1JFJA

Nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
b'MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
molecule tags Metal binding protein
source organism Entamoeba histolytica
publication title NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
pubmed doi rcsb
total genus 37
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA02
1S36A 3CR2A 1SK6D 4GGNA 1AHRA 1F4OA 3A8RA 2EC6C 3WHUB 2LVKA 1WDCC 5I8NA 5KU1A 1RROA 3KEVA 2FCEA 2WOSA 4IL1A 1QV1A 1HQVA 3EK4A 1UHHA 3CLNA 3KHEA 5CSJA 3SG4A 1F54A 2BKIB 2KQYA 1B8CA 3TDZA 1XFVO 1VRKA 2M3WA 1Y1UA 2JOJA 2M29A 1NPQA 1IJ5A 4OV2A 1L2OC 4MVFA 1QX5B 1MXLC 3BOWB 2PMYA 4TNCA 3TUYC 3CGAA 1YUUA 1J7PA 3PN7B 2JPTA 2LM5A 3BUXB 3E3RA 1SR6C 4L9MA 2JTTA 5CSIA 1JWDA 1R2UA 4YRUA 1KQMB 5HLVA 1Q80A 5AEQA 1ZMZA 1FI6A 1B47A 4XJKB 1K94A 4ZCVA 1OE9B 2K7OA 1QVIZ 1NCYA 2AUCA 4C0JA 2KI6D 1S6JA 2Y1MA 3SIBA 2JT8A 4ORBB 1FW4A 1K95A 4PALA 1KCYA 1CDPA 1FI5A 4PHJA 2KNEA 4UPGA 1LA0A 2BL0B 3CR4X 1SL9A 3FIAA 2BBNA 1A75A 5ER4X 1GJYA 2G9BA 1OSAA 1UHNA 3VGOA 1K9KA 1S3PA 1YVLA 2LNKA 3OX6A 1JF0A 1SCMC 4N1GA 1SMGA 1M39A 2LLUA 5HKYA 1ODBA 1SW8A 2L5XB 4JQ0D 1X02A 1YR5A 1IG5A 2JTZA 3BXKA 1J1DA 1A03A 3HX4A 1N65A 3AKBA 2E6WA 3F45A 4YGBB 1BG1A 3RM1A 2M7LA 4PE1A 1QASA 1SY9A 2KYFA 4MZKA 1CTRA 1RTP1 1ZOTB 2L4IA 3SG2A 3WHTB 2ZRSA 2I94A 1XO5A 4M2OA 3GK1A 1CDNA 2OS8C 1K90D 3DD4A 5AANA 1F8HA 1YRUB 1NUBA 1KWOB 4C0LA 1F70A 2LHLA 1LA3A 1JFJA 2D8NA 1QLSA 1YURA 2FJUB 1GGWA 1XA5A 1BR1B 4GFTA 1DTLA 1RWYA 2KOTA 1GGZA 4MLWA 1C07A 3EK8A 2P6BB 1S26D 1RECA 4HRGA 2LE9B 1TNXA 1SNLA 3ZWHA 1OOJA 5AFPA 3A4UB 2JNXA 2QACA 1SR6B 4MBEA 2ISDA 3I5HC 1ALVA 2BL0C 3NXAA 2JT0A 2LMUA 3I5GB 2WC8A 1N0YA 3GOFA 2GV5A 5KTYA 1IH0A 2OTGB 4ZCUA 2WNDA 1B8LA 4MSPA 1QTXA 1NP8A 2LVVA 1QIWA 1R6PA 2CNPA 1F71A 3NSLA 2F2OA 2MA2A 1A75B 2AMIA 4CIDA 2KDHA 1AJ5A 1LVCD 2NLNA 4PCWA 1U5IB 1CFCA 2HQWA 3DVJA 4OVNF 4A4BA 2OPOA 2PRUA 1KK8B 2BCAA 4M2QA 2KFFA 3BUOB 1IQ5A 1K9UA 3CZTX 2BE4A 3I5FB 3KPXA 4ORAB 3OHMB 2MRDA 1AUIB 3I5IC 4I5LB 1SKTA 3DF0B 4I5NB 2CTNA 3NSOA 1TTXA 1KK7Y 2M7NA 2BCBA 2HPSA 4MN0A 4D1EA 5TNCA 1J55A 1DMOA 4WQ2A 5DKNA 4OR9B 4C0KA 3AAKA 1UWOA 1J1EA 1N2DA 1DJZA 4XJKA 1KQVA 1B7TZ 1CMGA 1JF2A 1CLMA 2I2RE 1BMOA 4DUQA 1DJWA 1TCFA 2MAZA 1PVBA 4PHKA 2M8UA 1BLQA 2EC6B 2LCPA 1DVIA 2F3ZA 5CSNA 2ZKMX 3PATA 1ZACA 2MLEC 3EKJA 1Y1AA 1G4YR 2LVIA 2KAXA 3BQ3A 1AVSA 3OP0A 1XFZO 1K9PA 2KI6C 1J7RA 3RLZA 2Q4UA 4AOMA 4MRXA 1AK8A 2A4JA 1TNPA 4ORCB 2LV7A 1IRJA 4DS7A 2PASA 1SL7A 5DKQA 3WNXB 5B8IB 1PSBA 2KHNA 2KAYA 1DJXA 2K8MB 1TRFA 1BT6A 2LC5A 3LL8B 2NXQA 1NSHA 3TUYB 2JXLA 3CR5X 4P5OE 1CKKA 1EH2A 2L98A 2ZNDA 2H61A 3I5FC 2OTGC 3NSKA 1NCXA 1WLZA 3K21A 1MF8B 1B8RA 2LMTA 1C7WA 1LINA 1OZOA 1S5GZ 1ZFSA 2KGRA 3TZ1A 5BPJA 4DIRA 2IS9A 5D69A 1W7JB 2F2PA 1RK9A 3DVKA 2LLTA 2KSPA 1J7OA 1NWDA 2MHHA 2ZFDA 2KBMA 3PALA 3FWCA 1OMDA 2L4HA 2KQ6A 2HF5A 4I5KA 3SG7A 4XYNA 1PVAA 3GK4X 1D1OA 2COLB 3IQQA 4PHNA 1SPYA 1TCOB 1QIVA 1YUTA 1AJ4A 3EVVA 4OCIA 2CBLA 1PSRA 2LLSA 5J3XA 2F33A 1BJFA 2LP2A 4I5JA 3O78A 1G8IA 2WORA 4NDCA 1TOPA 2QPTA 5I2OA 1A29A 2JNFA 4MZLA 5HKZA 1G33A 2WCEA 4M2PA 2K2FA 3BUMB 4R1EA 1B4CA 2I18A 1CM1A 2K61A 2B1UA 1CFDA 1V1GA 2O60A 5JJGA 5ER5A 1QJTA 1J7QA 2KBIA 1NX2A 1YUSA 3TDIA 3H4SE 4WQ3A 1PRWA 1KWOC 1BODA 2KI4C 4JWQA 5D7FA 5IBWA 1H8BA 1RJVA 4HRHA 1FF1A 1QV0A 1CB1A 1SCVA 1CFFA 4ICBA 2BCXA 1K8UA 1NX3A 3KF9A 3I5IB 2JQ6A 1NX1A 2Y4QA 2SASA 3KO0A 1PALA 2E30A 2RGIA 3HCMA 1SL8A 2JZIA 4YI8A 1MR8A 1B7TY 3SG6A 2TN4A 3GK2A 2K7CA 2ZNEA 1JBAA 1M63B 1DJGA 3D10A 2MLFC 1WY9A 1KSOA 3SG5A 3BOWA 1F55A 4NQGA 1FBVA 1Y1XA 4N5XA 2KFGA 4CPVA 3JTDB 4DCKA 1EG4A 1OQPA 4U8DA 4ETOA 4Q04A 1BOCA 5CSFA 1DF0B 2NCPA 1V1FA 4MZJA 4JPZB 1MQ1A 2GGZA 3OB2B 1A2XA 1MWNA 2CCMA 4A4CA 1CM4A 2LANA 1TNQA 2O5GA 1FPWA 1EXRA 3BUNB 1H4BA 1WDCB 1KSMA 3O6BA 2L51A 2JT3A 1K93D 2K2AA 1CLBA 1NX0A 1XFUO 2H2KA 2GGMA 4GNKB 4YGDB 5HYDA 5I2LA 1WRLA 2M9GA 1UHIA 2V53A 3MSEB 1NYAA 1Y0VH 1M31A 5AERA 2EHBA 3IF7A 2HETA 5HLOA 1YVHA 1S1EA 2Y5IA 4OKHA 3JVTB 4GGFA 4QJ5B 4YI9A 1PK0D 3TS5B 1C7VA 1KK8C 1TN4A 3OX5A 3CS1A 4WRIA 1WRKA 1KFUL 2FCDA 3SIAA 1ALWA 1JFKA 2KFHA 2WCFA 5JOLA 1OMVA 1UHJA 4MEWA 4HREE 3SJSA 4USLA 1YRTB 2M49B 1CFPA 3FWBA 2JWWA 1LXFC 1LKJA 5FYXA 1CDLA 3ICBA 2HQ8A 4P2YB 3AKAA 2M1UA 4PHMA 2JXCA 4DRWA 3M0WA 3O2PA 3PN7C 1EG3A 1XYDA 1TNWA 3SG3A 2JULA 1DJHA 1W7IB 1XFYO 3C1VA 2ZRTA 2K7DA 2EGDA 4YGCB 1MXEA 2KGBC 1SBJA 3BUWB 3D0YA 4N1FA 4YGAA 2PALA 1M46A 4PE0A 3FS7A 5GQQC 1UHKA 3TDUA 2ZN9A 3DVMA 3DF0A 1UP5A 1YX7A 4GBAA 1Y6WA 3WXAA 2NCOA 1RFJA 3LCPC 5I2QA 4E68A 1IJ6A 1CNPA 1JSAA 1K2HA 2M0RA 4GPLB 2DOQA 1XFXO 1JUOA 2L2EA 2LVJA 2BBMA 4CLNA 3VRPA 1DF0A 3JVTC 1BU3A 1YX8A 5K89A 1KFXL 2KYCA 2LAPA 4AQJA 3PM8A 2JC2A 2LMVA 1JC2A 1OZSA 2F8PA 3QRXA 1EJ3A 4AQIA 3EVRA 2BECA 4YBHB 1QXPA 3EK7A 4BY4A 1KQMC 1KK7Z 2KI4B 3LLEA 2CT9A 1WLMA 2FOTA 3OB1B 2LP3A 4CFRA 1PULA 3VROA 1DGVA 1S6IA 1K96A 3PSRA 2NZ0A 1KFUS 1DGUA 2WCBA 3VRRA 1E8AA 1M45A 1QX2A 4HSZA 4GGFC 2K0JA 3LK1A 2LUCA 2VRGA 4YGEB 4CFQA 1A4PA 3I5HB 3JTDC 4F0ZB 3ZNIA 2Y1NA 4FTGA 2L50A 2PVBA 1EL4A 5AXIA 5G08A 2G2BA 2K7BA 5KSZA 3PFVA 1B9AA 1SRAA 1L7ZA 2M97A 4NDDA 1U5IA 1XVJA 3TS5C 3EKHA 2JRFA 2CXJA 1BR4B 1L2OB 4FQOA 1AP4A 2R2IA 4GAOA 3DVEA 1OMRA 2MBXA 1IKUA 3IQOA 1MHOA 1CDMA 1XK4A 1IWQA 2SCPA 1B1GA 4PDZA 1XK4C 1BF5A 3D0YB 1UURA 3NSIA 5CPVA 3CWGA 1CLLA 4QJ4B 3LK0A 1S6CA 5HKWA 2H61C 3BYAA 3AAJA 4BY5A 1S5GY 2M1KB 1DT7B 2LHIA 2MJWB 1NIWA 2BKHB 1QLKA 2Q91A 1WRZA 1QX7A 2BE6A 1QATA 1KFXS 1DJIA 1UUSA 2I7AA 2PSRA 1QS7A 1TIZA 4PE7A 2JU0A 4MRYA 1NCZA 4QJ3B 3VRNA 1IQ3A 3EVUA 4PE4A 1IGVA 3CTNA 3O4YA 4GUKA 1MUXA 5PALA 1CMFA 1F4QA 2ZN8A 1QVIY 2AAOA 2KAVA 1YTZC 5F6TA 5DKRA 2LUXA 1DJYA 1ZUZA 3VRQA 1HT9A 1SCMB 2OS8B 1GQMA 3I5GC 4NDBA 2L0PA 1XFWO 1SYMA 2F3YA 3PLFB
chains in the Genus database with same CATH superfamily
1S36A 3CR2A 1SK6D 4GGNA 3L47A 1AHRA 1F4OA 3A8RA 2EC6C 3WHUB 2LVKA 1WDCC 5I8NA 5KU1A 1RROA 2BNXA 3KEVA 2FCEA 2WOSA 4IL1A 1QV1A 1HQVA 3EK4A 1UHHA 3CLNA 3KHEA 5CSJA 3SG4A 1F54A 2BKIB 2KQYA 1B8CA 3TDZA 1XFVO 1VRKA 2M3WA 1Y1UA 2JOJA 2M29A 3OBVA 1NPQA 1IJ5A 3CDNA 4OV2A 1L2OC 4MVFA 1QX5B 1MXLC 3BOWB 2PMYA 4TNCA 3TUYC 3CGAA 1YUUA 1J7PA 3PN7B 2JPTA 2LM5A 3BUXB 3E3RA 1SR6C 4L9MA 3VB1A 2JTTA 5CSIA 1JWDA 1R2UA 4YRUA 1KQMB 5HLVA 1Q80A 1AP4A 5AEQA 1ZMZA 1FI6A 1B47A 4XJKB 1K94A 4ZCVA 1OE9B 2K7OA 4JD9A 1QVIZ 1NCYA 2AUCA 4C0JA 2KI6D 1S6JA 2Y1MA 3SIBA 2JT8A 4ORBB 1FW4A 3BFAA 1K95A 1OOIX 4PALA 1KCYA 1CDPA 1FI5A 4PHJA 2KNEA 4UPGA 1LA0A 2BL0B 3CR4X 1SL9A 3FIAA 2BBNA 1A75A 5ER4X 1GJYA 2G9BA 1OSAA 1UHNA 3VGOA 1K9KA 1S3PA 1YVLA 2LNKA 3OX6A 1JF0A 1SCMC 4N1GA 3S0AA 1SMGA 1M39A 2LLUA 3FE8A 1ODBA 1SW8A 5HKYA 2L5XB 4JQ0D 1X02A 3D76A 1YR5A 1IG5A 2JTZA 3BXKA 1J1DA 1A03A 3HX4A 1N65A 3AKBA 2E6WA 3F45A 4YGBB 1BG1A 3RM1A 2M7LA 4PE1A 1QASA 1SY9A 2KYFA 4MZKA 1CTRA 1RTP1 1ZOTB 2L4IA 3SG2A 3WHTB 2ZRSA 2I94A 1XO5A 4M2OA 3GK1A 1CDNA 3BJHA 2OS8C 1K90D 3DD4A 5AANA 1F8HA 1YRUB 1NUBA 1KWOB 4C0LA 1F70A 2LHLA 1LA3A 1JFJA 2D8NA 1QLSA 1YURA 2FJUB 1GGWA 1XA5A 1BR1B 3CZ0A 1DTLA 1RWYA 2KOTA 1GGZA 4GFTA 4MLWA 3SS5A 1C07A 3EK8A 1LS8A 2P6BB 1S26D 3B87A 1RECA 4HRGA 2LE9B 1TNXA 1TWOA 1SNLA 3ZWHA 1OOJA 5AFPA 3A4UB 1IIOA 2JNXA 3FE9A 2QACA 1SR6B 4MBEA 2ISDA 5DICA 3I5HC 1ALVA 2BL0C 3NXAA 2JT0A 2LMUA 3I5GB 2WC8A 3BFHA 1N0YA 2QDIA 3GOFA 1OW4A 2GV5A 5KTYA 1IH0A 2OTGB 4ZCUA 3PJIA 2WNDA 5EL2A 1B8LA 2KLEA 4MSPA 2QEHA 5FI2A 1QTXA 1DQEA 1NP8A 2LVVA 1QIWA 1R6PA 2CNPA 2GTEA 3NSLA 1F71A 4OZDA 2F2OA 2MA2A 1A75B 2AMIA 4CIDA 2KDHA 1AJ5A 1LVCD 4INXA 3D77A 2NLNA 3R1PA 4PCWA 1U5IB 1CFCA 2HQWA 3DVJA 4OVNF 4A4BA 2OPOA 2PRUA 1KK8B 2BCAA 4M2QA 2KFFA 3BUOB 1IQ5A 1K9UA 3CZTX 2BE4A 3I5FB 3KPXA 4ORAB 3OHMB 1SSEB 2MRDA 1AUIB 3I5IC 4I5LB 2WC5A 2BAPA 1SKTA 3DF0B 4I5NB 2CTNA 3NSOA 1TTXA 1KK7Y 2M7NA 2BCBA 2HPSA 4MN0A 4D1EA 5TNCA 1J55A 1DMOA 4WQ2A 5DKNA 4OR9B 4C0KA 3AAKA 1QWVA 1UWOA 1J1EA 2PQLA 1N2DA 1DJZA 4XJKA 1KQVA 1B7TZ 4KYNA 1CMGA 1JF2A 1CLMA 2I2RE 1BMOA 3OGNA 4DUQA 1DJWA 1TCFA 1OOFA 2MAZA 1PVBA 4PHKA 2M8UA 1BLQA 2EC6B 2LCPA 1DVIA 3O4XA 2F3ZA 2JPOA 5CSNA 2ZKMX 3PATA 1ZACA 2MLEC 3EKJA 1Y1AA 1G4YR 2LVIA 2KAXA 3BQ3A 1AVSA 3OP0A 1XFZO 3S0GA 1K9PA 1Z2CB 2KI6C 1J7RA 3L4AA 2Q4UA 3RLZA 4AOMA 4MRXA 1AK8A 2A4JA 1TNPA 4ORCB 2LV7A 1IRJA 4DS7A 2WCMA 2PASA 1SL7A 2FJYA 5DKQA 1P28A 1PSBA 3WNXB 5B8IB 2KHNA 2WCKA 2KAYA 3DZTA 1DJXA 2K8MB 1TRFA 1BT6A 2LC5A 3LL8B 2NXQA 1NSHA 3TUYB 2JXLA 3CR5X 3B7AA 4P5OE 1CKKA 1EH2A 2L98A 3S0EA 3DYEA 2ZNDA 2H61A 3K1EA 3I5FC 2OTGC 3NSKA 1NCXA 1WLZA 3K21A 1MF8B 1B8RA 2LMTA 1C7WA 1LINA 4PT1A 1OZOA 3SS4A 1S5GZ 5HL1A 1ZFSA 2KGRA 3TZ1A 5BPJA 4DIRA 3SS3A 3V2LA 1GM0A 2IS9A 5D69A 1W7JB 1XFRA 2F2PA 1RK9A 3DVKA 2LLTA 2KSPA 1J7OA 1NWDA 2MHHA 2ZFDA 2KBMA 3PALA 3FWCA 1OMDA 2L4HA 2KQ6A 2HF5A 4I5KA 3SG7A 4XYNA 3Q8IA 1PVAA 3GK4X 1D1OA 2COLB 3IQQA 3R72A 4PHNA 1SPYA 1DELA 1TCOB 1QIVA 1YUTA 1AJ4A 3EVVA 4OCIA 3UNWA 2CBLA 1PSRA 2LLSA 5J3XA 2F33A 3R1OA 1BJFA 2LP2A 4I5JA 3O78A 1G8IA 2WORA 4NDCA 1TOPA 3B86A 2QPTA 5I2OA 1A29A 2JNFA 4MZLA 5HKZA 1G33A 1TUZA 2WCEA 4M2PA 2K2FA 3BUMB 4R1EA 1B4CA 2I18A 2L2CA 1CM1A 4INWA 2K61A 2B1UA 1CFDA 1V1GA 2O60A 5JJGA 5ER5A 1QJTA 1J7QA 2KBIA 1NX2A 1YUSA 3TDIA 3H4SE 3R1VA 4WQ3A 1PRWA 1KWOC 2P71A 2WCHA 3NHIA 1BODA 2KI4C 4JWQA 5D7FA 5IBWA 1H8BA 1RJVA 4HRHA 1FF1A 1QV0A 1C3ZA 1SCVA 1CB1A 1CFFA 4ICBA 2BCXA 1K8UA 1NX3A 3KF9A 1OOHA 3I5IB 2JQ6A 1NX1A 2Y4QA 2QEBA 2SASA 2PYQA 3KO0A 1PALA 2E30A 2RGIA 1TUJA 3HCMA 1SL8A 2JZIA 3S0BA 4YI8A 1MR8A 1B7TY 3SG6A 2ERBA 2TN4A 3GK2A 2K7CA 2ZNEA 1JBAA 1M63B 1DJGA 3D10A 5FI7A 2MLFC 1WY9A 1KSOA 3SG5A 3BOWA 1F55A 4NQGA 1FBVA 1Y1XA 4N5XA 2KFGA 4CPVA 3RZSA 3JTDB 4DCKA 1EG4A 1OQPA 4U8DA 4ETOA 3D78A 4Q04A 3L4LA 1BOCA 1DEKA 5CSFA 1DF0B 2NCPA 1V1FA 4JKTA 4JPZB 1MQ1A 2KLDA 4MZJA 2GGZA 2H8VA 1C3YA 3OB2B 1A2XA 1MWNA 2CCMA 4A4CA 4F7FA 1CM4A 2LANA 1TNQA 2O5GA 3DXLA 1EXRA 3BUNB 1FPWA 1H4BA 1T14A 1WDCB 1KSMA 3D75A 3O6BA 2L51A 2JT3A 2WCJA 1K93D 3CABA 2K2AA 1CLBA 1NX0A 1XFUO 2H2KA 2GGMA 4GNKB 4YGDB 5HYDA 5I2LA 1WRLA 2M9GA 1UHIA 2V53A 3MSEB 1NYAA 1Y0VH 1M31A 5AERA 2EHBA 3IF7A 2HETA 5HLOA 1YVHA 1S1EA 2Y5IA 4OKHA 3PLFB 3JVTB 1W9ZA 4GGFA 5FI6A 4QJ5B 4YI9A 1PK0D 3TS5B 1C7VA 2L5YA 1KK8C 3CZ1A 1TN4A 3OX5A 3CS1A 4WRIA 1WRKA 1KFUL 2FCDA 3SIAA 1ALWA 3PM2A 1JFKA 2KFHA 2WCFA 5JOLA 1OMVA 2P70A 1UHJA 4MEWA 4HREE 3SJSA 4USLA 1YRTB 2M49B 1CFPA 3FWBA 2JWWA 3S0DA 1LXFC 1LKJA 5FYXA 1CDLA 3ICBA 2HQ8A 4P2YB 3AKAA 2M1UA 4PHMA 2JXCA 4DRWA 5I94A 3M0WA 3O2PA 3PN7C 1EG3A 1XYDA 1TNWA 3SG3A 1Z4HA 2JULA 2K60A 1DJHA 1W7IB 1XFYO 5D3OA 3C1VA 2ZRTA 2K7DA 2EGDA 4YGCB 1MXEA 2KGBC 1SBJA 3BUWB 3D0YA 4N1FA 3CZ2A 4YGAA 2PALA 1M46A 4PE0A 3FS7A 5GQQC 1UHKA 3TDUA 2ZN9A 3B6XA 3DVMA 3DF0A 1UP5A 1YX7A 4GBAA 1Y6WA 3WXAA 2NCOA 1RFJA 4FQTA 3LCPC 3CYZA 5I2QA 1IJ6A 3FE6A 4E68A 1CNPA 2M0RA 4GPLB 1JSAA 2DOQA 1K2HA 1XFXO 1JUOA 2L2EA 2LVJA 2BBMA 4CLNA 3VRPA 1DF0A 3JVTC 1BU3A 1YX8A 5K89A 2KPHA 1KFXL 2KYCA 2LAPA 4AQJA 3PM8A 2JC2A 2LMVA 2QEOA 1JC2A 1OZSA 2F8PA 3QRXA 3B88A 1EJ3A 4AQIA 3EVRA 3S0FA 2BECA 4YBHB 1QXPA 3EK7A 4BY4A 1KQMC 1KK7Z 2KI4B 3LLEA 2CT9A 1WLMA 2FOTA 3OB1B 2LP3A 4CFRA 1PULA 3VROA 1DGVA 1S6IA 1K96A 3D74A 2NZ0A 3PSRA 1KFUS 1DGUA 2WCBA 3VRRA 1E8AA 1M45A 1QX2A 4HSZA 4GGFC 2K0JA 3LK1A 2LUCA 2VRGA 4YGEB 4CFQA 1A4PA 3I5HB 2QEVA 3JTDC 4F0ZB 3ZNIA 2Y1NA 3QMEA 4FTGA 2L50A 2PVBA 2WC6A 1EL4A 5AXIA 3BFBA 5G08A 2G2BA 2K7BA 5KSZA 3PFVA 1B9AA 1SRAA 1L7ZA 3D73A 1DC1A 2M97A 4NDDA 4IJ7A 1U5IA 1XVJA 3TS5C 3DY9A 3EKHA 2JRFA 2CXJA 1BR4B 1L2OB 3IVTA 4FQOA 2R2IA 4GAOA 3DVEA 1OMRA 2MBXA 1IKUA 3IQOA 1MHOA 1CDMA 1XK4A 1IWQA 2SCPA 1B1GA 3NHTA 1XK4C 3NGVA 4PDZA 3EG5B 1BF5A 3D0YB 1UURA 3NSIA 5CPVA 3CWGA 2WCLA 1CLLA 4QJ4B 3LK0A 1S6CA 5HKWA 2H61C 3BYAA 3AAJA 4BY5A 1S5GY 2M1KB 2YGUA 1DT7B 2LHIA 2MJWB 1NIWA 2BKHB 1QLKA 2Q91A 1WRZA 1QX7A 2BE6A 1QATA 3N7HA 1KFXS 1DJIA 1UUSA 2I7AA 2PSRA 1QS7A 1TIZA 4PE7A 2JU0A 4MRYA 1NCZA 4QJ3B 3VRNA 1IQ3A 3EVUA 4PE4A 1IGVA 3CTNA 3O4YA 4GUKA 1MUXA 5PALA 1CMFA 3UO9A 1F4QA 2ZN8A 1QVIY 2AAOA 2KAVA 1YTZC 5F6TA 5DKRA 2LUXA 1DJYA 1ZUZA 3VRQA 1HT9A 1SCMB 2OS8B 1GQMA 1OOGA 3I5GC 4NDBA 2L0PA 1XFWO 1SYMA 2F3YA 1ORGA
chains in the Genus database with same CATH topology
1S36A 3CR2A 1SK6D 4GGNA 1AHRA 1F4OA 3A8RA 2EC6C 3WHUB 2LVKA 1WDCC 5I8NA 5KU1A 1RROA 3KEVA 2FCEA 2WOSA 4IL1A 1QV1A 1HQVA 3EK4A 1UHHA 3CLNA 3KHEA 5CSJA 3SG4A 1F54A 2BKIB 2KQYA 1B8CA 3TDZA 1XFVO 1VRKA 2M3WA 1Y1UA 2JOJA 2M29A 1NPQA 1IJ5A 4OV2A 1L2OC 4MVFA 1QX5B 1MXLC 3BOWB 2PMYA 4TNCA 3TUYC 3CGAA 1YUUA 1J7PA 3PN7B 2JPTA 2LM5A 3BUXB 3E3RA 1SR6C 4L9MA 2JTTA 5CSIA 1JWDA 1R2UA 4YRUA 1KQMB 5HLVA 1Q80A 5AEQA 1ZMZA 1FI6A 1B47A 4XJKB 1K94A 4ZCVA 1OE9B 2K7OA 1QVIZ 1NCYA 2AUCA 4C0JA 2KI6D 1S6JA 2Y1MA 3SIBA 2JT8A 4ORBB 1FW4A 1K95A 4PALA 1KCYA 1CDPA 1FI5A 4PHJA 2KNEA 4UPGA 1LA0A 2BL0B 3CR4X 1SL9A 3FIAA 2BBNA 1A75A 5ER4X 1GJYA 2G9BA 1OSAA 1UHNA 3VGOA 1K9KA 1S3PA 1YVLA 2LNKA 3OX6A 1JF0A 1SCMC 4N1GA 1SMGA 1M39A 2LLUA 5HKYA 1ODBA 1SW8A 2L5XB 4JQ0D 1X02A 1YR5A 1IG5A 2JTZA 3BXKA 1J1DA 1A03A 3HX4A 1N65A 3AKBA 2E6WA 3F45A 4YGBB 1BG1A 3RM1A 2M7LA 4PE1A 1QASA 1SY9A 2KYFA 4MZKA 1CTRA 1RTP1 1ZOTB 2L4IA 3SG2A 3WHTB 2ZRSA 2I94A 1XO5A 4M2OA 3GK1A 1CDNA 2OS8C 1K90D 3DD4A 5AANA 1F8HA 1YRUB 1NUBA 1KWOB 4C0LA 1F70A 2LHLA 1LA3A 1JFJA 2D8NA 1QLSA 1YURA 2FJUB 1GGWA 1XA5A 1BR1B 4GFTA 1DTLA 1RWYA 2KOTA 1GGZA 4MLWA 1C07A 3EK8A 2P6BB 1S26D 1RECA 4HRGA 2LE9B 1TNXA 1SNLA 3ZWHA 1OOJA 5AFPA 3A4UB 2JNXA 2QACA 1SR6B 4MBEA 2ISDA 3I5HC 1ALVA 2BL0C 3NXAA 2JT0A 2LMUA 3I5GB 2WC8A 1N0YA 3GOFA 2GV5A 5KTYA 1IH0A 2OTGB 4ZCUA 2WNDA 1B8LA 4MSPA 1QTXA 1NP8A 2LVVA 1QIWA 1R6PA 2CNPA 1F71A 3NSLA 2F2OA 2MA2A 1A75B 2AMIA 4CIDA 2KDHA 1AJ5A 1LVCD 2NLNA 4PCWA 1U5IB 1CFCA 2HQWA 3DVJA 4OVNF 4A4BA 2OPOA 2PRUA 1KK8B 2BCAA 4M2QA 2KFFA 3BUOB 1IQ5A 1K9UA 3CZTX 2BE4A 3I5FB 3KPXA 4ORAB 3OHMB 2MRDA 1AUIB 3I5IC 4I5LB 1SKTA 3DF0B 4I5NB 2CTNA 3NSOA 1TTXA 1KK7Y 2M7NA 2BCBA 2HPSA 4MN0A 4D1EA 5TNCA 1J55A 1DMOA 4WQ2A 5DKNA 4OR9B 4C0KA 3AAKA 1UWOA 1J1EA 1N2DA 1DJZA 4XJKA 1KQVA 1B7TZ 1CMGA 1JF2A 1CLMA 2I2RE 1BMOA 4DUQA 1DJWA 1TCFA 2MAZA 1PVBA 4PHKA 2M8UA 1BLQA 2EC6B 2LCPA 1DVIA 2F3ZA 5CSNA 2ZKMX 3PATA 1ZACA 2MLEC 3EKJA 1Y1AA 1G4YR 2LVIA 2KAXA 3BQ3A 1AVSA 3OP0A 1XFZO 1K9PA 2KI6C 1J7RA 3RLZA 2Q4UA 4AOMA 4MRXA 1AK8A 2A4JA 1TNPA 4ORCB 2LV7A 1IRJA 4DS7A 2PASA 1SL7A 5DKQA 3WNXB 5B8IB 1PSBA 2KHNA 2KAYA 1DJXA 2K8MB 1TRFA 1BT6A 2LC5A 3LL8B 2NXQA 1NSHA 3TUYB 2JXLA 3CR5X 4P5OE 1CKKA 1EH2A 2L98A 2ZNDA 2H61A 3I5FC 2OTGC 3NSKA 1NCXA 1WLZA 3K21A 1MF8B 1B8RA 2LMTA 1C7WA 1LINA 1OZOA 1S5GZ 1ZFSA 2KGRA 3TZ1A 5BPJA 4DIRA 2IS9A 5D69A 1W7JB 2F2PA 1RK9A 3DVKA 2LLTA 2KSPA 1J7OA 1NWDA 2MHHA 2ZFDA 2KBMA 3PALA 3FWCA 1OMDA 2L4HA 2KQ6A 2HF5A 4I5KA 3SG7A 4XYNA 1PVAA 3GK4X 1D1OA 2COLB 3IQQA 4PHNA 1SPYA 1TCOB 1QIVA 1YUTA 1AJ4A 3EVVA 4OCIA 2CBLA 1PSRA 2LLSA 5J3XA 2F33A 1BJFA 2LP2A 4I5JA 3O78A 1G8IA 2WORA 4NDCA 1TOPA 2QPTA 5I2OA 1A29A 2JNFA 4MZLA 5HKZA 1G33A 2WCEA 4M2PA 2K2FA 3BUMB 4R1EA 1B4CA 2I18A 1CM1A 2K61A 2B1UA 1CFDA 1V1GA 2O60A 5JJGA 5ER5A 1QJTA 1J7QA 2KBIA 1NX2A 1YUSA 3TDIA 3H4SE 4WQ3A 1PRWA 1KWOC 1BODA 2KI4C 4JWQA 5D7FA 5IBWA 1H8BA 1RJVA 4HRHA 1FF1A 1QV0A 1CB1A 1SCVA 1CFFA 4ICBA 2BCXA 1K8UA 1NX3A 3KF9A 3I5IB 2JQ6A 1NX1A 2Y4QA 2SASA 3KO0A 1PALA 2E30A 2RGIA 3HCMA 1SL8A 2JZIA 4YI8A 1MR8A 1B7TY 3SG6A 2TN4A 3GK2A 2K7CA 2ZNEA 1JBAA 1M63B 1DJGA 3D10A 2MLFC 1WY9A 1KSOA 3SG5A 3BOWA 1F55A 4NQGA 1FBVA 1Y1XA 4N5XA 2KFGA 4CPVA 3JTDB 4DCKA 1EG4A 1OQPA 4U8DA 4ETOA 4Q04A 1BOCA 5CSFA 1DF0B 2NCPA 1V1FA 4MZJA 4JPZB 1MQ1A 2GGZA 3OB2B 1A2XA 1MWNA 2CCMA 4A4CA 1CM4A 2LANA 1TNQA 2O5GA 1FPWA 1EXRA 3BUNB 1H4BA 1WDCB 1KSMA 3O6BA 2L51A 2JT3A 1K93D 2K2AA 1CLBA 1NX0A 1XFUO 2H2KA 2GGMA 4GNKB 4YGDB 5HYDA 5I2LA 1WRLA 2M9GA 1UHIA 2V53A 3MSEB 1NYAA 1Y0VH 1M31A 5AERA 2EHBA 3IF7A 2HETA 5HLOA 1YVHA 1S1EA 2Y5IA 4OKHA 3JVTB 4GGFA 4QJ5B 4YI9A 1PK0D 3TS5B 1C7VA 1KK8C 1TN4A 3OX5A 3CS1A 4WRIA 1WRKA 1KFUL 2FCDA 3SIAA 1ALWA 1JFKA 2KFHA 2WCFA 5JOLA 1OMVA 1UHJA 4MEWA 4HREE 3SJSA 4USLA 1YRTB 2M49B 1CFPA 3FWBA 2JWWA 1LXFC 1LKJA 5FYXA 1CDLA 3ICBA 2HQ8A 4P2YB 3AKAA 2M1UA 4PHMA 2JXCA 4DRWA 3M0WA 3O2PA 3PN7C 1EG3A 1XYDA 1TNWA 3SG3A 2JULA 1DJHA 1W7IB 1XFYO 3C1VA 2ZRTA 2K7DA 2EGDA 4YGCB 1MXEA 2KGBC 1SBJA 3BUWB 3D0YA 4N1FA 4YGAA 2PALA 1M46A 4PE0A 3FS7A 5GQQC 1UHKA 3TDUA 2ZN9A 3DVMA 3DF0A 1UP5A 1YX7A 4GBAA 1Y6WA 3WXAA 2NCOA 1RFJA 3LCPC 5I2QA 4E68A 1IJ6A 1CNPA 1JSAA 1K2HA 2M0RA 4GPLB 2DOQA 1XFXO 1JUOA 2L2EA 2LVJA 2BBMA 4CLNA 3VRPA 1DF0A 3JVTC 1BU3A 1YX8A 5K89A 1KFXL 2KYCA 2LAPA 4AQJA 3PM8A 2JC2A 2LMVA 1JC2A 1OZSA 2F8PA 3QRXA 1EJ3A 4AQIA 3EVRA 2BECA 4YBHB 1QXPA 3EK7A 4BY4A 1KQMC 1KK7Z 2KI4B 3LLEA 2CT9A 1WLMA 2FOTA 3OB1B 2LP3A 4CFRA 1PULA 3VROA 1DGVA 1S6IA 1K96A 3PSRA 2NZ0A 1KFUS 1DGUA 2WCBA 3VRRA 1E8AA 1M45A 1QX2A 4HSZA 4GGFC 2K0JA 3LK1A 2LUCA 2VRGA 4YGEB 4CFQA 1A4PA 3I5HB 3JTDC 4F0ZB 3ZNIA 2Y1NA 4FTGA 2L50A 2PVBA 1EL4A 5AXIA 5G08A 2G2BA 2K7BA 5KSZA 3PFVA 1B9AA 1SRAA 1L7ZA 2M97A 4NDDA 1U5IA 1XVJA 3TS5C 3EKHA 2JRFA 2CXJA 1BR4B 1L2OB 4FQOA 1AP4A 2R2IA 4GAOA 3DVEA 1OMRA 2MBXA 1IKUA 3IQOA 1MHOA 1CDMA 1XK4A 1IWQA 2SCPA 1B1GA 4PDZA 1XK4C 1BF5A 3D0YB 1UURA 3NSIA 5CPVA 3CWGA 1CLLA 4QJ4B 3LK0A 1S6CA 5HKWA 2H61C 3BYAA 3AAJA 4BY5A 1S5GY 2M1KB 1DT7B 2LHIA 2MJWB 1NIWA 2BKHB 1QLKA 2Q91A 1WRZA 1QX7A 2BE6A 1QATA 1KFXS 1DJIA 1UUSA 2I7AA 2PSRA 1QS7A 1TIZA 4PE7A 2JU0A 4MRYA 1NCZA 4QJ3B 3VRNA 1IQ3A 3EVUA 4PE4A 1IGVA 3CTNA 3O4YA 4GUKA 1MUXA 5PALA 1CMFA 1F4QA 2ZN8A 1QVIY 2AAOA 2KAVA 1YTZC 5F6TA 5DKRA 2LUXA 1DJYA 1ZUZA 3VRQA 1HT9A 1SCMB 2OS8B 1GQMA 3I5GC 4NDBA 2L0PA 1XFWO 1SYMA 2F3YA 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S36 A;  3CR2 A;  1SK6 D;  4GGN A;  1AHR A;  1F4O A;  3A8R A;  2EC6 C;  3WHU B;  2LVK A;  1WDC C;  5I8N A;  5KU1 A;  1RRO A;  3KEV A;  2FCE A;  2WOS A;  4IL1 A;  1QV1 A;  1HQV A;  3EK4 A;  1UHH A;  3CLN A;  3KHE A;  5CSJ A;  3SG4 A;  1F54 A;  2BKI B;  2KQY A;  1B8C A;  3TDZ A;  1XFV O;  1VRK A;  2M3W A;  1Y1U A;  2JOJ A;  2M29 A;  1NPQ A;  1IJ5 A;  4OV2 A;  1L2O C;  4MVF A;  1QX5 B;  1MXL C;  3BOW B;  2PMY A;  4TNC A;  3TUY C;  3CGA A;  1YUU A;  1J7P A;  3PN7 B;  2JPT A;  2LM5 A;  3BUX B;  3E3R A;  1SR6 C;  4L9M A;  2JTT A;  5CSI A;  1JWD A;  1R2U A;  4YRU A;  1KQM B;  5HLV A;  1Q80 A;  5AEQ A;  1ZMZ A;  1FI6 A;  1B47 A;  4XJK B;  1K94 A;  4ZCV A;  1OE9 B;  2K7O A;  1QVI Z;  1NCY A;  2AUC A;  4C0J A;  2KI6 D;  1S6J A;  2Y1M A;  3SIB A;  2JT8 A;  4ORB B;  1FW4 A;  1K95 A;  4PAL A;  1KCY A;  1CDP A;  1FI5 A;  4PHJ A;  2KNE A;  4UPG A;  1LA0 A;  2BL0 B;  3CR4 X;  1SL9 A;  3FIA A;  2BBN A;  1A75 A;  5ER4 X;  1GJY A;  2G9B A;  1OSA A;  1UHN A;  3VGO A;  1K9K A;  1S3P A;  1YVL A;  2LNK A;  3OX6 A;  1JF0 A;  1SCM C;  4N1G A;  1SMG A;  1M39 A;  2LLU A;  5HKY A;  1ODB A;  1SW8 A;  2L5X B;  4JQ0 D;  1X02 A;  1YR5 A;  1IG5 A;  2JTZ A;  3BXK A;  1J1D A;  1A03 A;  3HX4 A;  1N65 A;  3AKB A;  2E6W A;  3F45 A;  4YGB B;  1BG1 A;  3RM1 A;  2M7L A;  4PE1 A;  1QAS A;  1SY9 A;  2KYF A;  4MZK A;  1CTR A;  1RTP 1;  1ZOT B;  2L4I A;  3SG2 A;  3WHT B;  2ZRS A;  2I94 A;  1XO5 A;  4M2O A;  3GK1 A;  1CDN A;  2OS8 C;  1K90 D;  3DD4 A;  5AAN A;  1F8H A;  1YRU B;  1NUB A;  1KWO B;  4C0L A;  1F70 A;  2LHL A;  1LA3 A;  1JFJ A;  2D8N A;  1QLS A;  1YUR A;  2FJU B;  1GGW A;  1XA5 A;  1BR1 B;  4GFT A;  1DTL A;  1RWY A;  2KOT A;  1GGZ A;  4MLW A;  1C07 A;  3EK8 A;  2P6B B;  1S26 D;  1REC A;  4HRG A;  2LE9 B;  1TNX A;  1SNL A;  3ZWH A;  1OOJ A;  5AFP A;  3A4U B;  2JNX A;  2QAC A;  1SR6 B;  4MBE A;  2ISD A;  3I5H C;  1ALV A;  2BL0 C;  3NXA A;  2JT0 A;  2LMU A;  3I5G B;  2WC8 A;  1N0Y A;  3GOF A;  2GV5 A;  5KTY A;  1IH0 A;  2OTG B;  4ZCU A;  2WND A;  1B8L A;  4MSP A;  1QTX A;  1NP8 A;  2LVV A;  1QIW A;  1R6P A;  2CNP A;  1F71 A;  3NSL A;  2F2O A;  2MA2 A;  1A75 B;  2AMI A;  4CID A;  2KDH A;  1AJ5 A;  1LVC D;  2NLN A;  4PCW A;  1U5I B;  1CFC A;  2HQW A;  3DVJ A;  4OVN F;  4A4B A;  2OPO A;  2PRU A;  1KK8 B;  2BCA A;  4M2Q A;  2KFF A;  3BUO B;  1IQ5 A;  1K9U A;  3CZT X;  2BE4 A;  3I5F B;  3KPX A;  4ORA B;  3OHM B;  2MRD A;  1AUI B;  3I5I C;  4I5L B;  1SKT A;  3DF0 B;  4I5N B;  2CTN A;  3NSO A;  1TTX A;  1KK7 Y;  2M7N A;  2BCB A;  2HPS A;  4MN0 A;  4D1E A;  5TNC A;  1J55 A;  1DMO A;  4WQ2 A;  5DKN A;  4OR9 B;  4C0K A;  3AAK A;  1UWO A;  1J1E A;  1N2D A;  1DJZ A;  4XJK A;  1KQV A;  1B7T Z;  1CMG A;  1JF2 A;  1CLM A;  2I2R E;  1BMO A;  4DUQ A;  1DJW A;  1TCF A;  2MAZ A;  1PVB A;  4PHK A;  2M8U A;  1BLQ A;  2EC6 B;  2LCP A;  1DVI A;  2F3Z A;  5CSN A;  2ZKM X;  3PAT A;  1ZAC A;  2MLE C;  3EKJ A;  1Y1A A;  1G4Y R;  2LVI A;  2KAX A;  3BQ3 A;  1AVS A;  3OP0 A;  1XFZ O;  1K9P A;  2KI6 C;  1J7R A;  3RLZ A;  2Q4U A;  4AOM A;  4MRX A;  1AK8 A;  2A4J A;  1TNP A;  4ORC B;  2LV7 A;  1IRJ A;  4DS7 A;  2PAS A;  1SL7 A;  5DKQ A;  3WNX B;  5B8I B;  1PSB A;  2KHN A;  2KAY A;  1DJX A;  2K8M B;  1TRF A;  1BT6 A;  2LC5 A;  3LL8 B;  2NXQ A;  1NSH A;  3TUY B;  2JXL A;  3CR5 X;  4P5O E;  1CKK A;  1EH2 A;  2L98 A;  2ZND A;  2H61 A;  3I5F C;  2OTG C;  3NSK A;  1NCX A;  1WLZ A;  3K21 A;  1MF8 B;  1B8R A;  2LMT A;  1C7W A;  1LIN A;  1OZO A;  1S5G Z;  1ZFS A;  2KGR A;  3TZ1 A;  5BPJ A;  4DIR A;  2IS9 A;  5D69 A;  1W7J B;  2F2P A;  1RK9 A;  3DVK A;  2LLT A;  2KSP A;  1J7O A;  1NWD A;  2MHH A;  2ZFD A;  2KBM A;  3PAL A;  3FWC A;  1OMD A;  2L4H A;  2KQ6 A;  2HF5 A;  4I5K A;  3SG7 A;  4XYN A;  1PVA A;  3GK4 X;  1D1O A;  2COL B;  3IQQ A;  4PHN A;  1SPY A;  1TCO B;  1QIV A;  1YUT A;  1AJ4 A;  3EVV A;  4OCI A;  2CBL A;  1PSR A;  2LLS A;  5J3X A;  2F33 A;  1BJF A;  2LP2 A;  4I5J A;  3O78 A;  1G8I A;  2WOR A;  4NDC A;  1TOP A;  2QPT A;  5I2O A;  1A29 A;  2JNF A;  4MZL A;  5HKZ A;  1G33 A;  2WCE A;  4M2P A;  2K2F A;  3BUM B;  4R1E A;  1B4C A;  2I18 A;  1CM1 A;  2K61 A;  2B1U A;  1CFD A;  1V1G A;  2O60 A;  5JJG A;  5ER5 A;  1QJT A;  1J7Q A;  2KBI A;  1NX2 A;  1YUS A;  3TDI A;  3H4S E;  4WQ3 A;  1PRW A;  1KWO C;  1BOD A;  2KI4 C;  4JWQ A;  5D7F A;  5IBW A;  1H8B A;  1RJV A;  4HRH A;  1FF1 A;  1QV0 A;  1CB1 A;  1SCV A;  1CFF A;  4ICB A;  2BCX A;  1K8U A;  1NX3 A;  3KF9 A;  3I5I B;  2JQ6 A;  1NX1 A;  2Y4Q A;  2SAS A;  3KO0 A;  1PAL A;  2E30 A;  2RGI A;  3HCM A;  1SL8 A;  2JZI A;  4YI8 A;  1MR8 A;  1B7T Y;  3SG6 A;  2TN4 A;  3GK2 A;  2K7C A;  2ZNE A;  1JBA A;  1M63 B;  1DJG A;  3D10 A;  2MLF C;  1WY9 A;  1KSO A;  3SG5 A;  3BOW A;  1F55 A;  4NQG A;  1FBV A;  1Y1X A;  4N5X A;  2KFG A;  4CPV A;  3JTD B;  4DCK A;  1EG4 A;  1OQP A;  4U8D A;  4ETO A;  4Q04 A;  1BOC A;  5CSF A;  1DF0 B;  2NCP A;  1V1F A;  4MZJ A;  4JPZ B;  1MQ1 A;  2GGZ A;  3OB2 B;  1A2X A;  1MWN A;  2CCM A;  4A4C A;  1CM4 A;  2LAN A;  1TNQ A;  2O5G A;  1FPW A;  1EXR A;  3BUN B;  1H4B A;  1WDC B;  1KSM A;  3O6B A;  2L51 A;  2JT3 A;  1K93 D;  2K2A A;  1CLB A;  1NX0 A;  1XFU O;  2H2K A;  2GGM A;  4GNK B;  4YGD B;  5HYD A;  5I2L A;  1WRL A;  2M9G A;  1UHI A;  2V53 A;  3MSE B;  1NYA A;  1Y0V H;  1M31 A;  5AER A;  2EHB A;  3IF7 A;  2HET A;  5HLO A;  1YVH A;  1S1E A;  2Y5I A;  4OKH A;  3JVT B;  4GGF A;  4QJ5 B;  4YI9 A;  1PK0 D;  3TS5 B;  1C7V A;  1KK8 C;  1TN4 A;  3OX5 A;  3CS1 A;  4WRI A;  1WRK A;  1KFU L;  2FCD A;  3SIA A;  1ALW A;  1JFK A;  2KFH A;  2WCF A;  5JOL A;  1OMV A;  1UHJ A;  4MEW A;  4HRE E;  3SJS A;  4USL A;  1YRT B;  2M49 B;  1CFP A;  3FWB A;  2JWW A;  1LXF C;  1LKJ A;  5FYX A;  1CDL A;  3ICB A;  2HQ8 A;  4P2Y B;  3AKA A;  2M1U A;  4PHM A;  2JXC A;  4DRW A;  3M0W A;  3O2P A;  3PN7 C;  1EG3 A;  1XYD A;  1TNW A;  3SG3 A;  2JUL A;  1DJH A;  1W7I B;  1XFY O;  3C1V A;  2ZRT A;  2K7D A;  2EGD A;  4YGC B;  1MXE A;  2KGB C;  1SBJ A;  3BUW B;  3D0Y A;  4N1F A;  4YGA A;  2PAL A;  1M46 A;  4PE0 A;  3FS7 A;  5GQQ C;  1UHK A;  3TDU A;  2ZN9 A;  3DVM A;  3DF0 A;  1UP5 A;  1YX7 A;  4GBA A;  1Y6W A;  3WXA A;  2NCO A;  1RFJ A;  3LCP C;  5I2Q A;  4E68 A;  1IJ6 A;  1CNP A;  1JSA A;  1K2H A;  2M0R A;  4GPL B;  2DOQ A;  1XFX O;  1JUO A;  2L2E A;  2LVJ A;  2BBM A;  4CLN A;  3VRP A;  1DF0 A;  3JVT C;  1BU3 A;  1YX8 A;  5K89 A;  1KFX L;  2KYC A;  2LAP A;  4AQJ A;  3PM8 A;  2JC2 A;  2LMV A;  1JC2 A;  1OZS A;  2F8P A;  3QRX A;  1EJ3 A;  4AQI A;  3EVR A;  2BEC A;  4YBH B;  1QXP A;  3EK7 A;  4BY4 A;  1KQM C;  1KK7 Z;  2KI4 B;  3LLE A;  2CT9 A;  1WLM A;  2FOT A;  3OB1 B;  2LP3 A;  4CFR A;  1PUL A;  3VRO A;  1DGV A;  1S6I A;  1K96 A;  3PSR A;  2NZ0 A;  1KFU S;  1DGU A;  2WCB A;  3VRR A;  1E8A A;  1M45 A;  1QX2 A;  4HSZ A;  4GGF C;  2K0J A;  3LK1 A;  2LUC A;  2VRG A;  4YGE B;  4CFQ A;  1A4P A;  3I5H B;  3JTD C;  4F0Z B;  3ZNI A;  2Y1N A;  4FTG A;  2L50 A;  2PVB A;  1EL4 A;  5AXI A;  5G08 A;  2G2B A;  2K7B A;  5KSZ A;  3PFV A;  1B9A A;  1SRA A;  1L7Z A;  2M97 A;  4NDD A;  1U5I A;  1XVJ A;  3TS5 C;  3EKH A;  2JRF A;  2CXJ A;  1BR4 B;  1L2O B;  4FQO A;  1AP4 A;  2R2I A;  4GAO A;  3DVE A;  1OMR A;  2MBX A;  1IKU A;  3IQO A;  1MHO A;  1CDM A;  1XK4 A;  1IWQ A;  2SCP A;  1B1G A;  4PDZ A;  1XK4 C;  1BF5 A;  3D0Y B;  1UUR A;  3NSI A;  5CPV A;  3CWG A;  1CLL A;  4QJ4 B;  3LK0 A;  1S6C A;  5HKW A;  2H61 C;  3BYA A;  3AAJ A;  4BY5 A;  1S5G Y;  2M1K B;  1DT7 B;  2LHI A;  2MJW B;  1NIW A;  2BKH B;  1QLK A;  2Q91 A;  1WRZ A;  1QX7 A;  2BE6 A;  1QAT A;  1KFX S;  1DJI A;  1UUS A;  2I7A A;  2PSR A;  1QS7 A;  1TIZ A;  4PE7 A;  2JU0 A;  4MRY A;  1NCZ A;  4QJ3 B;  3VRN A;  1IQ3 A;  3EVU A;  4PE4 A;  1IGV A;  3CTN A;  3O4Y A;  4GUK A;  1MUX A;  5PAL A;  1CMF A;  1F4Q A;  2ZN8 A;  1QVI Y;  2AAO A;  2KAV A;  1YTZ C;  5F6T A;  5DKR A;  2LUX A;  1DJY A;  1ZUZ A;  3VRQ A;  1HT9 A;  1SCM B;  2OS8 B;  1GQM A;  3I5G C;  4NDB A;  2L0P A;  1XFW O;  1SYM A;  2F3Y A;  3PLF B; 
#chains in the Genus database with same CATH topology
 1S36 A;  3CR2 A;  1SK6 D;  4GGN A;  3L47 A;  1AHR A;  1F4O A;  3A8R A;  2EC6 C;  3WHU B;  2LVK A;  1WDC C;  5I8N A;  5KU1 A;  1RRO A;  2BNX A;  3KEV A;  2FCE A;  2WOS A;  4IL1 A;  1QV1 A;  1HQV A;  3EK4 A;  1UHH A;  3CLN A;  3KHE A;  5CSJ A;  3SG4 A;  1F54 A;  2BKI B;  2KQY A;  1B8C A;  3TDZ A;  1XFV O;  1VRK A;  2M3W A;  1Y1U A;  2JOJ A;  2M29 A;  3OBV A;  1NPQ A;  1IJ5 A;  3CDN A;  4OV2 A;  1L2O C;  4MVF A;  1QX5 B;  1MXL C;  3BOW B;  2PMY A;  4TNC A;  3TUY C;  3CGA A;  1YUU A;  1J7P A;  3PN7 B;  2JPT A;  2LM5 A;  3BUX B;  3E3R A;  1SR6 C;  4L9M A;  3VB1 A;  2JTT A;  5CSI A;  1JWD A;  1R2U A;  4YRU A;  1KQM B;  5HLV A;  1Q80 A;  1AP4 A;  5AEQ A;  1ZMZ A;  1FI6 A;  1B47 A;  4XJK B;  1K94 A;  4ZCV A;  1OE9 B;  2K7O A;  4JD9 A;  1QVI Z;  1NCY A;  2AUC A;  4C0J A;  2KI6 D;  1S6J A;  2Y1M A;  3SIB A;  2JT8 A;  4ORB B;  1FW4 A;  3BFA A;  1K95 A;  1OOI X;  4PAL A;  1KCY A;  1CDP A;  1FI5 A;  4PHJ A;  2KNE A;  4UPG A;  1LA0 A;  2BL0 B;  3CR4 X;  1SL9 A;  3FIA A;  2BBN A;  1A75 A;  5ER4 X;  1GJY A;  2G9B A;  1OSA A;  1UHN A;  3VGO A;  1K9K A;  1S3P A;  1YVL A;  2LNK A;  3OX6 A;  1JF0 A;  1SCM C;  4N1G A;  3S0A A;  1SMG A;  1M39 A;  2LLU A;  3FE8 A;  1ODB A;  1SW8 A;  5HKY A;  2L5X B;  4JQ0 D;  1X02 A;  3D76 A;  1YR5 A;  1IG5 A;  2JTZ A;  3BXK A;  1J1D A;  1A03 A;  3HX4 A;  1N65 A;  3AKB A;  2E6W A;  3F45 A;  4YGB B;  1BG1 A;  3RM1 A;  2M7L A;  4PE1 A;  1QAS A;  1SY9 A;  2KYF A;  4MZK A;  1CTR A;  1RTP 1;  1ZOT B;  2L4I A;  3SG2 A;  3WHT B;  2ZRS A;  2I94 A;  1XO5 A;  4M2O A;  3GK1 A;  1CDN A;  3BJH A;  2OS8 C;  1K90 D;  3DD4 A;  5AAN A;  1F8H A;  1YRU B;  1NUB A;  1KWO B;  4C0L A;  1F70 A;  2LHL A;  1LA3 A;  1JFJ A;  2D8N A;  1QLS A;  1YUR A;  2FJU B;  1GGW A;  1XA5 A;  1BR1 B;  3CZ0 A;  1DTL A;  1RWY A;  2KOT A;  1GGZ A;  4GFT A;  4MLW A;  3SS5 A;  1C07 A;  3EK8 A;  1LS8 A;  2P6B B;  1S26 D;  3B87 A;  1REC A;  4HRG A;  2LE9 B;  1TNX A;  1TWO A;  1SNL A;  3ZWH A;  1OOJ A;  5AFP A;  3A4U B;  1IIO A;  2JNX A;  3FE9 A;  2QAC A;  1SR6 B;  4MBE A;  2ISD A;  5DIC A;  3I5H C;  1ALV A;  2BL0 C;  3NXA A;  2JT0 A;  2LMU A;  3I5G B;  2WC8 A;  3BFH A;  1N0Y A;  2QDI A;  3GOF A;  1OW4 A;  2GV5 A;  5KTY A;  1IH0 A;  2OTG B;  4ZCU A;  3PJI A;  2WND A;  5EL2 A;  1B8L A;  2KLE A;  4MSP A;  2QEH A;  5FI2 A;  1QTX A;  1DQE A;  1NP8 A;  2LVV A;  1QIW A;  1R6P A;  2CNP A;  2GTE A;  3NSL A;  1F71 A;  4OZD A;  2F2O A;  2MA2 A;  1A75 B;  2AMI A;  4CID A;  2KDH A;  1AJ5 A;  1LVC D;  4INX A;  3D77 A;  2NLN A;  3R1P A;  4PCW A;  1U5I B;  1CFC A;  2HQW A;  3DVJ A;  4OVN F;  4A4B A;  2OPO A;  2PRU A;  1KK8 B;  2BCA A;  4M2Q A;  2KFF A;  3BUO B;  1IQ5 A;  1K9U A;  3CZT X;  2BE4 A;  3I5F B;  3KPX A;  4ORA B;  3OHM B;  1SSE B;  2MRD A;  1AUI B;  3I5I C;  4I5L B;  2WC5 A;  2BAP A;  1SKT A;  3DF0 B;  4I5N B;  2CTN A;  3NSO A;  1TTX A;  1KK7 Y;  2M7N A;  2BCB A;  2HPS A;  4MN0 A;  4D1E A;  5TNC A;  1J55 A;  1DMO A;  4WQ2 A;  5DKN A;  4OR9 B;  4C0K A;  3AAK A;  1QWV A;  1UWO A;  1J1E A;  2PQL A;  1N2D A;  1DJZ A;  4XJK A;  1KQV A;  1B7T Z;  4KYN A;  1CMG A;  1JF2 A;  1CLM A;  2I2R E;  1BMO A;  3OGN A;  4DUQ A;  1DJW A;  1TCF A;  1OOF A;  2MAZ A;  1PVB A;  4PHK A;  2M8U A;  1BLQ A;  2EC6 B;  2LCP A;  1DVI A;  3O4X A;  2F3Z A;  2JPO A;  5CSN A;  2ZKM X;  3PAT A;  1ZAC A;  2MLE C;  3EKJ A;  1Y1A A;  1G4Y R;  2LVI A;  2KAX A;  3BQ3 A;  1AVS A;  3OP0 A;  1XFZ O;  3S0G A;  1K9P A;  1Z2C B;  2KI6 C;  1J7R A;  3L4A A;  2Q4U A;  3RLZ A;  4AOM A;  4MRX A;  1AK8 A;  2A4J A;  1TNP A;  4ORC B;  2LV7 A;  1IRJ A;  4DS7 A;  2WCM A;  2PAS A;  1SL7 A;  2FJY A;  5DKQ A;  1P28 A;  1PSB A;  3WNX B;  5B8I B;  2KHN A;  2WCK A;  2KAY A;  3DZT A;  1DJX A;  2K8M B;  1TRF A;  1BT6 A;  2LC5 A;  3LL8 B;  2NXQ A;  1NSH A;  3TUY B;  2JXL A;  3CR5 X;  3B7A A;  4P5O E;  1CKK A;  1EH2 A;  2L98 A;  3S0E A;  3DYE A;  2ZND A;  2H61 A;  3K1E A;  3I5F C;  2OTG C;  3NSK A;  1NCX A;  1WLZ A;  3K21 A;  1MF8 B;  1B8R A;  2LMT A;  1C7W A;  1LIN A;  4PT1 A;  1OZO A;  3SS4 A;  1S5G Z;  5HL1 A;  1ZFS A;  2KGR A;  3TZ1 A;  5BPJ A;  4DIR A;  3SS3 A;  3V2L A;  1GM0 A;  2IS9 A;  5D69 A;  1W7J B;  1XFR A;  2F2P A;  1RK9 A;  3DVK A;  2LLT A;  2KSP A;  1J7O A;  1NWD A;  2MHH A;  2ZFD A;  2KBM A;  3PAL A;  3FWC A;  1OMD A;  2L4H A;  2KQ6 A;  2HF5 A;  4I5K A;  3SG7 A;  4XYN A;  3Q8I A;  1PVA A;  3GK4 X;  1D1O A;  2COL B;  3IQQ A;  3R72 A;  4PHN A;  1SPY A;  1DEL A;  1TCO B;  1QIV A;  1YUT A;  1AJ4 A;  3EVV A;  4OCI A;  3UNW A;  2CBL A;  1PSR A;  2LLS A;  5J3X A;  2F33 A;  3R1O A;  1BJF A;  2LP2 A;  4I5J A;  3O78 A;  1G8I A;  2WOR A;  4NDC A;  1TOP A;  3B86 A;  2QPT A;  5I2O A;  1A29 A;  2JNF A;  4MZL A;  5HKZ A;  1G33 A;  1TUZ A;  2WCE A;  4M2P A;  2K2F A;  3BUM B;  4R1E A;  1B4C A;  2I18 A;  2L2C A;  1CM1 A;  4INW A;  2K61 A;  2B1U A;  1CFD A;  1V1G A;  2O60 A;  5JJG A;  5ER5 A;  1QJT A;  1J7Q A;  2KBI A;  1NX2 A;  1YUS A;  3TDI A;  3H4S E;  3R1V A;  4WQ3 A;  1PRW A;  1KWO C;  2P71 A;  2WCH A;  3NHI A;  1BOD A;  2KI4 C;  4JWQ A;  5D7F A;  5IBW A;  1H8B A;  1RJV A;  4HRH A;  1FF1 A;  1QV0 A;  1C3Z A;  1SCV A;  1CB1 A;  1CFF A;  4ICB A;  2BCX A;  1K8U A;  1NX3 A;  3KF9 A;  1OOH A;  3I5I B;  2JQ6 A;  1NX1 A;  2Y4Q A;  2QEB A;  2SAS A;  2PYQ A;  3KO0 A;  1PAL A;  2E30 A;  2RGI A;  1TUJ A;  3HCM A;  1SL8 A;  2JZI A;  3S0B A;  4YI8 A;  1MR8 A;  1B7T Y;  3SG6 A;  2ERB A;  2TN4 A;  3GK2 A;  2K7C A;  2ZNE A;  1JBA A;  1M63 B;  1DJG A;  3D10 A;  5FI7 A;  2MLF C;  1WY9 A;  1KSO A;  3SG5 A;  3BOW A;  1F55 A;  4NQG A;  1FBV A;  1Y1X A;  4N5X A;  2KFG A;  4CPV A;  3RZS A;  3JTD B;  4DCK A;  1EG4 A;  1OQP A;  4U8D A;  4ETO A;  3D78 A;  4Q04 A;  3L4L A;  1BOC A;  1DEK A;  5CSF A;  1DF0 B;  2NCP A;  1V1F A;  4JKT A;  4JPZ B;  1MQ1 A;  2KLD A;  4MZJ A;  2GGZ A;  2H8V A;  1C3Y A;  3OB2 B;  1A2X A;  1MWN A;  2CCM A;  4A4C A;  4F7F A;  1CM4 A;  2LAN A;  1TNQ A;  2O5G A;  3DXL A;  1EXR A;  3BUN B;  1FPW A;  1H4B A;  1T14 A;  1WDC B;  1KSM A;  3D75 A;  3O6B A;  2L51 A;  2JT3 A;  2WCJ A;  1K93 D;  3CAB A;  2K2A A;  1CLB A;  1NX0 A;  1XFU O;  2H2K A;  2GGM A;  4GNK B;  4YGD B;  5HYD A;  5I2L A;  1WRL A;  2M9G A;  1UHI A;  2V53 A;  3MSE B;  1NYA A;  1Y0V H;  1M31 A;  5AER A;  2EHB A;  3IF7 A;  2HET A;  5HLO A;  1YVH A;  1S1E A;  2Y5I A;  4OKH A;  3PLF B;  3JVT B;  1W9Z A;  4GGF A;  5FI6 A;  4QJ5 B;  4YI9 A;  1PK0 D;  3TS5 B;  1C7V A;  2L5Y A;  1KK8 C;  3CZ1 A;  1TN4 A;  3OX5 A;  3CS1 A;  4WRI A;  1WRK A;  1KFU L;  2FCD A;  3SIA A;  1ALW A;  3PM2 A;  1JFK A;  2KFH A;  2WCF A;  5JOL A;  1OMV A;  2P70 A;  1UHJ A;  4MEW A;  4HRE E;  3SJS A;  4USL A;  1YRT B;  2M49 B;  1CFP A;  3FWB A;  2JWW A;  3S0D A;  1LXF C;  1LKJ A;  5FYX A;  1CDL A;  3ICB A;  2HQ8 A;  4P2Y B;  3AKA A;  2M1U A;  4PHM A;  2JXC A;  4DRW A;  5I94 A;  3M0W A;  3O2P A;  3PN7 C;  1EG3 A;  1XYD A;  1TNW A;  3SG3 A;  1Z4H A;  2JUL A;  2K60 A;  1DJH A;  1W7I B;  1XFY O;  5D3O A;  3C1V A;  2ZRT A;  2K7D A;  2EGD A;  4YGC B;  1MXE A;  2KGB C;  1SBJ A;  3BUW B;  3D0Y A;  4N1F A;  3CZ2 A;  4YGA A;  2PAL A;  1M46 A;  4PE0 A;  3FS7 A;  5GQQ C;  1UHK A;  3TDU A;  2ZN9 A;  3B6X A;  3DVM A;  3DF0 A;  1UP5 A;  1YX7 A;  4GBA A;  1Y6W A;  3WXA A;  2NCO A;  1RFJ A;  4FQT A;  3LCP C;  3CYZ A;  5I2Q A;  1IJ6 A;  3FE6 A;  4E68 A;  1CNP A;  2M0R A;  4GPL B;  1JSA A;  2DOQ A;  1K2H A;  1XFX O;  1JUO A;  2L2E A;  2LVJ A;  2BBM A;  4CLN A;  3VRP A;  1DF0 A;  3JVT C;  1BU3 A;  1YX8 A;  5K89 A;  2KPH A;  1KFX L;  2KYC A;  2LAP A;  4AQJ A;  3PM8 A;  2JC2 A;  2LMV A;  2QEO A;  1JC2 A;  1OZS A;  2F8P A;  3QRX A;  3B88 A;  1EJ3 A;  4AQI A;  3EVR A;  3S0F A;  2BEC A;  4YBH B;  1QXP A;  3EK7 A;  4BY4 A;  1KQM C;  1KK7 Z;  2KI4 B;  3LLE A;  2CT9 A;  1WLM A;  2FOT A;  3OB1 B;  2LP3 A;  4CFR A;  1PUL A;  3VRO A;  1DGV A;  1S6I A;  1K96 A;  3D74 A;  2NZ0 A;  3PSR A;  1KFU S;  1DGU A;  2WCB A;  3VRR A;  1E8A A;  1M45 A;  1QX2 A;  4HSZ A;  4GGF C;  2K0J A;  3LK1 A;  2LUC A;  2VRG A;  4YGE B;  4CFQ A;  1A4P A;  3I5H B;  2QEV A;  3JTD C;  4F0Z B;  3ZNI A;  2Y1N A;  3QME A;  4FTG A;  2L50 A;  2PVB A;  2WC6 A;  1EL4 A;  5AXI A;  3BFB A;  5G08 A;  2G2B A;  2K7B A;  5KSZ A;  3PFV A;  1B9A A;  1SRA A;  1L7Z A;  3D73 A;  1DC1 A;  2M97 A;  4NDD A;  4IJ7 A;  1U5I A;  1XVJ A;  3TS5 C;  3DY9 A;  3EKH A;  2JRF A;  2CXJ A;  1BR4 B;  1L2O B;  3IVT A;  4FQO A;  2R2I A;  4GAO A;  3DVE A;  1OMR A;  2MBX A;  1IKU A;  3IQO A;  1MHO A;  1CDM A;  1XK4 A;  1IWQ A;  2SCP A;  1B1G A;  3NHT A;  1XK4 C;  3NGV A;  4PDZ A;  3EG5 B;  1BF5 A;  3D0Y B;  1UUR A;  3NSI A;  5CPV A;  3CWG A;  2WCL A;  1CLL A;  4QJ4 B;  3LK0 A;  1S6C A;  5HKW A;  2H61 C;  3BYA A;  3AAJ A;  4BY5 A;  1S5G Y;  2M1K B;  2YGU A;  1DT7 B;  2LHI A;  2MJW B;  1NIW A;  2BKH B;  1QLK A;  2Q91 A;  1WRZ A;  1QX7 A;  2BE6 A;  1QAT A;  3N7H A;  1KFX S;  1DJI A;  1UUS A;  2I7A A;  2PSR A;  1QS7 A;  1TIZ A;  4PE7 A;  2JU0 A;  4MRY A;  1NCZ A;  4QJ3 B;  3VRN A;  1IQ3 A;  3EVU A;  4PE4 A;  1IGV A;  3CTN A;  3O4Y A;  4GUK A;  1MUX A;  5PAL A;  1CMF A;  3UO9 A;  1F4Q A;  2ZN8 A;  1QVI Y;  2AAO A;  2KAV A;  1YTZ C;  5F6T A;  5DKR A;  2LUX A;  1DJY A;  1ZUZ A;  3VRQ A;  1HT9 A;  1SCM B;  2OS8 B;  1GQM A;  1OOG A;  3I5G C;  4NDB A;  2L0P A;  1XFW O;  1SYM A;  2F3Y A;  1ORG A; 
#chains in the Genus database with same CATH homology
 1S36 A;  3CR2 A;  1SK6 D;  4GGN A;  1AHR A;  1F4O A;  3A8R A;  2EC6 C;  3WHU B;  2LVK A;  1WDC C;  5I8N A;  5KU1 A;  1RRO A;  3KEV A;  2FCE A;  2WOS A;  4IL1 A;  1QV1 A;  1HQV A;  3EK4 A;  1UHH A;  3CLN A;  3KHE A;  5CSJ A;  3SG4 A;  1F54 A;  2BKI B;  2KQY A;  1B8C A;  3TDZ A;  1XFV O;  1VRK A;  2M3W A;  1Y1U A;  2JOJ A;  2M29 A;  1NPQ A;  1IJ5 A;  4OV2 A;  1L2O C;  4MVF A;  1QX5 B;  1MXL C;  3BOW B;  2PMY A;  4TNC A;  3TUY C;  3CGA A;  1YUU A;  1J7P A;  3PN7 B;  2JPT A;  2LM5 A;  3BUX B;  3E3R A;  1SR6 C;  4L9M A;  2JTT A;  5CSI A;  1JWD A;  1R2U A;  4YRU A;  1KQM B;  5HLV A;  1Q80 A;  5AEQ A;  1ZMZ A;  1FI6 A;  1B47 A;  4XJK B;  1K94 A;  4ZCV A;  1OE9 B;  2K7O A;  1QVI Z;  1NCY A;  2AUC A;  4C0J A;  2KI6 D;  1S6J A;  2Y1M A;  3SIB A;  2JT8 A;  4ORB B;  1FW4 A;  1K95 A;  4PAL A;  1KCY A;  1CDP A;  1FI5 A;  4PHJ A;  2KNE A;  4UPG A;  1LA0 A;  2BL0 B;  3CR4 X;  1SL9 A;  3FIA A;  2BBN A;  1A75 A;  5ER4 X;  1GJY A;  2G9B A;  1OSA A;  1UHN A;  3VGO A;  1K9K A;  1S3P A;  1YVL A;  2LNK A;  3OX6 A;  1JF0 A;  1SCM C;  4N1G A;  1SMG A;  1M39 A;  2LLU A;  5HKY A;  1ODB A;  1SW8 A;  2L5X B;  4JQ0 D;  1X02 A;  1YR5 A;  1IG5 A;  2JTZ A;  3BXK A;  1J1D A;  1A03 A;  3HX4 A;  1N65 A;  3AKB A;  2E6W A;  3F45 A;  4YGB B;  1BG1 A;  3RM1 A;  2M7L A;  4PE1 A;  1QAS A;  1SY9 A;  2KYF A;  4MZK A;  1CTR A;  1RTP 1;  1ZOT B;  2L4I A;  3SG2 A;  3WHT B;  2ZRS A;  2I94 A;  1XO5 A;  4M2O A;  3GK1 A;  1CDN A;  2OS8 C;  1K90 D;  3DD4 A;  5AAN A;  1F8H A;  1YRU B;  1NUB A;  1KWO B;  4C0L A;  1F70 A;  2LHL A;  1LA3 A;  1JFJ A;  2D8N A;  1QLS A;  1YUR A;  2FJU B;  1GGW A;  1XA5 A;  1BR1 B;  4GFT A;  1DTL A;  1RWY A;  2KOT A;  1GGZ A;  4MLW A;  1C07 A;  3EK8 A;  2P6B B;  1S26 D;  1REC A;  4HRG A;  2LE9 B;  1TNX A;  1SNL A;  3ZWH A;  1OOJ A;  5AFP A;  3A4U B;  2JNX A;  2QAC A;  1SR6 B;  4MBE A;  2ISD A;  3I5H C;  1ALV A;  2BL0 C;  3NXA A;  2JT0 A;  2LMU A;  3I5G B;  2WC8 A;  1N0Y A;  3GOF A;  2GV5 A;  5KTY A;  1IH0 A;  2OTG B;  4ZCU A;  2WND A;  1B8L A;  4MSP A;  1QTX A;  1NP8 A;  2LVV A;  1QIW A;  1R6P A;  2CNP A;  1F71 A;  3NSL A;  2F2O A;  2MA2 A;  1A75 B;  2AMI A;  4CID A;  2KDH A;  1AJ5 A;  1LVC D;  2NLN A;  4PCW A;  1U5I B;  1CFC A;  2HQW A;  3DVJ A;  4OVN F;  4A4B A;  2OPO A;  2PRU A;  1KK8 B;  2BCA A;  4M2Q A;  2KFF A;  3BUO B;  1IQ5 A;  1K9U A;  3CZT X;  2BE4 A;  3I5F B;  3KPX A;  4ORA B;  3OHM B;  2MRD A;  1AUI B;  3I5I C;  4I5L B;  1SKT A;  3DF0 B;  4I5N B;  2CTN A;  3NSO A;  1TTX A;  1KK7 Y;  2M7N A;  2BCB A;  2HPS A;  4MN0 A;  4D1E A;  5TNC A;  1J55 A;  1DMO A;  4WQ2 A;  5DKN A;  4OR9 B;  4C0K A;  3AAK A;  1UWO A;  1J1E A;  1N2D A;  1DJZ A;  4XJK A;  1KQV A;  1B7T Z;  1CMG A;  1JF2 A;  1CLM A;  2I2R E;  1BMO A;  4DUQ A;  1DJW A;  1TCF A;  2MAZ A;  1PVB A;  4PHK A;  2M8U A;  1BLQ A;  2EC6 B;  2LCP A;  1DVI A;  2F3Z A;  5CSN A;  2ZKM X;  3PAT A;  1ZAC A;  2MLE C;  3EKJ A;  1Y1A A;  1G4Y R;  2LVI A;  2KAX A;  3BQ3 A;  1AVS A;  3OP0 A;  1XFZ O;  1K9P A;  2KI6 C;  1J7R A;  3RLZ A;  2Q4U A;  4AOM A;  4MRX A;  1AK8 A;  2A4J A;  1TNP A;  4ORC B;  2LV7 A;  1IRJ A;  4DS7 A;  2PAS A;  1SL7 A;  5DKQ A;  3WNX B;  5B8I B;  1PSB A;  2KHN A;  2KAY A;  1DJX A;  2K8M B;  1TRF A;  1BT6 A;  2LC5 A;  3LL8 B;  2NXQ A;  1NSH A;  3TUY B;  2JXL A;  3CR5 X;  4P5O E;  1CKK A;  1EH2 A;  2L98 A;  2ZND A;  2H61 A;  3I5F C;  2OTG C;  3NSK A;  1NCX A;  1WLZ A;  3K21 A;  1MF8 B;  1B8R A;  2LMT A;  1C7W A;  1LIN A;  1OZO A;  1S5G Z;  1ZFS A;  2KGR A;  3TZ1 A;  5BPJ A;  4DIR A;  2IS9 A;  5D69 A;  1W7J B;  2F2P A;  1RK9 A;  3DVK A;  2LLT A;  2KSP A;  1J7O A;  1NWD A;  2MHH A;  2ZFD A;  2KBM A;  3PAL A;  3FWC A;  1OMD A;  2L4H A;  2KQ6 A;  2HF5 A;  4I5K A;  3SG7 A;  4XYN A;  1PVA A;  3GK4 X;  1D1O A;  2COL B;  3IQQ A;  4PHN A;  1SPY A;  1TCO B;  1QIV A;  1YUT A;  1AJ4 A;  3EVV A;  4OCI A;  2CBL A;  1PSR A;  2LLS A;  5J3X A;  2F33 A;  1BJF A;  2LP2 A;  4I5J A;  3O78 A;  1G8I A;  2WOR A;  4NDC A;  1TOP A;  2QPT A;  5I2O A;  1A29 A;  2JNF A;  4MZL A;  5HKZ A;  1G33 A;  2WCE A;  4M2P A;  2K2F A;  3BUM B;  4R1E A;  1B4C A;  2I18 A;  1CM1 A;  2K61 A;  2B1U A;  1CFD A;  1V1G A;  2O60 A;  5JJG A;  5ER5 A;  1QJT A;  1J7Q A;  2KBI A;  1NX2 A;  1YUS A;  3TDI A;  3H4S E;  4WQ3 A;  1PRW A;  1KWO C;  1BOD A;  2KI4 C;  4JWQ A;  5D7F A;  5IBW A;  1H8B A;  1RJV A;  4HRH A;  1FF1 A;  1QV0 A;  1CB1 A;  1SCV A;  1CFF A;  4ICB A;  2BCX A;  1K8U A;  1NX3 A;  3KF9 A;  3I5I B;  2JQ6 A;  1NX1 A;  2Y4Q A;  2SAS A;  3KO0 A;  1PAL A;  2E30 A;  2RGI A;  3HCM A;  1SL8 A;  2JZI A;  4YI8 A;  1MR8 A;  1B7T Y;  3SG6 A;  2TN4 A;  3GK2 A;  2K7C A;  2ZNE A;  1JBA A;  1M63 B;  1DJG A;  3D10 A;  2MLF C;  1WY9 A;  1KSO A;  3SG5 A;  3BOW A;  1F55 A;  4NQG A;  1FBV A;  1Y1X A;  4N5X A;  2KFG A;  4CPV A;  3JTD B;  4DCK A;  1EG4 A;  1OQP A;  4U8D A;  4ETO A;  4Q04 A;  1BOC A;  5CSF A;  1DF0 B;  2NCP A;  1V1F A;  4MZJ A;  4JPZ B;  1MQ1 A;  2GGZ A;  3OB2 B;  1A2X A;  1MWN A;  2CCM A;  4A4C A;  1CM4 A;  2LAN A;  1TNQ A;  2O5G A;  1FPW A;  1EXR A;  3BUN B;  1H4B A;  1WDC B;  1KSM A;  3O6B A;  2L51 A;  2JT3 A;  1K93 D;  2K2A A;  1CLB A;  1NX0 A;  1XFU O;  2H2K A;  2GGM A;  4GNK B;  4YGD B;  5HYD A;  5I2L A;  1WRL A;  2M9G A;  1UHI A;  2V53 A;  3MSE B;  1NYA A;  1Y0V H;  1M31 A;  5AER A;  2EHB A;  3IF7 A;  2HET A;  5HLO A;  1YVH A;  1S1E A;  2Y5I A;  4OKH A;  3JVT B;  4GGF A;  4QJ5 B;  4YI9 A;  1PK0 D;  3TS5 B;  1C7V A;  1KK8 C;  1TN4 A;  3OX5 A;  3CS1 A;  4WRI A;  1WRK A;  1KFU L;  2FCD A;  3SIA A;  1ALW A;  1JFK A;  2KFH A;  2WCF A;  5JOL A;  1OMV A;  1UHJ A;  4MEW A;  4HRE E;  3SJS A;  4USL A;  1YRT B;  2M49 B;  1CFP A;  3FWB A;  2JWW A;  1LXF C;  1LKJ A;  5FYX A;  1CDL A;  3ICB A;  2HQ8 A;  4P2Y B;  3AKA A;  2M1U A;  4PHM A;  2JXC A;  4DRW A;  3M0W A;  3O2P A;  3PN7 C;  1EG3 A;  1XYD A;  1TNW A;  3SG3 A;  2JUL A;  1DJH A;  1W7I B;  1XFY O;  3C1V A;  2ZRT A;  2K7D A;  2EGD A;  4YGC B;  1MXE A;  2KGB C;  1SBJ A;  3BUW B;  3D0Y A;  4N1F A;  4YGA A;  2PAL A;  1M46 A;  4PE0 A;  3FS7 A;  5GQQ C;  1UHK A;  3TDU A;  2ZN9 A;  3DVM A;  3DF0 A;  1UP5 A;  1YX7 A;  4GBA A;  1Y6W A;  3WXA A;  2NCO A;  1RFJ A;  3LCP C;  5I2Q A;  4E68 A;  1IJ6 A;  1CNP A;  1JSA A;  1K2H A;  2M0R A;  4GPL B;  2DOQ A;  1XFX O;  1JUO A;  2L2E A;  2LVJ A;  2BBM A;  4CLN A;  3VRP A;  1DF0 A;  3JVT C;  1BU3 A;  1YX8 A;  5K89 A;  1KFX L;  2KYC A;  2LAP A;  4AQJ A;  3PM8 A;  2JC2 A;  2LMV A;  1JC2 A;  1OZS A;  2F8P A;  3QRX A;  1EJ3 A;  4AQI A;  3EVR A;  2BEC A;  4YBH B;  1QXP A;  3EK7 A;  4BY4 A;  1KQM C;  1KK7 Z;  2KI4 B;  3LLE A;  2CT9 A;  1WLM A;  2FOT A;  3OB1 B;  2LP3 A;  4CFR A;  1PUL A;  3VRO A;  1DGV A;  1S6I A;  1K96 A;  3PSR A;  2NZ0 A;  1KFU S;  1DGU A;  2WCB A;  3VRR A;  1E8A A;  1M45 A;  1QX2 A;  4HSZ A;  4GGF C;  2K0J A;  3LK1 A;  2LUC A;  2VRG A;  4YGE B;  4CFQ A;  1A4P A;  3I5H B;  3JTD C;  4F0Z B;  3ZNI A;  2Y1N A;  4FTG A;  2L50 A;  2PVB A;  1EL4 A;  5AXI A;  5G08 A;  2G2B A;  2K7B A;  5KSZ A;  3PFV A;  1B9A A;  1SRA A;  1L7Z A;  2M97 A;  4NDD A;  1U5I A;  1XVJ A;  3TS5 C;  3EKH A;  2JRF A;  2CXJ A;  1BR4 B;  1L2O B;  4FQO A;  1AP4 A;  2R2I A;  4GAO A;  3DVE A;  1OMR A;  2MBX A;  1IKU A;  3IQO A;  1MHO A;  1CDM A;  1XK4 A;  1IWQ A;  2SCP A;  1B1G A;  4PDZ A;  1XK4 C;  1BF5 A;  3D0Y B;  1UUR A;  3NSI A;  5CPV A;  3CWG A;  1CLL A;  4QJ4 B;  3LK0 A;  1S6C A;  5HKW A;  2H61 C;  3BYA A;  3AAJ A;  4BY5 A;  1S5G Y;  2M1K B;  1DT7 B;  2LHI A;  2MJW B;  1NIW A;  2BKH B;  1QLK A;  2Q91 A;  1WRZ A;  1QX7 A;  2BE6 A;  1QAT A;  1KFX S;  1DJI A;  1UUS A;  2I7A A;  2PSR A;  1QS7 A;  1TIZ A;  4PE7 A;  2JU0 A;  4MRY A;  1NCZ A;  4QJ3 B;  3VRN A;  1IQ3 A;  3EVU A;  4PE4 A;  1IGV A;  3CTN A;  3O4Y A;  4GUK A;  1MUX A;  5PAL A;  1CMF A;  1F4Q A;  2ZN8 A;  1QVI Y;  2AAO A;  2KAV A;  1YTZ C;  5F6T A;  5DKR A;  2LUX A;  1DJY A;  1ZUZ A;  3VRQ A;  1HT9 A;  1SCM B;  2OS8 B;  1GQM A;  3I5G C;  4NDB A;  2L0P A;  1XFW O;  1SYM A;  2F3Y A;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...