2KQ6A

The structure of the ef-hand domain of polycystin-2 suggests a mechanism for ca2+-dependent regulation of polycystin-2 channel activity
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
NTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Polycystin-2
publication title Structure of the EF-hand domain of polycystin-2 suggests a mechanism for Ca2+-dependent regulation of polycystin-2 channel activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kq6A01
2LVVA 1TN4A 1ALVA 4YGDB 2F33A 1K90D 4ICBA 5CSIA 2K61A 1KCYA 1EH2A 4L9MA 1U5IB 1W7JB 1JFJA 1DVIA 1TNPA 3JVTB 2G2BA 2KI4B 1H4BA 1IJ6A 2LNKA 4XYNA 2R2IA 1B7TZ 2KGRA 3EVVA 2M3WA 1MQ1A 3BYAA 1TCFA 1CLLA 3PFVA 1A75A 1DJWA 2KSPA 2LLSA 1ALWA 4NDDA 4JPZB 2AMIA 2I18A 4PCWA 1MXLC 2MLFC 1DMOA 1BJFA 4M2OA 1UURA 1CFPA 2K7CA 2KFHA 3BXKA 1RROA 3NSIA 5AXIA 1EJ3A 1S6IA 2JULA 1QASA 1A29A 2JXCA 1R2UA 2ZN8A 4OKHA 2L98A 2ZKMX 1JSAA 1M31A 4HSZA 1XFVO 1LKJA 3KF9A 2D8NA 1TCOB 3VRNA 1QTXA 1YR5A 3TDUA 1NP8A 2KYFA 3BQ3A 3BUXB 2KFGA 2B1UA 5G08A 3O78A 1AHRA 1SBJA 4DCKA 1SPYA 1RK9A 1QVIY 1TOPA 4OR9B 2O5GA 2DOQA 3OX5A 1AP4A 3CR5X 3GOFA 2L51A 4NDBA 2LE9B 4YGCB 1J7QA 1BLQA 1DTLA 5DKRA 4D1EA 2MLEC 1NIWA 2HPSA 3WNXB 1NX0A 1OOJA 2LCPA 2KAVA 2LHLA 1YVLA 4GGFA 1C7WA 3PLFB 1CMGA 1DF0A 2MBXA 2BCAA 2ZRSA 1SCMC 1SCVA 1K93D 1OMVA 2KAXA 3IQOA 1XFXO 1CLMA 1FBVA 1DT7B 3C1VA 2QPTA 4CLNA 4GAOA 1K8UA 2L5XB 1KSMA 3SIBA 2RGIA 4YGAA 2TN4A 2CBLA 2KI6C 1VRKA 1SCMB 2H61A 2LUXA 4GNKB 3RM1A 3KO0A 4A4CA 1J1DA 2M9GA 3CWGA 1NCXA 3EKHA 3PM8A 4PHKA 4GGFC 3ICBA 1C07A 2HQWA 1FI6A 1OMDA 3SIAA 1DJIA 2KOTA 2EHBA 2MA2A 1CDLA 2LVJA 5D69A 2LAPA 3HCMA 2COLB 5DKNA 4YGBB 1SY9A 1PSBA 3A8RA 2QACA 1KK8C 4YI8A 2OPOA 4P2YB 5AEQA 5ER5A 1QLSA 1XVJA 2H61C 5I2QA 5GQQC 1QX7A 1SRAA 1CFCA 5I2OA 1NCZA 4DS7A 3PATA 1BODA 1TNQA 1Y6WA 1Y1UA 1KK8B 4BY5A 2KQ6A 4F0ZB 5CSFA 2LP2A 1PSRA 3OB2B 1KFUS 1RJVA 1J7PA 2KFFA 3HX4A 1XYDA 1KQMB 5BPJA 2JC2A 1GGWA 4GPLB 1QVIZ 1U5IA 2NZ0A 1K96A 3SG4A 3TS5C 3AAJA 1C7VA 1DGVA 1Y1AA 4ZCUA 1YRTB 3GK1A 3TUYC 3SG5A 3O4YA 1ODBA 1UHJA 2MAZA 4USLA 1ZUZA 3I5FC 4AQJA 1AJ5A 1TIZA 3TS5B 2K7OA 2LP3A 4PE7A 2NXQA 1AUIB 1MUXA 2JOJA 3TUYB 1HQVA 1SNLA 1HT9A 2KGBC 2ZRTA 1W7IB 2BE6A 3D10A 3JVTC 3I5FB 2KI4C 4MRYA 1KQVA 1UUSA 5KSZA 5HLVA 3NXAA 3TDZA 1XO5A 1QIWA 2JT8A 2K7BA 2Y1NA 2LC5A 4YRUA 2V53A 3EK4A 1PK0D 2Q91A 2M29A 1F4QA 1NX2A 2BE4A 3EK7A 1NSHA 5I2LA 4IL1A 1IH0A 3PN7C 1DJHA 2MHHA 3VRQA 2EC6C 5PALA 1B1GA 2ISDA 1NX3A 5HKYA 2M1UA 3OB1B 1CMFA 1DJGA 3DVEA 3VROA 2JTTA 4PDZA 1YUUA 1J1EA 3A4UB 3PN7B 1B8LA 1IRJA 1YUTA 2I2RE 4MN0A 2EC6B 3NSOA 3KPXA 3SG2A 4CFQA 4YI9A 1TRFA 4DIRA 1R6PA 1L7ZA 1S6CA 2JXLA 3IF7A 1BU3A 4XJKB 3OP0A 2KAYA 4A4BA 1CDNA 1S36A 4OVNF 3JTDB 2M1KB 1MR8A 2M49B 3E3RA 4HRHA 2F2PA 1KFXL 1B8RA 1PRWA 2AUCA 2BBMA 3I5GC 4U8DA 1KSOA 3EK8A 1XFZO 2BECA 4MLWA 4I5NB 1EG3A 5TNCA 2K0JA 5HKZA 2E6WA 4ORAB 2JWWA 3I5GB 5FYXA 5K89A 1AK8A 2OTGC 1S5GY 1QS7A 1TTXA 2KNEA 1S3PA 2CCMA 2GGZA 3BUOB 4FTGA 3TDIA 2Q4UA 1YURA 4N1GA 1JF0A 2OTGB 1TNXA 1CDMA 1S26D 3GK2A 1NUBA 2PALA 1NWDA 4WQ2A 3SG6A 3TZ1A 1LXFC 4FQOA 3SG7A 2LLUA 3QRXA 1E8AA 3BUWB 2LUCA 1LVCD 5HYDA 1DJXA 1ZFSA 2LMVA 4MBEA 1SKTA 4ZCVA 1QIVA 1A4PA 3BUMB 4C0LA 2JT3A 1K9KA 2M0RA 3CZTX 2M97A 1PALA 1PULA 2M7NA 3PSRA 1F4OA 2CT9A 2WCBA 1BR4B 1XK4A 4M2QA 2L0PA 2LVKA 3DVKA 1EXRA 1IGVA 3O6BA 2M7LA 3CS1A 3DVJA 1XFYO 1Y0VH 1OMRA 5J3XA 4OCIA 4E68A 3AAKA 5HKWA 3EVUA 4PHNA 1J7RA 1EL4A 4BY4A 3ZWHA 4DRWA 1F54A 2BCXA 2JRFA 4OV2A 1UP5A 3I5HC 3IQQA 1AJ4A 1KQMC 1MF8B 4QJ5B 4ORCB 5CPVA 3KEVA 5JOLA 1XK4C 1Y1XA 2L4IA 1DJZA 2ZFDA 3M0WA 2HF5A 2L4HA 2G9BA 3I5HB 4PE4A 1CM1A 1YX8A 2FOTA 3BOWA 1NX1A 2JZIA 1BF5A 1WRKA 1CDPA 4N1FA 2F8PA 1KFXS 1DJYA 1SL7A 2F3ZA 1G4YR 2H2KA 1BR1B 1PVAA 1S5GZ 2LLTA 3DF0A 1QV1A 1IWQA 2AAOA 1S6JA 3VRPA 1QATA 3EVRA 3FIAA 1YX7A 2WCEA 4MSPA 3LK0A 3CGAA 1JC2A 4ORBB 3CR2A 1ZOTB 1L2OC 1ZACA 1GJYA 1QX2A 4I5KA 4JQ0D 4QJ4B 3KHEA 1BMOA 2BKIB 4MZKA 1KK7Y 1KWOC 3BOWB 1UHHA 4I5LB 1WLMA 4NQGA 4GFTA 2VRGA 1XFWO 2MRDA 1FW4A 5DKQA 1QXPA 1L2OB 1RFJA 2HQ8A 1SMGA 1GGZA 1WDCC 2FJUB 4XJKA 2SCPA 5CSJA 1XA5A 2NCOA 1K94A 1UHKA 1Q80A 1KWOB 1UWOA 3DF0B 2FCEA 2JT0A 3F45A 3LL8B 3SJSA 1D1OA 4CIDA 4ETOA 2L2EA 1F55A 5B8IB 5HLOA 5KTYA 1UHIA 1WDCB 1SYMA 1LA3A 1NYAA 2K2FA 2SASA 1CNPA 2WCFA 1OE9B 1CTRA 1RECA 3JTDC 2LV7A 3FS7A 1CB1A 3LCPC 1CM4A 1J55A 1B47A 2JNFA 1MHOA 2WORA 1IKUA 3CTNA 1TNWA 3OX6A 1J7OA 1YVHA 3GK4X 1BG1A 4AOMA 1QV0A 1OZOA 2LMUA 4I5JA 3FWCA 1M46A 1YTZC 3NSLA 1SW8A 2KBIA 4DUQA 2BL0C 5ER4X 4UPGA 3EKJA 4NDCA 4C0JA 3MSEB 3WHTB 2NCPA 2KBMA 5JJGA 1F70A 2JPTA 1SK6D 1BOCA 4MZJA 1KFUL 4Q04A 4AQIA 1PVBA 1K2HA 4MRXA 2BL0B 1RWYA 2KHNA 1KK7Z 2CTNA 1X02A 2ZNEA 4PE0A 1FPWA 1H8BA 4PALA 2HETA 2BCBA 4YGEB 2GV5A 1LA0A 2JU0A 3LLEA 1QX5B 2F2OA 1A75B 1OZSA 2ZN9A 4JWQA 4PE1A 3CLNA 4MEWA 2PRUA 1K95A 1N2DA 2NLNA 1DGUA 2F3YA 2K2AA 3O2PA 1SL9A 3VGOA 1K9UA 1N65A 2PSRA 4MZLA 2CXJA 3LK1A 1JUOA 2JQ6A 2JTZA 5AERA 4M2PA 5AFPA 4GUKA 3I5IC 1RTP1 2LHIA 2GGMA 1YUSA 1V1FA 2JNXA 2I94A 1GQMA 3VRRA 5I8NA 1N0YA 2PVBA 3ZNIA 1G8IA 3K21A 3OHMB 1UHNA 2LVIA 3I5IB 4HREE 4MVFA 1M63B 2LANA 2A4JA 1NCYA 1OSAA 1CFFA 2KI6D 3WXAA 4PHJA 1M45A 2KDHA 3D0YA 3DVMA 1IJ5A 2KQYA 3H4SE 1WRLA 4N5XA 2OS8C 1S1EA 5CSNA 1B7TY 2ZNDA 2P6BB 1FF1A 1A03A 1B4CA 2M8UA 4HRGA 1EG4A 1BT6A 4P5OE 2E30A 2Y4QA 2WOSA 2OS8B 2Y1MA 1DF0B 2L50A 2EGDA 1V1GA 1IQ3A 5F6TA 3SG3A 1IG5A 1FI5A 1JWDA 1WRZA 5IBWA 2PMYA 3FWBA 4YBHB 3WHUB 3PALA 1M39A 1NPQA 3DD4A 3NSKA 4WQ3A 2CNPA 3BUNB 1MWNA 1B9AA 2KYCA 1B8CA 1F8HA 2PASA 1LINA 1WLZA 1A2XA 1G33A 5AANA 1CKKA 2BKHB 3D0YB 4R1EA 1CLBA 1QLKA 2K8MB 1SR6C 1AVSA 2LM5A 1QJTA 3CR4X 2FCDA 1SL8A 2O60A 1YRUB 4CPVA 4PHMA 2MJWB 2WC8A 1JF2A 1IQ5A 3AKBA 1XFUO 1K9PA 5D7FA 1CFDA 3RLZA 4C0KA 1SR6B 1JFKA 1OQPA 2IS9A 3AKAA 4GGNA 5KU1A 2K7DA 2WNDA 2LMTA 4WRIA 1MXEA 4GBAA 1JBAA 1ZMZA 2BBNA 4CFRA 4TNCA 1F71A 2I7AA 4QJ3B 1WY9A 2Y5IA
chains in the Genus database with same CATH superfamily
3R1VA 2H8VA 2BNXA 1TN4A 2LVVA 2QEVA 1ALVA 4YGDB 2F33A 1K90D 4ICBA 5CSIA 2K61A 1KCYA 1EH2A 4L9MA 1U5IB 1W7JB 1JFJA 1DVIA 1TNPA 3JVTB 3NHTA 2WCMA 2G2BA 2KI4B 1H4BA 1IJ6A 2LNKA 4XYNA 2R2IA 1B7TZ 3K1EA 2KGRA 3EVVA 2M3WA 3R1OA 1MQ1A 3BYAA 1TCFA 1CLLA 3PFVA 1A75A 1DJWA 2KSPA 2LLSA 1ALWA 4NDDA 4JPZB 3SS5A 3EG5B 2AMIA 2I18A 4PCWA 1MXLC 2MLFC 1DMOA 1BJFA 4M2OA 1UURA 1CFPA 2K7CA 3D78A 2KFHA 3BXKA 5FI7A 1RROA 3NSIA 5AXIA 1EJ3A 1S6IA 2JULA 1QASA 1A29A 2JXCA 1R2UA 2ZN8A 4OKHA 2L98A 2ZKMX 1JSAA 1M31A 3D76A 1XFVO 4HSZA 1LKJA 3KF9A 2D8NA 1TCOB 3VRNA 1QTXA 1YR5A 3TDUA 1NP8A 2KYFA 3BQ3A 3BUXB 2KFGA 2B1UA 5G08A 3O78A 1AHRA 1SBJA 4DCKA 1SPYA 1RK9A 3DY9A 1QVIY 1TOPA 4OR9B 2O5GA 2DOQA 1LS8A 3OX5A 1AP4A 3CR5X 3GOFA 2L51A 4NDBA 2LE9B 4YGCB 1J7QA 1TUJA 4INXA 1BLQA 1DTLA 5DKRA 4D1EA 2MLEC 1NIWA 2HPSA 3WNXB 3DYEA 1NX0A 1OOJA 1DC1A 3BFHA 2LCPA 2KAVA 2LHLA 1YVLA 4GGFA 1C7WA 3PLFB 1CMGA 2KLDA 1DF0A 2MBXA 2BCAA 2ZRSA 1SCMC 1SCVA 1K93D 1OMVA 2KAXA 1OW4A 3BFAA 3IQOA 4INWA 1XFXO 1CLMA 1FBVA 1DT7B 3C1VA 2QPTA 4CLNA 4GAOA 1K8UA 2L5XB 1KSMA 3SIBA 2RGIA 4YGAA 2TN4A 2CBLA 5FI6A 2KI6C 1VRKA 1SCMB 2H61A 2LUXA 4GNKB 3RM1A 3KO0A 5DICA 4A4CA 1J1DA 2M9GA 3CWGA 1NCXA 3EKHA 3PM8A 4PHKA 4GGFC 3ICBA 1C07A 2HQWA 1FI6A 1OMDA 3SIAA 1DJIA 2KOTA 3BJHA 2EHBA 2MA2A 1CDLA 2LVJA 5D69A 2LAPA 3HCMA 2COLB 2WC5A 5DKNA 4YGBB 1SY9A 1PSBA 3A8RA 2QACA 1KK8C 4YI8A 2OPOA 4P2YB 5AEQA 5EL2A 5ER5A 1QLSA 1XVJA 2H61C 5I2QA 5GQQC 1QX7A 1SRAA 1CFCA 3SS3A 1NCZA 4DS7A 3PATA 5I2OA 1TNQA 1Y6WA 1Y1UA 1KK8B 4BY5A 1BODA 2KQ6A 4F0ZB 5CSFA 2LP2A 1PSRA 3OB2B 1KFUS 1RJVA 1J7PA 2KFFA 3HX4A 1XYDA 1KQMB 2YGUA 2JC2A 5BPJA 4GPLB 1GGWA 1QVIZ 1U5IA 2NZ0A 1K96A 3SG4A 3TS5C 3R72A 3AAJA 1C7VA 1DGVA 1Y1AA 4ZCUA 3CZ1A 1YRTB 3GK1A 3TUYC 3SG5A 3SS4A 3O4YA 1ODBA 1UHJA 2MAZA 4USLA 1ZUZA 3I5FC 4AQJA 1AJ5A 2WCHA 1TIZA 3TS5B 2K7OA 2LP3A 4PE7A 2NXQA 1AUIB 1MUXA 2JOJA 3TUYB 1HQVA 1SNLA 1HT9A 2KGBC 2ZRTA 1W7IB 2BE6A 3D10A 3JVTC 3I5FB 2KI4C 1DEKA 4MRYA 1KQVA 1UUSA 5KSZA 5HLVA 2L5YA 3IVTA 3NXAA 3S0EA 1XO5A 1QIWA 2JT8A 2K7BA 2Y1NA 2LC5A 3TDZA 4YRUA 1OOFA 2V53A 3EK4A 1PK0D 2Q91A 2M29A 1F4QA 3S0AA 1NX2A 2BE4A 3D75A 3EK7A 1NSHA 1Z4HA 1Z2CB 5I2LA 4IL1A 1IH0A 2PQLA 3PN7C 1DJHA 2MHHA 3VRQA 2EC6C 5PALA 1B1GA 3B86A 2ISDA 1NX3A 5HKYA 2FJYA 2M1UA 3OB1B 1CMFA 1DJGA 3DVEA 3VROA 2JTTA 4PDZA 3B7AA 1YUUA 1J1EA 3A4UB 3PN7B 1B8LA 1IRJA 1YUTA 2I2RE 4MN0A 2EC6B 3NHIA 3NSOA 2K60A 3KPXA 3SG2A 3CYZA 4CFQA 4YI9A 1TRFA 4DIRA 1R6PA 2QDIA 1L7ZA 1S6CA 2JXLA 3IF7A 1BU3A 4XJKB 3OGNA 3OP0A 2KAYA 4A4BA 3CDNA 1CDNA 1S36A 4OVNF 3QMEA 3JTDB 2M1KB 3VB1A 1MR8A 1OOGA 2M49B 3E3RA 4HRHA 2F2PA 1KFXL 1B8RA 1PRWA 2AUCA 2BBMA 3I5GC 1QWVA 4U8DA 4FQTA 1KSOA 1TWOA 3EK8A 3UNWA 1XFZO 2BECA 4MLWA 4I5NB 1EG3A 5TNCA 2K0JA 5HKZA 3DZTA 2E6WA 4ORAB 2JWWA 3I5GB 5FYXA 5K89A 1AK8A 2OTGC 1S5GY 1QS7A 1TTXA 2KNEA 4KYNA 1S3PA 2CCMA 2GGZA 3BUOB 4FTGA 3TDIA 2Q4UA 1YURA 5I94A 4N1GA 2BAPA 1JF0A 1C3ZA 2OTGB 1TNXA 1CDMA 1S26D 3GK2A 1NUBA 2PALA 1NWDA 2QEHA 4WQ2A 3SG6A 3TZ1A 1LXFC 4FQOA 3SG7A 2LLUA 3QRXA 1E8AA 3BUWB 2LUCA 1LVCD 5HYDA 1IIOA 1DJXA 1ZFSA 2LMVA 1ORGA 3O4XA 4MBEA 1SKTA 4ZCVA 1QIVA 1A4PA 2JPOA 3BUMB 4C0LA 2JT3A 1K9KA 2M0RA 3CZTX 2M97A 1PALA 1PULA 2M7NA 3PSRA 1F4OA 2CT9A 2WCBA 1BR4B 1XK4A 3Q8IA 4M2QA 2L0PA 2LVKA 3DVKA 1EXRA 1IGVA 3O6BA 2M7LA 3CS1A 3DVJA 1XFYO 1Y0VH 1OMRA 5J3XA 4OCIA 4E68A 3AAKA 4F7FA 5HKWA 3EVUA 4PHNA 3D74A 1J7RA 1EL4A 4BY4A 3ZWHA 4DRWA 1F54A 2BCXA 2JRFA 4OV2A 1UP5A 3I5HC 3IQQA 1AJ4A 3PJIA 1KQMC 1MF8B 3L47A 4QJ5B 4ORCB 5CPVA 2ERBA 3KEVA 5JOLA 1XK4C 1Y1XA 2L4IA 1DJZA 2ZFDA 3M0WA 2HF5A 2L4HA 2G9BA 2QEBA 3I5HB 4PE4A 1CM1A 1YX8A 2FOTA 3BOWA 1NX1A 2JZIA 1BF5A 1WRKA 3FE6A 1CDPA 4N1FA 2F8PA 1KFXS 3D73A 1XFRA 1DJYA 1SL7A 2F3ZA 2KLEA 1G4YR 2H2KA 1BR1B 1PVAA 1S5GZ 2LLTA 2QEOA 3DF0A 1QV1A 1IWQA 1GM0A 2AAOA 4JKTA 1S6JA 3VRPA 1QATA 3EVRA 3FIAA 1YX7A 2WCEA 4MSPA 3LK0A 3CGAA 1JC2A 4ORBB 3CR2A 1ZOTB 1L2OC 1ZACA 1GJYA 1QX2A 3PM2A 4OZDA 4I5KA 4JQ0D 4QJ4B 3KHEA 1BMOA 2WC6A 2BKIB 4MZKA 3S0DA 1KK7Y 1KWOC 3BOWB 1UHHA 4I5LB 1WLMA 4NQGA 4GFTA 2VRGA 1XFWO 3FE8A 2MRDA 1FW4A 5DKQA 1QXPA 1L2OB 1RFJA 2HQ8A 1SMGA 1GGZA 1WDCC 2FJUB 4XJKA 2SCPA 5CSJA 1XA5A 2NCOA 3CZ0A 1K94A 1UHKA 1Q80A 1KWOB 1UWOA 3DF0B 2FCEA 2JT0A 3F45A 3LL8B 3SJSA 1D1OA 4CIDA 4ETOA 2L2EA 1F55A 2WCKA 5B8IB 5HLOA 5KTYA 1UHIA 1WDCB 3S0BA 1SYMA 1LA3A 4JD9A 1NYAA 3CZ2A 3DXLA 2K2FA 2SASA 1CNPA 2WCFA 1OE9B 1CTRA 1RECA 3JTDC 2LV7A 3FS7A 1CB1A 3LCPC 1SSEB 1CM4A 3B87A 1J55A 1B47A 2JNFA 1MHOA 2WORA 2WCJA 2KPHA 1IKUA 1DELA 3CTNA 1TNWA 3OX6A 1J7OA 1YVHA 3GK4X 1TUZA 1BG1A 4AOMA 1QV0A 1OZOA 2LMUA 4I5JA 3FWCA 1M46A 1YTZC 3NSLA 3B88A 1SW8A 2KBIA 4DUQA 2BL0C 5ER4X 3R1PA 4UPGA 3EKJA 1OOHA 4NDCA 4C0JA 3MSEB 3WHTB 2NCPA 2KBMA 5JJGA 1F70A 5FI2A 2JPTA 1SK6D 1BOCA 4MZJA 1KFUL 4Q04A 4AQIA 1PVBA 1K2HA 4MRXA 2BL0B 1RWYA 2KHNA 1KK7Z 2CTNA 1X02A 2ZNEA 4PE0A 1FPWA 1H8BA 4PALA 2HETA 2BCBA 4YGEB 2GV5A 1LA0A 2JU0A 3LLEA 1QX5B 2F2OA 1A75B 1OZSA 2ZN9A 3CABA 4JWQA 3CLNA 4PE1A 4MEWA 2PRUA 1K95A 1N2DA 2NLNA 1DGUA 1T14A 2F3YA 2GTEA 2K2AA 3O2PA 1SL9A 2PYQA 3VGOA 1K9UA 1N65A 1P28A 2PSRA 3N7HA 2CXJA 4MZLA 3L4AA 3LK1A 1C3YA 1DQEA 1JUOA 2JQ6A 2JTZA 5AERA 4M2PA 5AFPA 4GUKA 3I5IC 1RTP1 2LHIA 2GGMA 1YUSA 1V1FA 2JNXA 2I94A 1GQMA 3VRRA 5I8NA 1N0YA 2PVBA 3ZNIA 1G8IA 3K21A 3OHMB 1UHNA 2LVIA 3I5IB 4HREE 4MVFA 1M63B 2LANA 2A4JA 1NCYA 1OSAA 1CFFA 2KI6D 3WXAA 4PHJA 1M45A 2KDHA 3D0YA 3DVMA 1IJ5A 2KQYA 3H4SE 1WRLA 3FE9A 4N5XA 2OS8C 1S1EA 3D77A 5CSNA 1B7TY 2ZNDA 2P6BB 3RZSA 1FF1A 1A03A 4PT1A 2M8UA 1B4CA 4HRGA 1EG4A 1BT6A 4IJ7A 3B6XA 4P5OE 2E30A 1W9ZA 2Y4QA 2WOSA 5HL1A 1OOIX 3BFBA 2OS8B 2Y1MA 1DF0B 2L50A 2EGDA 1V1GA 1IQ3A 5F6TA 3SG3A 1IG5A 1FI5A 1JWDA 1WRZA 5IBWA 2PMYA 3FWBA 4YBHB 3WHUB 3PALA 1M39A 1NPQA 3DD4A 3NSKA 4WQ3A 2CNPA 3BUNB 1MWNA 1B9AA 3L4LA 2KYCA 1B8CA 1F8HA 2PASA 3NGVA 1LINA 1WLZA 1A2XA 1G33A 5AANA 3S0FA 2BKHB 3D0YB 4R1EA 1CKKA 3V2LA 1QLKA 2P71A 1CLBA 2K8MB 1SR6C 3OBVA 1AVSA 2LM5A 1QJTA 3CR4X 2FCDA 3S0GA 1SL8A 2O60A 1YRUB 4CPVA 5D3OA 4PHMA 2MJWB 2WC8A 1JF2A 1IQ5A 2WCLA 1XFUO 3AKBA 2P70A 3UO9A 1K9PA 5D7FA 1CFDA 3RLZA 4C0KA 1SR6B 1JFKA 1OQPA 2IS9A 3AKAA 4GGNA 5KU1A 2K7DA 2WNDA 2LMTA 4WRIA 1MXEA 4GBAA 1JBAA 1ZMZA 2BBNA 4CFRA 4TNCA 2L2CA 1F71A 2I7AA 4QJ3B 1WY9A 2Y5IA
chains in the Genus database with same CATH topology
2LVVA 1TN4A 1ALVA 4YGDB 2F33A 1K90D 4ICBA 5CSIA 2K61A 1KCYA 1EH2A 4L9MA 1U5IB 1W7JB 1JFJA 1DVIA 1TNPA 3JVTB 2G2BA 2KI4B 1H4BA 1IJ6A 2LNKA 4XYNA 2R2IA 1B7TZ 2KGRA 3EVVA 2M3WA 1MQ1A 3BYAA 1TCFA 1CLLA 3PFVA 1A75A 1DJWA 2KSPA 2LLSA 1ALWA 4NDDA 4JPZB 2AMIA 2I18A 4PCWA 1MXLC 2MLFC 1DMOA 1BJFA 4M2OA 1UURA 1CFPA 2K7CA 2KFHA 3BXKA 1RROA 3NSIA 5AXIA 1EJ3A 1S6IA 2JULA 1QASA 1A29A 2JXCA 1R2UA 2ZN8A 4OKHA 2L98A 2ZKMX 1JSAA 1M31A 4HSZA 1XFVO 1LKJA 3KF9A 2D8NA 1TCOB 3VRNA 1QTXA 1YR5A 3TDUA 1NP8A 2KYFA 3BQ3A 3BUXB 2KFGA 2B1UA 5G08A 3O78A 1AHRA 1SBJA 4DCKA 1SPYA 1RK9A 1QVIY 1TOPA 4OR9B 2O5GA 2DOQA 3OX5A 1AP4A 3CR5X 3GOFA 2L51A 4NDBA 2LE9B 4YGCB 1J7QA 1BLQA 1DTLA 5DKRA 4D1EA 2MLEC 1NIWA 2HPSA 3WNXB 1NX0A 1OOJA 2LCPA 2KAVA 2LHLA 1YVLA 4GGFA 1C7WA 3PLFB 1CMGA 1DF0A 2MBXA 2BCAA 2ZRSA 1SCMC 1SCVA 1K93D 1OMVA 2KAXA 3IQOA 1XFXO 1CLMA 1FBVA 1DT7B 3C1VA 2QPTA 4CLNA 4GAOA 1K8UA 2L5XB 1KSMA 3SIBA 2RGIA 4YGAA 2TN4A 2CBLA 2KI6C 1VRKA 1SCMB 2H61A 2LUXA 4GNKB 3RM1A 3KO0A 4A4CA 1J1DA 2M9GA 3CWGA 1NCXA 3EKHA 3PM8A 4PHKA 4GGFC 3ICBA 1C07A 2HQWA 1FI6A 1OMDA 3SIAA 1DJIA 2KOTA 2EHBA 2MA2A 1CDLA 2LVJA 5D69A 2LAPA 3HCMA 2COLB 5DKNA 4YGBB 1SY9A 1PSBA 3A8RA 2QACA 1KK8C 4YI8A 2OPOA 4P2YB 5AEQA 5ER5A 1QLSA 1XVJA 2H61C 5I2QA 5GQQC 1QX7A 1SRAA 1CFCA 5I2OA 1NCZA 4DS7A 3PATA 1BODA 1TNQA 1Y6WA 1Y1UA 1KK8B 4BY5A 2KQ6A 4F0ZB 5CSFA 2LP2A 1PSRA 3OB2B 1KFUS 1RJVA 1J7PA 2KFFA 3HX4A 1XYDA 1KQMB 5BPJA 2JC2A 1GGWA 4GPLB 1QVIZ 1U5IA 2NZ0A 1K96A 3SG4A 3TS5C 3AAJA 1C7VA 1DGVA 1Y1AA 4ZCUA 1YRTB 3GK1A 3TUYC 3SG5A 3O4YA 1ODBA 1UHJA 2MAZA 4USLA 1ZUZA 3I5FC 4AQJA 1AJ5A 1TIZA 3TS5B 2K7OA 2LP3A 4PE7A 2NXQA 1AUIB 1MUXA 2JOJA 3TUYB 1HQVA 1SNLA 1HT9A 2KGBC 2ZRTA 1W7IB 2BE6A 3D10A 3JVTC 3I5FB 2KI4C 4MRYA 1KQVA 1UUSA 5KSZA 5HLVA 3NXAA 3TDZA 1XO5A 1QIWA 2JT8A 2K7BA 2Y1NA 2LC5A 4YRUA 2V53A 3EK4A 1PK0D 2Q91A 2M29A 1F4QA 1NX2A 2BE4A 3EK7A 1NSHA 5I2LA 4IL1A 1IH0A 3PN7C 1DJHA 2MHHA 3VRQA 2EC6C 5PALA 1B1GA 2ISDA 1NX3A 5HKYA 2M1UA 3OB1B 1CMFA 1DJGA 3DVEA 3VROA 2JTTA 4PDZA 1YUUA 1J1EA 3A4UB 3PN7B 1B8LA 1IRJA 1YUTA 2I2RE 4MN0A 2EC6B 3NSOA 3KPXA 3SG2A 4CFQA 4YI9A 1TRFA 4DIRA 1R6PA 1L7ZA 1S6CA 2JXLA 3IF7A 1BU3A 4XJKB 3OP0A 2KAYA 4A4BA 1CDNA 1S36A 4OVNF 3JTDB 2M1KB 1MR8A 2M49B 3E3RA 4HRHA 2F2PA 1KFXL 1B8RA 1PRWA 2AUCA 2BBMA 3I5GC 4U8DA 1KSOA 3EK8A 1XFZO 2BECA 4MLWA 4I5NB 1EG3A 5TNCA 2K0JA 5HKZA 2E6WA 4ORAB 2JWWA 3I5GB 5FYXA 5K89A 1AK8A 2OTGC 1S5GY 1QS7A 1TTXA 2KNEA 1S3PA 2CCMA 2GGZA 3BUOB 4FTGA 3TDIA 2Q4UA 1YURA 4N1GA 1JF0A 2OTGB 1TNXA 1CDMA 1S26D 3GK2A 1NUBA 2PALA 1NWDA 4WQ2A 3SG6A 3TZ1A 1LXFC 4FQOA 3SG7A 2LLUA 3QRXA 1E8AA 3BUWB 2LUCA 1LVCD 5HYDA 1DJXA 1ZFSA 2LMVA 4MBEA 1SKTA 4ZCVA 1QIVA 1A4PA 3BUMB 4C0LA 2JT3A 1K9KA 2M0RA 3CZTX 2M97A 1PALA 1PULA 2M7NA 3PSRA 1F4OA 2CT9A 2WCBA 1BR4B 1XK4A 4M2QA 2L0PA 2LVKA 3DVKA 1EXRA 1IGVA 3O6BA 2M7LA 3CS1A 3DVJA 1XFYO 1Y0VH 1OMRA 5J3XA 4OCIA 4E68A 3AAKA 5HKWA 3EVUA 4PHNA 1J7RA 1EL4A 4BY4A 3ZWHA 4DRWA 1F54A 2BCXA 2JRFA 4OV2A 1UP5A 3I5HC 3IQQA 1AJ4A 1KQMC 1MF8B 4QJ5B 4ORCB 5CPVA 3KEVA 5JOLA 1XK4C 1Y1XA 2L4IA 1DJZA 2ZFDA 3M0WA 2HF5A 2L4HA 2G9BA 3I5HB 4PE4A 1CM1A 1YX8A 2FOTA 3BOWA 1NX1A 2JZIA 1BF5A 1WRKA 1CDPA 4N1FA 2F8PA 1KFXS 1DJYA 1SL7A 2F3ZA 1G4YR 2H2KA 1BR1B 1PVAA 1S5GZ 2LLTA 3DF0A 1QV1A 1IWQA 2AAOA 1S6JA 3VRPA 1QATA 3EVRA 3FIAA 1YX7A 2WCEA 4MSPA 3LK0A 3CGAA 1JC2A 4ORBB 3CR2A 1ZOTB 1L2OC 1ZACA 1GJYA 1QX2A 4I5KA 4JQ0D 4QJ4B 3KHEA 1BMOA 2BKIB 4MZKA 1KK7Y 1KWOC 3BOWB 1UHHA 4I5LB 1WLMA 4NQGA 4GFTA 2VRGA 1XFWO 2MRDA 1FW4A 5DKQA 1QXPA 1L2OB 1RFJA 2HQ8A 1SMGA 1GGZA 1WDCC 2FJUB 4XJKA 2SCPA 5CSJA 1XA5A 2NCOA 1K94A 1UHKA 1Q80A 1KWOB 1UWOA 3DF0B 2FCEA 2JT0A 3F45A 3LL8B 3SJSA 1D1OA 4CIDA 4ETOA 2L2EA 1F55A 5B8IB 5HLOA 5KTYA 1UHIA 1WDCB 1SYMA 1LA3A 1NYAA 2K2FA 2SASA 1CNPA 2WCFA 1OE9B 1CTRA 1RECA 3JTDC 2LV7A 3FS7A 1CB1A 3LCPC 1CM4A 1J55A 1B47A 2JNFA 1MHOA 2WORA 1IKUA 3CTNA 1TNWA 3OX6A 1J7OA 1YVHA 3GK4X 1BG1A 4AOMA 1QV0A 1OZOA 2LMUA 4I5JA 3FWCA 1M46A 1YTZC 3NSLA 1SW8A 2KBIA 4DUQA 2BL0C 5ER4X 4UPGA 3EKJA 4NDCA 4C0JA 3MSEB 3WHTB 2NCPA 2KBMA 5JJGA 1F70A 2JPTA 1SK6D 1BOCA 4MZJA 1KFUL 4Q04A 4AQIA 1PVBA 1K2HA 4MRXA 2BL0B 1RWYA 2KHNA 1KK7Z 2CTNA 1X02A 2ZNEA 4PE0A 1FPWA 1H8BA 4PALA 2HETA 2BCBA 4YGEB 2GV5A 1LA0A 2JU0A 3LLEA 1QX5B 2F2OA 1A75B 1OZSA 2ZN9A 4JWQA 4PE1A 3CLNA 4MEWA 2PRUA 1K95A 1N2DA 2NLNA 1DGUA 2F3YA 2K2AA 3O2PA 1SL9A 3VGOA 1K9UA 1N65A 2PSRA 4MZLA 2CXJA 3LK1A 1JUOA 2JQ6A 2JTZA 5AERA 4M2PA 5AFPA 4GUKA 3I5IC 1RTP1 2LHIA 2GGMA 1YUSA 1V1FA 2JNXA 2I94A 1GQMA 3VRRA 5I8NA 1N0YA 2PVBA 3ZNIA 1G8IA 3K21A 3OHMB 1UHNA 2LVIA 3I5IB 4HREE 4MVFA 1M63B 2LANA 2A4JA 1NCYA 1OSAA 1CFFA 2KI6D 3WXAA 4PHJA 1M45A 2KDHA 3D0YA 3DVMA 1IJ5A 2KQYA 3H4SE 1WRLA 4N5XA 2OS8C 1S1EA 5CSNA 1B7TY 2ZNDA 2P6BB 1FF1A 1A03A 1B4CA 2M8UA 4HRGA 1EG4A 1BT6A 4P5OE 2E30A 2Y4QA 2WOSA 2OS8B 2Y1MA 1DF0B 2L50A 2EGDA 1V1GA 1IQ3A 5F6TA 3SG3A 1IG5A 1FI5A 1JWDA 1WRZA 5IBWA 2PMYA 3FWBA 4YBHB 3WHUB 3PALA 1M39A 1NPQA 3DD4A 3NSKA 4WQ3A 2CNPA 3BUNB 1MWNA 1B9AA 2KYCA 1B8CA 1F8HA 2PASA 1LINA 1WLZA 1A2XA 1G33A 5AANA 1CKKA 2BKHB 3D0YB 4R1EA 1CLBA 1QLKA 2K8MB 1SR6C 1AVSA 2LM5A 1QJTA 3CR4X 2FCDA 1SL8A 2O60A 1YRUB 4CPVA 4PHMA 2MJWB 2WC8A 1JF2A 1IQ5A 3AKBA 1XFUO 1K9PA 5D7FA 1CFDA 3RLZA 4C0KA 1SR6B 1JFKA 1OQPA 2IS9A 3AKAA 4GGNA 5KU1A 2K7DA 2WNDA 2LMTA 4WRIA 1MXEA 4GBAA 1JBAA 1ZMZA 2BBNA 4CFRA 4TNCA 1F71A 2I7AA 4QJ3B 1WY9A 2Y5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVV A;  1TN4 A;  1ALV A;  4YGD B;  2F33 A;  1K90 D;  4ICB A;  5CSI A;  2K61 A;  1KCY A;  1EH2 A;  4L9M A;  1U5I B;  1W7J B;  1JFJ A;  1DVI A;  1TNP A;  3JVT B;  2G2B A;  2KI4 B;  1H4B A;  1IJ6 A;  2LNK A;  4XYN A;  2R2I A;  1B7T Z;  2KGR A;  3EVV A;  2M3W A;  1MQ1 A;  3BYA A;  1TCF A;  1CLL A;  3PFV A;  1A75 A;  1DJW A;  2KSP A;  2LLS A;  1ALW A;  4NDD A;  4JPZ B;  2AMI A;  2I18 A;  4PCW A;  1MXL C;  2MLF C;  1DMO A;  1BJF A;  4M2O A;  1UUR A;  1CFP A;  2K7C A;  2KFH A;  3BXK A;  1RRO A;  3NSI A;  5AXI A;  1EJ3 A;  1S6I A;  2JUL A;  1QAS A;  1A29 A;  2JXC A;  1R2U A;  2ZN8 A;  4OKH A;  2L98 A;  2ZKM X;  1JSA A;  1M31 A;  4HSZ A;  1XFV O;  1LKJ A;  3KF9 A;  2D8N A;  1TCO B;  3VRN A;  1QTX A;  1YR5 A;  3TDU A;  1NP8 A;  2KYF A;  3BQ3 A;  3BUX B;  2KFG A;  2B1U A;  5G08 A;  3O78 A;  1AHR A;  1SBJ A;  4DCK A;  1SPY A;  1RK9 A;  1QVI Y;  1TOP A;  4OR9 B;  2O5G A;  2DOQ A;  3OX5 A;  1AP4 A;  3CR5 X;  3GOF A;  2L51 A;  4NDB A;  2LE9 B;  4YGC B;  1J7Q A;  1BLQ A;  1DTL A;  5DKR A;  4D1E A;  2MLE C;  1NIW A;  2HPS A;  3WNX B;  1NX0 A;  1OOJ A;  2LCP A;  2KAV A;  2LHL A;  1YVL A;  4GGF A;  1C7W A;  3PLF B;  1CMG A;  1DF0 A;  2MBX A;  2BCA A;  2ZRS A;  1SCM C;  1SCV A;  1K93 D;  1OMV A;  2KAX A;  3IQO A;  1XFX O;  1CLM A;  1FBV A;  1DT7 B;  3C1V A;  2QPT A;  4CLN A;  4GAO A;  1K8U A;  2L5X B;  1KSM A;  3SIB A;  2RGI A;  4YGA A;  2TN4 A;  2CBL A;  2KI6 C;  1VRK A;  1SCM B;  2H61 A;  2LUX A;  4GNK B;  3RM1 A;  3KO0 A;  4A4C A;  1J1D A;  2M9G A;  3CWG A;  1NCX A;  3EKH A;  3PM8 A;  4PHK A;  4GGF C;  3ICB A;  1C07 A;  2HQW A;  1FI6 A;  1OMD A;  3SIA A;  1DJI A;  2KOT A;  2EHB A;  2MA2 A;  1CDL A;  2LVJ A;  5D69 A;  2LAP A;  3HCM A;  2COL B;  5DKN A;  4YGB B;  1SY9 A;  1PSB A;  3A8R A;  2QAC A;  1KK8 C;  4YI8 A;  2OPO A;  4P2Y B;  5AEQ A;  5ER5 A;  1QLS A;  1XVJ A;  2H61 C;  5I2Q A;  5GQQ C;  1QX7 A;  1SRA A;  1CFC A;  5I2O A;  1NCZ A;  4DS7 A;  3PAT A;  1BOD A;  1TNQ A;  1Y6W A;  1Y1U A;  1KK8 B;  4BY5 A;  2KQ6 A;  4F0Z B;  5CSF A;  2LP2 A;  1PSR A;  3OB2 B;  1KFU S;  1RJV A;  1J7P A;  2KFF A;  3HX4 A;  1XYD A;  1KQM B;  5BPJ A;  2JC2 A;  1GGW A;  4GPL B;  1QVI Z;  1U5I A;  2NZ0 A;  1K96 A;  3SG4 A;  3TS5 C;  3AAJ A;  1C7V A;  1DGV A;  1Y1A A;  4ZCU A;  1YRT B;  3GK1 A;  3TUY C;  3SG5 A;  3O4Y A;  1ODB A;  1UHJ A;  2MAZ A;  4USL A;  1ZUZ A;  3I5F C;  4AQJ A;  1AJ5 A;  1TIZ A;  3TS5 B;  2K7O A;  2LP3 A;  4PE7 A;  2NXQ A;  1AUI B;  1MUX A;  2JOJ A;  3TUY B;  1HQV A;  1SNL A;  1HT9 A;  2KGB C;  2ZRT A;  1W7I B;  2BE6 A;  3D10 A;  3JVT C;  3I5F B;  2KI4 C;  4MRY A;  1KQV A;  1UUS A;  5KSZ A;  5HLV A;  3NXA A;  3TDZ A;  1XO5 A;  1QIW A;  2JT8 A;  2K7B A;  2Y1N A;  2LC5 A;  4YRU A;  2V53 A;  3EK4 A;  1PK0 D;  2Q91 A;  2M29 A;  1F4Q A;  1NX2 A;  2BE4 A;  3EK7 A;  1NSH A;  5I2L A;  4IL1 A;  1IH0 A;  3PN7 C;  1DJH A;  2MHH A;  3VRQ A;  2EC6 C;  5PAL A;  1B1G A;  2ISD A;  1NX3 A;  5HKY A;  2M1U A;  3OB1 B;  1CMF A;  1DJG A;  3DVE A;  3VRO A;  2JTT A;  4PDZ A;  1YUU A;  1J1E A;  3A4U B;  3PN7 B;  1B8L A;  1IRJ A;  1YUT A;  2I2R E;  4MN0 A;  2EC6 B;  3NSO A;  3KPX A;  3SG2 A;  4CFQ A;  4YI9 A;  1TRF A;  4DIR A;  1R6P A;  1L7Z A;  1S6C A;  2JXL A;  3IF7 A;  1BU3 A;  4XJK B;  3OP0 A;  2KAY A;  4A4B A;  1CDN A;  1S36 A;  4OVN F;  3JTD B;  2M1K B;  1MR8 A;  2M49 B;  3E3R A;  4HRH A;  2F2P A;  1KFX L;  1B8R A;  1PRW A;  2AUC A;  2BBM A;  3I5G C;  4U8D A;  1KSO A;  3EK8 A;  1XFZ O;  2BEC A;  4MLW A;  4I5N B;  1EG3 A;  5TNC A;  2K0J A;  5HKZ A;  2E6W A;  4ORA B;  2JWW A;  3I5G B;  5FYX A;  5K89 A;  1AK8 A;  2OTG C;  1S5G Y;  1QS7 A;  1TTX A;  2KNE A;  1S3P A;  2CCM A;  2GGZ A;  3BUO B;  4FTG A;  3TDI A;  2Q4U A;  1YUR A;  4N1G A;  1JF0 A;  2OTG B;  1TNX A;  1CDM A;  1S26 D;  3GK2 A;  1NUB A;  2PAL A;  1NWD A;  4WQ2 A;  3SG6 A;  3TZ1 A;  1LXF C;  4FQO A;  3SG7 A;  2LLU A;  3QRX A;  1E8A A;  3BUW B;  2LUC A;  1LVC D;  5HYD A;  1DJX A;  1ZFS A;  2LMV A;  4MBE A;  1SKT A;  4ZCV A;  1QIV A;  1A4P A;  3BUM B;  4C0L A;  2JT3 A;  1K9K A;  2M0R A;  3CZT X;  2M97 A;  1PAL A;  1PUL A;  2M7N A;  3PSR A;  1F4O A;  2CT9 A;  2WCB A;  1BR4 B;  1XK4 A;  4M2Q A;  2L0P A;  2LVK A;  3DVK A;  1EXR A;  1IGV A;  3O6B A;  2M7L A;  3CS1 A;  3DVJ A;  1XFY O;  1Y0V H;  1OMR A;  5J3X A;  4OCI A;  4E68 A;  3AAK A;  5HKW A;  3EVU A;  4PHN A;  1J7R A;  1EL4 A;  4BY4 A;  3ZWH A;  4DRW A;  1F54 A;  2BCX A;  2JRF A;  4OV2 A;  1UP5 A;  3I5H C;  3IQQ A;  1AJ4 A;  1KQM C;  1MF8 B;  4QJ5 B;  4ORC B;  5CPV A;  3KEV A;  5JOL A;  1XK4 C;  1Y1X A;  2L4I A;  1DJZ A;  2ZFD A;  3M0W A;  2HF5 A;  2L4H A;  2G9B A;  3I5H B;  4PE4 A;  1CM1 A;  1YX8 A;  2FOT A;  3BOW A;  1NX1 A;  2JZI A;  1BF5 A;  1WRK A;  1CDP A;  4N1F A;  2F8P A;  1KFX S;  1DJY A;  1SL7 A;  2F3Z A;  1G4Y R;  2H2K A;  1BR1 B;  1PVA A;  1S5G Z;  2LLT A;  3DF0 A;  1QV1 A;  1IWQ A;  2AAO A;  1S6J A;  3VRP A;  1QAT A;  3EVR A;  3FIA A;  1YX7 A;  2WCE A;  4MSP A;  3LK0 A;  3CGA A;  1JC2 A;  4ORB B;  3CR2 A;  1ZOT B;  1L2O C;  1ZAC A;  1GJY A;  1QX2 A;  4I5K A;  4JQ0 D;  4QJ4 B;  3KHE A;  1BMO A;  2BKI B;  4MZK A;  1KK7 Y;  1KWO C;  3BOW B;  1UHH A;  4I5L B;  1WLM A;  4NQG A;  4GFT A;  2VRG A;  1XFW O;  2MRD A;  1FW4 A;  5DKQ A;  1QXP A;  1L2O B;  1RFJ A;  2HQ8 A;  1SMG A;  1GGZ A;  1WDC C;  2FJU B;  4XJK A;  2SCP A;  5CSJ A;  1XA5 A;  2NCO A;  1K94 A;  1UHK A;  1Q80 A;  1KWO B;  1UWO A;  3DF0 B;  2FCE A;  2JT0 A;  3F45 A;  3LL8 B;  3SJS A;  1D1O A;  4CID A;  4ETO A;  2L2E A;  1F55 A;  5B8I B;  5HLO A;  5KTY A;  1UHI A;  1WDC B;  1SYM A;  1LA3 A;  1NYA A;  2K2F A;  2SAS A;  1CNP A;  2WCF A;  1OE9 B;  1CTR A;  1REC A;  3JTD C;  2LV7 A;  3FS7 A;  1CB1 A;  3LCP C;  1CM4 A;  1J55 A;  1B47 A;  2JNF A;  1MHO A;  2WOR A;  1IKU A;  3CTN A;  1TNW A;  3OX6 A;  1J7O A;  1YVH A;  3GK4 X;  1BG1 A;  4AOM A;  1QV0 A;  1OZO A;  2LMU A;  4I5J A;  3FWC A;  1M46 A;  1YTZ C;  3NSL A;  1SW8 A;  2KBI A;  4DUQ A;  2BL0 C;  5ER4 X;  4UPG A;  3EKJ A;  4NDC A;  4C0J A;  3MSE B;  3WHT B;  2NCP A;  2KBM A;  5JJG A;  1F70 A;  2JPT A;  1SK6 D;  1BOC A;  4MZJ A;  1KFU L;  4Q04 A;  4AQI A;  1PVB A;  1K2H A;  4MRX A;  2BL0 B;  1RWY A;  2KHN A;  1KK7 Z;  2CTN A;  1X02 A;  2ZNE A;  4PE0 A;  1FPW A;  1H8B A;  4PAL A;  2HET A;  2BCB A;  4YGE B;  2GV5 A;  1LA0 A;  2JU0 A;  3LLE A;  1QX5 B;  2F2O A;  1A75 B;  1OZS A;  2ZN9 A;  4JWQ A;  4PE1 A;  3CLN A;  4MEW A;  2PRU A;  1K95 A;  1N2D A;  2NLN A;  1DGU A;  2F3Y A;  2K2A A;  3O2P A;  1SL9 A;  3VGO A;  1K9U A;  1N65 A;  2PSR A;  4MZL A;  2CXJ A;  3LK1 A;  1JUO A;  2JQ6 A;  2JTZ A;  5AER A;  4M2P A;  5AFP A;  4GUK A;  3I5I C;  1RTP 1;  2LHI A;  2GGM A;  1YUS A;  1V1F A;  2JNX A;  2I94 A;  1GQM A;  3VRR A;  5I8N A;  1N0Y A;  2PVB A;  3ZNI A;  1G8I A;  3K21 A;  3OHM B;  1UHN A;  2LVI A;  3I5I B;  4HRE E;  4MVF A;  1M63 B;  2LAN A;  2A4J A;  1NCY A;  1OSA A;  1CFF A;  2KI6 D;  3WXA A;  4PHJ A;  1M45 A;  2KDH A;  3D0Y A;  3DVM A;  1IJ5 A;  2KQY A;  3H4S E;  1WRL A;  4N5X A;  2OS8 C;  1S1E A;  5CSN A;  1B7T Y;  2ZND A;  2P6B B;  1FF1 A;  1A03 A;  1B4C A;  2M8U A;  4HRG A;  1EG4 A;  1BT6 A;  4P5O E;  2E30 A;  2Y4Q A;  2WOS A;  2OS8 B;  2Y1M A;  1DF0 B;  2L50 A;  2EGD A;  1V1G A;  1IQ3 A;  5F6T A;  3SG3 A;  1IG5 A;  1FI5 A;  1JWD A;  1WRZ A;  5IBW A;  2PMY A;  3FWB A;  4YBH B;  3WHU B;  3PAL A;  1M39 A;  1NPQ A;  3DD4 A;  3NSK A;  4WQ3 A;  2CNP A;  3BUN B;  1MWN A;  1B9A A;  2KYC A;  1B8C A;  1F8H A;  2PAS A;  1LIN A;  1WLZ A;  1A2X A;  1G33 A;  5AAN A;  1CKK A;  2BKH B;  3D0Y B;  4R1E A;  1CLB A;  1QLK A;  2K8M B;  1SR6 C;  1AVS A;  2LM5 A;  1QJT A;  3CR4 X;  2FCD A;  1SL8 A;  2O60 A;  1YRU B;  4CPV A;  4PHM A;  2MJW B;  2WC8 A;  1JF2 A;  1IQ5 A;  3AKB A;  1XFU O;  1K9P A;  5D7F A;  1CFD A;  3RLZ A;  4C0K A;  1SR6 B;  1JFK A;  1OQP A;  2IS9 A;  3AKA A;  4GGN A;  5KU1 A;  2K7D A;  2WND A;  2LMT A;  4WRI A;  1MXE A;  4GBA A;  1JBA A;  1ZMZ A;  2BBN A;  4CFR A;  4TNC A;  1F71 A;  2I7A A;  4QJ3 B;  1WY9 A;  2Y5I A; 
#chains in the Genus database with same CATH topology
 3R1V A;  2H8V A;  2BNX A;  1TN4 A;  2LVV A;  2QEV A;  1ALV A;  4YGD B;  2F33 A;  1K90 D;  4ICB A;  5CSI A;  2K61 A;  1KCY A;  1EH2 A;  4L9M A;  1U5I B;  1W7J B;  1JFJ A;  1DVI A;  1TNP A;  3JVT B;  3NHT A;  2WCM A;  2G2B A;  2KI4 B;  1H4B A;  1IJ6 A;  2LNK A;  4XYN A;  2R2I A;  1B7T Z;  3K1E A;  2KGR A;  3EVV A;  2M3W A;  3R1O A;  1MQ1 A;  3BYA A;  1TCF A;  1CLL A;  3PFV A;  1A75 A;  1DJW A;  2KSP A;  2LLS A;  1ALW A;  4NDD A;  4JPZ B;  3SS5 A;  3EG5 B;  2AMI A;  2I18 A;  4PCW A;  1MXL C;  2MLF C;  1DMO A;  1BJF A;  4M2O A;  1UUR A;  1CFP A;  2K7C A;  3D78 A;  2KFH A;  3BXK A;  5FI7 A;  1RRO A;  3NSI A;  5AXI A;  1EJ3 A;  1S6I A;  2JUL A;  1QAS A;  1A29 A;  2JXC A;  1R2U A;  2ZN8 A;  4OKH A;  2L98 A;  2ZKM X;  1JSA A;  1M31 A;  3D76 A;  1XFV O;  4HSZ A;  1LKJ A;  3KF9 A;  2D8N A;  1TCO B;  3VRN A;  1QTX A;  1YR5 A;  3TDU A;  1NP8 A;  2KYF A;  3BQ3 A;  3BUX B;  2KFG A;  2B1U A;  5G08 A;  3O78 A;  1AHR A;  1SBJ A;  4DCK A;  1SPY A;  1RK9 A;  3DY9 A;  1QVI Y;  1TOP A;  4OR9 B;  2O5G A;  2DOQ A;  1LS8 A;  3OX5 A;  1AP4 A;  3CR5 X;  3GOF A;  2L51 A;  4NDB A;  2LE9 B;  4YGC B;  1J7Q A;  1TUJ A;  4INX A;  1BLQ A;  1DTL A;  5DKR A;  4D1E A;  2MLE C;  1NIW A;  2HPS A;  3WNX B;  3DYE A;  1NX0 A;  1OOJ A;  1DC1 A;  3BFH A;  2LCP A;  2KAV A;  2LHL A;  1YVL A;  4GGF A;  1C7W A;  3PLF B;  1CMG A;  2KLD A;  1DF0 A;  2MBX A;  2BCA A;  2ZRS A;  1SCM C;  1SCV A;  1K93 D;  1OMV A;  2KAX A;  1OW4 A;  3BFA A;  3IQO A;  4INW A;  1XFX O;  1CLM A;  1FBV A;  1DT7 B;  3C1V A;  2QPT A;  4CLN A;  4GAO A;  1K8U A;  2L5X B;  1KSM A;  3SIB A;  2RGI A;  4YGA A;  2TN4 A;  2CBL A;  5FI6 A;  2KI6 C;  1VRK A;  1SCM B;  2H61 A;  2LUX A;  4GNK B;  3RM1 A;  3KO0 A;  5DIC A;  4A4C A;  1J1D A;  2M9G A;  3CWG A;  1NCX A;  3EKH A;  3PM8 A;  4PHK A;  4GGF C;  3ICB A;  1C07 A;  2HQW A;  1FI6 A;  1OMD A;  3SIA A;  1DJI A;  2KOT A;  3BJH A;  2EHB A;  2MA2 A;  1CDL A;  2LVJ A;  5D69 A;  2LAP A;  3HCM A;  2COL B;  2WC5 A;  5DKN A;  4YGB B;  1SY9 A;  1PSB A;  3A8R A;  2QAC A;  1KK8 C;  4YI8 A;  2OPO A;  4P2Y B;  5AEQ A;  5EL2 A;  5ER5 A;  1QLS A;  1XVJ A;  2H61 C;  5I2Q A;  5GQQ C;  1QX7 A;  1SRA A;  1CFC A;  3SS3 A;  1NCZ A;  4DS7 A;  3PAT A;  5I2O A;  1TNQ A;  1Y6W A;  1Y1U A;  1KK8 B;  4BY5 A;  1BOD A;  2KQ6 A;  4F0Z B;  5CSF A;  2LP2 A;  1PSR A;  3OB2 B;  1KFU S;  1RJV A;  1J7P A;  2KFF A;  3HX4 A;  1XYD A;  1KQM B;  2YGU A;  2JC2 A;  5BPJ A;  4GPL B;  1GGW A;  1QVI Z;  1U5I A;  2NZ0 A;  1K96 A;  3SG4 A;  3TS5 C;  3R72 A;  3AAJ A;  1C7V A;  1DGV A;  1Y1A A;  4ZCU A;  3CZ1 A;  1YRT B;  3GK1 A;  3TUY C;  3SG5 A;  3SS4 A;  3O4Y A;  1ODB A;  1UHJ A;  2MAZ A;  4USL A;  1ZUZ A;  3I5F C;  4AQJ A;  1AJ5 A;  2WCH A;  1TIZ A;  3TS5 B;  2K7O A;  2LP3 A;  4PE7 A;  2NXQ A;  1AUI B;  1MUX A;  2JOJ A;  3TUY B;  1HQV A;  1SNL A;  1HT9 A;  2KGB C;  2ZRT A;  1W7I B;  2BE6 A;  3D10 A;  3JVT C;  3I5F B;  2KI4 C;  1DEK A;  4MRY A;  1KQV A;  1UUS A;  5KSZ A;  5HLV A;  2L5Y A;  3IVT A;  3NXA A;  3S0E A;  1XO5 A;  1QIW A;  2JT8 A;  2K7B A;  2Y1N A;  2LC5 A;  3TDZ A;  4YRU A;  1OOF A;  2V53 A;  3EK4 A;  1PK0 D;  2Q91 A;  2M29 A;  1F4Q A;  3S0A A;  1NX2 A;  2BE4 A;  3D75 A;  3EK7 A;  1NSH A;  1Z4H A;  1Z2C B;  5I2L A;  4IL1 A;  1IH0 A;  2PQL A;  3PN7 C;  1DJH A;  2MHH A;  3VRQ A;  2EC6 C;  5PAL A;  1B1G A;  3B86 A;  2ISD A;  1NX3 A;  5HKY A;  2FJY A;  2M1U A;  3OB1 B;  1CMF A;  1DJG A;  3DVE A;  3VRO A;  2JTT A;  4PDZ A;  3B7A A;  1YUU A;  1J1E A;  3A4U B;  3PN7 B;  1B8L A;  1IRJ A;  1YUT A;  2I2R E;  4MN0 A;  2EC6 B;  3NHI A;  3NSO A;  2K60 A;  3KPX A;  3SG2 A;  3CYZ A;  4CFQ A;  4YI9 A;  1TRF A;  4DIR A;  1R6P A;  2QDI A;  1L7Z A;  1S6C A;  2JXL A;  3IF7 A;  1BU3 A;  4XJK B;  3OGN A;  3OP0 A;  2KAY A;  4A4B A;  3CDN A;  1CDN A;  1S36 A;  4OVN F;  3QME A;  3JTD B;  2M1K B;  3VB1 A;  1MR8 A;  1OOG A;  2M49 B;  3E3R A;  4HRH A;  2F2P A;  1KFX L;  1B8R A;  1PRW A;  2AUC A;  2BBM A;  3I5G C;  1QWV A;  4U8D A;  4FQT A;  1KSO A;  1TWO A;  3EK8 A;  3UNW A;  1XFZ O;  2BEC A;  4MLW A;  4I5N B;  1EG3 A;  5TNC A;  2K0J A;  5HKZ A;  3DZT A;  2E6W A;  4ORA B;  2JWW A;  3I5G B;  5FYX A;  5K89 A;  1AK8 A;  2OTG C;  1S5G Y;  1QS7 A;  1TTX A;  2KNE A;  4KYN A;  1S3P A;  2CCM A;  2GGZ A;  3BUO B;  4FTG A;  3TDI A;  2Q4U A;  1YUR A;  5I94 A;  4N1G A;  2BAP A;  1JF0 A;  1C3Z A;  2OTG B;  1TNX A;  1CDM A;  1S26 D;  3GK2 A;  1NUB A;  2PAL A;  1NWD A;  2QEH A;  4WQ2 A;  3SG6 A;  3TZ1 A;  1LXF C;  4FQO A;  3SG7 A;  2LLU A;  3QRX A;  1E8A A;  3BUW B;  2LUC A;  1LVC D;  5HYD A;  1IIO A;  1DJX A;  1ZFS A;  2LMV A;  1ORG A;  3O4X A;  4MBE A;  1SKT A;  4ZCV A;  1QIV A;  1A4P A;  2JPO A;  3BUM B;  4C0L A;  2JT3 A;  1K9K A;  2M0R A;  3CZT X;  2M97 A;  1PAL A;  1PUL A;  2M7N A;  3PSR A;  1F4O A;  2CT9 A;  2WCB A;  1BR4 B;  1XK4 A;  3Q8I A;  4M2Q A;  2L0P A;  2LVK A;  3DVK A;  1EXR A;  1IGV A;  3O6B A;  2M7L A;  3CS1 A;  3DVJ A;  1XFY O;  1Y0V H;  1OMR A;  5J3X A;  4OCI A;  4E68 A;  3AAK A;  4F7F A;  5HKW A;  3EVU A;  4PHN A;  3D74 A;  1J7R A;  1EL4 A;  4BY4 A;  3ZWH A;  4DRW A;  1F54 A;  2BCX A;  2JRF A;  4OV2 A;  1UP5 A;  3I5H C;  3IQQ A;  1AJ4 A;  3PJI A;  1KQM C;  1MF8 B;  3L47 A;  4QJ5 B;  4ORC B;  5CPV A;  2ERB A;  3KEV A;  5JOL A;  1XK4 C;  1Y1X A;  2L4I A;  1DJZ A;  2ZFD A;  3M0W A;  2HF5 A;  2L4H A;  2G9B A;  2QEB A;  3I5H B;  4PE4 A;  1CM1 A;  1YX8 A;  2FOT A;  3BOW A;  1NX1 A;  2JZI A;  1BF5 A;  1WRK A;  3FE6 A;  1CDP A;  4N1F A;  2F8P A;  1KFX S;  3D73 A;  1XFR A;  1DJY A;  1SL7 A;  2F3Z A;  2KLE A;  1G4Y R;  2H2K A;  1BR1 B;  1PVA A;  1S5G Z;  2LLT A;  2QEO A;  3DF0 A;  1QV1 A;  1IWQ A;  1GM0 A;  2AAO A;  4JKT A;  1S6J A;  3VRP A;  1QAT A;  3EVR A;  3FIA A;  1YX7 A;  2WCE A;  4MSP A;  3LK0 A;  3CGA A;  1JC2 A;  4ORB B;  3CR2 A;  1ZOT B;  1L2O C;  1ZAC A;  1GJY A;  1QX2 A;  3PM2 A;  4OZD A;  4I5K A;  4JQ0 D;  4QJ4 B;  3KHE A;  1BMO A;  2WC6 A;  2BKI B;  4MZK A;  3S0D A;  1KK7 Y;  1KWO C;  3BOW B;  1UHH A;  4I5L B;  1WLM A;  4NQG A;  4GFT A;  2VRG A;  1XFW O;  3FE8 A;  2MRD A;  1FW4 A;  5DKQ A;  1QXP A;  1L2O B;  1RFJ A;  2HQ8 A;  1SMG A;  1GGZ A;  1WDC C;  2FJU B;  4XJK A;  2SCP A;  5CSJ A;  1XA5 A;  2NCO A;  3CZ0 A;  1K94 A;  1UHK A;  1Q80 A;  1KWO B;  1UWO A;  3DF0 B;  2FCE A;  2JT0 A;  3F45 A;  3LL8 B;  3SJS A;  1D1O A;  4CID A;  4ETO A;  2L2E A;  1F55 A;  2WCK A;  5B8I B;  5HLO A;  5KTY A;  1UHI A;  1WDC B;  3S0B A;  1SYM A;  1LA3 A;  4JD9 A;  1NYA A;  3CZ2 A;  3DXL A;  2K2F A;  2SAS A;  1CNP A;  2WCF A;  1OE9 B;  1CTR A;  1REC A;  3JTD C;  2LV7 A;  3FS7 A;  1CB1 A;  3LCP C;  1SSE B;  1CM4 A;  3B87 A;  1J55 A;  1B47 A;  2JNF A;  1MHO A;  2WOR A;  2WCJ A;  2KPH A;  1IKU A;  1DEL A;  3CTN A;  1TNW A;  3OX6 A;  1J7O A;  1YVH A;  3GK4 X;  1TUZ A;  1BG1 A;  4AOM A;  1QV0 A;  1OZO A;  2LMU A;  4I5J A;  3FWC A;  1M46 A;  1YTZ C;  3NSL A;  3B88 A;  1SW8 A;  2KBI A;  4DUQ A;  2BL0 C;  5ER4 X;  3R1P A;  4UPG A;  3EKJ A;  1OOH A;  4NDC A;  4C0J A;  3MSE B;  3WHT B;  2NCP A;  2KBM A;  5JJG A;  1F70 A;  5FI2 A;  2JPT A;  1SK6 D;  1BOC A;  4MZJ A;  1KFU L;  4Q04 A;  4AQI A;  1PVB A;  1K2H A;  4MRX A;  2BL0 B;  1RWY A;  2KHN A;  1KK7 Z;  2CTN A;  1X02 A;  2ZNE A;  4PE0 A;  1FPW A;  1H8B A;  4PAL A;  2HET A;  2BCB A;  4YGE B;  2GV5 A;  1LA0 A;  2JU0 A;  3LLE A;  1QX5 B;  2F2O A;  1A75 B;  1OZS A;  2ZN9 A;  3CAB A;  4JWQ A;  3CLN A;  4PE1 A;  4MEW A;  2PRU A;  1K95 A;  1N2D A;  2NLN A;  1DGU A;  1T14 A;  2F3Y A;  2GTE A;  2K2A A;  3O2P A;  1SL9 A;  2PYQ A;  3VGO A;  1K9U A;  1N65 A;  1P28 A;  2PSR A;  3N7H A;  2CXJ A;  4MZL A;  3L4A A;  3LK1 A;  1C3Y A;  1DQE A;  1JUO A;  2JQ6 A;  2JTZ A;  5AER A;  4M2P A;  5AFP A;  4GUK A;  3I5I C;  1RTP 1;  2LHI A;  2GGM A;  1YUS A;  1V1F A;  2JNX A;  2I94 A;  1GQM A;  3VRR A;  5I8N A;  1N0Y A;  2PVB A;  3ZNI A;  1G8I A;  3K21 A;  3OHM B;  1UHN A;  2LVI A;  3I5I B;  4HRE E;  4MVF A;  1M63 B;  2LAN A;  2A4J A;  1NCY A;  1OSA A;  1CFF A;  2KI6 D;  3WXA A;  4PHJ A;  1M45 A;  2KDH A;  3D0Y A;  3DVM A;  1IJ5 A;  2KQY A;  3H4S E;  1WRL A;  3FE9 A;  4N5X A;  2OS8 C;  1S1E A;  3D77 A;  5CSN A;  1B7T Y;  2ZND A;  2P6B B;  3RZS A;  1FF1 A;  1A03 A;  4PT1 A;  2M8U A;  1B4C A;  4HRG A;  1EG4 A;  1BT6 A;  4IJ7 A;  3B6X A;  4P5O E;  2E30 A;  1W9Z A;  2Y4Q A;  2WOS A;  5HL1 A;  1OOI X;  3BFB A;  2OS8 B;  2Y1M A;  1DF0 B;  2L50 A;  2EGD A;  1V1G A;  1IQ3 A;  5F6T A;  3SG3 A;  1IG5 A;  1FI5 A;  1JWD A;  1WRZ A;  5IBW A;  2PMY A;  3FWB A;  4YBH B;  3WHU B;  3PAL A;  1M39 A;  1NPQ A;  3DD4 A;  3NSK A;  4WQ3 A;  2CNP A;  3BUN B;  1MWN A;  1B9A A;  3L4L A;  2KYC A;  1B8C A;  1F8H A;  2PAS A;  3NGV A;  1LIN A;  1WLZ A;  1A2X A;  1G33 A;  5AAN A;  3S0F A;  2BKH B;  3D0Y B;  4R1E A;  1CKK A;  3V2L A;  1QLK A;  2P71 A;  1CLB A;  2K8M B;  1SR6 C;  3OBV A;  1AVS A;  2LM5 A;  1QJT A;  3CR4 X;  2FCD A;  3S0G A;  1SL8 A;  2O60 A;  1YRU B;  4CPV A;  5D3O A;  4PHM A;  2MJW B;  2WC8 A;  1JF2 A;  1IQ5 A;  2WCL A;  1XFU O;  3AKB A;  2P70 A;  3UO9 A;  1K9P A;  5D7F A;  1CFD A;  3RLZ A;  4C0K A;  1SR6 B;  1JFK A;  1OQP A;  2IS9 A;  3AKA A;  4GGN A;  5KU1 A;  2K7D A;  2WND A;  2LMT A;  4WRI A;  1MXE A;  4GBA A;  1JBA A;  1ZMZ A;  2BBN A;  4CFR A;  4TNC A;  2L2C A;  1F71 A;  2I7A A;  4QJ3 B;  1WY9 A;  2Y5I A; 
#chains in the Genus database with same CATH homology
 2LVV A;  1TN4 A;  1ALV A;  4YGD B;  2F33 A;  1K90 D;  4ICB A;  5CSI A;  2K61 A;  1KCY A;  1EH2 A;  4L9M A;  1U5I B;  1W7J B;  1JFJ A;  1DVI A;  1TNP A;  3JVT B;  2G2B A;  2KI4 B;  1H4B A;  1IJ6 A;  2LNK A;  4XYN A;  2R2I A;  1B7T Z;  2KGR A;  3EVV A;  2M3W A;  1MQ1 A;  3BYA A;  1TCF A;  1CLL A;  3PFV A;  1A75 A;  1DJW A;  2KSP A;  2LLS A;  1ALW A;  4NDD A;  4JPZ B;  2AMI A;  2I18 A;  4PCW A;  1MXL C;  2MLF C;  1DMO A;  1BJF A;  4M2O A;  1UUR A;  1CFP A;  2K7C A;  2KFH A;  3BXK A;  1RRO A;  3NSI A;  5AXI A;  1EJ3 A;  1S6I A;  2JUL A;  1QAS A;  1A29 A;  2JXC A;  1R2U A;  2ZN8 A;  4OKH A;  2L98 A;  2ZKM X;  1JSA A;  1M31 A;  4HSZ A;  1XFV O;  1LKJ A;  3KF9 A;  2D8N A;  1TCO B;  3VRN A;  1QTX A;  1YR5 A;  3TDU A;  1NP8 A;  2KYF A;  3BQ3 A;  3BUX B;  2KFG A;  2B1U A;  5G08 A;  3O78 A;  1AHR A;  1SBJ A;  4DCK A;  1SPY A;  1RK9 A;  1QVI Y;  1TOP A;  4OR9 B;  2O5G A;  2DOQ A;  3OX5 A;  1AP4 A;  3CR5 X;  3GOF A;  2L51 A;  4NDB A;  2LE9 B;  4YGC B;  1J7Q A;  1BLQ A;  1DTL A;  5DKR A;  4D1E A;  2MLE C;  1NIW A;  2HPS A;  3WNX B;  1NX0 A;  1OOJ A;  2LCP A;  2KAV A;  2LHL A;  1YVL A;  4GGF A;  1C7W A;  3PLF B;  1CMG A;  1DF0 A;  2MBX A;  2BCA A;  2ZRS A;  1SCM C;  1SCV A;  1K93 D;  1OMV A;  2KAX A;  3IQO A;  1XFX O;  1CLM A;  1FBV A;  1DT7 B;  3C1V A;  2QPT A;  4CLN A;  4GAO A;  1K8U A;  2L5X B;  1KSM A;  3SIB A;  2RGI A;  4YGA A;  2TN4 A;  2CBL A;  2KI6 C;  1VRK A;  1SCM B;  2H61 A;  2LUX A;  4GNK B;  3RM1 A;  3KO0 A;  4A4C A;  1J1D A;  2M9G A;  3CWG A;  1NCX A;  3EKH A;  3PM8 A;  4PHK A;  4GGF C;  3ICB A;  1C07 A;  2HQW A;  1FI6 A;  1OMD A;  3SIA A;  1DJI A;  2KOT A;  2EHB A;  2MA2 A;  1CDL A;  2LVJ A;  5D69 A;  2LAP A;  3HCM A;  2COL B;  5DKN A;  4YGB B;  1SY9 A;  1PSB A;  3A8R A;  2QAC A;  1KK8 C;  4YI8 A;  2OPO A;  4P2Y B;  5AEQ A;  5ER5 A;  1QLS A;  1XVJ A;  2H61 C;  5I2Q A;  5GQQ C;  1QX7 A;  1SRA A;  1CFC A;  5I2O A;  1NCZ A;  4DS7 A;  3PAT A;  1BOD A;  1TNQ A;  1Y6W A;  1Y1U A;  1KK8 B;  4BY5 A;  2KQ6 A;  4F0Z B;  5CSF A;  2LP2 A;  1PSR A;  3OB2 B;  1KFU S;  1RJV A;  1J7P A;  2KFF A;  3HX4 A;  1XYD A;  1KQM B;  5BPJ A;  2JC2 A;  1GGW A;  4GPL B;  1QVI Z;  1U5I A;  2NZ0 A;  1K96 A;  3SG4 A;  3TS5 C;  3AAJ A;  1C7V A;  1DGV A;  1Y1A A;  4ZCU A;  1YRT B;  3GK1 A;  3TUY C;  3SG5 A;  3O4Y A;  1ODB A;  1UHJ A;  2MAZ A;  4USL A;  1ZUZ A;  3I5F C;  4AQJ A;  1AJ5 A;  1TIZ A;  3TS5 B;  2K7O A;  2LP3 A;  4PE7 A;  2NXQ A;  1AUI B;  1MUX A;  2JOJ A;  3TUY B;  1HQV A;  1SNL A;  1HT9 A;  2KGB C;  2ZRT A;  1W7I B;  2BE6 A;  3D10 A;  3JVT C;  3I5F B;  2KI4 C;  4MRY A;  1KQV A;  1UUS A;  5KSZ A;  5HLV A;  3NXA A;  3TDZ A;  1XO5 A;  1QIW A;  2JT8 A;  2K7B A;  2Y1N A;  2LC5 A;  4YRU A;  2V53 A;  3EK4 A;  1PK0 D;  2Q91 A;  2M29 A;  1F4Q A;  1NX2 A;  2BE4 A;  3EK7 A;  1NSH A;  5I2L A;  4IL1 A;  1IH0 A;  3PN7 C;  1DJH A;  2MHH A;  3VRQ A;  2EC6 C;  5PAL A;  1B1G A;  2ISD A;  1NX3 A;  5HKY A;  2M1U A;  3OB1 B;  1CMF A;  1DJG A;  3DVE A;  3VRO A;  2JTT A;  4PDZ A;  1YUU A;  1J1E A;  3A4U B;  3PN7 B;  1B8L A;  1IRJ A;  1YUT A;  2I2R E;  4MN0 A;  2EC6 B;  3NSO A;  3KPX A;  3SG2 A;  4CFQ A;  4YI9 A;  1TRF A;  4DIR A;  1R6P A;  1L7Z A;  1S6C A;  2JXL A;  3IF7 A;  1BU3 A;  4XJK B;  3OP0 A;  2KAY A;  4A4B A;  1CDN A;  1S36 A;  4OVN F;  3JTD B;  2M1K B;  1MR8 A;  2M49 B;  3E3R A;  4HRH A;  2F2P A;  1KFX L;  1B8R A;  1PRW A;  2AUC A;  2BBM A;  3I5G C;  4U8D A;  1KSO A;  3EK8 A;  1XFZ O;  2BEC A;  4MLW A;  4I5N B;  1EG3 A;  5TNC A;  2K0J A;  5HKZ A;  2E6W A;  4ORA B;  2JWW A;  3I5G B;  5FYX A;  5K89 A;  1AK8 A;  2OTG C;  1S5G Y;  1QS7 A;  1TTX A;  2KNE A;  1S3P A;  2CCM A;  2GGZ A;  3BUO B;  4FTG A;  3TDI A;  2Q4U A;  1YUR A;  4N1G A;  1JF0 A;  2OTG B;  1TNX A;  1CDM A;  1S26 D;  3GK2 A;  1NUB A;  2PAL A;  1NWD A;  4WQ2 A;  3SG6 A;  3TZ1 A;  1LXF C;  4FQO A;  3SG7 A;  2LLU A;  3QRX A;  1E8A A;  3BUW B;  2LUC A;  1LVC D;  5HYD A;  1DJX A;  1ZFS A;  2LMV A;  4MBE A;  1SKT A;  4ZCV A;  1QIV A;  1A4P A;  3BUM B;  4C0L A;  2JT3 A;  1K9K A;  2M0R A;  3CZT X;  2M97 A;  1PAL A;  1PUL A;  2M7N A;  3PSR A;  1F4O A;  2CT9 A;  2WCB A;  1BR4 B;  1XK4 A;  4M2Q A;  2L0P A;  2LVK A;  3DVK A;  1EXR A;  1IGV A;  3O6B A;  2M7L A;  3CS1 A;  3DVJ A;  1XFY O;  1Y0V H;  1OMR A;  5J3X A;  4OCI A;  4E68 A;  3AAK A;  5HKW A;  3EVU A;  4PHN A;  1J7R A;  1EL4 A;  4BY4 A;  3ZWH A;  4DRW A;  1F54 A;  2BCX A;  2JRF A;  4OV2 A;  1UP5 A;  3I5H C;  3IQQ A;  1AJ4 A;  1KQM C;  1MF8 B;  4QJ5 B;  4ORC B;  5CPV A;  3KEV A;  5JOL A;  1XK4 C;  1Y1X A;  2L4I A;  1DJZ A;  2ZFD A;  3M0W A;  2HF5 A;  2L4H A;  2G9B A;  3I5H B;  4PE4 A;  1CM1 A;  1YX8 A;  2FOT A;  3BOW A;  1NX1 A;  2JZI A;  1BF5 A;  1WRK A;  1CDP A;  4N1F A;  2F8P A;  1KFX S;  1DJY A;  1SL7 A;  2F3Z A;  1G4Y R;  2H2K A;  1BR1 B;  1PVA A;  1S5G Z;  2LLT A;  3DF0 A;  1QV1 A;  1IWQ A;  2AAO A;  1S6J A;  3VRP A;  1QAT A;  3EVR A;  3FIA A;  1YX7 A;  2WCE A;  4MSP A;  3LK0 A;  3CGA A;  1JC2 A;  4ORB B;  3CR2 A;  1ZOT B;  1L2O C;  1ZAC A;  1GJY A;  1QX2 A;  4I5K A;  4JQ0 D;  4QJ4 B;  3KHE A;  1BMO A;  2BKI B;  4MZK A;  1KK7 Y;  1KWO C;  3BOW B;  1UHH A;  4I5L B;  1WLM A;  4NQG A;  4GFT A;  2VRG A;  1XFW O;  2MRD A;  1FW4 A;  5DKQ A;  1QXP A;  1L2O B;  1RFJ A;  2HQ8 A;  1SMG A;  1GGZ A;  1WDC C;  2FJU B;  4XJK A;  2SCP A;  5CSJ A;  1XA5 A;  2NCO A;  1K94 A;  1UHK A;  1Q80 A;  1KWO B;  1UWO A;  3DF0 B;  2FCE A;  2JT0 A;  3F45 A;  3LL8 B;  3SJS A;  1D1O A;  4CID A;  4ETO A;  2L2E A;  1F55 A;  5B8I B;  5HLO A;  5KTY A;  1UHI A;  1WDC B;  1SYM A;  1LA3 A;  1NYA A;  2K2F A;  2SAS A;  1CNP A;  2WCF A;  1OE9 B;  1CTR A;  1REC A;  3JTD C;  2LV7 A;  3FS7 A;  1CB1 A;  3LCP C;  1CM4 A;  1J55 A;  1B47 A;  2JNF A;  1MHO A;  2WOR A;  1IKU A;  3CTN A;  1TNW A;  3OX6 A;  1J7O A;  1YVH A;  3GK4 X;  1BG1 A;  4AOM A;  1QV0 A;  1OZO A;  2LMU A;  4I5J A;  3FWC A;  1M46 A;  1YTZ C;  3NSL A;  1SW8 A;  2KBI A;  4DUQ A;  2BL0 C;  5ER4 X;  4UPG A;  3EKJ A;  4NDC A;  4C0J A;  3MSE B;  3WHT B;  2NCP A;  2KBM A;  5JJG A;  1F70 A;  2JPT A;  1SK6 D;  1BOC A;  4MZJ A;  1KFU L;  4Q04 A;  4AQI A;  1PVB A;  1K2H A;  4MRX A;  2BL0 B;  1RWY A;  2KHN A;  1KK7 Z;  2CTN A;  1X02 A;  2ZNE A;  4PE0 A;  1FPW A;  1H8B A;  4PAL A;  2HET A;  2BCB A;  4YGE B;  2GV5 A;  1LA0 A;  2JU0 A;  3LLE A;  1QX5 B;  2F2O A;  1A75 B;  1OZS A;  2ZN9 A;  4JWQ A;  4PE1 A;  3CLN A;  4MEW A;  2PRU A;  1K95 A;  1N2D A;  2NLN A;  1DGU A;  2F3Y A;  2K2A A;  3O2P A;  1SL9 A;  3VGO A;  1K9U A;  1N65 A;  2PSR A;  4MZL A;  2CXJ A;  3LK1 A;  1JUO A;  2JQ6 A;  2JTZ A;  5AER A;  4M2P A;  5AFP A;  4GUK A;  3I5I C;  1RTP 1;  2LHI A;  2GGM A;  1YUS A;  1V1F A;  2JNX A;  2I94 A;  1GQM A;  3VRR A;  5I8N A;  1N0Y A;  2PVB A;  3ZNI A;  1G8I A;  3K21 A;  3OHM B;  1UHN A;  2LVI A;  3I5I B;  4HRE E;  4MVF A;  1M63 B;  2LAN A;  2A4J A;  1NCY A;  1OSA A;  1CFF A;  2KI6 D;  3WXA A;  4PHJ A;  1M45 A;  2KDH A;  3D0Y A;  3DVM A;  1IJ5 A;  2KQY A;  3H4S E;  1WRL A;  4N5X A;  2OS8 C;  1S1E A;  5CSN A;  1B7T Y;  2ZND A;  2P6B B;  1FF1 A;  1A03 A;  1B4C A;  2M8U A;  4HRG A;  1EG4 A;  1BT6 A;  4P5O E;  2E30 A;  2Y4Q A;  2WOS A;  2OS8 B;  2Y1M A;  1DF0 B;  2L50 A;  2EGD A;  1V1G A;  1IQ3 A;  5F6T A;  3SG3 A;  1IG5 A;  1FI5 A;  1JWD A;  1WRZ A;  5IBW A;  2PMY A;  3FWB A;  4YBH B;  3WHU B;  3PAL A;  1M39 A;  1NPQ A;  3DD4 A;  3NSK A;  4WQ3 A;  2CNP A;  3BUN B;  1MWN A;  1B9A A;  2KYC A;  1B8C A;  1F8H A;  2PAS A;  1LIN A;  1WLZ A;  1A2X A;  1G33 A;  5AAN A;  1CKK A;  2BKH B;  3D0Y B;  4R1E A;  1CLB A;  1QLK A;  2K8M B;  1SR6 C;  1AVS A;  2LM5 A;  1QJT A;  3CR4 X;  2FCD A;  1SL8 A;  2O60 A;  1YRU B;  4CPV A;  4PHM A;  2MJW B;  2WC8 A;  1JF2 A;  1IQ5 A;  3AKB A;  1XFU O;  1K9P A;  5D7F A;  1CFD A;  3RLZ A;  4C0K A;  1SR6 B;  1JFK A;  1OQP A;  2IS9 A;  3AKA A;  4GGN A;  5KU1 A;  2K7D A;  2WND A;  2LMT A;  4WRI A;  1MXE A;  4GBA A;  1JBA A;  1ZMZ A;  2BBN A;  4CFR A;  4TNC A;  1F71 A;  2I7A A;  4QJ3 B;  1WY9 A;  2Y5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...