WA 2FOTA 3IQQA 1F55A 3OX5A 3TS5C 2KI4B 2G2BA 5AFPA 1K8UA 1ZMZA 3DVJA 4YRUA 1UHJA 2MHHA 1W7IB 1EG4A 1JUOA 1NCYA 3HCMA 2K8MB 3AAKA 3KF9A 3PLFB 1N2DA 1SCVA 2FCEA 4HREE 1HQVA 5J3XA 1QLSA 1QV0A 4MVFA 1H8BA 3LK0A 3ZNIA 5FYXA 3WNXB 1CFDA 2LHLA 3TDZA 2LVKA 4BY4A 4CPVA 1RFJA 2JQ6A 2SCPA 1XVJA 3SG2A 1DTLA 2M7NA 5TNCA 3TUYB 3KEVA 4P5OE 1BR4B 1UHHA 5DKNA 1H4BA 2LNKA 1KCYA 2L5XB 1SBJA 1U5IB 1J7RA 1TIZA 3BUWB 1FF1A 2KFFA 1CKKA 1EH2A 1FPWA 1EXRA 1QX7A 5HKWA 1MR8A 2BE4A 2M9GA 1JBAA 2CTNA 2F3ZA 1M46A 1F4OA 2MAZA 1WLMA 5CSNA 5IBWA 4E68A 1DJWA 1CMGA 3OHMB 4F0ZB 2LVIA 5I2QA 3FWCA 3RLZA 2L4IA 1QVIZ 5CPVA 1KK7Z 2H2KA 1DJYA 1UHNA 1TTXA 1S26D 3A8RA 3GOFA 2L50A 2Y5IA 4PE4A 4I5JA 1S5GZ 2PALA 1XYDA 4I5KA 1PALA 1V1GA 2JC2A 3I5GB 4DS7A 5BPJA 1KQVA 3A4UB 1DJGA 5ER5A 2ZN9A 1S36A 2I94A 4N5XA 4PHKA 3LK1A 1YUSA 3I5GC 1IQ3A 1YTZC 1A75A 2MBXA 2JT3A 1NUBA 2K7CA 2KNEA 1F4QA 1KK7Y 1BLQA 1C7VA 2AUCA 3VRNA 4DCKA 3SG4A 4C0KA 1KQMB 2M49B 4QJ5B 4ORCB 3DF0A 3SIAA 4DRWA 3O78A 2PVBA 2H61A 2E30A 2VRGA 1ZACA 2NXQA 1CTRA 1SW8A 2K7BA 3SG7A 1ZOTB 4ETOA 1TCOB 3AKBA 1S6JA 1WDCB 2Q4UA 1PULA 1PSRA 2RGIA 3M0WA 4M2PA 1YUTA 2EGDA 1NX2A 2M97A 2WC8A 2M1UA 2V53A 3DVKA 4PALA 1WDCC 2LE9B 4GUKA 1NX3A 5AANA 1CLLA 4MZKA 4ZCVA 1TNPA 1BG1A 4USLA 5D69A 3EVUA 1OSAA 4WRIA 1EL4A 1J7QA 2Q91A 1YVHA 1DVIA 1XFZO 1SPYA 1BMOA 1TOPA 1CLMA 1KWOB 3JTDB 4AOMA 4MRYA 1BR1B 1XFXO 2K61A 4IL1A 1B8RA 1BJFA 2NCOA 2LLUA 3JTDC 4I5LB 2JRFA 2ZRSA 1XK4A 1SL8A 1G33A 2LVVA 4MBEA 1M63B 2CNPA 1FW4A 1B7TY 1S1EA 1EJ3A 1NYAA 1LINA 3HX4A 1D1OA 1W7JB 1M39A 4M2QA 4GPLB 1SR6C 1LA3A 4UPGA 1CDPA 4AQIA 2LANA 2E6WA 1DGVA 1KSOA 1IKUA 4D1EA 5GQQC 1DF0A 2M1KB 1SMGA 1IJ6A 2BKIB 1HT9A 3PN7C 1KFXL 4QJ4B 2K7OA 1CLBA 1MHOA 1EG3A 1M31A 1NCXA 2M3WA 1WRZA 3H4SE 1OMRA 2LC5A 4CFQA 2GGZA 4QJ3B 2NLNA 4N1GA 2KYFA 3BUMB 3PM8A 2JNFA 4TNCA 3LLEA 3OB1B 1K9UA 2L0PA 2QACA 2LMUA 4PHMA 2AMIA 1X02A 2JXCA 1QTXA 1RWYA 1GGWA 5F6TA 3SJSA 2BE6A 3EKJA 3CZTX 4MN0A 1PRWA 2HETA 2BL0B 4MSPA 2LLTA 1JF2A 4PE0A 5CSFA 1G4YR 2K0JA 1QS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL0 C;  5AXI A;  2JT8 A;  3I5H B;  1QX5 B;  1UUR A;  2COL B;  2WCE A;  1ALV A;  2KDH A;  3EVR A;  2PSR A;  3PFV A;  3VRQ A;  5K89 A;  1N65 A;  1QIW A;  3I5H C;  1TNQ A;  2EC6 B;  3CTN A;  1SY9 A;  2H61 C;  2L4H A;  4P2Y B;  1UHI A;  1M45 A;  1XFU O;  1SRA A;  1GJY A;  2BBN A;  2EC6 C;  4BY5 A;  2BBM A;  1KK8 B;  2PAS A;  1NSH A;  2ZRT A;  1YRU B;  1PSB A;  1SCM C;  1UUS A;  1YR5 A;  3GK4 X;  1KK8 C;  1IJ5 A;  1K96 A;  1IRJ A;  1K90 D;  3BYA A;  4ICB A;  5ER4 X;  4MEW A;  2ZNE A;  1JSA A;  5I8N A;  2OPO A;  4OR9 B;  4YGE B;  3BXK A;  2LHI A;  4DUQ A;  3ICB A;  3TZ1 A;  1QXP A;  1NX1 A;  1AVS A;  2BCB A;  2ISD A;  3EVV A;  3SG3 A;  2GGM A;  4N1F A;  1BOC A;  4WQ3 A;  1QLK A;  1QVI Y;  2ZND A;  1Q80 A;  1PVB A;  3CR4 X;  4PCW A;  1XK4 C;  3NSL A;  3O4Y A;  2L51 A;  1B9A A;  1DJH A;  1LA0 A;  1S5G Y;  4GBA A;  2HQW A;  2NZ0 A;  2CT9 A;  5CSJ A;  4FQO A;  1YRT B;  3O2P A;  4PDZ A;  1IH0 A;  2JTT A;  1NP8 A;  2Y1N A;  1DF0 B;  4PHN A;  2HQ8 A;  4GAO A;  3SG5 A;  3ZWH A;  3LCP C;  1AJ4 A;  1CM4 A;  4MLW A;  5KSZ A;  4CFR A;  2CCM A;  4XJK A;  3PAL A;  5JOL A;  1Y6W A;  4YBH B;  2LVJ A;  2JWW A;  2KAV A;  1TNX A;  2B1U A;  3CWG A;  4YGD B;  1YX7 A;  1CFP A;  3F45 A;  1CDL A;  1ZUZ A;  1XFV O;  1MWN A;  1LXF C;  1DGU A;  5PAL A;  2O5G A;  4C0J A;  5KU1 A;  1SL7 A;  3DVE A;  1F71 A;  1KSM A;  1GQM A;  1QAT A;  2BKH B;  2ZFD A;  1RRO A;  3D10 A;  1OOJ A;  2JOJ A;  3RM1 A;  4CLN A;  1U5I A;  3CR5 X;  1JFJ A;  3NXA A;  2LUX A;  2I18 A;  2BEC A;  5G08 A;  1K9P A;  2MLE C;  2F2P A;  1L2O B;  1JF0 A;  2KI6 C;  1Y0V H;  5AEQ A;  1FI6 A;  1QX2 A;  1K94 A;  1L2O C;  2WND A;  3BUN B;  4OV2 A;  2OTG B;  5DKQ A;  1AUI B;  2LUC A;  1CB1 A;  1SR6 B;  2JU0 A;  1NX0 A;  1TN4 A;  2L2E A;  2KFH A;  1YUR A;  2OTG C;  4PE7 A;  1MQ1 A;  4M2O A;  1GGZ A;  2FCD A;  4YGB B;  1TCF A;  2KBI A;  3I5F C;  1OMD A;  5KTY A;  1RTP 1;  2GV5 A;  2ZKM X;  3PN7 B;  1AK8 A;  3OB2 B;  2F8P A;  2M8U A;  5HLV A;  3BUO B;  3MSE B;  1J7P A;  2MA2 A;  2D8N A;  1XA5 A;  3AAJ A;  3I5I B;  2PMY A;  1WY9 A;  1SNL A;  3E3R A;  3GK2 A;  1J55 A;  1R6P A;  5D7F A;  3I5I C;  3FIA A;  4NDB A;  2NCP A;  3CLN A;  3D0Y A;  3CR2 A;  4JQ0 D;  1FBV A;  2HPS A;  3DD4 A;  2M29 A;  3JVT B;  4YI8 A;  5HKY A;  3EKH A;  2FJU B;  1CMF A;  1J1E A;  1BU3 A;  2AAO A;  2LMV A;  1ODB A;  1A75 B;  2EHB A;  3JVT C;  3QRX A;  1ALW A;  2CXJ A;  2JXL A;  5HLO A;  2WOR A;  1K93 D;  2KOT A;  3WXA A;  2Y4Q A;  1IQ5 A;  2KAX A;  1CM1 A;  2LCP A;  3DF0 B;  1MXE A;  2QPT A;  1SL9 A;  4PHJ A;  1SK6 D;  2KI4 C;  4OKH A;  3K21 A;  2K2F A;  2M7L A;  1LVC D;  2IS9 A;  1C07 A;  1BT6 A;  1BOD A;  1K2H A;  1OMV A;  3IQO A;  1MUX A;  4HSZ A;  1NPQ A;  3OX6 A;  1NWD A;  3WHU B;  2M0R A;  1PVA A;  2KAY A;  4XJK B;  1DMO A;  1XFY O;  4A4C A;  1NCZ A;  1A4P A;  1OE9 B;  1SCM B;  2CBL A;  2G9B A;  2KGB C;  2LMT A;  1S6I A;  4ORB B;  2A4J A;  3PAT A;  3TDI A;  3WHT B;  2WOS A;  3AKA A;  3BOW A;  1N0Y A;  5I2O A;  4JWQ A;  1WRL A;  4HRG A;  2F33 A;  4NDD A;  1JWD A;  1XO5 A;  3SIB A;  3TUY C;  1SYM A;  3LL8 B;  1QAS A;  2WCF A;  4GGF A;  4MZL A;  3BQ3 A;  2KHN A;  2KI6 D;  4YGA A;  4C0L A;  1JC2 A;  1V1F A;  4FTG A;  4YI9 A;  1LKJ A;  1ZFS A;  2P6B B;  3EK8 A;  2JPT A;  4MZJ A;  4I5N B;  1PK0 D;  1AJ5 A;  4XYN A;  3O6B A;  4JPZ B;  1KFU S;  1B8C A;  2LV7 A;  3CGA A;  2F2O A;  2WCB A;  1S3P A;  3GK1 A;  2KSP A;  1DJZ A;  2BCA A;  2KFG A;  1CNP A;  2JT0 A;  2JUL A;  3TDU A;  3KHE A;  4DIR A;  1DJX A;  2SAS A;  4GNK B;  1J7O A;  4WQ2 A;  2JTZ A;  1NIW A;  2K2A A;  1VRK A;  2Y1M A;  2OS8 B;  3C1V A;  4AQJ A;  3SG6 A;  1WLZ A;  1CDN A;  3FWB A;  1YX8 A;  1F70 A;  2HF5 A;  3CS1 A;  1YVL A;  3NSI A;  2OS8 C;  1MXL C;  1KFX S;  1CFC A;  1OQP A;  1CFF A;  4GGN A;  4Q04 A;  1QJT A;  2ZN8 A;  4U8D A;  1REC A;  1L7Z A;  2L98 A;  3DVM A;  5AER A;  2DOQ A;  1J1D A;  3KPX A;  4OVN F;  1IG5 A;  4MRX A;  3D0Y B;  1B8L A;  3VRP A;  4CID A;  2JZI A;  2R2I A;  1R2U A;  2JNX A;  4YGC B;  1B1G A;  1KQM C;  1YUU A;  2O60 A;  2LAP A;  1IWQ A;  4NDC A;  5CSI A;  4PE1 A;  3EK7 A;  4HRH A;  1QV1 A;  5HYD A;  5DKR A;  5I2L A;  1IGV A;  1OZO A;  1A2X A;  2TN4 A;  3EK4 A;  2KGR A;  1RK9 A;  2BCX A;  1DT7 B;  2PRU A;  1QIV A;  4ZCU A;  1XFW O;  1TNW A;  1TRF A;  2MLF C;  1DJI A;  1F54 A;  5B8I B;  3I5F B;  5JJG A;  1RJV A;  3NSK A;  1B4C A;  2LP2 A;  1B7T Z;  4ORA B;  1JFK A;  3KO0 A;  1OZS A;  3NSO A;  1UHK A;  1AP4 A;  2KBM A;  1CDM A;  5HKZ A;  2KYC A;  3VRR A;  2KQ6 A;  2LP3 A;  1S6C A;  1K95 A;  1MF8 B;  1K9K A;  1AHR A;  1KWO C;  4R1E A;  2KQY A;  3OP0 A;  1F8H A;  2MJW B;  3BOW B;  1KFU L;  1A29 A;  4A4B A;  1E8A A;  4NQG A;  1Y1U A;  3IF7 A;  2I2R E;  4GFT A;  1BF5 A;  1G8I A;  1FI5 A;  2LM5 A;  1UWO A;  3PSR A;  1SKT A;  2LLS A;  4GGF C;  2F3Y A;  1Y1X A;  4OCI A;  3BUX B;  3VRO A;  1UP5 A;  2I7A A;  2K7D A;  3TS5 B;  1A03 A;  2MRD A;  1WRK A;  1B47 A;  1Y1A A;  3FS7 A;  4L9M A;  3VGO A;  1C7W A;  2FOT A;  3IQQ A;  1F55 A;  3OX5 A;  3TS5 C;  2KI4 B;  2G2B A;  5AFP A;  1K8U A;  1ZMZ A;  3DVJ A;  4YRU A;  1UHJ A;  2MHH A;  1W7I B;  1EG4 A;  1JUO A;  1NCY A;  3HCM A;  2K8M B;  3AAK A;  3KF9 A;  3PLF B;  1N2D A;  1SCV A;  2FCE A;  4HRE E;  1HQV A;  5J3X A;  1QLS A;  1QV0 A;  4MVF A;  1H8B A;  3LK0 A;  3ZNI A;  5FYX A;  3WNX B;  1CFD A;  2LHL A;  3TDZ A;  2LVK A;  4BY4 A;  4CPV A;  1RFJ A;  2JQ6 A;  2SCP A;  1XVJ A;  3SG2 A;  1DTL A;  2M7N A;  5TNC A;  3TUY B;  3KEV A;  4P5O E;  1BR4 B;  1UHH A;  5DKN A;  1H4B A;  2LNK A;  1KCY A;  2L5X B;  1SBJ A;  1U5I B;  1J7R A;  1TIZ A;  3BUW B;  1FF1 A;  2KFF A;  1CKK A;  1EH2 A;  1FPW A;  1EXR A;  1QX7 A;  5HKW A;  1MR8 A;  2BE4 A;  2M9G A;  1JBA A;  2CTN A;  2F3Z A;  1M46 A;  1F4O A;  2MAZ A;  1WLM A;  5CSN A;  5IBW A;  4E68 A;  1DJW A;  1CMG A;  3OHM B;  4F0Z B;  2LVI A;  5I2Q A;  3FWC A;  3RLZ A;  2L4I A;  1QVI Z;  5CPV A;  1KK7 Z;  2H2K A;  1DJY A;  1UHN A;  1TTX A;  1S26 D;  3A8R A;  3GOF A;  2L50 A;  2Y5I A;  4PE4 A;  4I5J A;  1S5G Z;  2PAL A;  1XYD A;  4I5K A;  1PAL A;  1V1G A;  2JC2 A;  3I5G B;  4DS7 A;  5BPJ A;  1KQV A;  3A4U B;  1DJG A;  5ER5 A;  2ZN9 A;  1S36 A;  2I94 A;  4N5X A;  4PHK A;  3LK1 A;  1YUS A;  3I5G C;  1IQ3 A;  1YTZ C;  1A75 A;  2MBX A;  2JT3 A;  1NUB A;  2K7C A;  2KNE A;  1F4Q A;  1KK7 Y;  1BLQ A;  1C7V A;  2AUC A;  3VRN A;  4DCK A;  3SG4 A;  4C0K A;  1KQM B;  2M49 B;  4QJ5 B;  4ORC B;  3DF0 A;  3SIA A;  4DRW A;  3O78 A;  2PVB A;  2H61 A;  2E30 A;  2VRG A;  1ZAC A;  2NXQ A;  1CTR A;  1SW8 A;  2K7B A;  3SG7 A;  1ZOT B;  4ETO A;  1TCO B;  3AKB A;  1S6J A;  1WDC B;  2Q4U A;  1PUL A;  1PSR A;  2RGI A;  3M0W A;  4M2P A;  1YUT A;  2EGD A;  1NX2 A;  2M97 A;  2WC8 A;  2M1U A;  2V53 A;  3DVK A;  4PAL A;  1WDC C;  2LE9 B;  4GUK A;  1NX3 A;  5AAN A;  1CLL A;  4MZK A;  4ZCV A;  1TNP A;  1BG1 A;  4USL A;  5D69 A;  3EVU A;  1OSA A;  4WRI A;  1EL4 A;  1J7Q A;  2Q91 A;  1YVH A;  1DVI A;  1XFZ O;  1SPY A;  1BMO A;  1TOP A;  1CLM A;  1KWO B;  3JTD B;  4AOM A;  4MRY A;  1BR1 B;  1XFX O;  2K61 A;  4IL1 A;  1B8R A;  1BJF A;  2NCO A;  2LLU A;  3JTD C;  4I5L B;  2JRF A;  2ZRS A;  1XK4 A;  1SL8 A;  1G33 A;  2LVV A;  4MBE A;  1M63 B;  2CNP A;  1FW4 A;  1B7T Y;  1S1E A;  1EJ3 A;  1NYA A;  1LIN A;  3HX4 A;  1D1O A;  1W7J B;  1M39 A;  4M2Q A;  4GPL B;  1SR6 C;  1LA3 A;  4UPG A;  1CDP A;  4AQI A;  2LAN A;  2E6W A;  1DGV A;  1KSO A;  1IKU A;  4D1E A;  5GQQ C;  1DF0 A;  2M1K B;  1SMG A;  1IJ6 A;  2BKI B;  1HT9 A;  3PN7 C;  1KFX L;  4QJ4 B;  2K7O A;  1CLB A;  1MHO A;  1EG3 A;  1M31 A;  1NCX A;  2M3W A;  1WRZ A;  3H4S E;  1OMR A;  2LC5 A;  4CFQ A;  2GGZ A;  4QJ3 B;  2NLN A;  4N1G A;  2KYF A;  3BUM B;  3PM8 A;  2JNF A;  4TNC A;  3LLE A;  3OB1 B;  1K9U A;  2L0P A;  2QAC A;  2LMU A;  4PHM A;  2AMI A;  1X02 A;  2JXC A;  1QTX A;  1RWY A;  1GGW A;  5F6T A;  3SJS A;  2BE6 A;  3EKJ A;  3CZT X;  4MN0 A;  1PRW A;  2HET A;  2BL0 B;  4MSP A;  2LLT A;  1JF2 A;  4PE0 A;  5CSF A;  1G4Y R;  2K0J A;  1QS7 A; 
#chains in the Genus database with same CATH topology
 2BL0 C;  5FI7 A;  5AXI A;  2JT8 A;  2WC5 A;  3I5H B;  1QX5 B;  1UUR A;  2COL B;  2WCE A;  1ALV A;  2KDH A;  3EVR A;  2PSR A;  3PFV A;  4INX A;  3VRQ A;  5K89 A;  5DIC A;  1N65 A;  3SS3 A;  1QIW A;  3I5H C;  3D78 A;  1TNQ A;  2EC6 B;  3CTN A;  1SY9 A;  2H61 C;  2L4H A;  4P2Y B;  1UHI A;  1M45 A;  3B87 A;  1XFU O;  1SRA A;  1GJY A;  2BBN A;  2WCL A;  3FE6 A;  2EC6 C;  4BY5 A;  3DZT A;  2BBM A;  5HL1 A;  1KK8 B;  2PAS A;  1NSH A;  2ZRT A;  1YRU B;  1PSB A;  1SCM C;  1UUS A;  1YR5 A;  3GK4 X;  1KK8 C;  1IJ5 A;  1K96 A;  1IRJ A;  1K90 D;  1Z4H A;  2QEO A;  3BYA A;  4ICB A;  5ER4 X;  4MEW A;  3S0A A;  2ZNE A;  1JSA A;  3PJI A;  2OPO A;  5I8N A;  4OR9 B;  5FI2 A;  4YGE B;  2H8V A;  3BXK A;  3D73 A;  2LHI A;  4DUQ A;  3ICB A;  3TZ1 A;  1QXP A;  1NX1 A;  1AVS A;  2BCB A;  3B86 A;  3EVV A;  2ISD A;  3SG3 A;  1SSE B;  2GGM A;  4N1F A;  4F7F A;  2L5Y A;  1BOC A;  4WQ3 A;  1QLK A;  1QVI Y;  3B88 A;  2ZND A;  1Q80 A;  1PVB A;  3CR4 X;  4PCW A;  1XK4 C;  3NSL A;  3O4Y A;  2L51 A;  1B9A A;  1DJH A;  1LA0 A;  1S5G Y;  4GBA A;  2HQW A;  2NZ0 A;  2CT9 A;  5CSJ A;  4FQO A;  1YRT B;  3O2P A;  4PDZ A;  1IH0 A;  2JTT A;  1NP8 A;  2Y1N A;  1DF0 B;  4PHN A;  2HQ8 A;  4GAO A;  3SG5 A;  3ZWH A;  1DC1 A;  3LCP C;  1AJ4 A;  1CM4 A;  4MLW A;  5KSZ A;  4CFR A;  2CCM A;  4XJK A;  3PAL A;  5JOL A;  1Y6W A;  4YBH B;  2LVJ A;  2JWW A;  2KAV A;  1TNX A;  2B1U A;  3CWG A;  4YGD B;  1YX7 A;  1CFP A;  3F45 A;  1CDL A;  1ZUZ A;  1XFV O;  1MWN A;  1LXF C;  1DGU A;  5PAL A;  2O5G A;  4C0J A;  5KU1 A;  1SL7 A;  1W9Z A;  3DVE A;  1F71 A;  1KSM A;  1GQM A;  1QAT A;  2BKH B;  2ZFD A;  1RRO A;  3D10 A;  1OOJ A;  2JOJ A;  3RM1 A;  4CLN A;  1U5I A;  3CR5 X;  1JFJ A;  3NXA A;  2LUX A;  5FI6 A;  2I18 A;  2BEC A;  5G08 A;  1K9P A;  2MLE C;  2F2P A;  1L2O B;  1JF0 A;  2KI6 C;  1Y0V H;  5AEQ A;  1FI6 A;  1QX2 A;  1K94 A;  1TWO A;  3R1P A;  3S0E A;  1L2O C;  2WND A;  3BUN B;  4OV2 A;  2OTG B;  5DKQ A;  1AUI B;  2P70 A;  2LUC A;  1CB1 A;  1SR6 B;  3NGV A;  2JU0 A;  1NX0 A;  1TN4 A;  2L2E A;  2KFH A;  1YUR A;  2OTG C;  4PE7 A;  1MQ1 A;  2BNX A;  4M2O A;  1GGZ A;  2FCD A;  2WCJ A;  4YGB B;  1TCF A;  2KBI A;  3I5F C;  1OMD A;  5KTY A;  1RTP 1;  2GV5 A;  2ZKM X;  3PN7 B;  1AK8 A;  3OB2 B;  2F8P A;  2M8U A;  3NHT A;  5HLV A;  3BUO B;  3MSE B;  1KQV A;  1J7P A;  2MA2 A;  2D8N A;  1XA5 A;  3AAJ A;  3I5I B;  2PMY A;  3S0D A;  1T14 A;  1WY9 A;  1SNL A;  3E3R A;  3GK2 A;  1J55 A;  1R6P A;  5D7F A;  3I5I C;  3FIA A;  4NDB A;  2NCP A;  2PYQ A;  3CLN A;  3D0Y A;  3DY9 A;  3CR2 A;  4JQ0 D;  1FBV A;  2HPS A;  3DD4 A;  2M29 A;  3JVT B;  4YI8 A;  5HKY A;  3EKH A;  2FJU B;  1CMF A;  1J1E A;  1BU3 A;  2AAO A;  2LMV A;  3BFH A;  1ODB A;  1A75 B;  2EHB A;  3JVT C;  3QRX A;  2FJY A;  4JKT A;  1ALW A;  2CXJ A;  2JXL A;  5HLO A;  2WOR A;  3FE8 A;  1K93 D;  2KOT A;  3WXA A;  2Y4Q A;  1IQ5 A;  2KAX A;  1CM1 A;  2LCP A;  3CZ0 A;  1MXE A;  2QPT A;  3DF0 B;  1SL9 A;  4PHJ A;  1SK6 D;  2KI4 C;  4OKH A;  3V2L A;  1C3Y A;  3K21 A;  2K2F A;  2M7L A;  1LVC D;  2IS9 A;  3L4L A;  1C07 A;  1BT6 A;  1DMO A;  1BOD A;  1K2H A;  1OMV A;  3IQO A;  1MUX A;  4HSZ A;  1NPQ A;  3OX6 A;  1NWD A;  3WHU B;  2M0R A;  1PVA A;  2KAY A;  3K1E A;  4XJK B;  1XFY O;  4A4C A;  1NCZ A;  1A4P A;  1OE9 B;  1SCM B;  2CBL A;  2G9B A;  2KGB C;  2LMT A;  1S6I A;  4ORB B;  2A4J A;  3D74 A;  3PAT A;  3TDI A;  3WHT B;  2WOS A;  3AKA A;  3BOW A;  3UNW A;  1N0Y A;  5I2O A;  4JWQ A;  1WRL A;  4HRG A;  2KLD A;  2F33 A;  4NDD A;  1JWD A;  1XO5 A;  3SIB A;  3TUY C;  1SYM A;  3LL8 B;  1QAS A;  1OOH A;  2WCF A;  4GGF A;  4MZL A;  3BQ3 A;  1OOI X;  3S0F A;  2KHN A;  3BFA A;  2KI6 D;  3Q8I A;  4YGA A;  4C0L A;  4JD9 A;  1JC2 A;  1V1F A;  4FTG A;  4YI9 A;  1LKJ A;  1ZFS A;  2P6B B;  3EK8 A;  2JPT A;  4MZJ A;  4I5N B;  1PK0 D;  1AJ5 A;  4XYN A;  3O6B A;  4JPZ B;  1KFU S;  3R1O A;  1B8C A;  2LV7 A;  3CGA A;  2F2O A;  2WCB A;  1S3P A;  3CZ2 A;  2KSP A;  1DJZ A;  2BCA A;  2KFG A;  3IVT A;  1CNP A;  2JT0 A;  2QEH A;  2JUL A;  3TDU A;  3KHE A;  1TUZ A;  4DIR A;  1DEK A;  1DJX A;  1OOG A;  2SAS A;  4GNK B;  1J7O A;  4WQ2 A;  2JTZ A;  1NIW A;  2K2A A;  1VRK A;  2Y1M A;  2OS8 B;  3C1V A;  4AQJ A;  1DEL A;  3SG6 A;  1WLZ A;  1CDN A;  3FWB A;  1YX8 A;  1F70 A;  2HF5 A;  3CS1 A;  1YVL A;  3NSI A;  2OS8 C;  3UO9 A;  1MXL C;  1KFX S;  1CFC A;  1OQP A;  1CFF A;  4GGN A;  4Q04 A;  1QJT A;  2ZN8 A;  4U8D A;  1REC A;  1L7Z A;  2L98 A;  3D76 A;  3DVM A;  5AER A;  2DOQ A;  1J1D A;  3CYZ A;  4PT1 A;  3KPX A;  4OVN F;  1IG5 A;  3OGN A;  2P71 A;  4MRX A;  3D0Y B;  1B8L A;  3VRP A;  4CID A;  2JZI A;  2R2I A;  1R2U A;  2JNX A;  4YGC B;  3S0G A;  1KQM C;  1YUU A;  2GTE A;  2O60 A;  1B1G A;  2LAP A;  1IWQ A;  1OOF A;  4NDC A;  5CSI A;  4PE1 A;  3EK7 A;  4HRH A;  1QV1 A;  5HYD A;  5DKR A;  5I2L A;  1IGV A;  1OZO A;  1A2X A;  2TN4 A;  3EK4 A;  1DQE A;  2KGR A;  1RK9 A;  3OBV A;  2BCX A;  1DT7 B;  2PRU A;  1QIV A;  4ZCU A;  1XFW O;  1TNW A;  1TRF A;  2MLF C;  1DJI A;  1F54 A;  2ERB A;  5B8I B;  3I5F B;  5JJG A;  1RJV A;  3NSK A;  1B4C A;  1GM0 A;  2LP2 A;  1B7T Z;  4ORA B;  1JFK A;  3KO0 A;  1OZS A;  3NSO A;  1UHK A;  1AP4 A;  2KBM A;  1CDM A;  5HKZ A;  2KYC A;  3VRR A;  2KQ6 A;  2LP3 A;  1S6C A;  1K95 A;  1MF8 B;  1IIO A;  1K9K A;  1AHR A;  1KWO C;  4R1E A;  2KQY A;  3OP0 A;  1F8H A;  2MJW B;  3BOW B;  1KFU L;  1A29 A;  4A4B A;  1E8A A;  4NQG A;  1Y1U A;  1ORG A;  3IF7 A;  2I2R E;  4GFT A;  1LS8 A;  1BF5 A;  1G8I A;  1FI5 A;  2LM5 A;  1UWO A;  3PSR A;  1SKT A;  2LLS A;  4GGF C;  2F3Y A;  3VB1 A;  1Y1X A;  3BJH A;  4OCI A;  3BUX B;  3VRO A;  1UP5 A;  2QEB A;  4PAL A;  2I7A A;  2K7D A;  2WCK A;  3TS5 B;  1A03 A;  2MRD A;  1WRK A;  1B47 A;  1Y1A A;  3FS7 A;  4L9M A;  3VGO A;  1C7W A;  2FOT A;  1OW4 A;  3IQQ A;  1F55 A;  3OX5 A;  3SS4 A;  3TS5 C;  2KI4 B;  2G2B A;  5AFP A;  1K8U A;  3NHI A;  1ZMZ A;  3DVJ A;  4YRU A;  1UHJ A;  2MHH A;  1W7I B;  1EG4 A;  1JUO A;  1NCY A;  3HCM A;  2K8M B;  3AAK A;  3KF9 A;  3PLF B;  1N2D A;  1SCV A;  2FCE A;  3D77 A;  1HQV A;  4HRE E;  1QLS A;  5J3X A;  1QV0 A;  4MVF A;  1H8B A;  3LK0 A;  3ZNI A;  4IJ7 A;  5FYX A;  3WNX B;  1CFD A;  2LHL A;  3TDZ A;  2LVK A;  4BY4 A;  4CPV A;  1RFJ A;  2WCM A;  2JQ6 A;  3RZS A;  2SCP A;  1XVJ A;  2WCH A;  3SG2 A;  1DTL A;  2M7N A;  5TNC A;  3TUY B;  3KEV A;  4P5O E;  5D3O A;  1BR4 B;  1UHH A;  5DKN A;  1H4B A;  2LNK A;  1KCY A;  3B6X A;  2L5X B;  1SBJ A;  1U5I B;  5EL2 A;  1J7R A;  1TIZ A;  3BUW B;  1FF1 A;  2KFF A;  1CKK A;  1EH2 A;  1FPW A;  2PQL A;  1EXR A;  1QX7 A;  5HKW A;  1MR8 A;  2BE4 A;  2M9G A;  1JBA A;  2CTN A;  2F3Z A;  1M46 A;  1F4O A;  2MAZ A;  1WLM A;  5CSN A;  5IBW A;  4E68 A;  1DJW A;  1CMG A;  3OHM B;  4F0Z B;  3D75 A;  4INW A;  2LVI A;  5I2Q A;  3FWC A;  3RLZ A;  2L4I A;  1QVI Z;  5CPV A;  1KK7 Z;  2H2K A;  1DJY A;  1UHN A;  1TUJ A;  1TTX A;  1S26 D;  3A8R A;  2L50 A;  2Y5I A;  3GOF A;  3PM2 A;  4PE4 A;  4I5J A;  1S5G Z;  2PAL A;  3R1V A;  4KYN A;  1XYD A;  4I5K A;  1PAL A;  1V1G A;  2JC2 A;  3I5G B;  3QME A;  4DS7 A;  5BPJ A;  3A4U B;  1XFR A;  1DJG A;  3R72 A;  3SS5 A;  3CAB A;  5ER5 A;  2ZN9 A;  1S36 A;  2I94 A;  4N5X A;  4PHK A;  3LK1 A;  1YUS A;  3I5G C;  1IQ3 A;  1YTZ C;  4FQT A;  1A75 A;  3L47 A;  2MBX A;  2JT3 A;  1NUB A;  2K7C A;  2KNE A;  1F4Q A;  1KK7 Y;  1BLQ A;  1C7V A;  2AUC A;  3VRN A;  4DCK A;  3SG4 A;  4C0K A;  1KQM B;  2M49 B;  4QJ5 B;  4ORC B;  3DF0 A;  3SIA A;  4DRW A;  3O78 A;  2PVB A;  2H61 A;  2E30 A;  2VRG A;  1ZAC A;  2NXQ A;  1CTR A;  1SW8 A;  2K7B A;  3SG7 A;  1ZOT B;  2YGU A;  4ETO A;  1TCO B;  3AKB A;  3B7A A;  3GK1 A;  1S6J A;  1WDC B;  2Q4U A;  1PUL A;  1PSR A;  2RGI A;  3M0W A;  4M2P A;  1YUT A;  1C3Z A;  1NX2 A;  2EGD A;  2M97 A;  2M1U A;  2V53 A;  2K60 A;  2WC8 A;  1WDC C;  2KLE A;  2LE9 B;  3DVK A;  3DXL A;  3DYE A;  1NX3 A;  4GUK A;  5AAN A;  1CLL A;  4MZK A;  4ZCV A;  1TNP A;  1BG1 A;  4USL A;  5D69 A;  3EVU A;  1OSA A;  4WRI A;  1EL4 A;  1J7Q A;  2Q91 A;  3BFB A;  1YVH A;  3EG5 B;  1DVI A;  1XFZ O;  1SPY A;  1BMO A;  1TOP A;  1CLM A;  1KWO B;  3JTD B;  4AOM A;  4MRY A;  1BR1 B;  1XFX O;  2K61 A;  4IL1 A;  1B8R A;  1BJF A;  2NCO A;  2LLU A;  3JTD C;  4I5L B;  2JRF A;  2ZRS A;  1XK4 A;  1SL8 A;  1G33 A;  2LVV A;  4MBE A;  1M63 B;  2CNP A;  1FW4 A;  1B7T Y;  3FE9 A;  1S1E A;  1EJ3 A;  1NYA A;  1LIN A;  3HX4 A;  1D1O A;  1W7J B;  1M39 A;  1QWV A;  4M2Q A;  4GPL B;  1SR6 C;  1LA3 A;  4UPG A;  1CDP A;  4AQI A;  2LAN A;  2E6W A;  1DGV A;  2L2C A;  1KSO A;  1IKU A;  4D1E A;  5GQQ C;  2QEV A;  1DF0 A;  2M1K B;  1SMG A;  3CDN A;  3N7H A;  1IJ6 A;  2BKI B;  3S0B A;  1HT9 A;  5I94 A;  3PN7 C;  1KFX L;  4QJ4 B;  2K7O A;  1CLB A;  1Z2C B;  4OZD A;  1MHO A;  1EG3 A;  1M31 A;  1NCX A;  2M3W A;  1WRZ A;  3H4S E;  3O4X A;  1OMR A;  2LC5 A;  4CFQ A;  2GGZ A;  1P28 A;  4QJ3 B;  2NLN A;  4N1G A;  2KYF A;  3BUM B;  3PM8 A;  2JNF A;  4TNC A;  3LLE A;  3OB1 B;  1K9U A;  2JPO A;  2L0P A;  2QAC A;  2LMU A;  2BAP A;  4PHM A;  2AMI A;  3L4A A;  2QDI A;  1X02 A;  2JXC A;  3CZ1 A;  1QTX A;  1RWY A;  1GGW A;  5F6T A;  3SJS A;  2BE6 A;  3EKJ A;  3CZT X;  4MN0 A;  1PRW A;  2HET A;  2BL0 B;  4MSP A;  2LLT A;  2KPH A;  2WC6 A;  1JF2 A;  4PE0 A;  5CSF A;  1G4Y R;  2K0J A;  1QS7 A; 
#chains in the Genus database with same CATH homology
 2BL0 C;  5AXI A;  2JT8 A;  3I5H B;  1QX5 B;  1UUR A;  2COL B;  2WCE A;  1ALV A;  2KDH A;  3EVR A;  2PSR A;  3PFV A;  3VRQ A;  5K89 A;  1N65 A;  1QIW A;  3I5H C;  1TNQ A;  2EC6 B;  3CTN A;  1SY9 A;  2H61 C;  2L4H A;  4P2Y B;  1UHI A;  1M45 A;  1XFU O;  1SRA A;  1GJY A;  2BBN A;  2EC6 C;  4BY5 A;  2BBM A;  1KK8 B;  2PAS A;  1NSH A;  2ZRT A;  1YRU B;  1PSB A;  1SCM C;  1UUS A;  1YR5 A;  3GK4 X;  1KK8 C;  1IJ5 A;  1K96 A;  1IRJ A;  1K90 D;  3BYA A;  4ICB A;  5ER4 X;  4MEW A;  2ZNE A;  1JSA A;  5I8N A;  2OPO A;  4OR9 B;  4YGE B;  3BXK A;  2LHI A;  4DUQ A;  3ICB A;  3TZ1 A;  1QXP A;  1NX1 A;  1AVS A;  2BCB A;  2ISD A;  3EVV A;  3SG3 A;  2GGM A;  4N1F A;  1BOC A;  4WQ3 A;  1QLK A;  1QVI Y;  2ZND A;  1Q80 A;  1PVB A;  3CR4 X;  4PCW A;  1XK4 C;  3NSL A;  3O4Y A;  2L51 A;  1B9A A;  1DJH A;  1LA0 A;  1S5G Y;  4GBA A;  2HQW A;  2NZ0 A;  2CT9 A;  5CSJ A;  4FQO A;  1YRT B;  3O2P A;  4PDZ A;  1IH0 A;  2JTT A;  1NP8 A;  2Y1N A;  1DF0 B;  4PHN A;  2HQ8 A;  4GAO A;  3SG5 A;  3ZWH A;  3LCP C;  1AJ4 A;  1CM4 A;  4MLW A;  5KSZ A;  4CFR A;  2CCM A;  4XJK A;  3PAL A;  5JOL A;  1Y6W A;  4YBH B;  2LVJ A;  2JWW A;  2KAV A;  1TNX A;  2B1U A;  3CWG A;  4YGD B;  1YX7 A;  1CFP A;  3F45 A;  1CDL A;  1ZUZ A;  1XFV O;  1MWN A;  1LXF C;  1DGU A;  5PAL A;  2O5G A;  4C0J A;  5KU1 A;  1SL7 A;  3DVE A;  1F71 A;  1KSM A;  1GQM A;  1QAT A;  2BKH B;  2ZFD A;  1RRO A;  3D10 A;  1OOJ A;  2JOJ A;  3RM1 A;  4CLN A;  1U5I A;  3CR5 X;  1JFJ A;  3NXA A;  2LUX A;  2I18 A;  2BEC A;  5G08 A;  1K9P A;  2MLE C;  2F2P A;  1L2O B;  1JF0 A;  2KI6 C;  1Y0V H;  5AEQ A;  1FI6 A;  1QX2 A;  1K94 A;  1L2O C;  2WND A;  3BUN B;  4OV2 A;  2OTG B;  5DKQ A;  1AUI B;  2LUC A;  1CB1 A;  1SR6 B;  2JU0 A;  1NX0 A;  1TN4 A;  2L2E A;  2KFH A;  1YUR A;  2OTG C;  4PE7 A;  1MQ1 A;  4M2O A;  1GGZ A;  2FCD A;  4YGB B;  1TCF A;  2KBI A;  3I5F C;  1OMD A;  5KTY A;  1RTP 1;  2GV5 A;  2ZKM X;  3PN7 B;  1AK8 A;  3OB2 B;  2F8P A;  2M8U A;  5HLV A;  3BUO B;  3MSE B;  1J7P A;  2MA2 A;  2D8N A;  1XA5 A;  3AAJ A;  3I5I B;  2PMY A;  1WY9 A;  1SNL A;  3E3R A;  3GK2 A;  1J55 A;  1R6P A;  5D7F A;  3I5I C;  3FIA A;  4NDB A;  2NCP A;  3CLN A;  3D0Y A;  3CR2 A;  4JQ0 D;  1FBV A;  2HPS A;  3DD4 A;  2M29 A;  3JVT B;  4YI8 A;  5HKY A;  3EKH A;  2FJU B;  1CMF A;  1J1E A;  1BU3 A;  2AAO A;  2LMV A;  1ODB A;  1A75 B;  2EHB A;  3JVT C;  3QRX A;  1ALW A;  2CXJ A;  2JXL A;  5HLO A;  2WOR A;  1K93 D;  2KOT A;  3WXA A;  2Y4Q A;  1IQ5 A;  2KAX A;  1CM1 A;  2LCP A;  3DF0 B;  1MXE A;  2QPT A;  1SL9 A;  4PHJ A;  1SK6 D;  2KI4 C;  4OKH A;  3K21 A;  2K2F A;  2M7L A;  1LVC D;  2IS9 A;  1C07 A;  1BT6 A;  1BOD A;  1K2H A;  1OMV A;  3IQO A;  1MUX A;  4HSZ A;  1NPQ A;  3OX6 A;  1NWD A;  3WHU B;  2M0R A;  1PVA A;  2KAY A;  4XJK B;  1DMO A;  1XFY O;  4A4C A;  1NCZ A;  1A4P A;  1OE9 B;  1SCM B;  2CBL A;  2G9B A;  2KGB C;  2LMT A;  1S6I A;  4ORB B;  2A4J A;  3PAT A;  3TDI A;  3WHT B;  2WOS A;  3AKA A;  3BOW A;  1N0Y A;  5I2O A;  4JWQ A;  1WRL A;  4HRG A;  2F33 A;  4NDD A;  1JWD A;  1XO5 A;  3SIB A;  3TUY C;  1SYM A;  3LL8 B;  1QAS A;  2WCF A;  4GGF A;  4MZL A;  3BQ3 A;  2KHN A;  2KI6 D;  4YGA A;  4C0L A;  1JC2 A;  1V1F A;  4FTG A;  4YI9 A;  1LKJ A;  1ZFS A;  2P6B B;  3EK8 A;  2JPT A;  4MZJ A;  4I5N B;  1PK0 D;  1AJ5 A;  4XYN A;  3O6B A;  4JPZ B;  1KFU S;  1B8C A;  2LV7 A;  3CGA A;  2F2O A;  2WCB A;  1S3P A;  3GK1 A;  2KSP A;  1DJZ A;  2BCA A;  2KFG A;  1CNP A;  2JT0 A;  2JUL A;  3TDU A;  3KHE A;  4DIR A;  1DJX A;  2SAS A;  4GNK B;  1J7O A;  4WQ2 A;  2JTZ A;  1NIW A;  2K2A A;  1VRK A;  2Y1M A;  2OS8 B;  3C1V A;  4AQJ A;  3SG6 A;  1WLZ A;  1CDN A;  3FWB A;  1YX8 A;  1F70 A;  2HF5 A;  3CS1 A;  1YVL A;  3NSI A;  2OS8 C;  1MXL C;  1KFX S;  1CFC A;  1OQP A;  1CFF A;  4GGN A;  4Q04 A;  1QJT A;  2ZN8 A;  4U8D A;  1REC A;  1L7Z A;  2L98 A;  3DVM A;  5AER A;  2DOQ A;  1J1D A;  3KPX A;  4OVN F;  1IG5 A;  4MRX A;  3D0Y B;  1B8L A;  3VRP A;  4CID A;  2JZI A;  2R2I A;  1R2U A;  2JNX A;  4YGC B;  1B1G A;  1KQM C;  1YUU A;  2O60 A;  2LAP A;  1IWQ A;  4NDC A;  5CSI A;  4PE1 A;  3EK7 A;  4HRH A;  1QV1 A;  5HYD A;  5DKR A;  5I2L A;  1IGV A;  1OZO A;  1A2X A;  2TN4 A;  3EK4 A;  2KGR A;  1RK9 A;  2BCX A;  1DT7 B;  2PRU A;  1QIV A;  4ZCU A;  1XFW O;  1TNW A;  1TRF A;  2MLF C;  1DJI A;  1F54 A;  5B8I B;  3I5F B;  5JJG A;  1RJV A;  3NSK A;  1B4C A;  2LP2 A;  1B7T Z;  4ORA B;  1JFK A;  3KO0 A;  1OZS A;  3NSO A;  1UHK A;  1AP4 A;  2KBM A;  1CDM A;  5HKZ A;  2KYC A;  3VRR A;  2KQ6 A;  2LP3 A;  1S6C A;  1K95 A;  1MF8 B;  1K9K A;  1AHR A;  1KWO C;  4R1E A;  2KQY A;  3OP0 A;  1F8H A;  2MJW B;  3BOW B;  1KFU L;  1A29 A;  4A4B A;  1E8A A;  4NQG A;  1Y1U A;  3IF7 A;  2I2R E;  4GFT A;  1BF5 A;  1G8I A;  1FI5 A;  2LM5 A;  1UWO A;  3PSR A;  1SKT A;  2LLS A;  4GGF C;  2F3Y A;  1Y1X A;  4OCI A;  3BUX B;  3VRO A;  1UP5 A;  2I7A A;  2K7D A;  3TS5 B;  1A03 A;  2MRD A;  1WRK A;  1B47 A;  1Y1A A;  3FS7 A;  4L9M A;  3VGO A;  1C7W A;  2FOT A;  3IQQ A;  1F55 A;  3OX5 A;  3TS5 C;  2KI4 B;  2G2B A;  5AFP A;  1K8U A;  1ZMZ A;  3DVJ A;  4YRU A;  1UHJ A;  2MHH A;  1W7I B;  1EG4 A;  1JUO A;  1NCY A;  3HCM A;  2K8M B;  3AAK A;  3KF9 A;  3PLF B;  1N2D A;  1SCV A;  2FCE A;  4HRE E;  1HQV A;  5J3X A;  1QLS A;  1QV0 A;  4MVF A;  1H8B A;  3LK0 A;  3ZNI A;  5FYX A;  3WNX B;  1CFD A;  2LHL A;  3TDZ A;  2LVK A;  4BY4 A;  4CPV A;  1RFJ A;  2JQ6 A;  2SCP A;  1XVJ A;  3SG2 A;  1DTL A;  2M7N A;  5TNC A;  3TUY B;  3KEV A;  4P5O E;  1BR4 B;  1UHH A;  5DKN A;  1H4B A;  2LNK A;  1KCY A;  2L5X B;  1SBJ A;  1U5I B;  1J7R A;  1TIZ A;  3BUW B;  1FF1 A;  2KFF A;  1CKK A;  1EH2 A;  1FPW A;  1EXR A;  1QX7 A;  5HKW A;  1MR8 A;  2BE4 A;  2M9G A;  1JBA A;  2CTN A;  2F3Z A;  1M46 A;  1F4O A;  2MAZ A;  1WLM A;  5CSN A;  5IBW A;  4E68 A;  1DJW A;  1CMG A;  3OHM B;  4F0Z B;  2LVI A;  5I2Q A;  3FWC A;  3RLZ A;  2L4I A;  1QVI Z;  5CPV A;  1KK7 Z;  2H2K A;  1DJY A;  1UHN A;  1TTX A;  1S26 D;  3A8R A;  3GOF A;  2L50 A;  2Y5I A;  4PE4 A;  4I5J A;  1S5G Z;  2PAL A;  1XYD A;  4I5K A;  1PAL A;  1V1G A;  2JC2 A;  3I5G B;  4DS7 A;  5BPJ A;  1KQV A;  3A4U B;  1DJG A;  5ER5 A;  2ZN9 A;  1S36 A;  2I94 A;  4N5X A;  4PHK A;  3LK1 A;  1YUS A;  3I5G C;  1IQ3 A;  1YTZ C;  1A75 A;  2MBX A;  2JT3 A;  1NUB A;  2K7C A;  2KNE A;  1F4Q A;  1KK7 Y;  1BLQ A;  1C7V A;  2AUC A;  3VRN A;  4DCK A;  3SG4 A;  4C0K A;  1KQM B;  2M49 B;  4QJ5 B;  4ORC B;  3DF0 A;  3SIA A;  4DRW A;  3O78 A;  2PVB A;  2H61 A;  2E30 A;  2VRG A;  1ZAC A;  2NXQ A;  1CTR A;  1SW8 A;  2K7B A;  3SG7 A;  1ZOT B;  4ETO A;  1TCO B;  3AKB A;  1S6J A;  1WDC B;  2Q4U A;  1PUL A;  1PSR A;  2RGI A;  3M0W A;  4M2P A;  1YUT A;  2EGD A;  1NX2 A;  2M97 A;  2WC8 A;  2M1U A;  2V53 A;  3DVK A;  4PAL A;  1WDC C;  2LE9 B;  4GUK A;  1NX3 A;  5AAN A;  1CLL A;  4MZK A;  4ZCV A;  1TNP A;  1BG1 A;  4USL A;  5D69 A;  3EVU A;  1OSA A;  4WRI A;  1EL4 A;  1J7Q A;  2Q91 A;  1YVH A;  1DVI A;  1XFZ O;  1SPY A;  1BMO A;  1TOP A;  1CLM A;  1KWO B;  3JTD B;  4AOM A;  4MRY A;  1BR1 B;  1XFX O;  2K61 A;  4IL1 A;  1B8R A;  1BJF A;  2NCO A;  2LLU A;  3JTD C;  4I5L B;  2JRF A;  2ZRS A;  1XK4 A;  1SL8 A;  1G33 A;  2LVV A;  4MBE A;  1M63 B;  2CNP A;  1FW4 A;  1B7T Y;  1S1E A;  1EJ3 A;  1NYA A;  1LIN A;  3HX4 A;  1D1O A;  1W7J B;  1M39 A;  4M2Q A;  4GPL B;  1SR6 C;  1LA3 A;  4UPG A;  1CDP A;  4AQI A;  2LAN A;  2E6W A;  1DGV A;  1KSO A;  1IKU A;  4D1E A;  5GQQ C;  1DF0 A;  2M1K B;  1SMG A;  1IJ6 A;  2BKI B;  1HT9 A;  3PN7 C;  1KFX L;  4QJ4 B;  2K7O A;  1CLB A;  1MHO A;  1EG3 A;  1M31 A;  1NCX A;  2M3W A;  1WRZ A;  3H4S E;  1OMR A;  2LC5 A;  4CFQ A;  2GGZ A;  4QJ3 B;  2NLN A;  4N1G A;  2KYF A;  3BUM B;  3PM8 A;  2JNF A;  4TNC A;  3LLE A;  3OB1 B;  1K9U A;  2L0P A;  2QAC A;  2LMU A;  4PHM A;  2AMI A;  1X02 A;  2JXC A;  1QTX A;  1RWY A;  1GGW A;  5F6T A;  3SJS A;  2BE6 A;  3EKJ A;  3CZT X;  4MN0 A;  1PRW A;  2HET A;  2BL0 B;  4MSP A;  2LLT A;  1JF2 A;  4PE0 A;  5CSF A;  1G4Y R;  2K0J A;  1QS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...