2KQ6A

The structure of the ef-hand domain of polycystin-2 suggests a mechanism for ca2+-dependent regulation of polycystin-2 channel activity
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
b'NTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycystin-2
publication title Structure of the EF-hand domain of polycystin-2 suggests a mechanism for Ca2+-dependent regulation of polycystin-2 channel activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kq6A01
1KQVA 3ZNIA 2OPOA 3TDIA 4M2QA 2I7AA 2A4JA 1K93D 3BUXB 3DVEA 1G4YR 1JC2A 3CS1A 2L2EA 4CFQA 1ALVA 1B47A 2DOQA 2MHHA 3ZWHA 1J7RA 1XO5A 1NX3A 2MBXA 1YUUA 2ZKMX 1SL7A 3PM8A 1IQ3A 2LMTA 1L2OC 1J7OA 1GGWA 2G9BA 3WXAA 3VGOA 3PN7C 1QS7A 2LLSA 2L4HA 3VRRA 1OQPA 3TUYC 1JUOA 1TCFA 2F2PA 4OCIA 1PSBA 1CDLA 2ZFDA 1F4QA 1M63B 4YRUA 1FPWA 4I5NB 1SL8A 2I94A 2KI4B 4R1EA 1F55A 3NSOA 2OTGC 3C1VA 1BT6A 2CXJA 3QRXA 1UHJA 3I5FB 4P5OE 1BJFA 3VRQA 3PFVA 4YGCB 2BCAA 3NSLA 5D7FA 3I5IC 1WDCB 4YGEB 2F33A 3TS5C 2L5XB 3BUWB 1CMGA 3BYAA 4Q04A 3K21A 2LCPA 3EVRA 4YI8A 4MVFA 3SG5A 1KFUL 4YI9A 1RFJA 1OMVA 3FS7A 1R6PA 3GK4X 4E68A 1S6CA 4HRGA 2ZRSA 3HX4A 1U5IB 3BUMB 1QXPA 1K9PA 4YBHB 3LK0A 4MRXA 1Y1XA 1RWYA 1CMFA 5PALA 1SMGA 5CSJA 3BUOB 1XFXO 2P6BB 1QLSA 2LP2A 4GGFC 2KQYA 5KU1A 2WCEA 4DUQA 4OV2A 3CLNA 5IBWA 1RJVA 1B4CA 1NPQA 3IF7A 1CDPA 3LLEA 2K61A 2LM5A 2KDHA 2SCPA 1S36A 3SG7A 1L7ZA 1WLMA 1SCMB 1J1DA 2JU0A 3OHMB 4NDBA 2V53A 3CTNA 4MZLA 1B8CA 3D10A 2G2BA 2JPTA 1UWOA 2KAVA 2KQ6A 4UPGA 3EK4A 3I5IB 1LVCD 2B1UA 3KF9A 1TRFA 3TS5B 1IJ5A 1K9UA 1XVJA 5F6TA 2AAOA 4MN0A 5HKZA 2TN4A 1ZACA 1YR5A 1NYAA 1UHHA 1VRKA 3D0YB 4MLWA 1SBJA 2FOTA 1D1OA 2KFGA 1F70A 1CLMA 2MRDA 3DD4A 1XFUO 4JWQA 1KQMC 1WLZA 4C0LA 1DMOA 4ORAB 2JXLA 4I5JA 1FBVA 1IRJA 1C07A 1AHRA 2JQ6A 2AUCA 1W7JB 1B7TY 1EXRA 1ZOTB 2LAPA 1FI6A 2M49B 2PASA 1NP8A 1HQVA 1S26D 1PVAA 3CR4X 3TDZA 1XK4C 1PRWA 4PE1A 1DGVA 1CFDA 2O5GA 1WY9A 1OZSA 1XA5A 4MBEA 3O2PA 1GGZA 1CLBA 1S5GZ 4DRWA 1CFCA 1XYDA 1OMRA 1S3PA 2ZN9A 4NDDA 1IWQA 1RROA 4WQ3A 3RLZA 1KK7Y 3FIAA 3JTDC 2KI6D 2Y1NA 4C0KA 4ETOA 4GBAA 1TTXA 1DJXA 1SR6B 2BE6A 2KAYA 3LK1A 2ISDA 2LE9B 4MZKA 1SL9A 1LXFC 2HPSA 3SJSA 1IKUA 1YRUB 1S6JA 1MQ1A 3A8RA 4AQIA 2LVJA 5HYDA 4PE0A 2JXCA 2WORA 1IQ5A 2I2RE 1BU3A 4P2YB 1NX0A 3FWBA 4M2OA 1QX5B 1U5IA 4A4CA 4CLNA 2ZN8A 4MRYA 1KFXS 2KGBC 4PHNA 4HSZA 2EGDA 2M3WA 2KHNA 2FCEA 2MAZA 3SIAA 2K7OA 3PLFB 1Q80A 4PE4A 1OE9B 2BCXA 2E6WA 4USLA 1DJHA 1KK8B 1QV1A 2AMIA 2LMUA 1UHKA 3JVTC 1BMOA 2LP3A 2JWWA 3PALA 1SNLA 1KSOA 2JNXA 4N1FA 1B1GA 4PALA 3WHTB 4C0JA 1AUIB 5CPVA 4JPZB 1J55A 1PSRA 5AEQA 5G08A 2BBNA 5AERA 3O4YA 1MF8B 1PK0D 4PE7A 1NCZA 5DKQA 1NIWA 3JTDB 2CCMA 5CSFA 1EG4A 3NXAA 4PHJA 1K94A 1NWDA 2LLUA 3D0YA 2FJUB 2KYCA 1XFVO 2F3ZA 2BL0C 1OOJA 2EC6B 4QJ3B 3CZTX 1AK8A 1IGVA 2LHIA 2K7CA 1JWDA 1IG5A 1RECA 1QLKA 2HETA 5B8IB 1JFKA 1CLLA 3E3RA 1DJIA 4GAOA 2MJWB 1XFYO 2MLEC 1F8HA 1WRLA 2E30A 3DF0B 4WQ2A 1V1FA 5BPJA 2FCDA 4TNCA 1BOCA 1NCYA 4QJ5B 2M9GA 1LKJA 2O60A 1F54A 3ICBA 2NXQA 1SPYA 2WCFA 1Y0VH 4GGFA 4HREE 2K8MB 2K2AA 1L2OB 3GK1A 5TNCA 3PN7B 5I2OA 2NCPA 1AJ4A 3TUYB 4DS7A 5FYXA 1JBAA 1B8RA 1UHNA 3EKJA 5KSZA 3A4UB 1J7QA 5HLOA 1WRZA 2K0JA 1M39A 1BR4B 4ORBB 5AANA 2LC5A 1IH0A 1DJZA 3AAJA 2WOSA 5ER4X 1IJ6A 1CM1A 2OTGB 2GV5A 3H4SE 1EG3A 4N1GA 1C7VA 3IQQA 1KSMA 1BR1B 4BY4A 1ALWA 4F0ZB 2JULA 4GGNA 1RK9A 4ZCUA 1TN4A 1DVIA 1A03A 2BL0B 5ER5A 1DJWA 1K8UA 4U8DA 4ICBA 1WRKA 1NCXA 1LINA 2F3YA 2Q4UA 3LL8B 2NLNA 3PSRA 3BQ3A 2PVBA 2WNDA 4GFTA 1CFFA 2OS8C 3OB2B 4DIRA 5I8NA 1QV0A 4DCKA 1SY9A 2Y5IA 3EK8A 1AVSA 1TOPA 1M46A 1CM4A 1PULA 2MA2A 1XK4A 2CT9A 4QJ4B 1CFPA 2L98A 4D1EA 1Y1AA 2JZIA 4OVNF 2KI6C 4PDZA 1ZUZA 2BE4A 4IL1A 4N5XA 1EL4A 3CGAA 3F45A 1JSAA 1GJYA 1YVLA 5I2QA 3PATA 2LANA 1K2HA 2Q91A 4BY5A 1QIVA 5DKRA 3KO0A 1SCVA 2JTZA 2KAXA 3BUNB 1YURA 1Y6WA 2PALA 1DF0B 2D8NA 2L4IA 1YX8A 2H61C 2HQWA 2JC2A 3MSEB 3CR2A 1C7WA 3EKHA 2KBIA 1QTXA 1DT7B 1CDMA 2Y4QA 4ZCVA 4MZJA 3DF0A 4GPLB 2ZRTA 1QJTA 4YGDB 2M7NA 4XJKB 2BCBA 1A4PA 1EJ3A 1LA0A 2KNEA 1MHOA 2KSPA 4M2PA 3OX5A 1DJGA 1FW4A 1Y1UA 3DVMA 1QVIY 1KFXL 1TNPA 3SG6A 1KQMB 1NX2A 2M1UA 1YTZC 4YGBB 2LVVA 1UP5A 1JF2A 2EHBA 3EVUA 2Y1MA 4MSPA 3O6BA 4GNKB 2L50A 2ZNDA 4ORCB 1SRAA 3KHEA 2KYFA 1YVHA 4NQGA 4FTGA 1K96A 4CPVA 1N2DA 1NSHA 3BXKA 1A75B 1F4OA 3CWGA 2LVKA 2BBMA 1CTRA 1E8AA 3NSIA 1B7TZ 1SW8A 1TIZA 3FWCA 4PHMA 1KWOC 1B9AA 1H4BA 4AOMA 1NX1A 4OR9B 3CR5X 2H2KA 1V1GA 2QPTA 3WNXB 2BKIB 1PVBA 2VRGA 1JF0A 3GK2A 2CNPA 1NUBA 2ZNEA 3BOWB 2WC8A 1SKTA 1HT9A 2MLFC 1GQMA 3AKAA 1G33A 1ZMZA 1BF5A 2COLB 1JFJA 4FQOA 1SCMC 1KK7Z 2JT3A 2NCOA 2CTNA 3EVVA 3GOFA 3SG3A 1R2UA 2K7DA 2BKHB 3AAKA 2LNKA 2WCBA 4YGAA 2KGRA 3WHUB 3EK7A 2NZ0A 3DVKA 3SG4A 3AKBA 4I5KA 2M8UA 3O78A 1S6IA 1KCYA 2R2IA 1CNPA 1S1EA 3I5HC 1AJ5A 4OKHA 1PALA 1QX2A 1KFUS 1UURA 3JVTB 5HKYA 1DF0A 1A29A 1QVIZ 1TNXA 4CIDA 4L9MA 3VRNA 4I5LB 2HQ8A 1FI5A 2LVIA 1YUSA 1OMDA 1BODA 3DVJA 3SIBA 1S5GY 5AXIA 2JNFA 1X02A 2PRUA 4MEWA 2JRFA 1KWOB 2JT8A 1DJYA 1AP4A 2F8PA 2QACA 1QATA 3OB1B 1K95A 5D69A 4XJKA 4JQ0D 1MXLC 4HRHA 2LHLA 1EH2A 3OX6A 3HCMA 5DKNA 5I2LA 4XYNA 1YUTA 4PHKA 1TCOB 2M1KB 1RTP1 2PSRA 2CBLA 1BLQA 1QASA 2K7BA 1A2XA 1BG1A 1DGUA 5GQQC 3I5GC 3IQOA 1OZOA 2I18A 3TDUA 1LA3A 2M29A 2JT0A 1J7PA 5CSNA 3KPXA 2GGZA 1CB1A 1SR6C 1B8LA 1N0YA 2KBMA 3OP0A 2LUCA 4AQJA 1QIWA 1DTLA 1G8IA 1SYMA 2RGIA 1A75A 1TNQA 1MWNA 1UHIA 3I5HB 4GUKA 3VROA 3NSKA 2LV7A 2SASA 3KEVA 3VRPA 1FF1A 5KTYA 1MR8A 1MXEA 4NDCA 5K89A 4PCWA 1M45A 2H61A 2M0RA 2L0PA 4CFRA 2M7LA 2BECA 5JJGA 1TNWA 4WRIA 5CSIA 2K2FA 2GGMA 2JOJA 2KOTA 1H8BA 3BOWA 1J1EA 1KK8C 3M0WA 5HKWA 1SK6D 1QX7A 2LMVA 1XFZO 1UUSA 1W7IB 2JTTA 2PMYA 1M31A 5HLVA 1CKKA 2KI4C 2LUXA 1N65A 3SG2A 1YRTB 2IS9A 3LCPC 2KFHA 1MUXA 3RM1A 3I5FC 1K90D 2LLTA 2OS8B 5AFPA 5JOLA 2HF5A 3I5GB 1XFWO 5J3XA 2KFFA 1WDCC 1CDNA 1K9KA 2M97A 1YX7A 2F2OA 1ODBA 1OSAA 3TZ1A 2L51A 4A4BA 1ZFSA 1F71A 2EC6C
chains in the Genus database with same CATH superfamily
1KQVA 3D75A 3ZNIA 3V2LA 2OPOA 3TDIA 4M2QA 2I7AA 2A4JA 1K93D 2QEOA 3BUXB 1G4YR 3DVEA 1JC2A 3CS1A 3VB1A 2L2EA 4CFQA 1ALVA 1B47A 2DOQA 1DQEA 2MHHA 3ZWHA 1J7RA 1XO5A 1NX3A 2MBXA 1YUUA 2ZKMX 1SL7A 3PM8A 1IQ3A 2LMTA 1L2OC 1J7OA 3NHIA 1GGWA 2G9BA 3WXAA 3VGOA 3PN7C 1QS7A 2LLSA 2L4HA 3VRRA 1OQPA 3TUYC 1JUOA 1TCFA 2F2PA 4OCIA 1PSBA 1CDLA 2ZFDA 1F4QA 1M63B 4YRUA 1FPWA 4I5NB 3CZ1A 1SL8A 2I94A 2KI4B 4R1EA 1F55A 3NSOA 2OTGC 3C1VA 1BT6A 2CXJA 3QRXA 1UHJA 3I5FB 4P5OE 1BJFA 3VRQA 3PFVA 4YGCB 2BCAA 3NSLA 5D7FA 1OW4A 3I5IC 1WDCB 4YGEB 2F33A 3TS5C 2L5XB 3BUWB 1CMGA 3BYAA 4Q04A 2GTEA 3K21A 2LCPA 3EVRA 4YI8A 4MVFA 3SG5A 1KFUL 4YI9A 3L47A 1RFJA 1OMVA 3FS7A 1R6PA 3GK4X 4E68A 1S6CA 4HRGA 2ZRSA 3PJIA 3HX4A 1U5IB 3BUMB 1QXPA 1K9PA 4YBHB 3LK0A 4MRXA 1Y1XA 3B87A 1RWYA 1CMFA 5PALA 1SMGA 5CSJA 3BUOB 1XFXO 2P6BB 3DY9A 2FJYA 1QLSA 2LP2A 4GGFC 2KQYA 5KU1A 2WCEA 5D3OA 4DUQA 4OV2A 3CLNA 5IBWA 3S0GA 1RJVA 1B4CA 1NPQA 4INWA 3IF7A 1CDPA 3LLEA 2K61A 2LM5A 2KDHA 2SCPA 1S36A 3SG7A 1L7ZA 1WLMA 1SCMB 1J1DA 2JU0A 3OHMB 4NDBA 2V53A 3R1VA 3CTNA 4MZLA 1B8CA 5DICA 3D10A 5EL2A 2G2BA 2JPTA 1UWOA 2KAVA 2KQ6A 4UPGA 3EK4A 3I5IB 1LVCD 3DXLA 2B1UA 3KF9A 1TRFA 3TS5B 1IJ5A 1K9UA 1XVJA 3NHTA 2AAOA 4MN0A 5F6TA 5HKZA 2TN4A 1ORGA 1ZACA 3S0EA 1YR5A 1NYAA 1UHHA 1VRKA 3D0YB 4MLWA 1SBJA 2FOTA 1D1OA 2KFGA 1F70A 1CLMA 2MRDA 3DD4A 1XFUO 4JWQA 1KQMC 1P28A 1WLZA 3B7AA 4C0LA 4ORAB 1DMOA 2JXLA 4I5JA 1FBVA 1IRJA 1C07A 1AHRA 5I94A 2JQ6A 2AUCA 1W7JB 1B7TY 1EXRA 1ZOTB 2LAPA 1FI6A 2M49B 2PASA 1NP8A 1HQVA 1S26D 1PVAA 3CR4X 3TDZA 1XK4C 1TUJA 1PRWA 4PE1A 1DGVA 1C3ZA 1CFDA 2O5GA 3BFHA 4KYNA 1WY9A 3RZSA 1OZSA 1XA5A 4MBEA 3O2PA 1GGZA 1CLBA 1S5GZ 4DRWA 1CFCA 1XYDA 1OMRA 1S3PA 2ZN9A 2PQLA 4FQTA 1IWQA 4NDDA 1RROA 2KLDA 4WQ3A 1KK7Y 1Z2CB 3FIAA 3JTDC 4PT1A 2KI6D 2Y1NA 4C0KA 4ETOA 4GBAA 3S0FA 1TTXA 1DJXA 1SR6B 2BE6A 2KAYA 3LK1A 2ISDA 2LE9B 3D73A 4MZKA 1SL9A 2P71A 3SS4A 1LXFC 2HPSA 3SJSA 2H8VA 1IKUA 1YRUB 1S6JA 1MQ1A 3A8RA 4AQIA 2LVJA 5HYDA 4PE0A 2JXCA 2WORA 1IQ5A 2I2RE 1BU3A 4P2YB 1NX0A 3FWBA 4M2OA 1QX5B 1U5IA 4A4CA 3R1PA 2ZN8A 4CLNA 4MRYA 2ERBA 1SSEB 1KFXS 2KGBC 4PHNA 4HSZA 2EGDA 4IJ7A 3SS3A 2M3WA 2KHNA 2FCEA 2MAZA 3R1OA 3SIAA 2K7OA 3PLFB 1Q80A 3B88A 4PE4A 1OE9B 2BCXA 3BJHA 2E6WA 4USLA 1DJHA 1KK8B 1QV1A 2AMIA 2LMUA 1UHKA 3JVTC 3O4XA 2YGUA 1BMOA 2LP3A 2JWWA 2KPHA 3S0BA 3CZ0A 3PALA 1SNLA 1OOIX 1KSOA 2JNXA 4N1FA 1B1GA 4PALA 3WHTB 4C0JA 1AUIB 5CPVA 4JPZB 1J55A 1PSRA 5AEQA 5G08A 2BBNA 5AERA 3O4YA 1MF8B 1PK0D 4PE7A 2WC6A 1NCZA 5DKQA 1NIWA 3JTDB 2CCMA 5CSFA 1EG4A 3L4AA 3NXAA 1K94A 1NWDA 2LLUA 3D0YA 4PHJA 2FJUB 2KYCA 1XFVO 2F3ZA 2BL0C 1OOJA 2EC6B 4INXA 3CZTX 4QJ3B 1AK8A 1IGVA 2LHIA 2K7CA 1JWDA 1IG5A 1RECA 1QLKA 1T14A 2HETA 1JFKA 5B8IB 1CLLA 3E3RA 1DJIA 4GAOA 2MJWB 1XFYO 2MLEC 3NGVA 1WRLA 1F8HA 2E30A 3DF0B 4WQ2A 1V1FA 5BPJA 2FCDA 4TNCA 1BOCA 1NCYA 4QJ5B 2M9GA 1LKJA 2O60A 1F54A 3ICBA 2NXQA 1SPYA 2WCFA 1Y0VH 4GGFA 4HREE 2K8MB 2K2AA 2WCLA 1L2OB 3GK1A 5TNCA 4F7FA 3PN7B 5I2OA 2NCPA 3RLZA 1AJ4A 3TUYB 4DS7A 5FYXA 1JBAA 1B8RA 1UHNA 3EKJA 5KSZA 3A4UB 1J7QA 3CZ2A 5HLOA 1WRZA 2K0JA 1M39A 1BR4B 4ORBB 5AANA 2LC5A 1IH0A 1DJZA 4JD9A 3AAJA 3UNWA 2WOSA 5ER4X 1IJ6A 1CM1A 2OTGB 2GV5A 2QDIA 3H4SE 1EG3A 4N1GA 2JPOA 1C7VA 3IQQA 1KSMA 1BR1B 4BY4A 1ALWA 4F0ZB 2JULA 3FE9A 4GGNA 1RK9A 4ZCUA 1TN4A 2QEHA 1DVIA 1A03A 2BL0B 3OBVA 3DYEA 5ER5A 3Q8IA 1DJWA 1K8UA 3PM2A 4U8DA 4ICBA 1WRKA 1NCXA 3BFAA 1LINA 2F3YA 2Q4UA 3LL8B 2NLNA 3PSRA 3BQ3A 2PVBA 2WNDA 4GFTA 1CFFA 2OS8C 3B6XA 3OB2B 2P70A 4DIRA 3FE8A 1QV0A 4DCKA 5I8NA 1QWVA 1SY9A 2Y5IA 3EK8A 2PYQA 1AVSA 1TOPA 1M46A 1CM4A 1PULA 2MA2A 1XK4A 2CT9A 4QJ4B 3BFBA 1CFPA 2L98A 4D1EA 1Y1AA 2JZIA 4OVNF 2KI6C 4PDZA 1ZUZA 2BE4A 4IL1A 4N5XA 1EL4A 3CGAA 3F45A 1JSAA 1GJYA 4JKTA 4OZDA 1YVLA 5I2QA 3PATA 2LANA 1K2HA 3CYZA 2WC5A 1TWOA 2Q91A 4BY5A 1QIVA 5DKRA 3KO0A 1SCVA 2JTZA 2KAXA 3BUNB 1YURA 1Y6WA 2PALA 1DF0B 3D74A 1LS8A 2D8NA 2L4IA 1YX8A 2H61C 2HQWA 2JC2A 3MSEB 3CR2A 1C7WA 3EKHA 2KBIA 1QTXA 1DT7B 2K60A 1CDMA 2Y4QA 4ZCVA 4MZJA 3DF0A 4GPLB 2ZRTA 1QJTA 4YGDB 2M7NA 4XJKB 2BCBA 1A4PA 1EJ3A 1LA0A 2KNEA 1MHOA 2KSPA 4M2PA 3OX5A 1DJGA 1FW4A 1Y1UA 3DVMA 1DEKA 1QVIY 1KFXL 1TNPA 2WCKA 3SG6A 1KQMB 1NX2A 3D77A 2M1UA 1YTZC 4YGBB 2LVVA 1UP5A 1JF2A 2EHBA 3EVUA 2Y1MA 4MSPA 3O6BA 4GNKB 2L50A 2ZNDA 4ORCB 1SRAA 3KHEA 2KYFA 1YVHA 4NQGA 4FTGA 1K96A 4CPVA 1N2DA 1NSHA 3BXKA 1A75B 1F4OA 3CWGA 2LVKA 2BBMA 1CTRA 5FI6A 1E8AA 3NSIA 1B7TZ 1SW8A 1TIZA 3FWCA 4PHMA 1KWOC 1B9AA 5FI7A 1H4BA 4AOMA 1NX1A 4OR9B 3CR5X 2H2KA 3N7HA 1V1GA 2QPTA 3WNXB 3UO9A 2BKIB 1PVBA 2VRGA 3SS5A 1JF0A 3GK2A 2CNPA 1NUBA 2ZNEA 3BOWB 2WC8A 3CDNA 1SKTA 1HT9A 2MLFC 1GQMA 2WCMA 1G33A 1ZMZA 3AKAA 1BF5A 2COLB 1JFJA 4FQOA 1SCMC 1KK7Z 2JT3A 2NCOA 2CTNA 3EVVA 3GOFA 3SG3A 1R2UA 2K7DA 2BKHB 3AAKA 1XFRA 2LNKA 2WCBA 4YGAA 2KGRA 3WHUB 3EK7A 2NZ0A 3DVKA 3R72A 3AKBA 3SG4A 4I5KA 2M8UA 3O78A 1S6IA 1KCYA 2R2IA 1CNPA 1S1EA 3I5HC 1AJ5A 4OKHA 1PALA 1QX2A 1KFUS 1UURA 3JVTB 1DELA 5HKYA 1DF0A 1A29A 1QVIZ 1TNXA 4CIDA 4L9MA 3VRNA 4I5LB 2HQ8A 1FI5A 2LVIA 1W9ZA 1YUSA 1OMDA 1BODA 3DVJA 3SIBA 1S5GY 3K1EA 5AXIA 2JNFA 1X02A 2PRUA 4MEWA 2JRFA 1KWOB 2JT8A 1DJYA 1AP4A 2F8PA 1C3YA 2QACA 1QATA 3OB1B 1K95A 5D69A 4XJKA 4JQ0D 1MXLC 4HRHA 3D76A 1Z4HA 2LHLA 1EH2A 3OX6A 3HCMA 2L2CA 5DKNA 5I2LA 4XYNA 1YUTA 2WCHA 4PHKA 2WCJA 1TCOB 2M1KB 3B86A 1RTP1 1DC1A 2PSRA 2QEVA 2CBLA 1BLQA 1QASA 2K7BA 1A2XA 1BG1A 1DGUA 5GQQC 3I5GC 3IQOA 1OZOA 2I18A 3TDUA 1LA3A 2M29A 2JT0A 3L4LA 1J7PA 5CSNA 3KPXA 2GGZA 1CB1A 1SR6C 1B8LA 1N0YA 1TUZA 2KBMA 3OP0A 3QMEA 2LUCA 4AQJA 2BNXA 1QIWA 1DTLA 1G8IA 1SYMA 2RGIA 1A75A 1TNQA 1MWNA 1UHIA 3I5HB 4GUKA 5FI2A 3S0DA 3VROA 3NSKA 2LV7A 2SASA 3KEVA 3VRPA 1FF1A 5KTYA 2BAPA 1MR8A 1MXEA 4NDCA 5K89A 4PCWA 1M45A 2H61A 2M0RA 3DZTA 2L0PA 1OOHA 1OOFA 3D78A 3CABA 4CFRA 2M7LA 2BECA 5JJGA 1TNWA 4WRIA 5HL1A 5CSIA 2K2FA 2GGMA 2JOJA 2KOTA 3FE6A 1H8BA 3BOWA 1J1EA 1KK8C 3M0WA 5HKWA 1SK6D 1QX7A 2LMVA 3OGNA 1XFZO 1UUSA 1W7IB 2JTTA 2PMYA 1M31A 5HLVA 3S0AA 1CKKA 2KI4C 2LUXA 1N65A 3SG2A 1YRTB 1IIOA 2IS9A 3LCPC 2KFHA 1MUXA 3RM1A 3I5FC 1K90D 2L5YA 2LLTA 2OS8B 3EG5B 5AFPA 5JOLA 2HF5A 3I5GB 1XFWO 5J3XA 2KFFA 2KLEA 1WDCC 1CDNA 1K9KA 2M97A 1OOGA 1YX7A 1ODBA 1OSAA 2F2OA 3TZ1A 2L51A 1GM0A 4A4BA 1ZFSA 1F71A 3IVTA 2QEBA 2EC6C
chains in the Genus database with same CATH topology
1KQVA 3ZNIA 2OPOA 3TDIA 4M2QA 2I7AA 2A4JA 1K93D 3BUXB 3DVEA 1G4YR 1JC2A 3CS1A 2L2EA 4CFQA 1ALVA 1B47A 2DOQA 2MHHA 3ZWHA 1J7RA 1XO5A 1NX3A 2MBXA 1YUUA 2ZKMX 1SL7A 3PM8A 1IQ3A 2LMTA 1L2OC 1J7OA 1GGWA 2G9BA 3WXAA 3VGOA 3PN7C 1QS7A 2LLSA 2L4HA 3VRRA 1OQPA 3TUYC 1JUOA 1TCFA 2F2PA 4OCIA 1PSBA 1CDLA 2ZFDA 1F4QA 1M63B 4YRUA 1FPWA 4I5NB 1SL8A 2I94A 2KI4B 4R1EA 1F55A 3NSOA 2OTGC 3C1VA 1BT6A 2CXJA 3QRXA 1UHJA 3I5FB 4P5OE 1BJFA 3VRQA 3PFVA 4YGCB 2BCAA 3NSLA 5D7FA 3I5IC 1WDCB 4YGEB 2F33A 3TS5C 2L5XB 3BUWB 1CMGA 3BYAA 4Q04A 3K21A 2LCPA 3EVRA 4YI8A 4MVFA 3SG5A 1KFUL 4YI9A 1RFJA 1OMVA 3FS7A 1R6PA 3GK4X 4E68A 1S6CA 4HRGA 2ZRSA 3HX4A 1U5IB 3BUMB 1QXPA 1K9PA 4YBHB 3LK0A 4MRXA 1Y1XA 1RWYA 1CMFA 5PALA 1SMGA 5CSJA 3BUOB 1XFXO 2P6BB 1QLSA 2LP2A 4GGFC 2KQYA 5KU1A 2WCEA 4DUQA 4OV2A 3CLNA 5IBWA 1RJVA 1B4CA 1NPQA 3IF7A 1CDPA 3LLEA 2K61A 2LM5A 2KDHA 2SCPA 1S36A 3SG7A 1L7ZA 1WLMA 1SCMB 1J1DA 2JU0A 3OHMB 4NDBA 2V53A 3CTNA 4MZLA 1B8CA 3D10A 2G2BA 2JPTA 1UWOA 2KAVA 2KQ6A 4UPGA 3EK4A 3I5IB 1LVCD 2B1UA 3KF9A 1TRFA 3TS5B 1IJ5A 1K9UA 1XVJA 5F6TA 2AAOA 4MN0A 5HKZA 2TN4A 1ZACA 1YR5A 1NYAA 1UHHA 1VRKA 3D0YB 4MLWA 1SBJA 2FOTA 1D1OA 2KFGA 1F70A 1CLMA 2MRDA 3DD4A 1XFUO 4JWQA 1KQMC 1WLZA 4C0LA 1DMOA 4ORAB 2JXLA 4I5JA 1FBVA 1IRJA 1C07A 1AHRA 2JQ6A 2AUCA 1W7JB 1B7TY 1EXRA 1ZOTB 2LAPA 1FI6A 2M49B 2PASA 1NP8A 1HQVA 1S26D 1PVAA 3CR4X 3TDZA 1XK4C 1PRWA 4PE1A 1DGVA 1CFDA 2O5GA 1WY9A 1OZSA 1XA5A 4MBEA 3O2PA 1GGZA 1CLBA 1S5GZ 4DRWA 1CFCA 1XYDA 1OMRA 1S3PA 2ZN9A 4NDDA 1IWQA 1RROA 4WQ3A 3RLZA 1KK7Y 3FIAA 3JTDC 2KI6D 2Y1NA 4C0KA 4ETOA 4GBAA 1TTXA 1DJXA 1SR6B 2BE6A 2KAYA 3LK1A 2ISDA 2LE9B 4MZKA 1SL9A 1LXFC 2HPSA 3SJSA 1IKUA 1YRUB 1S6JA 1MQ1A 3A8RA 4AQIA 2LVJA 5HYDA 4PE0A 2JXCA 2WORA 1IQ5A 2I2RE 1BU3A 4P2YB 1NX0A 3FWBA 4M2OA 1QX5B 1U5IA 4A4CA 4CLNA 2ZN8A 4MRYA 1KFXS 2KGBC 4PHNA 4HSZA 2EGDA 2M3WA 2KHNA 2FCEA 2MAZA 3SIAA 2K7OA 3PLFB 1Q80A 4PE4A 1OE9B 2BCXA 2E6WA 4USLA 1DJHA 1KK8B 1QV1A 2AMIA 2LMUA 1UHKA 3JVTC 1BMOA 2LP3A 2JWWA 3PALA 1SNLA 1KSOA 2JNXA 4N1FA 1B1GA 4PALA 3WHTB 4C0JA 1AUIB 5CPVA 4JPZB 1J55A 1PSRA 5AEQA 5G08A 2BBNA 5AERA 3O4YA 1MF8B 1PK0D 4PE7A 1NCZA 5DKQA 1NIWA 3JTDB 2CCMA 5CSFA 1EG4A 3NXAA 4PHJA 1K94A 1NWDA 2LLUA 3D0YA 2FJUB 2KYCA 1XFVO 2F3ZA 2BL0C 1OOJA 2EC6B 4QJ3B 3CZTX 1AK8A 1IGVA 2LHIA 2K7CA 1JWDA 1IG5A 1RECA 1QLKA 2HETA 5B8IB 1JFKA 1CLLA 3E3RA 1DJIA 4GAOA 2MJWB 1XFYO 2MLEC 1F8HA 1WRLA 2E30A 3DF0B 4WQ2A 1V1FA 5BPJA 2FCDA 4TNCA 1BOCA 1NCYA 4QJ5B 2M9GA 1LKJA 2O60A 1F54A 3ICBA 2NXQA 1SPYA 2WCFA 1Y0VH 4GGFA 4HREE 2K8MB 2K2AA 1L2OB 3GK1A 5TNCA 3PN7B 5I2OA 2NCPA 1AJ4A 3TUYB 4DS7A 5FYXA 1JBAA 1B8RA 1UHNA 3EKJA 5KSZA 3A4UB 1J7QA 5HLOA 1WRZA 2K0JA 1M39A 1BR4B 4ORBB 5AANA 2LC5A 1IH0A 1DJZA 3AAJA 2WOSA 5ER4X 1IJ6A 1CM1A 2OTGB 2GV5A 3H4SE 1EG3A 4N1GA 1C7VA 3IQQA 1KSMA 1BR1B 4BY4A 1ALWA 4F0ZB 2JULA 4GGNA 1RK9A 4ZCUA 1TN4A 1DVIA 1A03A 2BL0B 5ER5A 1DJWA 1K8UA 4U8DA 4ICBA 1WRKA 1NCXA 1LINA 2F3YA 2Q4UA 3LL8B 2NLNA 3PSRA 3BQ3A 2PVBA 2WNDA 4GFTA 1CFFA 2OS8C 3OB2B 4DIRA 5I8NA 1QV0A 4DCKA 1SY9A 2Y5IA 3EK8A 1AVSA 1TOPA 1M46A 1CM4A 1PULA 2MA2A 1XK4A 2CT9A 4QJ4B 1CFPA 2L98A 4D1EA 1Y1AA 2JZIA 4OVNF 2KI6C 4PDZA 1ZUZA 2BE4A 4IL1A 4N5XA 1EL4A 3CGAA 3F45A 1JSAA 1GJYA 1YVLA 5I2QA 3PATA 2LANA 1K2HA 2Q91A 4BY5A 1QIVA 5DKRA 3KO0A 1SCVA 2JTZA 2KAXA 3BUNB 1YURA 1Y6WA 2PALA 1DF0B 2D8NA 2L4IA 1YX8A 2H61C 2HQWA 2JC2A 3MSEB 3CR2A 1C7WA 3EKHA 2KBIA 1QTXA 1DT7B 1CDMA 2Y4QA 4ZCVA 4MZJA 3DF0A 4GPLB 2ZRTA 1QJTA 4YGDB 2M7NA 4XJKB 2BCBA 1A4PA 1EJ3A 1LA0A 2KNEA 1MHOA 2KSPA 4M2PA 3OX5A 1DJGA 1FW4A 1Y1UA 3DVMA 1QVIY 1KFXL 1TNPA 3SG6A 1KQMB 1NX2A 2M1UA 1YTZC 4YGBB 2LVVA 1UP5A 1JF2A 2EHBA 3EVUA 2Y1MA 4MSPA 3O6BA 4GNKB 2L50A 2ZNDA 4ORCB 1SRAA 3KHEA 2KYFA 1YVHA 4NQGA 4FTGA 1K96A 4CPVA 1N2DA 1NSHA 3BXKA 1A75B 1F4OA 3CWGA 2LVKA 2BBMA 1CTRA 1E8AA 3NSIA 1B7TZ 1SW8A 1TIZA 3FWCA 4PHMA 1KWOC 1B9AA 1H4BA 4AOMA 1NX1A 4OR9B 3CR5X 2H2KA 1V1GA 2QPTA 3WNXB 2BKIB 1PVBA 2VRGA 1JF0A 3GK2A 2CNPA 1NUBA 2ZNEA 3BOWB 2WC8A 1SKTA 1HT9A 2MLFC 1GQMA 3AKAA 1G33A 1ZMZA 1BF5A 2COLB 1JFJA 4FQOA 1SCMC 1KK7Z 2JT3A 2NCOA 2CTNA 3EVVA 3GOFA 3SG3A 1R2UA 2K7DA 2BKHB 3AAKA 2LNKA 2WCBA 4YGAA 2KGRA 3WHUB 3EK7A 2NZ0A 3DVKA 3SG4A 3AKBA 4I5KA 2M8UA 3O78A 1S6IA 1KCYA 2R2IA 1CNPA 1S1EA 3I5HC 1AJ5A 4OKHA 1PALA 1QX2A 1KFUS 1UURA 3JVTB 5HKYA 1DF0A 1A29A 1QVIZ 1TNXA 4CIDA 4L9MA 3VRNA 4I5LB 2HQ8A 1FI5A 2LVIA 1YUSA 1OMDA 1BODA 3DVJA 3SIBA 1S5GY 5AXIA 2JNFA 1X02A 2PRUA 4MEWA 2JRFA 1KWOB 2JT8A 1DJYA 1AP4A 2F8PA 2QACA 1QATA 3OB1B 1K95A 5D69A 4XJKA 4JQ0D 1MXLC 4HRHA 2LHLA 1EH2A 3OX6A 3HCMA 5DKNA 5I2LA 4XYNA 1YUTA 4PHKA 1TCOB 2M1KB 1RTP1 2PSRA 2CBLA 1BLQA 1QASA 2K7BA 1A2XA 1BG1A 1DGUA 5GQQC 3I5GC 3IQOA 1OZOA 2I18A 3TDUA 1LA3A 2M29A 2JT0A 1J7PA 5CSNA 3KPXA 2GGZA 1CB1A 1SR6C 1B8LA 1N0YA 2KBMA 3OP0A 2LUCA 4AQJA 1QIWA 1DTLA 1G8IA 1SYMA 2RGIA 1A75A 1TNQA 1MWNA 1UHIA 3I5HB 4GUKA 3VROA 3NSKA 2LV7A 2SASA 3KEVA 3VRPA 1FF1A 5KTYA 1MR8A 1MXEA 4NDCA 5K89A 4PCWA 1M45A 2H61A 2M0RA 2L0PA 4CFRA 2M7LA 2BECA 5JJGA 1TNWA 4WRIA 5CSIA 2K2FA 2GGMA 2JOJA 2KOTA 1H8BA 3BOWA 1J1EA 1KK8C 3M0WA 5HKWA 1SK6D 1QX7A 2LMVA 1XFZO 1UUSA 1W7IB 2JTTA 2PMYA 1M31A 5HLVA 1CKKA 2KI4C 2LUXA 1N65A 3SG2A 1YRTB 2IS9A 3LCPC 2KFHA 1MUXA 3RM1A 3I5FC 1K90D 2LLTA 2OS8B 5AFPA 5JOLA 2HF5A 3I5GB 1XFWO 5J3XA 2KFFA 1WDCC 1CDNA 1K9KA 2M97A 1YX7A 2F2OA 1ODBA 1OSAA 3TZ1A 2L51A 4A4BA 1ZFSA 1F71A 2EC6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQV A;  3ZNI A;  2OPO A;  3TDI A;  4M2Q A;  2I7A A;  2A4J A;  1K93 D;  3BUX B;  3DVE A;  1G4Y R;  1JC2 A;  3CS1 A;  2L2E A;  4CFQ A;  1ALV A;  1B47 A;  2DOQ A;  2MHH A;  3ZWH A;  1J7R A;  1XO5 A;  1NX3 A;  2MBX A;  1YUU A;  2ZKM X;  1SL7 A;  3PM8 A;  1IQ3 A;  2LMT A;  1L2O C;  1J7O A;  1GGW A;  2G9B A;  3WXA A;  3VGO A;  3PN7 C;  1QS7 A;  2LLS A;  2L4H A;  3VRR A;  1OQP A;  3TUY C;  1JUO A;  1TCF A;  2F2P A;  4OCI A;  1PSB A;  1CDL A;  2ZFD A;  1F4Q A;  1M63 B;  4YRU A;  1FPW A;  4I5N B;  1SL8 A;  2I94 A;  2KI4 B;  4R1E A;  1F55 A;  3NSO A;  2OTG C;  3C1V A;  1BT6 A;  2CXJ A;  3QRX A;  1UHJ A;  3I5F B;  4P5O E;  1BJF A;  3VRQ A;  3PFV A;  4YGC B;  2BCA A;  3NSL A;  5D7F A;  3I5I C;  1WDC B;  4YGE B;  2F33 A;  3TS5 C;  2L5X B;  3BUW B;  1CMG A;  3BYA A;  4Q04 A;  3K21 A;  2LCP A;  3EVR A;  4YI8 A;  4MVF A;  3SG5 A;  1KFU L;  4YI9 A;  1RFJ A;  1OMV A;  3FS7 A;  1R6P A;  3GK4 X;  4E68 A;  1S6C A;  4HRG A;  2ZRS A;  3HX4 A;  1U5I B;  3BUM B;  1QXP A;  1K9P A;  4YBH B;  3LK0 A;  4MRX A;  1Y1X A;  1RWY A;  1CMF A;  5PAL A;  1SMG A;  5CSJ A;  3BUO B;  1XFX O;  2P6B B;  1QLS A;  2LP2 A;  4GGF C;  2KQY A;  5KU1 A;  2WCE A;  4DUQ A;  4OV2 A;  3CLN A;  5IBW A;  1RJV A;  1B4C A;  1NPQ A;  3IF7 A;  1CDP A;  3LLE A;  2K61 A;  2LM5 A;  2KDH A;  2SCP A;  1S36 A;  3SG7 A;  1L7Z A;  1WLM A;  1SCM B;  1J1D A;  2JU0 A;  3OHM B;  4NDB A;  2V53 A;  3CTN A;  4MZL A;  1B8C A;  3D10 A;  2G2B A;  2JPT A;  1UWO A;  2KAV A;  2KQ6 A;  4UPG A;  3EK4 A;  3I5I B;  1LVC D;  2B1U A;  3KF9 A;  1TRF A;  3TS5 B;  1IJ5 A;  1K9U A;  1XVJ A;  5F6T A;  2AAO A;  4MN0 A;  5HKZ A;  2TN4 A;  1ZAC A;  1YR5 A;  1NYA A;  1UHH A;  1VRK A;  3D0Y B;  4MLW A;  1SBJ A;  2FOT A;  1D1O A;  2KFG A;  1F70 A;  1CLM A;  2MRD A;  3DD4 A;  1XFU O;  4JWQ A;  1KQM C;  1WLZ A;  4C0L A;  1DMO A;  4ORA B;  2JXL A;  4I5J A;  1FBV A;  1IRJ A;  1C07 A;  1AHR A;  2JQ6 A;  2AUC A;  1W7J B;  1B7T Y;  1EXR A;  1ZOT B;  2LAP A;  1FI6 A;  2M49 B;  2PAS A;  1NP8 A;  1HQV A;  1S26 D;  1PVA A;  3CR4 X;  3TDZ A;  1XK4 C;  1PRW A;  4PE1 A;  1DGV A;  1CFD A;  2O5G A;  1WY9 A;  1OZS A;  1XA5 A;  4MBE A;  3O2P A;  1GGZ A;  1CLB A;  1S5G Z;  4DRW A;  1CFC A;  1XYD A;  1OMR A;  1S3P A;  2ZN9 A;  4NDD A;  1IWQ A;  1RRO A;  4WQ3 A;  3RLZ A;  1KK7 Y;  3FIA A;  3JTD C;  2KI6 D;  2Y1N A;  4C0K A;  4ETO A;  4GBA A;  1TTX A;  1DJX A;  1SR6 B;  2BE6 A;  2KAY A;  3LK1 A;  2ISD A;  2LE9 B;  4MZK A;  1SL9 A;  1LXF C;  2HPS A;  3SJS A;  1IKU A;  1YRU B;  1S6J A;  1MQ1 A;  3A8R A;  4AQI A;  2LVJ A;  5HYD A;  4PE0 A;  2JXC A;  2WOR A;  1IQ5 A;  2I2R E;  1BU3 A;  4P2Y B;  1NX0 A;  3FWB A;  4M2O A;  1QX5 B;  1U5I A;  4A4C A;  4CLN A;  2ZN8 A;  4MRY A;  1KFX S;  2KGB C;  4PHN A;  4HSZ A;  2EGD A;  2M3W A;  2KHN A;  2FCE A;  2MAZ A;  3SIA A;  2K7O A;  3PLF B;  1Q80 A;  4PE4 A;  1OE9 B;  2BCX A;  2E6W A;  4USL A;  1DJH A;  1KK8 B;  1QV1 A;  2AMI A;  2LMU A;  1UHK A;  3JVT C;  1BMO A;  2LP3 A;  2JWW A;  3PAL A;  1SNL A;  1KSO A;  2JNX A;  4N1F A;  1B1G A;  4PAL A;  3WHT B;  4C0J A;  1AUI B;  5CPV A;  4JPZ B;  1J55 A;  1PSR A;  5AEQ A;  5G08 A;  2BBN A;  5AER A;  3O4Y A;  1MF8 B;  1PK0 D;  4PE7 A;  1NCZ A;  5DKQ A;  1NIW A;  3JTD B;  2CCM A;  5CSF A;  1EG4 A;  3NXA A;  4PHJ A;  1K94 A;  1NWD A;  2LLU A;  3D0Y A;  2FJU B;  2KYC A;  1XFV O;  2F3Z A;  2BL0 C;  1OOJ A;  2EC6 B;  4QJ3 B;  3CZT X;  1AK8 A;  1IGV A;  2LHI A;  2K7C A;  1JWD A;  1IG5 A;  1REC A;  1QLK A;  2HET A;  5B8I B;  1JFK A;  1CLL A;  3E3R A;  1DJI A;  4GAO A;  2MJW B;  1XFY O;  2MLE C;  1F8H A;  1WRL A;  2E30 A;  3DF0 B;  4WQ2 A;  1V1F A;  5BPJ A;  2FCD A;  4TNC A;  1BOC A;  1NCY A;  4QJ5 B;  2M9G A;  1LKJ A;  2O60 A;  1F54 A;  3ICB A;  2NXQ A;  1SPY A;  2WCF A;  1Y0V H;  4GGF A;  4HRE E;  2K8M B;  2K2A A;  1L2O B;  3GK1 A;  5TNC A;  3PN7 B;  5I2O A;  2NCP A;  1AJ4 A;  3TUY B;  4DS7 A;  5FYX A;  1JBA A;  1B8R A;  1UHN A;  3EKJ A;  5KSZ A;  3A4U B;  1J7Q A;  5HLO A;  1WRZ A;  2K0J A;  1M39 A;  1BR4 B;  4ORB B;  5AAN A;  2LC5 A;  1IH0 A;  1DJZ A;  3AAJ A;  2WOS A;  5ER4 X;  1IJ6 A;  1CM1 A;  2OTG B;  2GV5 A;  3H4S E;  1EG3 A;  4N1G A;  1C7V A;  3IQQ A;  1KSM A;  1BR1 B;  4BY4 A;  1ALW A;  4F0Z B;  2JUL A;  4GGN A;  1RK9 A;  4ZCU A;  1TN4 A;  1DVI A;  1A03 A;  2BL0 B;  5ER5 A;  1DJW A;  1K8U A;  4U8D A;  4ICB A;  1WRK A;  1NCX A;  1LIN A;  2F3Y A;  2Q4U A;  3LL8 B;  2NLN A;  3PSR A;  3BQ3 A;  2PVB A;  2WND A;  4GFT A;  1CFF A;  2OS8 C;  3OB2 B;  4DIR A;  5I8N A;  1QV0 A;  4DCK A;  1SY9 A;  2Y5I A;  3EK8 A;  1AVS A;  1TOP A;  1M46 A;  1CM4 A;  1PUL A;  2MA2 A;  1XK4 A;  2CT9 A;  4QJ4 B;  1CFP A;  2L98 A;  4D1E A;  1Y1A A;  2JZI A;  4OVN F;  2KI6 C;  4PDZ A;  1ZUZ A;  2BE4 A;  4IL1 A;  4N5X A;  1EL4 A;  3CGA A;  3F45 A;  1JSA A;  1GJY A;  1YVL A;  5I2Q A;  3PAT A;  2LAN A;  1K2H A;  2Q91 A;  4BY5 A;  1QIV A;  5DKR A;  3KO0 A;  1SCV A;  2JTZ A;  2KAX A;  3BUN B;  1YUR A;  1Y6W A;  2PAL A;  1DF0 B;  2D8N A;  2L4I A;  1YX8 A;  2H61 C;  2HQW A;  2JC2 A;  3MSE B;  3CR2 A;  1C7W A;  3EKH A;  2KBI A;  1QTX A;  1DT7 B;  1CDM A;  2Y4Q A;  4ZCV A;  4MZJ A;  3DF0 A;  4GPL B;  2ZRT A;  1QJT A;  4YGD B;  2M7N A;  4XJK B;  2BCB A;  1A4P A;  1EJ3 A;  1LA0 A;  2KNE A;  1MHO A;  2KSP A;  4M2P A;  3OX5 A;  1DJG A;  1FW4 A;  1Y1U A;  3DVM A;  1QVI Y;  1KFX L;  1TNP A;  3SG6 A;  1KQM B;  1NX2 A;  2M1U A;  1YTZ C;  4YGB B;  2LVV A;  1UP5 A;  1JF2 A;  2EHB A;  3EVU A;  2Y1M A;  4MSP A;  3O6B A;  4GNK B;  2L50 A;  2ZND A;  4ORC B;  1SRA A;  3KHE A;  2KYF A;  1YVH A;  4NQG A;  4FTG A;  1K96 A;  4CPV A;  1N2D A;  1NSH A;  3BXK A;  1A75 B;  1F4O A;  3CWG A;  2LVK A;  2BBM A;  1CTR A;  1E8A A;  3NSI A;  1B7T Z;  1SW8 A;  1TIZ A;  3FWC A;  4PHM A;  1KWO C;  1B9A A;  1H4B A;  4AOM A;  1NX1 A;  4OR9 B;  3CR5 X;  2H2K A;  1V1G A;  2QPT A;  3WNX B;  2BKI B;  1PVB A;  2VRG A;  1JF0 A;  3GK2 A;  2CNP A;  1NUB A;  2ZNE A;  3BOW B;  2WC8 A;  1SKT A;  1HT9 A;  2MLF C;  1GQM A;  3AKA A;  1G33 A;  1ZMZ A;  1BF5 A;  2COL B;  1JFJ A;  4FQO A;  1SCM C;  1KK7 Z;  2JT3 A;  2NCO A;  2CTN A;  3EVV A;  3GOF A;  3SG3 A;  1R2U A;  2K7D A;  2BKH B;  3AAK A;  2LNK A;  2WCB A;  4YGA A;  2KGR A;  3WHU B;  3EK7 A;  2NZ0 A;  3DVK A;  3SG4 A;  3AKB A;  4I5K A;  2M8U A;  3O78 A;  1S6I A;  1KCY A;  2R2I A;  1CNP A;  1S1E A;  3I5H C;  1AJ5 A;  4OKH A;  1PAL A;  1QX2 A;  1KFU S;  1UUR A;  3JVT B;  5HKY A;  1DF0 A;  1A29 A;  1QVI Z;  1TNX A;  4CID A;  4L9M A;  3VRN A;  4I5L B;  2HQ8 A;  1FI5 A;  2LVI A;  1YUS A;  1OMD A;  1BOD A;  3DVJ A;  3SIB A;  1S5G Y;  5AXI A;  2JNF A;  1X02 A;  2PRU A;  4MEW A;  2JRF A;  1KWO B;  2JT8 A;  1DJY A;  1AP4 A;  2F8P A;  2QAC A;  1QAT A;  3OB1 B;  1K95 A;  5D69 A;  4XJK A;  4JQ0 D;  1MXL C;  4HRH A;  2LHL A;  1EH2 A;  3OX6 A;  3HCM A;  5DKN A;  5I2L A;  4XYN A;  1YUT A;  4PHK A;  1TCO B;  2M1K B;  1RTP 1;  2PSR A;  2CBL A;  1BLQ A;  1QAS A;  2K7B A;  1A2X A;  1BG1 A;  1DGU A;  5GQQ C;  3I5G C;  3IQO A;  1OZO A;  2I18 A;  3TDU A;  1LA3 A;  2M29 A;  2JT0 A;  1J7P A;  5CSN A;  3KPX A;  2GGZ A;  1CB1 A;  1SR6 C;  1B8L A;  1N0Y A;  2KBM A;  3OP0 A;  2LUC A;  4AQJ A;  1QIW A;  1DTL A;  1G8I A;  1SYM A;  2RGI A;  1A75 A;  1TNQ A;  1MWN A;  1UHI A;  3I5H B;  4GUK A;  3VRO A;  3NSK A;  2LV7 A;  2SAS A;  3KEV A;  3VRP A;  1FF1 A;  5KTY A;  1MR8 A;  1MXE A;  4NDC A;  5K89 A;  4PCW A;  1M45 A;  2H61 A;  2M0R A;  2L0P A;  4CFR A;  2M7L A;  2BEC A;  5JJG A;  1TNW A;  4WRI A;  5CSI A;  2K2F A;  2GGM A;  2JOJ A;  2KOT A;  1H8B A;  3BOW A;  1J1E A;  1KK8 C;  3M0W A;  5HKW A;  1SK6 D;  1QX7 A;  2LMV A;  1XFZ O;  1UUS A;  1W7I B;  2JTT A;  2PMY A;  1M31 A;  5HLV A;  1CKK A;  2KI4 C;  2LUX A;  1N65 A;  3SG2 A;  1YRT B;  2IS9 A;  3LCP C;  2KFH A;  1MUX A;  3RM1 A;  3I5F C;  1K90 D;  2LLT A;  2OS8 B;  5AFP A;  5JOL A;  2HF5 A;  3I5G B;  1XFW O;  5J3X A;  2KFF A;  1WDC C;  1CDN A;  1K9K A;  2M97 A;  1YX7 A;  2F2O A;  1ODB A;  1OSA A;  3TZ1 A;  2L51 A;  4A4B A;  1ZFS A;  1F71 A;  2EC6 C; 
#chains in the Genus database with same CATH topology
 1KQV A;  3D75 A;  3ZNI A;  3V2L A;  2OPO A;  3TDI A;  4M2Q A;  2I7A A;  2A4J A;  1K93 D;  2QEO A;  3BUX B;  1G4Y R;  3DVE A;  1JC2 A;  3CS1 A;  3VB1 A;  2L2E A;  4CFQ A;  1ALV A;  1B47 A;  2DOQ A;  1DQE A;  2MHH A;  3ZWH A;  1J7R A;  1XO5 A;  1NX3 A;  2MBX A;  1YUU A;  2ZKM X;  1SL7 A;  3PM8 A;  1IQ3 A;  2LMT A;  1L2O C;  1J7O A;  3NHI A;  1GGW A;  2G9B A;  3WXA A;  3VGO A;  3PN7 C;  1QS7 A;  2LLS A;  2L4H A;  3VRR A;  1OQP A;  3TUY C;  1JUO A;  1TCF A;  2F2P A;  4OCI A;  1PSB A;  1CDL A;  2ZFD A;  1F4Q A;  1M63 B;  4YRU A;  1FPW A;  4I5N B;  3CZ1 A;  1SL8 A;  2I94 A;  2KI4 B;  4R1E A;  1F55 A;  3NSO A;  2OTG C;  3C1V A;  1BT6 A;  2CXJ A;  3QRX A;  1UHJ A;  3I5F B;  4P5O E;  1BJF A;  3VRQ A;  3PFV A;  4YGC B;  2BCA A;  3NSL A;  5D7F A;  1OW4 A;  3I5I C;  1WDC B;  4YGE B;  2F33 A;  3TS5 C;  2L5X B;  3BUW B;  1CMG A;  3BYA A;  4Q04 A;  2GTE A;  3K21 A;  2LCP A;  3EVR A;  4YI8 A;  4MVF A;  3SG5 A;  1KFU L;  4YI9 A;  3L47 A;  1RFJ A;  1OMV A;  3FS7 A;  1R6P A;  3GK4 X;  4E68 A;  1S6C A;  4HRG A;  2ZRS A;  3PJI A;  3HX4 A;  1U5I B;  3BUM B;  1QXP A;  1K9P A;  4YBH B;  3LK0 A;  4MRX A;  1Y1X A;  3B87 A;  1RWY A;  1CMF A;  5PAL A;  1SMG A;  5CSJ A;  3BUO B;  1XFX O;  2P6B B;  3DY9 A;  2FJY A;  1QLS A;  2LP2 A;  4GGF C;  2KQY A;  5KU1 A;  2WCE A;  5D3O A;  4DUQ A;  4OV2 A;  3CLN A;  5IBW A;  3S0G A;  1RJV A;  1B4C A;  1NPQ A;  4INW A;  3IF7 A;  1CDP A;  3LLE A;  2K61 A;  2LM5 A;  2KDH A;  2SCP A;  1S36 A;  3SG7 A;  1L7Z A;  1WLM A;  1SCM B;  1J1D A;  2JU0 A;  3OHM B;  4NDB A;  2V53 A;  3R1V A;  3CTN A;  4MZL A;  1B8C A;  5DIC A;  3D10 A;  5EL2 A;  2G2B A;  2JPT A;  1UWO A;  2KAV A;  2KQ6 A;  4UPG A;  3EK4 A;  3I5I B;  1LVC D;  3DXL A;  2B1U A;  3KF9 A;  1TRF A;  3TS5 B;  1IJ5 A;  1K9U A;  1XVJ A;  3NHT A;  2AAO A;  4MN0 A;  5F6T A;  5HKZ A;  2TN4 A;  1ORG A;  1ZAC A;  3S0E A;  1YR5 A;  1NYA A;  1UHH A;  1VRK A;  3D0Y B;  4MLW A;  1SBJ A;  2FOT A;  1D1O A;  2KFG A;  1F70 A;  1CLM A;  2MRD A;  3DD4 A;  1XFU O;  4JWQ A;  1KQM C;  1P28 A;  1WLZ A;  3B7A A;  4C0L A;  4ORA B;  1DMO A;  2JXL A;  4I5J A;  1FBV A;  1IRJ A;  1C07 A;  1AHR A;  5I94 A;  2JQ6 A;  2AUC A;  1W7J B;  1B7T Y;  1EXR A;  1ZOT B;  2LAP A;  1FI6 A;  2M49 B;  2PAS A;  1NP8 A;  1HQV A;  1S26 D;  1PVA A;  3CR4 X;  3TDZ A;  1XK4 C;  1TUJ A;  1PRW A;  4PE1 A;  1DGV A;  1C3Z A;  1CFD A;  2O5G A;  3BFH A;  4KYN A;  1WY9 A;  3RZS A;  1OZS A;  1XA5 A;  4MBE A;  3O2P A;  1GGZ A;  1CLB A;  1S5G Z;  4DRW A;  1CFC A;  1XYD A;  1OMR A;  1S3P A;  2ZN9 A;  2PQL A;  4FQT A;  1IWQ A;  4NDD A;  1RRO A;  2KLD A;  4WQ3 A;  1KK7 Y;  1Z2C B;  3FIA A;  3JTD C;  4PT1 A;  2KI6 D;  2Y1N A;  4C0K A;  4ETO A;  4GBA A;  3S0F A;  1TTX A;  1DJX A;  1SR6 B;  2BE6 A;  2KAY A;  3LK1 A;  2ISD A;  2LE9 B;  3D73 A;  4MZK A;  1SL9 A;  2P71 A;  3SS4 A;  1LXF C;  2HPS A;  3SJS A;  2H8V A;  1IKU A;  1YRU B;  1S6J A;  1MQ1 A;  3A8R A;  4AQI A;  2LVJ A;  5HYD A;  4PE0 A;  2JXC A;  2WOR A;  1IQ5 A;  2I2R E;  1BU3 A;  4P2Y B;  1NX0 A;  3FWB A;  4M2O A;  1QX5 B;  1U5I A;  4A4C A;  3R1P A;  2ZN8 A;  4CLN A;  4MRY A;  2ERB A;  1SSE B;  1KFX S;  2KGB C;  4PHN A;  4HSZ A;  2EGD A;  4IJ7 A;  3SS3 A;  2M3W A;  2KHN A;  2FCE A;  2MAZ A;  3R1O A;  3SIA A;  2K7O A;  3PLF B;  1Q80 A;  3B88 A;  4PE4 A;  1OE9 B;  2BCX A;  3BJH A;  2E6W A;  4USL A;  1DJH A;  1KK8 B;  1QV1 A;  2AMI A;  2LMU A;  1UHK A;  3JVT C;  3O4X A;  2YGU A;  1BMO A;  2LP3 A;  2JWW A;  2KPH A;  3S0B A;  3CZ0 A;  3PAL A;  1SNL A;  1OOI X;  1KSO A;  2JNX A;  4N1F A;  1B1G A;  4PAL A;  3WHT B;  4C0J A;  1AUI B;  5CPV A;  4JPZ B;  1J55 A;  1PSR A;  5AEQ A;  5G08 A;  2BBN A;  5AER A;  3O4Y A;  1MF8 B;  1PK0 D;  4PE7 A;  2WC6 A;  1NCZ A;  5DKQ A;  1NIW A;  3JTD B;  2CCM A;  5CSF A;  1EG4 A;  3L4A A;  3NXA A;  1K94 A;  1NWD A;  2LLU A;  3D0Y A;  4PHJ A;  2FJU B;  2KYC A;  1XFV O;  2F3Z A;  2BL0 C;  1OOJ A;  2EC6 B;  4INX A;  3CZT X;  4QJ3 B;  1AK8 A;  1IGV A;  2LHI A;  2K7C A;  1JWD A;  1IG5 A;  1REC A;  1QLK A;  1T14 A;  2HET A;  1JFK A;  5B8I B;  1CLL A;  3E3R A;  1DJI A;  4GAO A;  2MJW B;  1XFY O;  2MLE C;  3NGV A;  1WRL A;  1F8H A;  2E30 A;  3DF0 B;  4WQ2 A;  1V1F A;  5BPJ A;  2FCD A;  4TNC A;  1BOC A;  1NCY A;  4QJ5 B;  2M9G A;  1LKJ A;  2O60 A;  1F54 A;  3ICB A;  2NXQ A;  1SPY A;  2WCF A;  1Y0V H;  4GGF A;  4HRE E;  2K8M B;  2K2A A;  2WCL A;  1L2O B;  3GK1 A;  5TNC A;  4F7F A;  3PN7 B;  5I2O A;  2NCP A;  3RLZ A;  1AJ4 A;  3TUY B;  4DS7 A;  5FYX A;  1JBA A;  1B8R A;  1UHN A;  3EKJ A;  5KSZ A;  3A4U B;  1J7Q A;  3CZ2 A;  5HLO A;  1WRZ A;  2K0J A;  1M39 A;  1BR4 B;  4ORB B;  5AAN A;  2LC5 A;  1IH0 A;  1DJZ A;  4JD9 A;  3AAJ A;  3UNW A;  2WOS A;  5ER4 X;  1IJ6 A;  1CM1 A;  2OTG B;  2GV5 A;  2QDI A;  3H4S E;  1EG3 A;  4N1G A;  2JPO A;  1C7V A;  3IQQ A;  1KSM A;  1BR1 B;  4BY4 A;  1ALW A;  4F0Z B;  2JUL A;  3FE9 A;  4GGN A;  1RK9 A;  4ZCU A;  1TN4 A;  2QEH A;  1DVI A;  1A03 A;  2BL0 B;  3OBV A;  3DYE A;  5ER5 A;  3Q8I A;  1DJW A;  1K8U A;  3PM2 A;  4U8D A;  4ICB A;  1WRK A;  1NCX A;  3BFA A;  1LIN A;  2F3Y A;  2Q4U A;  3LL8 B;  2NLN A;  3PSR A;  3BQ3 A;  2PVB A;  2WND A;  4GFT A;  1CFF A;  2OS8 C;  3B6X A;  3OB2 B;  2P70 A;  4DIR A;  3FE8 A;  1QV0 A;  4DCK A;  5I8N A;  1QWV A;  1SY9 A;  2Y5I A;  3EK8 A;  2PYQ A;  1AVS A;  1TOP A;  1M46 A;  1CM4 A;  1PUL A;  2MA2 A;  1XK4 A;  2CT9 A;  4QJ4 B;  3BFB A;  1CFP A;  2L98 A;  4D1E A;  1Y1A A;  2JZI A;  4OVN F;  2KI6 C;  4PDZ A;  1ZUZ A;  2BE4 A;  4IL1 A;  4N5X A;  1EL4 A;  3CGA A;  3F45 A;  1JSA A;  1GJY A;  4JKT A;  4OZD A;  1YVL A;  5I2Q A;  3PAT A;  2LAN A;  1K2H A;  3CYZ A;  2WC5 A;  1TWO A;  2Q91 A;  4BY5 A;  1QIV A;  5DKR A;  3KO0 A;  1SCV A;  2JTZ A;  2KAX A;  3BUN B;  1YUR A;  1Y6W A;  2PAL A;  1DF0 B;  3D74 A;  1LS8 A;  2D8N A;  2L4I A;  1YX8 A;  2H61 C;  2HQW A;  2JC2 A;  3MSE B;  3CR2 A;  1C7W A;  3EKH A;  2KBI A;  1QTX A;  1DT7 B;  2K60 A;  1CDM A;  2Y4Q A;  4ZCV A;  4MZJ A;  3DF0 A;  4GPL B;  2ZRT A;  1QJT A;  4YGD B;  2M7N A;  4XJK B;  2BCB A;  1A4P A;  1EJ3 A;  1LA0 A;  2KNE A;  1MHO A;  2KSP A;  4M2P A;  3OX5 A;  1DJG A;  1FW4 A;  1Y1U A;  3DVM A;  1DEK A;  1QVI Y;  1KFX L;  1TNP A;  2WCK A;  3SG6 A;  1KQM B;  1NX2 A;  3D77 A;  2M1U A;  1YTZ C;  4YGB B;  2LVV A;  1UP5 A;  1JF2 A;  2EHB A;  3EVU A;  2Y1M A;  4MSP A;  3O6B A;  4GNK B;  2L50 A;  2ZND A;  4ORC B;  1SRA A;  3KHE A;  2KYF A;  1YVH A;  4NQG A;  4FTG A;  1K96 A;  4CPV A;  1N2D A;  1NSH A;  3BXK A;  1A75 B;  1F4O A;  3CWG A;  2LVK A;  2BBM A;  1CTR A;  5FI6 A;  1E8A A;  3NSI A;  1B7T Z;  1SW8 A;  1TIZ A;  3FWC A;  4PHM A;  1KWO C;  1B9A A;  5FI7 A;  1H4B A;  4AOM A;  1NX1 A;  4OR9 B;  3CR5 X;  2H2K A;  3N7H A;  1V1G A;  2QPT A;  3WNX B;  3UO9 A;  2BKI B;  1PVB A;  2VRG A;  3SS5 A;  1JF0 A;  3GK2 A;  2CNP A;  1NUB A;  2ZNE A;  3BOW B;  2WC8 A;  3CDN A;  1SKT A;  1HT9 A;  2MLF C;  1GQM A;  2WCM A;  1G33 A;  1ZMZ A;  3AKA A;  1BF5 A;  2COL B;  1JFJ A;  4FQO A;  1SCM C;  1KK7 Z;  2JT3 A;  2NCO A;  2CTN A;  3EVV A;  3GOF A;  3SG3 A;  1R2U A;  2K7D A;  2BKH B;  3AAK A;  1XFR A;  2LNK A;  2WCB A;  4YGA A;  2KGR A;  3WHU B;  3EK7 A;  2NZ0 A;  3DVK A;  3R72 A;  3AKB A;  3SG4 A;  4I5K A;  2M8U A;  3O78 A;  1S6I A;  1KCY A;  2R2I A;  1CNP A;  1S1E A;  3I5H C;  1AJ5 A;  4OKH A;  1PAL A;  1QX2 A;  1KFU S;  1UUR A;  3JVT B;  1DEL A;  5HKY A;  1DF0 A;  1A29 A;  1QVI Z;  1TNX A;  4CID A;  4L9M A;  3VRN A;  4I5L B;  2HQ8 A;  1FI5 A;  2LVI A;  1W9Z A;  1YUS A;  1OMD A;  1BOD A;  3DVJ A;  3SIB A;  1S5G Y;  3K1E A;  5AXI A;  2JNF A;  1X02 A;  2PRU A;  4MEW A;  2JRF A;  1KWO B;  2JT8 A;  1DJY A;  1AP4 A;  2F8P A;  1C3Y A;  2QAC A;  1QAT A;  3OB1 B;  1K95 A;  5D69 A;  4XJK A;  4JQ0 D;  1MXL C;  4HRH A;  3D76 A;  1Z4H A;  2LHL A;  1EH2 A;  3OX6 A;  3HCM A;  2L2C A;  5DKN A;  5I2L A;  4XYN A;  1YUT A;  2WCH A;  4PHK A;  2WCJ A;  1TCO B;  2M1K B;  3B86 A;  1RTP 1;  1DC1 A;  2PSR A;  2QEV A;  2CBL A;  1BLQ A;  1QAS A;  2K7B A;  1A2X A;  1BG1 A;  1DGU A;  5GQQ C;  3I5G C;  3IQO A;  1OZO A;  2I18 A;  3TDU A;  1LA3 A;  2M29 A;  2JT0 A;  3L4L A;  1J7P A;  5CSN A;  3KPX A;  2GGZ A;  1CB1 A;  1SR6 C;  1B8L A;  1N0Y A;  1TUZ A;  2KBM A;  3OP0 A;  3QME A;  2LUC A;  4AQJ A;  2BNX A;  1QIW A;  1DTL A;  1G8I A;  1SYM A;  2RGI A;  1A75 A;  1TNQ A;  1MWN A;  1UHI A;  3I5H B;  4GUK A;  5FI2 A;  3S0D A;  3VRO A;  3NSK A;  2LV7 A;  2SAS A;  3KEV A;  3VRP A;  1FF1 A;  5KTY A;  2BAP A;  1MR8 A;  1MXE A;  4NDC A;  5K89 A;  4PCW A;  1M45 A;  2H61 A;  2M0R A;  3DZT A;  2L0P A;  1OOH A;  1OOF A;  3D78 A;  3CAB A;  4CFR A;  2M7L A;  2BEC A;  5JJG A;  1TNW A;  4WRI A;  5HL1 A;  5CSI A;  2K2F A;  2GGM A;  2JOJ A;  2KOT A;  3FE6 A;  1H8B A;  3BOW A;  1J1E A;  1KK8 C;  3M0W A;  5HKW A;  1SK6 D;  1QX7 A;  2LMV A;  3OGN A;  1XFZ O;  1UUS A;  1W7I B;  2JTT A;  2PMY A;  1M31 A;  5HLV A;  3S0A A;  1CKK A;  2KI4 C;  2LUX A;  1N65 A;  3SG2 A;  1YRT B;  1IIO A;  2IS9 A;  3LCP C;  2KFH A;  1MUX A;  3RM1 A;  3I5F C;  1K90 D;  2L5Y A;  2LLT A;  2OS8 B;  3EG5 B;  5AFP A;  5JOL A;  2HF5 A;  3I5G B;  1XFW O;  5J3X A;  2KFF A;  2KLE A;  1WDC C;  1CDN A;  1K9K A;  2M97 A;  1OOG A;  1YX7 A;  1ODB A;  1OSA A;  2F2O A;  3TZ1 A;  2L51 A;  1GM0 A;  4A4B A;  1ZFS A;  1F71 A;  3IVT A;  2QEB A;  2EC6 C; 
#chains in the Genus database with same CATH homology
 1KQV A;  3ZNI A;  2OPO A;  3TDI A;  4M2Q A;  2I7A A;  2A4J A;  1K93 D;  3BUX B;  3DVE A;  1G4Y R;  1JC2 A;  3CS1 A;  2L2E A;  4CFQ A;  1ALV A;  1B47 A;  2DOQ A;  2MHH A;  3ZWH A;  1J7R A;  1XO5 A;  1NX3 A;  2MBX A;  1YUU A;  2ZKM X;  1SL7 A;  3PM8 A;  1IQ3 A;  2LMT A;  1L2O C;  1J7O A;  1GGW A;  2G9B A;  3WXA A;  3VGO A;  3PN7 C;  1QS7 A;  2LLS A;  2L4H A;  3VRR A;  1OQP A;  3TUY C;  1JUO A;  1TCF A;  2F2P A;  4OCI A;  1PSB A;  1CDL A;  2ZFD A;  1F4Q A;  1M63 B;  4YRU A;  1FPW A;  4I5N B;  1SL8 A;  2I94 A;  2KI4 B;  4R1E A;  1F55 A;  3NSO A;  2OTG C;  3C1V A;  1BT6 A;  2CXJ A;  3QRX A;  1UHJ A;  3I5F B;  4P5O E;  1BJF A;  3VRQ A;  3PFV A;  4YGC B;  2BCA A;  3NSL A;  5D7F A;  3I5I C;  1WDC B;  4YGE B;  2F33 A;  3TS5 C;  2L5X B;  3BUW B;  1CMG A;  3BYA A;  4Q04 A;  3K21 A;  2LCP A;  3EVR A;  4YI8 A;  4MVF A;  3SG5 A;  1KFU L;  4YI9 A;  1RFJ A;  1OMV A;  3FS7 A;  1R6P A;  3GK4 X;  4E68 A;  1S6C A;  4HRG A;  2ZRS A;  3HX4 A;  1U5I B;  3BUM B;  1QXP A;  1K9P A;  4YBH B;  3LK0 A;  4MRX A;  1Y1X A;  1RWY A;  1CMF A;  5PAL A;  1SMG A;  5CSJ A;  3BUO B;  1XFX O;  2P6B B;  1QLS A;  2LP2 A;  4GGF C;  2KQY A;  5KU1 A;  2WCE A;  4DUQ A;  4OV2 A;  3CLN A;  5IBW A;  1RJV A;  1B4C A;  1NPQ A;  3IF7 A;  1CDP A;  3LLE A;  2K61 A;  2LM5 A;  2KDH A;  2SCP A;  1S36 A;  3SG7 A;  1L7Z A;  1WLM A;  1SCM B;  1J1D A;  2JU0 A;  3OHM B;  4NDB A;  2V53 A;  3CTN A;  4MZL A;  1B8C A;  3D10 A;  2G2B A;  2JPT A;  1UWO A;  2KAV A;  2KQ6 A;  4UPG A;  3EK4 A;  3I5I B;  1LVC D;  2B1U A;  3KF9 A;  1TRF A;  3TS5 B;  1IJ5 A;  1K9U A;  1XVJ A;  5F6T A;  2AAO A;  4MN0 A;  5HKZ A;  2TN4 A;  1ZAC A;  1YR5 A;  1NYA A;  1UHH A;  1VRK A;  3D0Y B;  4MLW A;  1SBJ A;  2FOT A;  1D1O A;  2KFG A;  1F70 A;  1CLM A;  2MRD A;  3DD4 A;  1XFU O;  4JWQ A;  1KQM C;  1WLZ A;  4C0L A;  1DMO A;  4ORA B;  2JXL A;  4I5J A;  1FBV A;  1IRJ A;  1C07 A;  1AHR A;  2JQ6 A;  2AUC A;  1W7J B;  1B7T Y;  1EXR A;  1ZOT B;  2LAP A;  1FI6 A;  2M49 B;  2PAS A;  1NP8 A;  1HQV A;  1S26 D;  1PVA A;  3CR4 X;  3TDZ A;  1XK4 C;  1PRW A;  4PE1 A;  1DGV A;  1CFD A;  2O5G A;  1WY9 A;  1OZS A;  1XA5 A;  4MBE A;  3O2P A;  1GGZ A;  1CLB A;  1S5G Z;  4DRW A;  1CFC A;  1XYD A;  1OMR A;  1S3P A;  2ZN9 A;  4NDD A;  1IWQ A;  1RRO A;  4WQ3 A;  3RLZ A;  1KK7 Y;  3FIA A;  3JTD C;  2KI6 D;  2Y1N A;  4C0K A;  4ETO A;  4GBA A;  1TTX A;  1DJX A;  1SR6 B;  2BE6 A;  2KAY A;  3LK1 A;  2ISD A;  2LE9 B;  4MZK A;  1SL9 A;  1LXF C;  2HPS A;  3SJS A;  1IKU A;  1YRU B;  1S6J A;  1MQ1 A;  3A8R A;  4AQI A;  2LVJ A;  5HYD A;  4PE0 A;  2JXC A;  2WOR A;  1IQ5 A;  2I2R E;  1BU3 A;  4P2Y B;  1NX0 A;  3FWB A;  4M2O A;  1QX5 B;  1U5I A;  4A4C A;  4CLN A;  2ZN8 A;  4MRY A;  1KFX S;  2KGB C;  4PHN A;  4HSZ A;  2EGD A;  2M3W A;  2KHN A;  2FCE A;  2MAZ A;  3SIA A;  2K7O A;  3PLF B;  1Q80 A;  4PE4 A;  1OE9 B;  2BCX A;  2E6W A;  4USL A;  1DJH A;  1KK8 B;  1QV1 A;  2AMI A;  2LMU A;  1UHK A;  3JVT C;  1BMO A;  2LP3 A;  2JWW A;  3PAL A;  1SNL A;  1KSO A;  2JNX A;  4N1F A;  1B1G A;  4PAL A;  3WHT B;  4C0J A;  1AUI B;  5CPV A;  4JPZ B;  1J55 A;  1PSR A;  5AEQ A;  5G08 A;  2BBN A;  5AER A;  3O4Y A;  1MF8 B;  1PK0 D;  4PE7 A;  1NCZ A;  5DKQ A;  1NIW A;  3JTD B;  2CCM A;  5CSF A;  1EG4 A;  3NXA A;  4PHJ A;  1K94 A;  1NWD A;  2LLU A;  3D0Y A;  2FJU B;  2KYC A;  1XFV O;  2F3Z A;  2BL0 C;  1OOJ A;  2EC6 B;  4QJ3 B;  3CZT X;  1AK8 A;  1IGV A;  2LHI A;  2K7C A;  1JWD A;  1IG5 A;  1REC A;  1QLK A;  2HET A;  5B8I B;  1JFK A;  1CLL A;  3E3R A;  1DJI A;  4GAO A;  2MJW B;  1XFY O;  2MLE C;  1F8H A;  1WRL A;  2E30 A;  3DF0 B;  4WQ2 A;  1V1F A;  5BPJ A;  2FCD A;  4TNC A;  1BOC A;  1NCY A;  4QJ5 B;  2M9G A;  1LKJ A;  2O60 A;  1F54 A;  3ICB A;  2NXQ A;  1SPY A;  2WCF A;  1Y0V H;  4GGF A;  4HRE E;  2K8M B;  2K2A A;  1L2O B;  3GK1 A;  5TNC A;  3PN7 B;  5I2O A;  2NCP A;  1AJ4 A;  3TUY B;  4DS7 A;  5FYX A;  1JBA A;  1B8R A;  1UHN A;  3EKJ A;  5KSZ A;  3A4U B;  1J7Q A;  5HLO A;  1WRZ A;  2K0J A;  1M39 A;  1BR4 B;  4ORB B;  5AAN A;  2LC5 A;  1IH0 A;  1DJZ A;  3AAJ A;  2WOS A;  5ER4 X;  1IJ6 A;  1CM1 A;  2OTG B;  2GV5 A;  3H4S E;  1EG3 A;  4N1G A;  1C7V A;  3IQQ A;  1KSM A;  1BR1 B;  4BY4 A;  1ALW A;  4F0Z B;  2JUL A;  4GGN A;  1RK9 A;  4ZCU A;  1TN4 A;  1DVI A;  1A03 A;  2BL0 B;  5ER5 A;  1DJW A;  1K8U A;  4U8D A;  4ICB A;  1WRK A;  1NCX A;  1LIN A;  2F3Y A;  2Q4U A;  3LL8 B;  2NLN A;  3PSR A;  3BQ3 A;  2PVB A;  2WND A;  4GFT A;  1CFF A;  2OS8 C;  3OB2 B;  4DIR A;  5I8N A;  1QV0 A;  4DCK A;  1SY9 A;  2Y5I A;  3EK8 A;  1AVS A;  1TOP A;  1M46 A;  1CM4 A;  1PUL A;  2MA2 A;  1XK4 A;  2CT9 A;  4QJ4 B;  1CFP A;  2L98 A;  4D1E A;  1Y1A A;  2JZI A;  4OVN F;  2KI6 C;  4PDZ A;  1ZUZ A;  2BE4 A;  4IL1 A;  4N5X A;  1EL4 A;  3CGA A;  3F45 A;  1JSA A;  1GJY A;  1YVL A;  5I2Q A;  3PAT A;  2LAN A;  1K2H A;  2Q91 A;  4BY5 A;  1QIV A;  5DKR A;  3KO0 A;  1SCV A;  2JTZ A;  2KAX A;  3BUN B;  1YUR A;  1Y6W A;  2PAL A;  1DF0 B;  2D8N A;  2L4I A;  1YX8 A;  2H61 C;  2HQW A;  2JC2 A;  3MSE B;  3CR2 A;  1C7W A;  3EKH A;  2KBI A;  1QTX A;  1DT7 B;  1CDM A;  2Y4Q A;  4ZCV A;  4MZJ A;  3DF0 A;  4GPL B;  2ZRT A;  1QJT A;  4YGD B;  2M7N A;  4XJK B;  2BCB A;  1A4P A;  1EJ3 A;  1LA0 A;  2KNE A;  1MHO A;  2KSP A;  4M2P A;  3OX5 A;  1DJG A;  1FW4 A;  1Y1U A;  3DVM A;  1QVI Y;  1KFX L;  1TNP A;  3SG6 A;  1KQM B;  1NX2 A;  2M1U A;  1YTZ C;  4YGB B;  2LVV A;  1UP5 A;  1JF2 A;  2EHB A;  3EVU A;  2Y1M A;  4MSP A;  3O6B A;  4GNK B;  2L50 A;  2ZND A;  4ORC B;  1SRA A;  3KHE A;  2KYF A;  1YVH A;  4NQG A;  4FTG A;  1K96 A;  4CPV A;  1N2D A;  1NSH A;  3BXK A;  1A75 B;  1F4O A;  3CWG A;  2LVK A;  2BBM A;  1CTR A;  1E8A A;  3NSI A;  1B7T Z;  1SW8 A;  1TIZ A;  3FWC A;  4PHM A;  1KWO C;  1B9A A;  1H4B A;  4AOM A;  1NX1 A;  4OR9 B;  3CR5 X;  2H2K A;  1V1G A;  2QPT A;  3WNX B;  2BKI B;  1PVB A;  2VRG A;  1JF0 A;  3GK2 A;  2CNP A;  1NUB A;  2ZNE A;  3BOW B;  2WC8 A;  1SKT A;  1HT9 A;  2MLF C;  1GQM A;  3AKA A;  1G33 A;  1ZMZ A;  1BF5 A;  2COL B;  1JFJ A;  4FQO A;  1SCM C;  1KK7 Z;  2JT3 A;  2NCO A;  2CTN A;  3EVV A;  3GOF A;  3SG3 A;  1R2U A;  2K7D A;  2BKH B;  3AAK A;  2LNK A;  2WCB A;  4YGA A;  2KGR A;  3WHU B;  3EK7 A;  2NZ0 A;  3DVK A;  3SG4 A;  3AKB A;  4I5K A;  2M8U A;  3O78 A;  1S6I A;  1KCY A;  2R2I A;  1CNP A;  1S1E A;  3I5H C;  1AJ5 A;  4OKH A;  1PAL A;  1QX2 A;  1KFU S;  1UUR A;  3JVT B;  5HKY A;  1DF0 A;  1A29 A;  1QVI Z;  1TNX A;  4CID A;  4L9M A;  3VRN A;  4I5L B;  2HQ8 A;  1FI5 A;  2LVI A;  1YUS A;  1OMD A;  1BOD A;  3DVJ A;  3SIB A;  1S5G Y;  5AXI A;  2JNF A;  1X02 A;  2PRU A;  4MEW A;  2JRF A;  1KWO B;  2JT8 A;  1DJY A;  1AP4 A;  2F8P A;  2QAC A;  1QAT A;  3OB1 B;  1K95 A;  5D69 A;  4XJK A;  4JQ0 D;  1MXL C;  4HRH A;  2LHL A;  1EH2 A;  3OX6 A;  3HCM A;  5DKN A;  5I2L A;  4XYN A;  1YUT A;  4PHK A;  1TCO B;  2M1K B;  1RTP 1;  2PSR A;  2CBL A;  1BLQ A;  1QAS A;  2K7B A;  1A2X A;  1BG1 A;  1DGU A;  5GQQ C;  3I5G C;  3IQO A;  1OZO A;  2I18 A;  3TDU A;  1LA3 A;  2M29 A;  2JT0 A;  1J7P A;  5CSN A;  3KPX A;  2GGZ A;  1CB1 A;  1SR6 C;  1B8L A;  1N0Y A;  2KBM A;  3OP0 A;  2LUC A;  4AQJ A;  1QIW A;  1DTL A;  1G8I A;  1SYM A;  2RGI A;  1A75 A;  1TNQ A;  1MWN A;  1UHI A;  3I5H B;  4GUK A;  3VRO A;  3NSK A;  2LV7 A;  2SAS A;  3KEV A;  3VRP A;  1FF1 A;  5KTY A;  1MR8 A;  1MXE A;  4NDC A;  5K89 A;  4PCW A;  1M45 A;  2H61 A;  2M0R A;  2L0P A;  4CFR A;  2M7L A;  2BEC A;  5JJG A;  1TNW A;  4WRI A;  5CSI A;  2K2F A;  2GGM A;  2JOJ A;  2KOT A;  1H8B A;  3BOW A;  1J1E A;  1KK8 C;  3M0W A;  5HKW A;  1SK6 D;  1QX7 A;  2LMV A;  1XFZ O;  1UUS A;  1W7I B;  2JTT A;  2PMY A;  1M31 A;  5HLV A;  1CKK A;  2KI4 C;  2LUX A;  1N65 A;  3SG2 A;  1YRT B;  2IS9 A;  3LCP C;  2KFH A;  1MUX A;  3RM1 A;  3I5F C;  1K90 D;  2LLT A;  2OS8 B;  5AFP A;  5JOL A;  2HF5 A;  3I5G B;  1XFW O;  5J3X A;  2KFF A;  1WDC C;  1CDN A;  1K9K A;  2M97 A;  1YX7 A;  2F2O A;  1ODB A;  1OSA A;  3TZ1 A;  2L51 A;  4A4B A;  1ZFS A;  1F71 A;  2EC6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...