2KQ6A

The structure of the ef-hand domain of polycystin-2 suggests a mechanism for ca2+-dependent regulation of polycystin-2 channel activity
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
NTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycystin-2
publication title Structure of the EF-hand domain of polycystin-2 suggests a mechanism for Ca2+-dependent regulation of polycystin-2 channel activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kq6A01
2DOQA 2Y1MA 4I5JA 4C0LA 3E3RA 2L98A 1DGUA 2BCAA 2NCOA 2JNXA 3BXKA 1B8RA 2AMIA 3EK8A 4MZLA 1SNLA 1KCYA 1BU3A 2KFFA 4DCKA 5IBWA 2Q4UA 1TIZA 2PMYA 4E68A 1SYMA 2NCPA 1K90D 1WRLA 1KFUS 2KI6C 3DVMA 4ETOA 1NUBA 2KI6D 5J3XA 1UUSA 1JF0A 2Y5IA 3SG2A 3PM8A 1UP5A 2FOTA 2M97A 2MAZA 4C0KA 1NPQA 1L7ZA 1V1FA 2JC2A 2MLFC 2WC8A 3M0WA 1C7VA 1RK9A 1DJZA 1PVAA 1RFJA 1OQPA 5CSFA 1QX2A 5G08A 2M3WA 3WXAA 3TZ1A 3TS5C 2RGIA 4AQJA 2M29A 4M2OA 5F6TA 2KYFA 2L4HA 4PE7A 1EH2A 2O60A 1DJYA 2PSRA 3JVTC 1EL4A 1H4BA 2F33A 4PE0A 4N1FA 1KSMA 1IKUA 2Y1NA 1SCVA 2M8UA 3HX4A 1CLMA 2BBMA 4R1EA 3OB1B 3VRPA 3LK1A 2PVBA 3GK4X 3F45A 1ZUZA 1N65A 1CM1A 3BUXB 4YGAA 1TCFA 3IQOA 2BCXA 1A03A 2FCEA 1B1GA 5KTYA 1PULA 1UHHA 5CPVA 2KOTA 3GK2A 3EVVA 4YGBB 4ORCB 3TDUA 4QJ3B 4XJKB 3BOWA 3ICBA 1NCZA 2WCBA 1YRTB 1MR8A 2JT8A 1NCYA 4MEWA 3NSKA 2R2IA 1M46A 2E30A 2OTGB 2JXLA 2M7NA 1OZSA 2KDHA 2BCBA 1ALWA 3D10A 1J7PA 2M9GA 4GGFC 1KQVA 2VRGA 3O4YA 3EKHA 3LCPC 1CKKA 1UHKA 2LVJA 4JPZB 1K96A 1OMRA 2L5XB 2MRDA 4ZCUA 2G9BA 1DT7B 3EVRA 3AAKA 5AERA 1K94A 1U5IB 5CSIA 1AUIB 1SKTA 1EXRA 4A4BA 1G4YR 2KI4B 1A75B 1DVIA 2KAXA 1KFUL 4PHNA 2EC6B 1AP4A 1B7TZ 1TNXA 4I5KA 4PALA 2L2EA 3VGOA 3DVKA 2M0RA 3O2PA 3TS5B 4OKHA 2CCMA 1EG4A 2I94A 4MLWA 1NYAA 1ALVA 2O5GA 1AHRA 1B4CA 1CFDA 2AUCA 3I5GB 1NWDA 1N2DA 1QVIY 1CDLA 3PATA 4Q04A 5KU1A 1CFFA 2HF5A 5I2LA 1JF2A 5CSJA 2M1UA 1A4PA 1LA3A 2WORA 2IS9A 3EK4A 2F8PA 1LVCD 1RWYA 4GGFA 2ISDA 1IQ3A 1SBJA 3LK0A 1S5GY 4GBAA 4GNKB 2MJWB 3AAJA 4M2PA 5HKYA 1SY9A 1BT6A 2LHIA 1FI5A 5HLVA 1BMOA 1YX8A 1DTLA 1CFCA 2K2FA 2JT3A 1D1OA 1CTRA 1DJWA 4DUQA 1KSOA 1Y1XA 3BQ3A 4A4CA 2H61C 1KWOB 2LP3A 1TCOB 3JTDC 4CLNA 1YURA 2CTNA 1WRZA 4P5OE 1Y1AA 2K61A 3C1VA 5DKQA 3OB2B 2HQ8A 4PHJA 1W7JB 2KFGA 2OTGC 2ZN9A 2L0PA 1CM4A 1K2HA 4C0JA 1FI6A 2MHHA 2V53A 1TRFA 1E8AA 1BR1B 1M45A 4AOMA 2LVVA 1NX1A 1LA0A 1QX7A 5JOLA 1TNPA 1M39A 3PN7B 1BR4B 1QV0A 1YVLA 1WDCB 2SCPA 1Y0VH 5D7FA 1CLBA 1UWOA 1J1DA 1QLKA 2JZIA 1DJGA 3GOFA 1QLSA 2WOSA 2K8MB 1LKJA 1DJXA 2KI4C 1S6JA 3CGAA 4CFRA 1F70A 2KBMA 2MA2A 5TNCA 4XYNA 1WRKA 5JJGA 1BOCA 2EC6C 2PRUA 2ZN8A 3EK7A 2M7LA 2AAOA 3KF9A 3QRXA 1IWQA 4YGDB 1J1EA 2ZNDA 1NX3A 1SL7A 2I7AA 2KQYA 2LAPA 4XJKA 1UURA 1WLMA 3I5GC 2JT0A 5DKNA 1XFZO 2OPOA 1FW4A 2CXJA 3VRNA 1Q80A 1AJ5A 2L4IA 1ZMZA 1KK7Z 3NSIA 5AFPA 1WLZA 2LCPA 3FIAA 2LC5A 3SG5A 4WQ2A 1WY9A 3KHEA 4U8DA 3DF0B 4HREE 2M1KB 3OX5A 1CDNA 4YGCB 4PE1A 1U5IA 2Q91A 1YUTA 2QACA 5AANA 1ZOTB 1XA5A 1KWOC 2KAVA 3JTDB 1NP8A 4GFTA 3VROA 1QATA 1SR6B 2JOJA 3CLNA 1ZFSA 2JQ6A 1GJYA 2LNKA 2F2OA 4WRIA 5CSNA 3I5HB 2EHBA 1CB1A 1EJ3A 4WQ3A 4CPVA 1K9UA 3A4UB 1R6PA 1B9AA 1TN4A 3CWGA 2OS8C 2GV5A 2H2KA 3PN7C 1WDCC 5AXIA 1FF1A 1B7TY 3CR5X 2BE6A 2TN4A 2D8NA 4YI8A 2BBNA 1KFXS 1OZOA 1QTXA 2LMUA 3SG7A 3OX6A 2ZKMX 1K93D 5BPJA 1ZACA 1HT9A 3RM1A 5HLOA 4GUKA 1PSBA 1TNQA 5I2OA 2BL0B 4GPLB 3WHUB 4HRHA 1LINA 2CT9A 2LE9B 4NDBA 1UHIA 2COLB 2K7CA 1GQMA 3GK1A 2ZFDA 4PCWA 2KSPA 5KSZA 1F8HA 1YTZC 2WCEA 1XYDA 3BUMB 4USLA 2LMTA 3SG3A 1XFVO 5ER4X 1DJIA 4N5XA 3WNXB 1CDMA 2M49B 4OR9B 1CNPA 2K2AA 2JWWA 3BOWB 3ZNIA 4AQIA 2LUXA 3I5FC 1VRKA 2MLEC 1JWDA 3SG4A 1GGWA 1TNWA 2L50A 1B47A 5D69A 2I2RE 4PE4A 4BY5A 4CFQA 4HSZA 3OP0A 3NXAA 1IG5A 2GGMA 1J7OA 1XFWO 1SL9A 2L51A 1GGZA 2LP2A 2WCFA 2JRFA 2F3ZA 5PALA 3BUOB 5I8NA 4NDCA 1BLQA 2PASA 1SR6C 4DIRA 1A2XA 1CDPA 3IQQA 1QIVA 1S6CA 1IGVA 3PSRA 1J55A 3EVUA 4N1GA 4NQGA 1MUXA 1QVIZ 1SCMB 3CR4X 3CS1A 4FQOA 4CIDA 5B8IB 1AK8A 3PLFB 1C7WA 3O78A 4JWQA 2LM5A 4QJ5B 2KGRA 3I5HC 2BKHB 3FS7A 1N0YA 1SPYA 1PALA 3TDIA 2OS8B 1XVJA 2BKIB 1S5GZ 2HPSA 3CTNA 1K9KA 2CNPA 1MXEA 1YR5A 1OOJA 2A4JA 1JFJA 3PALA 1XFXO 1NIWA 3D0YB 1NX2A 3BYAA 1IQ5A 4OVNF 2CBLA 2JXCA 4UPGA 1RJVA 3DF0A 4PHMA 1YRUB 3TDZA 1K8UA 3FWBA 3FWCA 1JSAA 1B8CA 4MRYA 2KQ6A 1QS7A 2LUCA 2Y4QA 1JC2A 1J7RA 1K95A 2FCDA 1KQMB 5AEQA 1RROA 2K0JA 5HKWA 1CFPA 1KFXL 1NCXA 2H61A 3DVEA 1JBAA 2K7DA 3KO0A 1KK7Y 1Y6WA 1DF0B 2K7BA 2KHNA 2BL0C 3KEVA 3PFVA 1BJFA 4MZJA 4MRXA 4ORBB 2BE4A 1FPWA 3NSLA 2MBXA 1AVSA 1CMFA 2NZ0A 2SASA 2P6BB 2JULA 3SG6A 3AKAA 1QX5B 1MQ1A 2K7OA 3KPXA 2GGZA 2KNEA 4OCIA 1F4OA 2EGDA 2LV7A 4YGEB 1YVHA 3I5FB 3OHMB 1A29A 3IF7A 4NDDA 1XFUO 1F71A 4P2YB 1KK8C 3TUYB 3WHTB 1IH0A 1JUOA 3VRRA 1XK4C 2JTZA 4YRUA 2NLNA 4PHKA 1PRWA 4MSPA 3I5IB 2QPTA 2I18A 1C07A 1F54A 1A75A 1IJ5A 4TNCA 3VRQA 2KGBC 1SK6D 2JPTA 2LLUA 1M31A 2HETA 1PK0D 4MBEA 1QASA 1QJTA 1S36A 1PSRA 2F2PA 1SL8A 1UHJA 1OMVA 1SCMC 1SMGA 1AJ4A 1SRAA 2LANA 2LLTA 1L2OB 3DVJA 5GQQC 4D1EA 2PALA 1FBVA 3HCMA 2KYCA 1NX0A 4GAOA 1OMDA 3LL8B 4GGNA 1YUUA 1F4QA 1IJ6A 1MXLC 1MF8B 1MHOA 3BUNB 4FTGA 1BG1A 1J7QA 1YUSA 4MZKA 1X02A 4I5LB 3ZWHA 1JFKA 3LLEA 2LVIA 1EG3A 1YX7A 2LLSA 4HRGA 2LHLA 2KFHA 4MN0A 4I5NB 1S3PA 5K89A 2B1UA 5DKRA 4BY4A 1M63B 1XK4A 2WNDA 4QJ4B 4M2QA 1PVBA 1SW8A 1KQMC 2KBIA 1Y1UA 2KAYA 1QIWA 5FYXA 1LXFC 3RLZA 4DS7A 1RECA 4JQ0D 2HQWA 1QXPA 4PDZA 1QV1A 1G33A 1K9PA 1R2UA 1NSHA 4ORAB 1S26D 2LVKA 1DMOA 1IRJA 1DGVA 1S6IA 3SIAA 2JNFA 3NSOA 1XO5A 2NXQA 1S1EA 3AKBA 2E6WA 3EKJA 3CZTX 2FJUB 1KK8B 5ER5A 2F3YA 1V1GA 4IL1A 4DRWA 3TUYC 1BODA 1CLLA 2ZRTA 2JU0A 3D0YA 1OE9B 3JVTB 4OV2A 2BECA 3I5IC 3K21A 1F55A 1H8BA 1MWNA 3O6BA 4L9MA 1HQVA 4MVFA 3SJSA 1TOPA 3H4SE 1ODBA 3SIBA 2G2BA 4YI9A 1UHNA 1DJHA 1W7IB 4F0ZB 1DF0A 1RTP1 3MSEB 1B8LA 2LMVA 4ZCVA 5HKZA 1L2OC 3A8RA 4ICBA 1XFYO 2ZRSA 2JTTA 3BUWB 2ZNEA 3DD4A 4YBHB 5HYDA 1TTXA 3CR2A 5I2QA 1CMGA 1G8IA 1BF5A 1OSAA
chains in the Genus database with same CATH superfamily
2DOQA 2Y1MA 4I5JA 4C0LA 3E3RA 2L98A 1DGUA 2BCAA 2NCOA 2JNXA 3BXKA 3UO9A 1B8RA 2AMIA 3EK8A 5FI7A 4MZLA 1SNLA 1KCYA 1BU3A 2KFFA 4DCKA 5IBWA 2Q4UA 1TIZA 2PMYA 4E68A 1SYMA 2NCPA 1K90D 1WRLA 1KFUS 2KI6C 3DVMA 5FI6A 4ETOA 1NUBA 2KI6D 4JKTA 5J3XA 1UUSA 1JF0A 2Y5IA 3SG2A 3PM8A 1UP5A 2FOTA 2M97A 2MAZA 1LS8A 1NPQA 1L7ZA 1V1FA 4C0KA 2JC2A 2BAPA 2MLFC 2WC8A 3M0WA 1C7VA 1RK9A 1DJZA 1PVAA 1RFJA 1OQPA 5CSFA 1QX2A 5G08A 2M3WA 2KLDA 3EG5B 3TS5C 3TZ1A 2RGIA 3WXAA 4AQJA 2M29A 4M2OA 5F6TA 2KYFA 2L4HA 4PE7A 1EH2A 2O60A 1DJYA 2PSRA 3JVTC 1EL4A 1H4BA 2F33A 1DELA 4PE0A 2WCJA 4N1FA 1KSMA 1IKUA 2Y1NA 4OZDA 1SCVA 2KLEA 2M8UA 3HX4A 1CLMA 2BBMA 4R1EA 3OB1B 3VRPA 1TUZA 3LK1A 2PVBA 3GK4X 3F45A 1ZUZA 2BNXA 1N65A 1CM1A 3BUXB 4YGAA 1TCFA 3IQOA 2BCXA 1A03A 2FCEA 1B1GA 3Q8IA 5KTYA 1PULA 1UHHA 2GTEA 5CPVA 4IJ7A 3CDNA 2KOTA 3IVTA 3GK2A 3R1OA 3EVVA 4YGBB 4ORCB 3TDUA 4QJ3B 4XJKB 3BOWA 3ICBA 3CZ2A 1NCZA 2WCBA 1YRTB 1MR8A 2JT8A 1NCYA 4MEWA 3NSKA 2R2IA 1M46A 2E30A 2OTGB 2JXLA 2M7NA 2PYQA 1OZSA 2KDHA 3D76A 2BCBA 1ALWA 3D10A 3SS4A 1J7PA 2M9GA 4GGFC 1KQVA 2VRGA 3O4YA 3EKHA 3LCPC 1CKKA 1UHKA 2LVJA 4JPZB 1K96A 1OMRA 2L5XB 2MRDA 4ZCUA 2G9BA 1DT7B 3BFHA 3EVRA 3AAKA 5AERA 1K94A 1U5IB 5CSIA 3R72A 1AUIB 1SKTA 1EXRA 4A4BA 1G4YR 1CFFA 2KI4B 1A75B 1DVIA 2KAXA 1KFUL 4PHNA 2EC6B 1AP4A 1B7TZ 1TNXA 3PM2A 4I5KA 2L2EA 4PALA 3S0DA 3VGOA 3DVKA 2M0RA 3O2PA 3TS5B 4OKHA 2CCMA 1EG4A 2I94A 4MLWA 1NYAA 1ALVA 2O5GA 1AHRA 1B4CA 1CFDA 2AUCA 3I5GB 1NWDA 1N2DA 1QVIY 1CDLA 2L5YA 3PATA 4Q04A 5KU1A 2HF5A 5I2LA 1JF2A 5CSJA 2M1UA 1A4PA 1LA3A 2WORA 2IS9A 3EK4A 2F8PA 1LVCD 1RWYA 2L2CA 4GGFA 2ISDA 1IQ3A 1SBJA 3LK0A 1S5GY 4GBAA 4GNKB 2MJWB 3AAJA 4M2PA 5HKYA 1SY9A 3D78A 1BT6A 2LHIA 1FI5A 5HLVA 3D74A 1BMOA 1YX8A 1DTLA 1CFCA 2K2FA 2JT3A 1D1OA 1CTRA 1DJWA 1DQEA 4DUQA 1KSOA 1Y1XA 3BQ3A 4A4CA 2H61C 1KWOB 2LP3A 1TCOB 3JTDC 2JPOA 4CLNA 1YURA 4JD9A 2CTNA 1WRZA 4P5OE 1Y1AA 2K61A 2P71A 3C1VA 5DKQA 3OB2B 3QMEA 2HQ8A 4PHJA 1W7JB 2KFGA 2OTGC 1C3YA 2ZN9A 3BFAA 2L0PA 1CM4A 1K2HA 3O4XA 4C0JA 1FI6A 2MHHA 2V53A 1TRFA 4KYNA 1E8AA 1BR1B 1M45A 4AOMA 2LVVA 1NX1A 1LA0A 1QX7A 3PJIA 5JOLA 3CABA 1TNPA 1M39A 3PN7B 1BR4B 1C3ZA 1QV0A 1WDCB 1YVLA 1Y0VH 2SCPA 5D7FA 1UWOA 1J1DA 3CZ0A 1QLKA 1QWVA 2JZIA 1DJGA 3GOFA 1QLSA 2WOSA 2K8MB 1LKJA 1DJXA 2KI4C 1S6JA 3CGAA 4CFRA 1F70A 1TWOA 2KBMA 2MA2A 5TNCA 4XYNA 1WRKA 5JJGA 1BOCA 2EC6C 2PRUA 2ZN8A 3EK7A 2M7LA 2AAOA 3KF9A 3QRXA 1IWQA 4YGDB 1J1EA 2ZNDA 1NX3A 1OOGA 1SL7A 2I7AA 2KQYA 2LAPA 4XJKA 1UURA 1WLMA 3N7HA 3I5GC 2JT0A 3DZTA 1P28A 5DKNA 1XFZO 2OPOA 1FW4A 3SS3A 2CXJA 3VRNA 1Q80A 1AJ5A 3NHIA 2L4IA 1ZMZA 1KK7Z 3NSIA 5AFPA 1WLZA 2LCPA 3FIAA 2LC5A 3D73A 3SG5A 4WQ2A 1WY9A 3KHEA 4U8DA 1Z4HA 1GM0A 3DF0B 3K1EA 4HREE 2M1KB 3B6XA 3BFBA 3OX5A 1CDNA 5DICA 4YGCB 4PE1A 1U5IA 2Q91A 2WCKA 1YUTA 2QACA 5AANA 1ZOTB 1XA5A 1KWOC 2KAVA 3JTDB 1NP8A 4GFTA 3VROA 1QATA 1SR6B 3L4AA 2JOJA 3CLNA 3DXLA 1ZFSA 3CYZA 2JQ6A 1GJYA 2LNKA 2F2OA 4WRIA 5CSNA 3I5HB 2EHBA 1CB1A 1EJ3A 4WQ3A 4CPVA 1K9UA 3A4UB 1R6PA 1B9AA 1TN4A 3CWGA 2OS8C 2GV5A 3S0EA 2H2KA 2WCHA 3PN7C 2FJYA 1WDCC 2QDIA 5AXIA 1FF1A 1B7TY 3CR5X 2BE6A 2TN4A 2D8NA 4YI8A 3R1PA 4PT1A 2BBNA 1KFXS 1OZOA 1QTXA 2LMUA 3SG7A 3OX6A 2ZKMX 3R1VA 1K93D 5BPJA 1ZACA 1HT9A 3NHTA 4F7FA 3RM1A 5HLOA 4GUKA 1PSBA 1TNQA 5FI2A 5I2OA 2BL0B 4GPLB 3WHUB 4HRHA 1LINA 2CT9A 2LE9B 4NDBA 1UHIA 2COLB 2K7CA 1GQMA 3GK1A 2ZFDA 4PCWA 2KSPA 5KSZA 1F8HA 1YTZC 2WCEA 1XYDA 3BUMB 4USLA 2LMTA 3SG3A 1XFVO 5ER4X 1DJIA 4N5XA 3WNXB 1CDMA 2M49B 4OR9B 1CNPA 2K2AA 3UNWA 2JWWA 3BOWB 3ZNIA 4AQIA 2LUXA 3I5FC 1T14A 1VRKA 2MLEC 1JWDA 3SG4A 1DEKA 1GGWA 1SSEB 1TNWA 2L50A 2WCLA 3RZSA 1B47A 5D69A 2I2RE 4PE4A 3VB1A 4BY5A 4CFQA 4HSZA 3NGVA 3NXAA 3OP0A 1IG5A 2GGMA 1J7OA 1XFWO 1SL9A 2L51A 1GGZA 2LP2A 2WCFA 2JRFA 2F3ZA 3D77A 3BUOB 5PALA 3V2LA 5I8NA 4NDCA 1BLQA 2PASA 1SR6C 4DIRA 1A2XA 1CDPA 3IQQA 1QIVA 1S6CA 1IGVA 3PSRA 1J55A 3EVUA 4N1GA 4NQGA 1MUXA 1QVIZ 1SCMB 3CR4X 3CS1A 4FQOA 4INWA 4CIDA 5B8IB 1AK8A 3PLFB 1DC1A 1C7WA 3O78A 4JWQA 2LM5A 4QJ5B 2KGRA 3I5HC 2BKHB 3FS7A 1N0YA 1SPYA 1PALA 2QEVA 3TDIA 2OS8B 1XVJA 2BKIB 1S5GZ 2HPSA 4MZJA 2H8VA 3CTNA 1K9KA 2CNPA 1MXEA 1YR5A 1OOJA 2A4JA 1JFJA 3PALA 1XFXO 1NIWA 3D0YB 1NX2A 3BYAA 1IQ5A 4OVNF 2CBLA 2JXCA 4UPGA 1RJVA 3DF0A 4PHMA 1YRUB 3TDZA 5I94A 1K8UA 1OW4A 3FWBA 3FWCA 1B8CA 1JSAA 2YGUA 3FE9A 4MRYA 2KQ6A 1QS7A 2LUCA 2Y4QA 2QEHA 1JC2A 1J7RA 1K95A 2FCDA 1KQMB 5AEQA 1RROA 2K0JA 5HKWA 1CFPA 1KFXL 1NCXA 2H61A 3DVEA 1JBAA 2K7DA 1TUJA 3KO0A 1KK7Y 1Y6WA 1DF0B 2K7BA 2KHNA 2BL0C 2QEOA 3DYEA 1BJFA 3KEVA 3PFVA 4MRXA 2BE4A 1FPWA 3B86A 3NSLA 2MBXA 5EL2A 1AVSA 2QEBA 1CMFA 2NZ0A 2SASA 2P6BB 2JULA 3SG6A 3AKAA 1QX5B 3B87A 1MQ1A 2K7OA 3KPXA 2GGZA 2KNEA 4OCIA 3L4LA 1ORGA 1F4OA 2KPHA 2EGDA 2LV7A 4YGEB 1YVHA 3I5FB 3OHMB 1A29A 3IF7A 4NDDA 1XFUO 1F71A 4P2YB 1KK8C 3TUYB 3WHTB 1IH0A 1JUOA 3VRRA 1XK4C 1OOHA 2JTZA 1IIOA 4YRUA 3S0AA 2NLNA 4PHKA 1PRWA 1Z2CB 4MSPA 5HL1A 3I5IB 2QPTA 2I18A 1C07A 3OBVA 1F54A 1A75A 1IJ5A 2WCMA 4TNCA 3VRQA 2KGBC 1SK6D 2JPTA 2LLUA 3SS5A 1M31A 3S0BA 3S0GA 2HETA 1PK0D 4MBEA 1QASA 1QJTA 1S36A 1PSRA 2F2PA 1SL8A 1UHJA 1OMVA 1SCMC 1SMGA 1AJ4A 1SRAA 2LANA 2LLTA 1L2OB 3DVJA 3L47A 5GQQC 2PALA 4D1EA 1FBVA 3HCMA 3BJHA 2KYCA 1NX0A 4GAOA 1OMDA 3LL8B 4GGNA 3B7AA 1YUUA 1F4QA 1IJ6A 1MXLC 1MF8B 1MHOA 3BUNB 3FE6A 4FTGA 1BG1A 1J7QA 1YUSA 4MZKA 1X02A 4I5LB 3ZWHA 1JFKA 4ORBB 2ERBA 3LLEA 2LVIA 1EG3A 1YX7A 2LLSA 4HRGA 2LHLA 2KFHA 4MN0A 4I5NB 1S3PA 5K89A 3OGNA 2B1UA 5DKRA 4BY4A 1M63B 1XK4A 2WNDA 4QJ4B 4M2QA 1PVBA 1SW8A 1KQMC 3B88A 2KBIA 1Y1UA 2P70A 2KAYA 1QIWA 4FQTA 1LXFC 5FYXA 3RLZA 4DS7A 1RECA 4JQ0D 2HQWA 1QXPA 4PDZA 1QV1A 1G33A 1K9PA 1R2UA 1NSHA 5D3OA 4ORAB 1S26D 2LVKA 1DMOA 1IRJA 1DGVA 1S6IA 3SIAA 2JNFA 3CZ1A 3DY9A 3NSOA 1XO5A 2NXQA 1S1EA 3AKBA 2WC5A 4INXA 2E6WA 3FE8A 3EKJA 3CZTX 2FJUB 1KK8B 5ER5A 2F3YA 1V1GA 4IL1A 4DRWA 3TUYC 1BODA 1CLLA 3S0FA 2ZRTA 2JU0A 3D0YA 2K60A 1OE9B 3JVTB 1XFRA 4OV2A 1CLBA 2BECA 3I5IC 3K21A 1F55A 1H8BA 1MWNA 1OOFA 3O6BA 4L9MA 1HQVA 4MVFA 3SJSA 1TOPA 3H4SE 1ODBA 3SIBA 2G2BA 4YI9A 1UHNA 1DJHA 1W7IB 4F0ZB 1DF0A 1RTP1 3MSEB 1B8LA 2LMVA 4ZCVA 5HKZA 1L2OC 3A8RA 2PQLA 1XFYO 4ICBA 2ZRSA 2JTTA 3BUWB 2ZNEA 3DD4A 4YBHB 5HYDA 1W9ZA 1OOIX 1TTXA 3CR2A 3D75A 2WC6A 5I2QA 1CMGA 1G8IA 1BF5A 1OSAA
chains in the Genus database with same CATH topology
2DOQA 2Y1MA 4I5JA 4C0LA 3E3RA 2L98A 1DGUA 2BCAA 2NCOA 2JNXA 3BXKA 1B8RA 2AMIA 3EK8A 4MZLA 1SNLA 1KCYA 1BU3A 2KFFA 4DCKA 5IBWA 2Q4UA 1TIZA 2PMYA 4E68A 1SYMA 2NCPA 1K90D 1WRLA 1KFUS 2KI6C 3DVMA 4ETOA 1NUBA 2KI6D 5J3XA 1UUSA 1JF0A 2Y5IA 3SG2A 3PM8A 1UP5A 2FOTA 2M97A 2MAZA 4C0KA 1NPQA 1L7ZA 1V1FA 2JC2A 2MLFC 2WC8A 3M0WA 1C7VA 1RK9A 1DJZA 1PVAA 1RFJA 1OQPA 5CSFA 1QX2A 5G08A 2M3WA 3WXAA 3TZ1A 3TS5C 2RGIA 4AQJA 2M29A 4M2OA 5F6TA 2KYFA 2L4HA 4PE7A 1EH2A 2O60A 1DJYA 2PSRA 3JVTC 1EL4A 1H4BA 2F33A 4PE0A 4N1FA 1KSMA 1IKUA 2Y1NA 1SCVA 2M8UA 3HX4A 1CLMA 2BBMA 4R1EA 3OB1B 3VRPA 3LK1A 2PVBA 3GK4X 3F45A 1ZUZA 1N65A 1CM1A 3BUXB 4YGAA 1TCFA 3IQOA 2BCXA 1A03A 2FCEA 1B1GA 5KTYA 1PULA 1UHHA 5CPVA 2KOTA 3GK2A 3EVVA 4YGBB 4ORCB 3TDUA 4QJ3B 4XJKB 3BOWA 3ICBA 1NCZA 2WCBA 1YRTB 1MR8A 2JT8A 1NCYA 4MEWA 3NSKA 2R2IA 1M46A 2E30A 2OTGB 2JXLA 2M7NA 1OZSA 2KDHA 2BCBA 1ALWA 3D10A 1J7PA 2M9GA 4GGFC 1KQVA 2VRGA 3O4YA 3EKHA 3LCPC 1CKKA 1UHKA 2LVJA 4JPZB 1K96A 1OMRA 2L5XB 2MRDA 4ZCUA 2G9BA 1DT7B 3EVRA 3AAKA 5AERA 1K94A 1U5IB 5CSIA 1AUIB 1SKTA 1EXRA 4A4BA 1G4YR 2KI4B 1A75B 1DVIA 2KAXA 1KFUL 4PHNA 2EC6B 1AP4A 1B7TZ 1TNXA 4I5KA 4PALA 2L2EA 3VGOA 3DVKA 2M0RA 3O2PA 3TS5B 4OKHA 2CCMA 1EG4A 2I94A 4MLWA 1NYAA 1ALVA 2O5GA 1AHRA 1B4CA 1CFDA 2AUCA 3I5GB 1NWDA 1N2DA 1QVIY 1CDLA 3PATA 4Q04A 5KU1A 1CFFA 2HF5A 5I2LA 1JF2A 5CSJA 2M1UA 1A4PA 1LA3A 2WORA 2IS9A 3EK4A 2F8PA 1LVCD 1RWYA 4GGFA 2ISDA 1IQ3A 1SBJA 3LK0A 1S5GY 4GBAA 4GNKB 2MJWB 3AAJA 4M2PA 5HKYA 1SY9A 1BT6A 2LHIA 1FI5A 5HLVA 1BMOA 1YX8A 1DTLA 1CFCA 2K2FA 2JT3A 1D1OA 1CTRA 1DJWA 4DUQA 1KSOA 1Y1XA 3BQ3A 4A4CA 2H61C 1KWOB 2LP3A 1TCOB 3JTDC 4CLNA 1YURA 2CTNA 1WRZA 4P5OE 1Y1AA 2K61A 3C1VA 5DKQA 3OB2B 2HQ8A 4PHJA 1W7JB 2KFGA 2OTGC 2ZN9A 2L0PA 1CM4A 1K2HA 4C0JA 1FI6A 2MHHA 2V53A 1TRFA 1E8AA 1BR1B 1M45A 4AOMA 2LVVA 1NX1A 1LA0A 1QX7A 5JOLA 1TNPA 1M39A 3PN7B 1BR4B 1QV0A 1YVLA 1WDCB 2SCPA 1Y0VH 5D7FA 1CLBA 1UWOA 1J1DA 1QLKA 2JZIA 1DJGA 3GOFA 1QLSA 2WOSA 2K8MB 1LKJA 1DJXA 2KI4C 1S6JA 3CGAA 4CFRA 1F70A 2KBMA 2MA2A 5TNCA 4XYNA 1WRKA 5JJGA 1BOCA 2EC6C 2PRUA 2ZN8A 3EK7A 2M7LA 2AAOA 3KF9A 3QRXA 1IWQA 4YGDB 1J1EA 2ZNDA 1NX3A 1SL7A 2I7AA 2KQYA 2LAPA 4XJKA 1UURA 1WLMA 3I5GC 2JT0A 5DKNA 1XFZO 2OPOA 1FW4A 2CXJA 3VRNA 1Q80A 1AJ5A 2L4IA 1ZMZA 1KK7Z 3NSIA 5AFPA 1WLZA 2LCPA 3FIAA 2LC5A 3SG5A 4WQ2A 1WY9A 3KHEA 4U8DA 3DF0B 4HREE 2M1KB 3OX5A 1CDNA 4YGCB 4PE1A 1U5IA 2Q91A 1YUTA 2QACA 5AANA 1ZOTB 1XA5A 1KWOC 2KAVA 3JTDB 1NP8A 4GFTA 3VROA 1QATA 1SR6B 2JOJA 3CLNA 1ZFSA 2JQ6A 1GJYA 2LNKA 2F2OA 4WRIA 5CSNA 3I5HB 2EHBA 1CB1A 1EJ3A 4WQ3A 4CPVA 1K9UA 3A4UB 1R6PA 1B9AA 1TN4A 3CWGA 2OS8C 2GV5A 2H2KA 3PN7C 1WDCC 5AXIA 1FF1A 1B7TY 3CR5X 2BE6A 2TN4A 2D8NA 4YI8A 2BBNA 1KFXS 1OZOA 1QTXA 2LMUA 3SG7A 3OX6A 2ZKMX 1K93D 5BPJA 1ZACA 1HT9A 3RM1A 5HLOA 4GUKA 1PSBA 1TNQA 5I2OA 2BL0B 4GPLB 3WHUB 4HRHA 1LINA 2CT9A 2LE9B 4NDBA 1UHIA 2COLB 2K7CA 1GQMA 3GK1A 2ZFDA 4PCWA 2KSPA 5KSZA 1F8HA 1YTZC 2WCEA 1XYDA 3BUMB 4USLA 2LMTA 3SG3A 1XFVO 5ER4X 1DJIA 4N5XA 3WNXB 1CDMA 2M49B 4OR9B 1CNPA 2K2AA 2JWWA 3BOWB 3ZNIA 4AQIA 2LUXA 3I5FC 1VRKA 2MLEC 1JWDA 3SG4A 1GGWA 1TNWA 2L50A 1B47A 5D69A 2I2RE 4PE4A 4BY5A 4CFQA 4HSZA 3OP0A 3NXAA 1IG5A 2GGMA 1J7OA 1XFWO 1SL9A 2L51A 1GGZA 2LP2A 2WCFA 2JRFA 2F3ZA 5PALA 3BUOB 5I8NA 4NDCA 1BLQA 2PASA 1SR6C 4DIRA 1A2XA 1CDPA 3IQQA 1QIVA 1S6CA 1IGVA 3PSRA 1J55A 3EVUA 4N1GA 4NQGA 1MUXA 1QVIZ 1SCMB 3CR4X 3CS1A 4FQOA 4CIDA 5B8IB 1AK8A 3PLFB 1C7WA 3O78A 4JWQA 2LM5A 4QJ5B 2KGRA 3I5HC 2BKHB 3FS7A 1N0YA 1SPYA 1PALA 3TDIA 2OS8B 1XVJA 2BKIB 1S5GZ 2HPSA 3CTNA 1K9KA 2CNPA 1MXEA 1YR5A 1OOJA 2A4JA 1JFJA 3PALA 1XFXO 1NIWA 3D0YB 1NX2A 3BYAA 1IQ5A 4OVNF 2CBLA 2JXCA 4UPGA 1RJVA 3DF0A 4PHMA 1YRUB 3TDZA 1K8UA 3FWBA 3FWCA 1JSAA 1B8CA 4MRYA 2KQ6A 1QS7A 2LUCA 2Y4QA 1JC2A 1J7RA 1K95A 2FCDA 1KQMB 5AEQA 1RROA 2K0JA 5HKWA 1CFPA 1KFXL 1NCXA 2H61A 3DVEA 1JBAA 2K7DA 3KO0A 1KK7Y 1Y6WA 1DF0B 2K7BA 2KHNA 2BL0C 3KEVA 3PFVA 1BJFA 4MZJA 4MRXA 4ORBB 2BE4A 1FPWA 3NSLA 2MBXA 1AVSA 1CMFA 2NZ0A 2SASA 2P6BB 2JULA 3SG6A 3AKAA 1QX5B 1MQ1A 2K7OA 3KPXA 2GGZA 2KNEA 4OCIA 1F4OA 2EGDA 2LV7A 4YGEB 1YVHA 3I5FB 3OHMB 1A29A 3IF7A 4NDDA 1XFUO 1F71A 4P2YB 1KK8C 3TUYB 3WHTB 1IH0A 1JUOA 3VRRA 1XK4C 2JTZA 4YRUA 2NLNA 4PHKA 1PRWA 4MSPA 3I5IB 2QPTA 2I18A 1C07A 1F54A 1A75A 1IJ5A 4TNCA 3VRQA 2KGBC 1SK6D 2JPTA 2LLUA 1M31A 2HETA 1PK0D 4MBEA 1QASA 1QJTA 1S36A 1PSRA 2F2PA 1SL8A 1UHJA 1OMVA 1SCMC 1SMGA 1AJ4A 1SRAA 2LANA 2LLTA 1L2OB 3DVJA 5GQQC 4D1EA 2PALA 1FBVA 3HCMA 2KYCA 1NX0A 4GAOA 1OMDA 3LL8B 4GGNA 1YUUA 1F4QA 1IJ6A 1MXLC 1MF8B 1MHOA 3BUNB 4FTGA 1BG1A 1J7QA 1YUSA 4MZKA 1X02A 4I5LB 3ZWHA 1JFKA 3LLEA 2LVIA 1EG3A 1YX7A 2LLSA 4HRGA 2LHLA 2KFHA 4MN0A 4I5NB 1S3PA 5K89A 2B1UA 5DKRA 4BY4A 1M63B 1XK4A 2WNDA 4QJ4B 4M2QA 1PVBA 1SW8A 1KQMC 2KBIA 1Y1UA 2KAYA 1QIWA 5FYXA 1LXFC 3RLZA 4DS7A 1RECA 4JQ0D 2HQWA 1QXPA 4PDZA 1QV1A 1G33A 1K9PA 1R2UA 1NSHA 4ORAB 1S26D 2LVKA 1DMOA 1IRJA 1DGVA 1S6IA 3SIAA 2JNFA 3NSOA 1XO5A 2NXQA 1S1EA 3AKBA 2E6WA 3EKJA 3CZTX 2FJUB 1KK8B 5ER5A 2F3YA 1V1GA 4IL1A 4DRWA 3TUYC 1BODA 1CLLA 2ZRTA 2JU0A 3D0YA 1OE9B 3JVTB 4OV2A 2BECA 3I5IC 3K21A 1F55A 1H8BA 1MWNA 3O6BA 4L9MA 1HQVA 4MVFA 3SJSA 1TOPA 3H4SE 1ODBA 3SIBA 2G2BA 4YI9A 1UHNA 1DJHA 1W7IB 4F0ZB 1DF0A 1RTP1 3MSEB 1B8LA 2LMVA 4ZCVA 5HKZA 1L2OC 3A8RA 4ICBA 1XFYO 2ZRSA 2JTTA 3BUWB 2ZNEA 3DD4A 4YBHB 5HYDA 1TTXA 3CR2A 5I2QA 1CMGA 1G8IA 1BF5A 1OSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOQ A;  2Y1M A;  4I5J A;  4C0L A;  3E3R A;  2L98 A;  1DGU A;  2BCA A;  2NCO A;  2JNX A;  3BXK A;  1B8R A;  2AMI A;  3EK8 A;  4MZL A;  1SNL A;  1KCY A;  1BU3 A;  2KFF A;  4DCK A;  5IBW A;  2Q4U A;  1TIZ A;  2PMY A;  4E68 A;  1SYM A;  2NCP A;  1K90 D;  1WRL A;  1KFU S;  2KI6 C;  3DVM A;  4ETO A;  1NUB A;  2KI6 D;  5J3X A;  1UUS A;  1JF0 A;  2Y5I A;  3SG2 A;  3PM8 A;  1UP5 A;  2FOT A;  2M97 A;  2MAZ A;  4C0K A;  1NPQ A;  1L7Z A;  1V1F A;  2JC2 A;  2MLF C;  2WC8 A;  3M0W A;  1C7V A;  1RK9 A;  1DJZ A;  1PVA A;  1RFJ A;  1OQP A;  5CSF A;  1QX2 A;  5G08 A;  2M3W A;  3WXA A;  3TZ1 A;  3TS5 C;  2RGI A;  4AQJ A;  2M29 A;  4M2O A;  5F6T A;  2KYF A;  2L4H A;  4PE7 A;  1EH2 A;  2O60 A;  1DJY A;  2PSR A;  3JVT C;  1EL4 A;  1H4B A;  2F33 A;  4PE0 A;  4N1F A;  1KSM A;  1IKU A;  2Y1N A;  1SCV A;  2M8U A;  3HX4 A;  1CLM A;  2BBM A;  4R1E A;  3OB1 B;  3VRP A;  3LK1 A;  2PVB A;  3GK4 X;  3F45 A;  1ZUZ A;  1N65 A;  1CM1 A;  3BUX B;  4YGA A;  1TCF A;  3IQO A;  2BCX A;  1A03 A;  2FCE A;  1B1G A;  5KTY A;  1PUL A;  1UHH A;  5CPV A;  2KOT A;  3GK2 A;  3EVV A;  4YGB B;  4ORC B;  3TDU A;  4QJ3 B;  4XJK B;  3BOW A;  3ICB A;  1NCZ A;  2WCB A;  1YRT B;  1MR8 A;  2JT8 A;  1NCY A;  4MEW A;  3NSK A;  2R2I A;  1M46 A;  2E30 A;  2OTG B;  2JXL A;  2M7N A;  1OZS A;  2KDH A;  2BCB A;  1ALW A;  3D10 A;  1J7P A;  2M9G A;  4GGF C;  1KQV A;  2VRG A;  3O4Y A;  3EKH A;  3LCP C;  1CKK A;  1UHK A;  2LVJ A;  4JPZ B;  1K96 A;  1OMR A;  2L5X B;  2MRD A;  4ZCU A;  2G9B A;  1DT7 B;  3EVR A;  3AAK A;  5AER A;  1K94 A;  1U5I B;  5CSI A;  1AUI B;  1SKT A;  1EXR A;  4A4B A;  1G4Y R;  2KI4 B;  1A75 B;  1DVI A;  2KAX A;  1KFU L;  4PHN A;  2EC6 B;  1AP4 A;  1B7T Z;  1TNX A;  4I5K A;  4PAL A;  2L2E A;  3VGO A;  3DVK A;  2M0R A;  3O2P A;  3TS5 B;  4OKH A;  2CCM A;  1EG4 A;  2I94 A;  4MLW A;  1NYA A;  1ALV A;  2O5G A;  1AHR A;  1B4C A;  1CFD A;  2AUC A;  3I5G B;  1NWD A;  1N2D A;  1QVI Y;  1CDL A;  3PAT A;  4Q04 A;  5KU1 A;  1CFF A;  2HF5 A;  5I2L A;  1JF2 A;  5CSJ A;  2M1U A;  1A4P A;  1LA3 A;  2WOR A;  2IS9 A;  3EK4 A;  2F8P A;  1LVC D;  1RWY A;  4GGF A;  2ISD A;  1IQ3 A;  1SBJ A;  3LK0 A;  1S5G Y;  4GBA A;  4GNK B;  2MJW B;  3AAJ A;  4M2P A;  5HKY A;  1SY9 A;  1BT6 A;  2LHI A;  1FI5 A;  5HLV A;  1BMO A;  1YX8 A;  1DTL A;  1CFC A;  2K2F A;  2JT3 A;  1D1O A;  1CTR A;  1DJW A;  4DUQ A;  1KSO A;  1Y1X A;  3BQ3 A;  4A4C A;  2H61 C;  1KWO B;  2LP3 A;  1TCO B;  3JTD C;  4CLN A;  1YUR A;  2CTN A;  1WRZ A;  4P5O E;  1Y1A A;  2K61 A;  3C1V A;  5DKQ A;  3OB2 B;  2HQ8 A;  4PHJ A;  1W7J B;  2KFG A;  2OTG C;  2ZN9 A;  2L0P A;  1CM4 A;  1K2H A;  4C0J A;  1FI6 A;  2MHH A;  2V53 A;  1TRF A;  1E8A A;  1BR1 B;  1M45 A;  4AOM A;  2LVV A;  1NX1 A;  1LA0 A;  1QX7 A;  5JOL A;  1TNP A;  1M39 A;  3PN7 B;  1BR4 B;  1QV0 A;  1YVL A;  1WDC B;  2SCP A;  1Y0V H;  5D7F A;  1CLB A;  1UWO A;  1J1D A;  1QLK A;  2JZI A;  1DJG A;  3GOF A;  1QLS A;  2WOS A;  2K8M B;  1LKJ A;  1DJX A;  2KI4 C;  1S6J A;  3CGA A;  4CFR A;  1F70 A;  2KBM A;  2MA2 A;  5TNC A;  4XYN A;  1WRK A;  5JJG A;  1BOC A;  2EC6 C;  2PRU A;  2ZN8 A;  3EK7 A;  2M7L A;  2AAO A;  3KF9 A;  3QRX A;  1IWQ A;  4YGD B;  1J1E A;  2ZND A;  1NX3 A;  1SL7 A;  2I7A A;  2KQY A;  2LAP A;  4XJK A;  1UUR A;  1WLM A;  3I5G C;  2JT0 A;  5DKN A;  1XFZ O;  2OPO A;  1FW4 A;  2CXJ A;  3VRN A;  1Q80 A;  1AJ5 A;  2L4I A;  1ZMZ A;  1KK7 Z;  3NSI A;  5AFP A;  1WLZ A;  2LCP A;  3FIA A;  2LC5 A;  3SG5 A;  4WQ2 A;  1WY9 A;  3KHE A;  4U8D A;  3DF0 B;  4HRE E;  2M1K B;  3OX5 A;  1CDN A;  4YGC B;  4PE1 A;  1U5I A;  2Q91 A;  1YUT A;  2QAC A;  5AAN A;  1ZOT B;  1XA5 A;  1KWO C;  2KAV A;  3JTD B;  1NP8 A;  4GFT A;  3VRO A;  1QAT A;  1SR6 B;  2JOJ A;  3CLN A;  1ZFS A;  2JQ6 A;  1GJY A;  2LNK A;  2F2O A;  4WRI A;  5CSN A;  3I5H B;  2EHB A;  1CB1 A;  1EJ3 A;  4WQ3 A;  4CPV A;  1K9U A;  3A4U B;  1R6P A;  1B9A A;  1TN4 A;  3CWG A;  2OS8 C;  2GV5 A;  2H2K A;  3PN7 C;  1WDC C;  5AXI A;  1FF1 A;  1B7T Y;  3CR5 X;  2BE6 A;  2TN4 A;  2D8N A;  4YI8 A;  2BBN A;  1KFX S;  1OZO A;  1QTX A;  2LMU A;  3SG7 A;  3OX6 A;  2ZKM X;  1K93 D;  5BPJ A;  1ZAC A;  1HT9 A;  3RM1 A;  5HLO A;  4GUK A;  1PSB A;  1TNQ A;  5I2O A;  2BL0 B;  4GPL B;  3WHU B;  4HRH A;  1LIN A;  2CT9 A;  2LE9 B;  4NDB A;  1UHI A;  2COL B;  2K7C A;  1GQM A;  3GK1 A;  2ZFD A;  4PCW A;  2KSP A;  5KSZ A;  1F8H A;  1YTZ C;  2WCE A;  1XYD A;  3BUM B;  4USL A;  2LMT A;  3SG3 A;  1XFV O;  5ER4 X;  1DJI A;  4N5X A;  3WNX B;  1CDM A;  2M49 B;  4OR9 B;  1CNP A;  2K2A A;  2JWW A;  3BOW B;  3ZNI A;  4AQI A;  2LUX A;  3I5F C;  1VRK A;  2MLE C;  1JWD A;  3SG4 A;  1GGW A;  1TNW A;  2L50 A;  1B47 A;  5D69 A;  2I2R E;  4PE4 A;  4BY5 A;  4CFQ A;  4HSZ A;  3OP0 A;  3NXA A;  1IG5 A;  2GGM A;  1J7O A;  1XFW O;  1SL9 A;  2L51 A;  1GGZ A;  2LP2 A;  2WCF A;  2JRF A;  2F3Z A;  5PAL A;  3BUO B;  5I8N A;  4NDC A;  1BLQ A;  2PAS A;  1SR6 C;  4DIR A;  1A2X A;  1CDP A;  3IQQ A;  1QIV A;  1S6C A;  1IGV A;  3PSR A;  1J55 A;  3EVU A;  4N1G A;  4NQG A;  1MUX A;  1QVI Z;  1SCM B;  3CR4 X;  3CS1 A;  4FQO A;  4CID A;  5B8I B;  1AK8 A;  3PLF B;  1C7W A;  3O78 A;  4JWQ A;  2LM5 A;  4QJ5 B;  2KGR A;  3I5H C;  2BKH B;  3FS7 A;  1N0Y A;  1SPY A;  1PAL A;  3TDI A;  2OS8 B;  1XVJ A;  2BKI B;  1S5G Z;  2HPS A;  3CTN A;  1K9K A;  2CNP A;  1MXE A;  1YR5 A;  1OOJ A;  2A4J A;  1JFJ A;  3PAL A;  1XFX O;  1NIW A;  3D0Y B;  1NX2 A;  3BYA A;  1IQ5 A;  4OVN F;  2CBL A;  2JXC A;  4UPG A;  1RJV A;  3DF0 A;  4PHM A;  1YRU B;  3TDZ A;  1K8U A;  3FWB A;  3FWC A;  1JSA A;  1B8C A;  4MRY A;  2KQ6 A;  1QS7 A;  2LUC A;  2Y4Q A;  1JC2 A;  1J7R A;  1K95 A;  2FCD A;  1KQM B;  5AEQ A;  1RRO A;  2K0J A;  5HKW A;  1CFP A;  1KFX L;  1NCX A;  2H61 A;  3DVE A;  1JBA A;  2K7D A;  3KO0 A;  1KK7 Y;  1Y6W A;  1DF0 B;  2K7B A;  2KHN A;  2BL0 C;  3KEV A;  3PFV A;  1BJF A;  4MZJ A;  4MRX A;  4ORB B;  2BE4 A;  1FPW A;  3NSL A;  2MBX A;  1AVS A;  1CMF A;  2NZ0 A;  2SAS A;  2P6B B;  2JUL A;  3SG6 A;  3AKA A;  1QX5 B;  1MQ1 A;  2K7O A;  3KPX A;  2GGZ A;  2KNE A;  4OCI A;  1F4O A;  2EGD A;  2LV7 A;  4YGE B;  1YVH A;  3I5F B;  3OHM B;  1A29 A;  3IF7 A;  4NDD A;  1XFU O;  1F71 A;  4P2Y B;  1KK8 C;  3TUY B;  3WHT B;  1IH0 A;  1JUO A;  3VRR A;  1XK4 C;  2JTZ A;  4YRU A;  2NLN A;  4PHK A;  1PRW A;  4MSP A;  3I5I B;  2QPT A;  2I18 A;  1C07 A;  1F54 A;  1A75 A;  1IJ5 A;  4TNC A;  3VRQ A;  2KGB C;  1SK6 D;  2JPT A;  2LLU A;  1M31 A;  2HET A;  1PK0 D;  4MBE A;  1QAS A;  1QJT A;  1S36 A;  1PSR A;  2F2P A;  1SL8 A;  1UHJ A;  1OMV A;  1SCM C;  1SMG A;  1AJ4 A;  1SRA A;  2LAN A;  2LLT A;  1L2O B;  3DVJ A;  5GQQ C;  4D1E A;  2PAL A;  1FBV A;  3HCM A;  2KYC A;  1NX0 A;  4GAO A;  1OMD A;  3LL8 B;  4GGN A;  1YUU A;  1F4Q A;  1IJ6 A;  1MXL C;  1MF8 B;  1MHO A;  3BUN B;  4FTG A;  1BG1 A;  1J7Q A;  1YUS A;  4MZK A;  1X02 A;  4I5L B;  3ZWH A;  1JFK A;  3LLE A;  2LVI A;  1EG3 A;  1YX7 A;  2LLS A;  4HRG A;  2LHL A;  2KFH A;  4MN0 A;  4I5N B;  1S3P A;  5K89 A;  2B1U A;  5DKR A;  4BY4 A;  1M63 B;  1XK4 A;  2WND A;  4QJ4 B;  4M2Q A;  1PVB A;  1SW8 A;  1KQM C;  2KBI A;  1Y1U A;  2KAY A;  1QIW A;  5FYX A;  1LXF C;  3RLZ A;  4DS7 A;  1REC A;  4JQ0 D;  2HQW A;  1QXP A;  4PDZ A;  1QV1 A;  1G33 A;  1K9P A;  1R2U A;  1NSH A;  4ORA B;  1S26 D;  2LVK A;  1DMO A;  1IRJ A;  1DGV A;  1S6I A;  3SIA A;  2JNF A;  3NSO A;  1XO5 A;  2NXQ A;  1S1E A;  3AKB A;  2E6W A;  3EKJ A;  3CZT X;  2FJU B;  1KK8 B;  5ER5 A;  2F3Y A;  1V1G A;  4IL1 A;  4DRW A;  3TUY C;  1BOD A;  1CLL A;  2ZRT A;  2JU0 A;  3D0Y A;  1OE9 B;  3JVT B;  4OV2 A;  2BEC A;  3I5I C;  3K21 A;  1F55 A;  1H8B A;  1MWN A;  3O6B A;  4L9M A;  1HQV A;  4MVF A;  3SJS A;  1TOP A;  3H4S E;  1ODB A;  3SIB A;  2G2B A;  4YI9 A;  1UHN A;  1DJH A;  1W7I B;  4F0Z B;  1DF0 A;  1RTP 1;  3MSE B;  1B8L A;  2LMV A;  4ZCV A;  5HKZ A;  1L2O C;  3A8R A;  4ICB A;  1XFY O;  2ZRS A;  2JTT A;  3BUW B;  2ZNE A;  3DD4 A;  4YBH B;  5HYD A;  1TTX A;  3CR2 A;  5I2Q A;  1CMG A;  1G8I A;  1BF5 A;  1OSA A; 
#chains in the Genus database with same CATH topology
 2DOQ A;  2Y1M A;  4I5J A;  4C0L A;  3E3R A;  2L98 A;  1DGU A;  2BCA A;  2NCO A;  2JNX A;  3BXK A;  3UO9 A;  1B8R A;  2AMI A;  3EK8 A;  5FI7 A;  4MZL A;  1SNL A;  1KCY A;  1BU3 A;  2KFF A;  4DCK A;  5IBW A;  2Q4U A;  1TIZ A;  2PMY A;  4E68 A;  1SYM A;  2NCP A;  1K90 D;  1WRL A;  1KFU S;  2KI6 C;  3DVM A;  5FI6 A;  4ETO A;  1NUB A;  2KI6 D;  4JKT A;  5J3X A;  1UUS A;  1JF0 A;  2Y5I A;  3SG2 A;  3PM8 A;  1UP5 A;  2FOT A;  2M97 A;  2MAZ A;  1LS8 A;  1NPQ A;  1L7Z A;  1V1F A;  4C0K A;  2JC2 A;  2BAP A;  2MLF C;  2WC8 A;  3M0W A;  1C7V A;  1RK9 A;  1DJZ A;  1PVA A;  1RFJ A;  1OQP A;  5CSF A;  1QX2 A;  5G08 A;  2M3W A;  2KLD A;  3EG5 B;  3TS5 C;  3TZ1 A;  2RGI A;  3WXA A;  4AQJ A;  2M29 A;  4M2O A;  5F6T A;  2KYF A;  2L4H A;  4PE7 A;  1EH2 A;  2O60 A;  1DJY A;  2PSR A;  3JVT C;  1EL4 A;  1H4B A;  2F33 A;  1DEL A;  4PE0 A;  2WCJ A;  4N1F A;  1KSM A;  1IKU A;  2Y1N A;  4OZD A;  1SCV A;  2KLE A;  2M8U A;  3HX4 A;  1CLM A;  2BBM A;  4R1E A;  3OB1 B;  3VRP A;  1TUZ A;  3LK1 A;  2PVB A;  3GK4 X;  3F45 A;  1ZUZ A;  2BNX A;  1N65 A;  1CM1 A;  3BUX B;  4YGA A;  1TCF A;  3IQO A;  2BCX A;  1A03 A;  2FCE A;  1B1G A;  3Q8I A;  5KTY A;  1PUL A;  1UHH A;  2GTE A;  5CPV A;  4IJ7 A;  3CDN A;  2KOT A;  3IVT A;  3GK2 A;  3R1O A;  3EVV A;  4YGB B;  4ORC B;  3TDU A;  4QJ3 B;  4XJK B;  3BOW A;  3ICB A;  3CZ2 A;  1NCZ A;  2WCB A;  1YRT B;  1MR8 A;  2JT8 A;  1NCY A;  4MEW A;  3NSK A;  2R2I A;  1M46 A;  2E30 A;  2OTG B;  2JXL A;  2M7N A;  2PYQ A;  1OZS A;  2KDH A;  3D76 A;  2BCB A;  1ALW A;  3D10 A;  3SS4 A;  1J7P A;  2M9G A;  4GGF C;  1KQV A;  2VRG A;  3O4Y A;  3EKH A;  3LCP C;  1CKK A;  1UHK A;  2LVJ A;  4JPZ B;  1K96 A;  1OMR A;  2L5X B;  2MRD A;  4ZCU A;  2G9B A;  1DT7 B;  3BFH A;  3EVR A;  3AAK A;  5AER A;  1K94 A;  1U5I B;  5CSI A;  3R72 A;  1AUI B;  1SKT A;  1EXR A;  4A4B A;  1G4Y R;  1CFF A;  2KI4 B;  1A75 B;  1DVI A;  2KAX A;  1KFU L;  4PHN A;  2EC6 B;  1AP4 A;  1B7T Z;  1TNX A;  3PM2 A;  4I5K A;  2L2E A;  4PAL A;  3S0D A;  3VGO A;  3DVK A;  2M0R A;  3O2P A;  3TS5 B;  4OKH A;  2CCM A;  1EG4 A;  2I94 A;  4MLW A;  1NYA A;  1ALV A;  2O5G A;  1AHR A;  1B4C A;  1CFD A;  2AUC A;  3I5G B;  1NWD A;  1N2D A;  1QVI Y;  1CDL A;  2L5Y A;  3PAT A;  4Q04 A;  5KU1 A;  2HF5 A;  5I2L A;  1JF2 A;  5CSJ A;  2M1U A;  1A4P A;  1LA3 A;  2WOR A;  2IS9 A;  3EK4 A;  2F8P A;  1LVC D;  1RWY A;  2L2C A;  4GGF A;  2ISD A;  1IQ3 A;  1SBJ A;  3LK0 A;  1S5G Y;  4GBA A;  4GNK B;  2MJW B;  3AAJ A;  4M2P A;  5HKY A;  1SY9 A;  3D78 A;  1BT6 A;  2LHI A;  1FI5 A;  5HLV A;  3D74 A;  1BMO A;  1YX8 A;  1DTL A;  1CFC A;  2K2F A;  2JT3 A;  1D1O A;  1CTR A;  1DJW A;  1DQE A;  4DUQ A;  1KSO A;  1Y1X A;  3BQ3 A;  4A4C A;  2H61 C;  1KWO B;  2LP3 A;  1TCO B;  3JTD C;  2JPO A;  4CLN A;  1YUR A;  4JD9 A;  2CTN A;  1WRZ A;  4P5O E;  1Y1A A;  2K61 A;  2P71 A;  3C1V A;  5DKQ A;  3OB2 B;  3QME A;  2HQ8 A;  4PHJ A;  1W7J B;  2KFG A;  2OTG C;  1C3Y A;  2ZN9 A;  3BFA A;  2L0P A;  1CM4 A;  1K2H A;  3O4X A;  4C0J A;  1FI6 A;  2MHH A;  2V53 A;  1TRF A;  4KYN A;  1E8A A;  1BR1 B;  1M45 A;  4AOM A;  2LVV A;  1NX1 A;  1LA0 A;  1QX7 A;  3PJI A;  5JOL A;  3CAB A;  1TNP A;  1M39 A;  3PN7 B;  1BR4 B;  1C3Z A;  1QV0 A;  1WDC B;  1YVL A;  1Y0V H;  2SCP A;  5D7F A;  1UWO A;  1J1D A;  3CZ0 A;  1QLK A;  1QWV A;  2JZI A;  1DJG A;  3GOF A;  1QLS A;  2WOS A;  2K8M B;  1LKJ A;  1DJX A;  2KI4 C;  1S6J A;  3CGA A;  4CFR A;  1F70 A;  1TWO A;  2KBM A;  2MA2 A;  5TNC A;  4XYN A;  1WRK A;  5JJG A;  1BOC A;  2EC6 C;  2PRU A;  2ZN8 A;  3EK7 A;  2M7L A;  2AAO A;  3KF9 A;  3QRX A;  1IWQ A;  4YGD B;  1J1E A;  2ZND A;  1NX3 A;  1OOG A;  1SL7 A;  2I7A A;  2KQY A;  2LAP A;  4XJK A;  1UUR A;  1WLM A;  3N7H A;  3I5G C;  2JT0 A;  3DZT A;  1P28 A;  5DKN A;  1XFZ O;  2OPO A;  1FW4 A;  3SS3 A;  2CXJ A;  3VRN A;  1Q80 A;  1AJ5 A;  3NHI A;  2L4I A;  1ZMZ A;  1KK7 Z;  3NSI A;  5AFP A;  1WLZ A;  2LCP A;  3FIA A;  2LC5 A;  3D73 A;  3SG5 A;  4WQ2 A;  1WY9 A;  3KHE A;  4U8D A;  1Z4H A;  1GM0 A;  3DF0 B;  3K1E A;  4HRE E;  2M1K B;  3B6X A;  3BFB A;  3OX5 A;  1CDN A;  5DIC A;  4YGC B;  4PE1 A;  1U5I A;  2Q91 A;  2WCK A;  1YUT A;  2QAC A;  5AAN A;  1ZOT B;  1XA5 A;  1KWO C;  2KAV A;  3JTD B;  1NP8 A;  4GFT A;  3VRO A;  1QAT A;  1SR6 B;  3L4A A;  2JOJ A;  3CLN A;  3DXL A;  1ZFS A;  3CYZ A;  2JQ6 A;  1GJY A;  2LNK A;  2F2O A;  4WRI A;  5CSN A;  3I5H B;  2EHB A;  1CB1 A;  1EJ3 A;  4WQ3 A;  4CPV A;  1K9U A;  3A4U B;  1R6P A;  1B9A A;  1TN4 A;  3CWG A;  2OS8 C;  2GV5 A;  3S0E A;  2H2K A;  2WCH A;  3PN7 C;  2FJY A;  1WDC C;  2QDI A;  5AXI A;  1FF1 A;  1B7T Y;  3CR5 X;  2BE6 A;  2TN4 A;  2D8N A;  4YI8 A;  3R1P A;  4PT1 A;  2BBN A;  1KFX S;  1OZO A;  1QTX A;  2LMU A;  3SG7 A;  3OX6 A;  2ZKM X;  3R1V A;  1K93 D;  5BPJ A;  1ZAC A;  1HT9 A;  3NHT A;  4F7F A;  3RM1 A;  5HLO A;  4GUK A;  1PSB A;  1TNQ A;  5FI2 A;  5I2O A;  2BL0 B;  4GPL B;  3WHU B;  4HRH A;  1LIN A;  2CT9 A;  2LE9 B;  4NDB A;  1UHI A;  2COL B;  2K7C A;  1GQM A;  3GK1 A;  2ZFD A;  4PCW A;  2KSP A;  5KSZ A;  1F8H A;  1YTZ C;  2WCE A;  1XYD A;  3BUM B;  4USL A;  2LMT A;  3SG3 A;  1XFV O;  5ER4 X;  1DJI A;  4N5X A;  3WNX B;  1CDM A;  2M49 B;  4OR9 B;  1CNP A;  2K2A A;  3UNW A;  2JWW A;  3BOW B;  3ZNI A;  4AQI A;  2LUX A;  3I5F C;  1T14 A;  1VRK A;  2MLE C;  1JWD A;  3SG4 A;  1DEK A;  1GGW A;  1SSE B;  1TNW A;  2L50 A;  2WCL A;  3RZS A;  1B47 A;  5D69 A;  2I2R E;  4PE4 A;  3VB1 A;  4BY5 A;  4CFQ A;  4HSZ A;  3NGV A;  3NXA A;  3OP0 A;  1IG5 A;  2GGM A;  1J7O A;  1XFW O;  1SL9 A;  2L51 A;  1GGZ A;  2LP2 A;  2WCF A;  2JRF A;  2F3Z A;  3D77 A;  3BUO B;  5PAL A;  3V2L A;  5I8N A;  4NDC A;  1BLQ A;  2PAS A;  1SR6 C;  4DIR A;  1A2X A;  1CDP A;  3IQQ A;  1QIV A;  1S6C A;  1IGV A;  3PSR A;  1J55 A;  3EVU A;  4N1G A;  4NQG A;  1MUX A;  1QVI Z;  1SCM B;  3CR4 X;  3CS1 A;  4FQO A;  4INW A;  4CID A;  5B8I B;  1AK8 A;  3PLF B;  1DC1 A;  1C7W A;  3O78 A;  4JWQ A;  2LM5 A;  4QJ5 B;  2KGR A;  3I5H C;  2BKH B;  3FS7 A;  1N0Y A;  1SPY A;  1PAL A;  2QEV A;  3TDI A;  2OS8 B;  1XVJ A;  2BKI B;  1S5G Z;  2HPS A;  4MZJ A;  2H8V A;  3CTN A;  1K9K A;  2CNP A;  1MXE A;  1YR5 A;  1OOJ A;  2A4J A;  1JFJ A;  3PAL A;  1XFX O;  1NIW A;  3D0Y B;  1NX2 A;  3BYA A;  1IQ5 A;  4OVN F;  2CBL A;  2JXC A;  4UPG A;  1RJV A;  3DF0 A;  4PHM A;  1YRU B;  3TDZ A;  5I94 A;  1K8U A;  1OW4 A;  3FWB A;  3FWC A;  1B8C A;  1JSA A;  2YGU A;  3FE9 A;  4MRY A;  2KQ6 A;  1QS7 A;  2LUC A;  2Y4Q A;  2QEH A;  1JC2 A;  1J7R A;  1K95 A;  2FCD A;  1KQM B;  5AEQ A;  1RRO A;  2K0J A;  5HKW A;  1CFP A;  1KFX L;  1NCX A;  2H61 A;  3DVE A;  1JBA A;  2K7D A;  1TUJ A;  3KO0 A;  1KK7 Y;  1Y6W A;  1DF0 B;  2K7B A;  2KHN A;  2BL0 C;  2QEO A;  3DYE A;  1BJF A;  3KEV A;  3PFV A;  4MRX A;  2BE4 A;  1FPW A;  3B86 A;  3NSL A;  2MBX A;  5EL2 A;  1AVS A;  2QEB A;  1CMF A;  2NZ0 A;  2SAS A;  2P6B B;  2JUL A;  3SG6 A;  3AKA A;  1QX5 B;  3B87 A;  1MQ1 A;  2K7O A;  3KPX A;  2GGZ A;  2KNE A;  4OCI A;  3L4L A;  1ORG A;  1F4O A;  2KPH A;  2EGD A;  2LV7 A;  4YGE B;  1YVH A;  3I5F B;  3OHM B;  1A29 A;  3IF7 A;  4NDD A;  1XFU O;  1F71 A;  4P2Y B;  1KK8 C;  3TUY B;  3WHT B;  1IH0 A;  1JUO A;  3VRR A;  1XK4 C;  1OOH A;  2JTZ A;  1IIO A;  4YRU A;  3S0A A;  2NLN A;  4PHK A;  1PRW A;  1Z2C B;  4MSP A;  5HL1 A;  3I5I B;  2QPT A;  2I18 A;  1C07 A;  3OBV A;  1F54 A;  1A75 A;  1IJ5 A;  2WCM A;  4TNC A;  3VRQ A;  2KGB C;  1SK6 D;  2JPT A;  2LLU A;  3SS5 A;  1M31 A;  3S0B A;  3S0G A;  2HET A;  1PK0 D;  4MBE A;  1QAS A;  1QJT A;  1S36 A;  1PSR A;  2F2P A;  1SL8 A;  1UHJ A;  1OMV A;  1SCM C;  1SMG A;  1AJ4 A;  1SRA A;  2LAN A;  2LLT A;  1L2O B;  3DVJ A;  3L47 A;  5GQQ C;  2PAL A;  4D1E A;  1FBV A;  3HCM A;  3BJH A;  2KYC A;  1NX0 A;  4GAO A;  1OMD A;  3LL8 B;  4GGN A;  3B7A A;  1YUU A;  1F4Q A;  1IJ6 A;  1MXL C;  1MF8 B;  1MHO A;  3BUN B;  3FE6 A;  4FTG A;  1BG1 A;  1J7Q A;  1YUS A;  4MZK A;  1X02 A;  4I5L B;  3ZWH A;  1JFK A;  4ORB B;  2ERB A;  3LLE A;  2LVI A;  1EG3 A;  1YX7 A;  2LLS A;  4HRG A;  2LHL A;  2KFH A;  4MN0 A;  4I5N B;  1S3P A;  5K89 A;  3OGN A;  2B1U A;  5DKR A;  4BY4 A;  1M63 B;  1XK4 A;  2WND A;  4QJ4 B;  4M2Q A;  1PVB A;  1SW8 A;  1KQM C;  3B88 A;  2KBI A;  1Y1U A;  2P70 A;  2KAY A;  1QIW A;  4FQT A;  1LXF C;  5FYX A;  3RLZ A;  4DS7 A;  1REC A;  4JQ0 D;  2HQW A;  1QXP A;  4PDZ A;  1QV1 A;  1G33 A;  1K9P A;  1R2U A;  1NSH A;  5D3O A;  4ORA B;  1S26 D;  2LVK A;  1DMO A;  1IRJ A;  1DGV A;  1S6I A;  3SIA A;  2JNF A;  3CZ1 A;  3DY9 A;  3NSO A;  1XO5 A;  2NXQ A;  1S1E A;  3AKB A;  2WC5 A;  4INX A;  2E6W A;  3FE8 A;  3EKJ A;  3CZT X;  2FJU B;  1KK8 B;  5ER5 A;  2F3Y A;  1V1G A;  4IL1 A;  4DRW A;  3TUY C;  1BOD A;  1CLL A;  3S0F A;  2ZRT A;  2JU0 A;  3D0Y A;  2K60 A;  1OE9 B;  3JVT B;  1XFR A;  4OV2 A;  1CLB A;  2BEC A;  3I5I C;  3K21 A;  1F55 A;  1H8B A;  1MWN A;  1OOF A;  3O6B A;  4L9M A;  1HQV A;  4MVF A;  3SJS A;  1TOP A;  3H4S E;  1ODB A;  3SIB A;  2G2B A;  4YI9 A;  1UHN A;  1DJH A;  1W7I B;  4F0Z B;  1DF0 A;  1RTP 1;  3MSE B;  1B8L A;  2LMV A;  4ZCV A;  5HKZ A;  1L2O C;  3A8R A;  2PQL A;  1XFY O;  4ICB A;  2ZRS A;  2JTT A;  3BUW B;  2ZNE A;  3DD4 A;  4YBH B;  5HYD A;  1W9Z A;  1OOI X;  1TTX A;  3CR2 A;  3D75 A;  2WC6 A;  5I2Q A;  1CMG A;  1G8I A;  1BF5 A;  1OSA A; 
#chains in the Genus database with same CATH homology
 2DOQ A;  2Y1M A;  4I5J A;  4C0L A;  3E3R A;  2L98 A;  1DGU A;  2BCA A;  2NCO A;  2JNX A;  3BXK A;  1B8R A;  2AMI A;  3EK8 A;  4MZL A;  1SNL A;  1KCY A;  1BU3 A;  2KFF A;  4DCK A;  5IBW A;  2Q4U A;  1TIZ A;  2PMY A;  4E68 A;  1SYM A;  2NCP A;  1K90 D;  1WRL A;  1KFU S;  2KI6 C;  3DVM A;  4ETO A;  1NUB A;  2KI6 D;  5J3X A;  1UUS A;  1JF0 A;  2Y5I A;  3SG2 A;  3PM8 A;  1UP5 A;  2FOT A;  2M97 A;  2MAZ A;  4C0K A;  1NPQ A;  1L7Z A;  1V1F A;  2JC2 A;  2MLF C;  2WC8 A;  3M0W A;  1C7V A;  1RK9 A;  1DJZ A;  1PVA A;  1RFJ A;  1OQP A;  5CSF A;  1QX2 A;  5G08 A;  2M3W A;  3WXA A;  3TZ1 A;  3TS5 C;  2RGI A;  4AQJ A;  2M29 A;  4M2O A;  5F6T A;  2KYF A;  2L4H A;  4PE7 A;  1EH2 A;  2O60 A;  1DJY A;  2PSR A;  3JVT C;  1EL4 A;  1H4B A;  2F33 A;  4PE0 A;  4N1F A;  1KSM A;  1IKU A;  2Y1N A;  1SCV A;  2M8U A;  3HX4 A;  1CLM A;  2BBM A;  4R1E A;  3OB1 B;  3VRP A;  3LK1 A;  2PVB A;  3GK4 X;  3F45 A;  1ZUZ A;  1N65 A;  1CM1 A;  3BUX B;  4YGA A;  1TCF A;  3IQO A;  2BCX A;  1A03 A;  2FCE A;  1B1G A;  5KTY A;  1PUL A;  1UHH A;  5CPV A;  2KOT A;  3GK2 A;  3EVV A;  4YGB B;  4ORC B;  3TDU A;  4QJ3 B;  4XJK B;  3BOW A;  3ICB A;  1NCZ A;  2WCB A;  1YRT B;  1MR8 A;  2JT8 A;  1NCY A;  4MEW A;  3NSK A;  2R2I A;  1M46 A;  2E30 A;  2OTG B;  2JXL A;  2M7N A;  1OZS A;  2KDH A;  2BCB A;  1ALW A;  3D10 A;  1J7P A;  2M9G A;  4GGF C;  1KQV A;  2VRG A;  3O4Y A;  3EKH A;  3LCP C;  1CKK A;  1UHK A;  2LVJ A;  4JPZ B;  1K96 A;  1OMR A;  2L5X B;  2MRD A;  4ZCU A;  2G9B A;  1DT7 B;  3EVR A;  3AAK A;  5AER A;  1K94 A;  1U5I B;  5CSI A;  1AUI B;  1SKT A;  1EXR A;  4A4B A;  1G4Y R;  2KI4 B;  1A75 B;  1DVI A;  2KAX A;  1KFU L;  4PHN A;  2EC6 B;  1AP4 A;  1B7T Z;  1TNX A;  4I5K A;  4PAL A;  2L2E A;  3VGO A;  3DVK A;  2M0R A;  3O2P A;  3TS5 B;  4OKH A;  2CCM A;  1EG4 A;  2I94 A;  4MLW A;  1NYA A;  1ALV A;  2O5G A;  1AHR A;  1B4C A;  1CFD A;  2AUC A;  3I5G B;  1NWD A;  1N2D A;  1QVI Y;  1CDL A;  3PAT A;  4Q04 A;  5KU1 A;  1CFF A;  2HF5 A;  5I2L A;  1JF2 A;  5CSJ A;  2M1U A;  1A4P A;  1LA3 A;  2WOR A;  2IS9 A;  3EK4 A;  2F8P A;  1LVC D;  1RWY A;  4GGF A;  2ISD A;  1IQ3 A;  1SBJ A;  3LK0 A;  1S5G Y;  4GBA A;  4GNK B;  2MJW B;  3AAJ A;  4M2P A;  5HKY A;  1SY9 A;  1BT6 A;  2LHI A;  1FI5 A;  5HLV A;  1BMO A;  1YX8 A;  1DTL A;  1CFC A;  2K2F A;  2JT3 A;  1D1O A;  1CTR A;  1DJW A;  4DUQ A;  1KSO A;  1Y1X A;  3BQ3 A;  4A4C A;  2H61 C;  1KWO B;  2LP3 A;  1TCO B;  3JTD C;  4CLN A;  1YUR A;  2CTN A;  1WRZ A;  4P5O E;  1Y1A A;  2K61 A;  3C1V A;  5DKQ A;  3OB2 B;  2HQ8 A;  4PHJ A;  1W7J B;  2KFG A;  2OTG C;  2ZN9 A;  2L0P A;  1CM4 A;  1K2H A;  4C0J A;  1FI6 A;  2MHH A;  2V53 A;  1TRF A;  1E8A A;  1BR1 B;  1M45 A;  4AOM A;  2LVV A;  1NX1 A;  1LA0 A;  1QX7 A;  5JOL A;  1TNP A;  1M39 A;  3PN7 B;  1BR4 B;  1QV0 A;  1YVL A;  1WDC B;  2SCP A;  1Y0V H;  5D7F A;  1CLB A;  1UWO A;  1J1D A;  1QLK A;  2JZI A;  1DJG A;  3GOF A;  1QLS A;  2WOS A;  2K8M B;  1LKJ A;  1DJX A;  2KI4 C;  1S6J A;  3CGA A;  4CFR A;  1F70 A;  2KBM A;  2MA2 A;  5TNC A;  4XYN A;  1WRK A;  5JJG A;  1BOC A;  2EC6 C;  2PRU A;  2ZN8 A;  3EK7 A;  2M7L A;  2AAO A;  3KF9 A;  3QRX A;  1IWQ A;  4YGD B;  1J1E A;  2ZND A;  1NX3 A;  1SL7 A;  2I7A A;  2KQY A;  2LAP A;  4XJK A;  1UUR A;  1WLM A;  3I5G C;  2JT0 A;  5DKN A;  1XFZ O;  2OPO A;  1FW4 A;  2CXJ A;  3VRN A;  1Q80 A;  1AJ5 A;  2L4I A;  1ZMZ A;  1KK7 Z;  3NSI A;  5AFP A;  1WLZ A;  2LCP A;  3FIA A;  2LC5 A;  3SG5 A;  4WQ2 A;  1WY9 A;  3KHE A;  4U8D A;  3DF0 B;  4HRE E;  2M1K B;  3OX5 A;  1CDN A;  4YGC B;  4PE1 A;  1U5I A;  2Q91 A;  1YUT A;  2QAC A;  5AAN A;  1ZOT B;  1XA5 A;  1KWO C;  2KAV A;  3JTD B;  1NP8 A;  4GFT A;  3VRO A;  1QAT A;  1SR6 B;  2JOJ A;  3CLN A;  1ZFS A;  2JQ6 A;  1GJY A;  2LNK A;  2F2O A;  4WRI A;  5CSN A;  3I5H B;  2EHB A;  1CB1 A;  1EJ3 A;  4WQ3 A;  4CPV A;  1K9U A;  3A4U B;  1R6P A;  1B9A A;  1TN4 A;  3CWG A;  2OS8 C;  2GV5 A;  2H2K A;  3PN7 C;  1WDC C;  5AXI A;  1FF1 A;  1B7T Y;  3CR5 X;  2BE6 A;  2TN4 A;  2D8N A;  4YI8 A;  2BBN A;  1KFX S;  1OZO A;  1QTX A;  2LMU A;  3SG7 A;  3OX6 A;  2ZKM X;  1K93 D;  5BPJ A;  1ZAC A;  1HT9 A;  3RM1 A;  5HLO A;  4GUK A;  1PSB A;  1TNQ A;  5I2O A;  2BL0 B;  4GPL B;  3WHU B;  4HRH A;  1LIN A;  2CT9 A;  2LE9 B;  4NDB A;  1UHI A;  2COL B;  2K7C A;  1GQM A;  3GK1 A;  2ZFD A;  4PCW A;  2KSP A;  5KSZ A;  1F8H A;  1YTZ C;  2WCE A;  1XYD A;  3BUM B;  4USL A;  2LMT A;  3SG3 A;  1XFV O;  5ER4 X;  1DJI A;  4N5X A;  3WNX B;  1CDM A;  2M49 B;  4OR9 B;  1CNP A;  2K2A A;  2JWW A;  3BOW B;  3ZNI A;  4AQI A;  2LUX A;  3I5F C;  1VRK A;  2MLE C;  1JWD A;  3SG4 A;  1GGW A;  1TNW A;  2L50 A;  1B47 A;  5D69 A;  2I2R E;  4PE4 A;  4BY5 A;  4CFQ A;  4HSZ A;  3OP0 A;  3NXA A;  1IG5 A;  2GGM A;  1J7O A;  1XFW O;  1SL9 A;  2L51 A;  1GGZ A;  2LP2 A;  2WCF A;  2JRF A;  2F3Z A;  5PAL A;  3BUO B;  5I8N A;  4NDC A;  1BLQ A;  2PAS A;  1SR6 C;  4DIR A;  1A2X A;  1CDP A;  3IQQ A;  1QIV A;  1S6C A;  1IGV A;  3PSR A;  1J55 A;  3EVU A;  4N1G A;  4NQG A;  1MUX A;  1QVI Z;  1SCM B;  3CR4 X;  3CS1 A;  4FQO A;  4CID A;  5B8I B;  1AK8 A;  3PLF B;  1C7W A;  3O78 A;  4JWQ A;  2LM5 A;  4QJ5 B;  2KGR A;  3I5H C;  2BKH B;  3FS7 A;  1N0Y A;  1SPY A;  1PAL A;  3TDI A;  2OS8 B;  1XVJ A;  2BKI B;  1S5G Z;  2HPS A;  3CTN A;  1K9K A;  2CNP A;  1MXE A;  1YR5 A;  1OOJ A;  2A4J A;  1JFJ A;  3PAL A;  1XFX O;  1NIW A;  3D0Y B;  1NX2 A;  3BYA A;  1IQ5 A;  4OVN F;  2CBL A;  2JXC A;  4UPG A;  1RJV A;  3DF0 A;  4PHM A;  1YRU B;  3TDZ A;  1K8U A;  3FWB A;  3FWC A;  1JSA A;  1B8C A;  4MRY A;  2KQ6 A;  1QS7 A;  2LUC A;  2Y4Q A;  1JC2 A;  1J7R A;  1K95 A;  2FCD A;  1KQM B;  5AEQ A;  1RRO A;  2K0J A;  5HKW A;  1CFP A;  1KFX L;  1NCX A;  2H61 A;  3DVE A;  1JBA A;  2K7D A;  3KO0 A;  1KK7 Y;  1Y6W A;  1DF0 B;  2K7B A;  2KHN A;  2BL0 C;  3KEV A;  3PFV A;  1BJF A;  4MZJ A;  4MRX A;  4ORB B;  2BE4 A;  1FPW A;  3NSL A;  2MBX A;  1AVS A;  1CMF A;  2NZ0 A;  2SAS A;  2P6B B;  2JUL A;  3SG6 A;  3AKA A;  1QX5 B;  1MQ1 A;  2K7O A;  3KPX A;  2GGZ A;  2KNE A;  4OCI A;  1F4O A;  2EGD A;  2LV7 A;  4YGE B;  1YVH A;  3I5F B;  3OHM B;  1A29 A;  3IF7 A;  4NDD A;  1XFU O;  1F71 A;  4P2Y B;  1KK8 C;  3TUY B;  3WHT B;  1IH0 A;  1JUO A;  3VRR A;  1XK4 C;  2JTZ A;  4YRU A;  2NLN A;  4PHK A;  1PRW A;  4MSP A;  3I5I B;  2QPT A;  2I18 A;  1C07 A;  1F54 A;  1A75 A;  1IJ5 A;  4TNC A;  3VRQ A;  2KGB C;  1SK6 D;  2JPT A;  2LLU A;  1M31 A;  2HET A;  1PK0 D;  4MBE A;  1QAS A;  1QJT A;  1S36 A;  1PSR A;  2F2P A;  1SL8 A;  1UHJ A;  1OMV A;  1SCM C;  1SMG A;  1AJ4 A;  1SRA A;  2LAN A;  2LLT A;  1L2O B;  3DVJ A;  5GQQ C;  4D1E A;  2PAL A;  1FBV A;  3HCM A;  2KYC A;  1NX0 A;  4GAO A;  1OMD A;  3LL8 B;  4GGN A;  1YUU A;  1F4Q A;  1IJ6 A;  1MXL C;  1MF8 B;  1MHO A;  3BUN B;  4FTG A;  1BG1 A;  1J7Q A;  1YUS A;  4MZK A;  1X02 A;  4I5L B;  3ZWH A;  1JFK A;  3LLE A;  2LVI A;  1EG3 A;  1YX7 A;  2LLS A;  4HRG A;  2LHL A;  2KFH A;  4MN0 A;  4I5N B;  1S3P A;  5K89 A;  2B1U A;  5DKR A;  4BY4 A;  1M63 B;  1XK4 A;  2WND A;  4QJ4 B;  4M2Q A;  1PVB A;  1SW8 A;  1KQM C;  2KBI A;  1Y1U A;  2KAY A;  1QIW A;  5FYX A;  1LXF C;  3RLZ A;  4DS7 A;  1REC A;  4JQ0 D;  2HQW A;  1QXP A;  4PDZ A;  1QV1 A;  1G33 A;  1K9P A;  1R2U A;  1NSH A;  4ORA B;  1S26 D;  2LVK A;  1DMO A;  1IRJ A;  1DGV A;  1S6I A;  3SIA A;  2JNF A;  3NSO A;  1XO5 A;  2NXQ A;  1S1E A;  3AKB A;  2E6W A;  3EKJ A;  3CZT X;  2FJU B;  1KK8 B;  5ER5 A;  2F3Y A;  1V1G A;  4IL1 A;  4DRW A;  3TUY C;  1BOD A;  1CLL A;  2ZRT A;  2JU0 A;  3D0Y A;  1OE9 B;  3JVT B;  4OV2 A;  2BEC A;  3I5I C;  3K21 A;  1F55 A;  1H8B A;  1MWN A;  3O6B A;  4L9M A;  1HQV A;  4MVF A;  3SJS A;  1TOP A;  3H4S E;  1ODB A;  3SIB A;  2G2B A;  4YI9 A;  1UHN A;  1DJH A;  1W7I B;  4F0Z B;  1DF0 A;  1RTP 1;  3MSE B;  1B8L A;  2LMV A;  4ZCV A;  5HKZ A;  1L2O C;  3A8R A;  4ICB A;  1XFY O;  2ZRS A;  2JTT A;  3BUW B;  2ZNE A;  3DD4 A;  4YBH B;  5HYD A;  1TTX A;  3CR2 A;  5I2Q A;  1CMG A;  1G8I A;  1BF5 A;  1OSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...