1JFJA

Nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
publication title NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Metal binding protein
total genus 37
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA02
1R6PA 2ZNEA 3O78A 1RJVA 1K9KA 1A2XA 1DJXA 1BU3A 2GGZA 2LAPA 1JWDA 4WRIA 1CFCA 4OR9B 1CFPA 2L5XB 3ICBA 2FJUB 1K93D 2WOSA 1NUBA 1BLQA 5GQQC 4ETOA 4C0JA 2P6BB 3CGAA 4YI8A 1FI6A 1UWOA 2BECA 1IQ5A 1YUTA 1DJWA 2LVIA 4YI9A 1OZSA 2M29A 2M7NA 5J3XA 4MSPA 3TS5B 1PALA 3VROA 2JTTA 3BUMB 1M45A 3DVEA 1AP4A 4NDCA 2H2KA 1PRWA 1MWNA 1B7TY 1SNLA 1ZOTB 1DJHA 3PLFB 2MLEC 1UURA 2PSRA 4P2YB 2JOJA 1OMDA 2M97A 2BCAA 2KQ6A 2LMTA 2Q91A 3O4YA 1KK7Z 2K8MB 2KI4C 3I5IC 2LUCA 1S26D 4PE4A 1IQ3A 3PN7B 3DVKA 5HKZA 3IQOA 1CLLA 1Y1AA 1UP5A 2AAOA 1LA3A 3IQQA 1SPYA 4OKHA 1J7PA 2LCPA 2JQ6A 1UHHA 3VRQA 1F54A 2CCMA 4WQ2A 1SRAA 1ZFSA 1NP8A 1WDCC 3GK2A 2EC6C 3OB2B 2Y5IA 3PATA 1SKTA 4IL1A 2L0PA 2L2EA 2LVKA 1MUXA 4E68A 1KWOC 2LLUA 2F2OA 2QACA 1SCMC 1SBJA 3TDIA 4MVFA 3OX6A 2MRDA 1OMRA 4F0ZB 1S5GY 2H61C 1NYAA 4USLA 1KQVA 1N65A 2L98A 1BR4B 2LP3A 4CFRA 1CDNA 2Y4QA 1JBAA 2NZ0A 1QJTA 3MSEB 1CMGA 3M0WA 1KK8C 4MRXA 1XVJA 1DJGA 2LP2A 2Y1NA 3BOWA 1K9PA 1KFXS 5HLOA 1K2HA 1PK0D 2JPTA 1E8AA 3LK0A 4GFTA 1IJ5A 2LMUA 2FCEA 1YUSA 1EG3A 2F33A 2FOTA 4ZCVA 3D10A 1ZACA 1U5IB 4GBAA 1G8IA 1C07A 1CB1A 2IS9A 1F8HA 1EXRA 1JFKA 2K7DA 2KYCA 3VRNA 3NSOA 1NCZA 1LINA 4Q04A 1IG5A 5I2LA 1Y0VH 4CIDA 3SIAA 2WCBA 1CLBA 1MQ1A 2F3YA 3AAJA 2LLSA 1B8RA 1J7RA 1BT6A 1BF5A 1JUOA 2F3ZA 2Q4UA 1B47A 2JWWA 2PMYA 3DF0B 4PDZA 2M49B 1TNWA 4DS7A 1CM1A 1QV0A 2JT0A 1SCMB 4D1EA 2LUXA 1SL7A 2JZIA 3AAKA 1YX7A 5ER5A 1N0YA 5CSJA 3LLEA 4DRWA 2GV5A 1YRUB 2LLTA 2MA2A 4GGFC 1B8LA 1S6JA 1K9UA 1YVLA 4YGEB 4XJKB 1KK8B 4MZJA 1DJYA 1W7JB 1OQPA 4BY5A 1SK6D 1NCXA 1LVCD 3TS5C 1LXFC 1CNPA 2RGIA 3WHTB 3BUOB 1BOCA 1AJ5A 1OOJA 2L4HA 1A75A 3K21A 1TOPA 1HQVA 1Q80A 2WCFA 2ZRTA 3TDZA 2E30A 1QX5B 1DVIA 3NSLA 1IRJA 4MN0A 2ZKMX 4M2OA 3PN7C 5AEQA 5KTYA 1GQMA 4MRYA 1A03A 1A29A 4L9MA 5JOLA 1IH0A 1EL4A 3OX5A 2F2PA 1M63B 2KFGA 2WC8A 1TN4A 1SR6C 4WQ3A 3SG5A 3EK7A 2JTZA 1CFDA 3SJSA 2K2FA 1S6CA 4N5XA 1D1OA 3BYAA 1RTP1 1RK9A 3FWBA 3EK8A 2BE6A 3ZWHA 3WNXB 1FF1A 4GAOA 1M46A 2PRUA 1F55A 2O5GA 2KGRA 3DD4A 2CTNA 5JJGA 1FPWA 1PVAA 1MXLC 1QTXA 2M1UA 1B9AA 2DOQA 2A4JA 1EH2A 1QXPA 1XFVO 1QX2A 4OV2A 1F70A 4OVNF 1TNPA 3EKJA 1J1EA 4NDDA 1CLMA 2ZN9A 2LC5A 5I2OA 2QPTA 4QJ4B 1YX8A 1K96A 2PASA 3JVTC 3KEVA 5AFPA 1GGWA 3KHEA 3NSIA 1OE9B 1G33A 3LL8B 1WY9A 1RFJA 1NCYA 1U5IA 2KAVA 3KF9A 3QRXA 1S5GZ 2M3WA 1CM4A 2KGBC 1SR6B 1WRZA 2LNKA 1L2OB 3E3RA 1WRLA 1F4QA 3CR4X 3C1VA 5HYDA 1DGUA 4YGAA 2BKIB 1QLSA 2LVJA 3SG6A 3BUWB 1JSAA 3CR5X 1UHNA 1UHIA 3BQ3A 3OB1B 5ER4X 1CDPA 1KSMA 2GGMA 3CTNA 1CTRA 5D69A 1G4YR 3BUNB 3LK1A 3GK1A 3DF0A 2BKHB 1OMVA 3I5GB 1B8CA 5F6TA 2K7CA 1SY9A 1SMGA 2KI6D 1K95A 1N2DA 3SIBA 2H61A 1OZOA 3FIAA 3KPXA 4HSZA 1YVHA 3I5FB 2NLNA 1KQMC 2BE4A 4PHNA 5HKWA 3O2PA 2JC2A 5KSZA 2K7OA 3IF7A 4M2QA 4YGBB 2ISDA 3RM1A 1ALWA 2ZN8A 2I94A 3JVTB 5AXIA 2SASA 1DJZA 2MHHA 4JPZB 3SG4A 1M31A 3PM8A 4CPVA 3EVVA 2HPSA 5DKRA 1XYDA 4OCIA 4A4BA 1QV1A 1F4OA 1J1DA 1K8UA 4BY4A 3FWCA 1NX3A 5TNCA 4AOMA 2L50A 1WRKA 2CT9A 4I5KA 3RLZA 3D0YA 1K90D 1NX2A 2LHIA 1XK4C 4QJ3B 3CR2A 1DT7B 2ZNDA 2OTGB 4MZLA 4U8DA 2KAYA 1QVIZ 1MXEA 2LVVA 1QIVA 2WORA 4N1FA 1YR5A 1YUUA 3CLNA 5CSFA 4FQOA 5FYXA 1WLZA 1QS7A 1NX0A 3GOFA 3FS7A 3EKHA 1DF0B 2KNEA 1QATA 2HQ8A 1BODA 3KO0A 1W7IB 4GGFA 1BG1A 1KQMB 2KBIA 4YBHB 1XFYO 5BPJA 1YURA 4GGNA 2F8PA 1OSAA 3BOWB 1A4PA 2LE9B 1AHRA 4FTGA 1C7WA 1S36A 1XA5A 2EGDA 1F71A 1FI5A 1KFXL 1UUSA 1RWYA 4XYNA 2L51A 3OHMB 1CKKA 1NX1A 1ODBA 1PVBA 2JXCA 2K7BA 1YTZC 1KSOA 1L2OC 2COLB 2LMVA 3DVMA 5PALA 1B1GA 3OP0A 1XFXO 4PE1A 5CSNA 1BR1B 2R2IA 2JNFA 2MAZA 2VRGA 1EJ3A 1H4BA 2JXLA 1GGZA 1B7TZ 1IGVA 1TNQA 5KU1A 1QLKA 3VRPA 1FW4A 1H8BA 1CDLA 4JQ0D 3I5GC 1NIWA 1UHKA 1ALVA 1WLMA 1J7OA 2AUCA 2TN4A 2PVBA 4PHMA 2CBLA 2M9GA 3I5FC 3TUYB 3O6BA 1NSHA 4M2PA 3CWGA 4DUQA 2KSPA 3A8RA 1Y1UA 1IKUA 1A75B 5D7FA 4GPLB 4C0LA 2KBMA 3EVUA 1TRFA 3PFVA 2OS8B 4I5JA 2K61A 1AK8A 4PHKA 2K2AA 1QX7A 2KDHA 3I5HB 1PSBA 4N1GA 1IJ6A 2Y1MA 1B4CA 1MHOA 4MBEA 1ZMZA 1V1FA 1CDMA 4CFQA 2FCDA 4C0KA 4DCKA 2BCXA 2L4IA 2JU0A 3EK4A 1DMOA 1MR8A 3SG3A 2OTGC 2G9BA 2M0RA 4ICBA 1ZUZA 5DKNA 3NXAA 4ORBB 2NCPA 4ORAB 3A4UB 1IWQA 2I18A 3BXKA 3JTDB 4MZKA 3CS1A 1BJFA 1KK7Y 4NQGA 2OPOA 1NPQA 1TCFA 1Y6WA 2BL0C 4PE7A 2JT3A 2LANA 5DKQA 2HF5A 2HETA 3PALA 2JNXA 2KQYA 4HRHA 2ZFDA 2KOTA 3LCPC 1GJYA 4R1EA 4NDBA 1X02A 1XO5A 5B8IB 2B1UA 2BBMA 1JFJA 1JC2A 2G2BA 5HKYA 4XJKA 5K89A 3F45A 4PHJA 2I2RE 2M8UA 1DF0A 2O60A 4MEWA 4JWQA 1SW8A 1S1EA 1V1GA 1QIWA 3TDUA 1QASA 2WNDA 1KFUS 2ZRSA 1NWDA 1SL8A 3PSRA 1DTLA 4YGCB 5HLVA 4I5LB 1CFFA 3BUXB 3HX4A 5I2QA 1TTXA 2BBNA 1VRKA 2MBXA 3AKAA 1TIZA 3WXAA 2KI4B 2BCBA 2KYFA 3I5IB 4PE0A 1SYMA 1SL9A 5CSIA 1Y1XA 3DVJA 3H4SE 1S6IA 4HRGA 1DJIA 1KCYA 1EG4A 2KAXA 1WDCB 2BL0B 2NCOA 3VGOA 2EC6B 1XK4A 4YGDB 4PALA 2K0JA 4A4CA 2KHNA 2HQWA 4UPGA 2LHLA 1AVSA 1S3PA 1XFUO 1KWOB 4ORCB 4P5OE 1TCOB 2MLFC 4ZCUA 1XFWO 1DGVA 3WHUB 3TUYC 4HREE 4MLWA 1AJ4A 2JULA 2M7LA 1CMFA 1PSRA 1C7VA 1K94A 4GNKB 3EVRA 1YRTB 1R2UA 1PULA 2SCPA 2OS8C 1FBVA 1QVIY 2WCEA 1UHJA 3TZ1A 3SG7A 2NXQA 3VRRA 2LV7A 2JT8A 3I5HC 1AUIB 2LM5A 1TNXA 2V53A 1J7QA 2M1KB 4DIRA 1XFZO 5IBWA 4AQIA 1L7ZA 1JF2A 2KI6C 2EHBA 3SG2A 5I8NA 1RROA 1BMOA 4YRUA 1J55A 5AERA 1LA0A 2I7AA 1JF0A 1M39A 2JRFA 3ZNIA 2CXJA 3CZTX 1KFUL 2E6WA 5AANA 4GUKA 3D0YB 4CLNA 3GK4X 4TNCA 2PALA 3AKBA 2D8NA 4I5NB 4PCWA 4QJ5B 2KFHA 3JTDC 4AQJA 2AMIA 2CNPA 1LKJA 1SCVA 5CPVA 5G08A 1HT9A 3HCMA 2MJWB 3NSKA 2KFFA 1RECA 1MF8B
chains in the Genus database with same CATH superfamily
1R6PA 2ZNEA 3D78A 3O78A 1RJVA 4IJ7A 2WCHA 1K9KA 1A2XA 1DJXA 1BU3A 2GGZA 2LAPA 3BFHA 4WRIA 1CFCA 4OR9B 4FQTA 1CFPA 1JWDA 2L5XB 3ICBA 1P28A 1K93D 2FJUB 2WOSA 1NUBA 3L4LA 3S0EA 1BLQA 5GQQC 4ETOA 2KPHA 3FE9A 4C0JA 2BAPA 2P6BB 3CGAA 4YI8A 1FI6A 1UWOA 2BECA 1IQ5A 1YUTA 1DJWA 2LVIA 4YI9A 1OZSA 2M29A 2M7NA 5J3XA 4MSPA 3TS5B 1PALA 3VROA 2JTTA 3BUMB 1M45A 3DVEA 1AP4A 4NDCA 2H2KA 1PRWA 1MWNA 1B7TY 1SNLA 1TUJA 1DJHA 1ZOTB 3PLFB 2MLEC 2WCJA 1UURA 2PSRA 3L4AA 4P2YB 2JOJA 1OMDA 2M97A 5FI2A 2BCAA 2KQ6A 2LMTA 2Q91A 3D74A 3O4YA 1KK7Z 2K8MB 2KI4C 3I5IC 2LUCA 2KLEA 4KYNA 1S26D 4PE4A 1IQ3A 3PN7B 2KLDA 3DVKA 4F7FA 5HKZA 3IQOA 1CLLA 1Y1AA 1UP5A 2AAOA 1LA3A 3IQQA 1SPYA 4INXA 4OKHA 1J7PA 2LCPA 2JQ6A 1UHHA 3VRQA 1F54A 2CCMA 4WQ2A 1SRAA 1ZFSA 1NP8A 1WDCC 3GK2A 3CDNA 2EC6C 3OB2B 2Y5IA 3PATA 1SKTA 4IL1A 2L0PA 1OOIX 2L2EA 2LVKA 1MUXA 4E68A 1KWOC 2LLUA 2F2OA 2QACA 5EL2A 1SCMC 1SBJA 3TDIA 4MVFA 3OX6A 2MRDA 1OMRA 4F0ZB 1QWVA 1S5GY 2H61C 1NYAA 4USLA 1KQVA 1N65A 2L98A 1BR4B 2LP3A 2QEHA 4CFRA 1CDNA 2Y4QA 1JBAA 2NZ0A 1QJTA 3MSEB 1CMGA 3M0WA 1KK8C 4MRXA 1XVJA 1DJGA 2LP2A 2Y1NA 3BFAA 3BOWA 1K9PA 1KFXS 3OBVA 5HLOA 1K2HA 1PK0D 2JPTA 1E8AA 3LK0A 4GFTA 5DICA 1IJ5A 2LMUA 2FCEA 1YUSA 1EG3A 2F33A 2FOTA 3S0FA 4ZCVA 3D10A 1ZACA 1U5IB 4GBAA 1G8IA 1C07A 1IIOA 1CB1A 2IS9A 2QDIA 1F8HA 3D75A 1EXRA 1JFKA 2K7DA 1C3ZA 2KYCA 3VRNA 3NSOA 2JPOA 3QMEA 1NCZA 1LINA 4Q04A 1IG5A 5I2LA 3V2LA 1Y0VH 4CIDA 3DZTA 3SIAA 2WCBA 1CLBA 3O4XA 1MQ1A 2F3YA 3AAJA 2LLSA 1B8RA 1J7RA 1BT6A 1BF5A 1JUOA 2F3ZA 2Q4UA 1B47A 2JWWA 2PMYA 3DF0B 4PDZA 2M49B 1TNWA 4DS7A 1CM1A 1QV0A 2JT0A 1SCMB 4D1EA 2LUXA 3DXLA 1SL7A 2JZIA 3AAKA 1YX7A 5ER5A 1N0YA 5CSJA 3LLEA 4DRWA 2GV5A 1YRUB 2LLTA 2MA2A 4GGFC 1B8LA 1S6JA 1K9UA 1YVLA 4YGEB 4XJKB 1KK8B 4MZJA 1DJYA 1W7JB 3UO9A 1OQPA 4BY5A 1SK6D 3R1PA 1NCXA 1LVCD 3TS5C 1LXFC 1CNPA 2RGIA 1Z4HA 3WHTB 3BUOB 1BOCA 1AJ5A 1OOJA 2L4HA 3D76A 1A75A 3K21A 1TOPA 5D3OA 1DQEA 1HQVA 1Q80A 2WCFA 2ZRTA 3TDZA 2E30A 1QX5B 1DVIA 3CYZA 3NSLA 1IRJA 4MN0A 2ZKMX 4M2OA 3PN7C 5AEQA 5KTYA 1GQMA 4MRYA 1A03A 1A29A 4L9MA 5JOLA 2FJYA 1IH0A 1EL4A 3OX5A 2F2PA 1M63B 3S0BA 2KFGA 2WC8A 1TN4A 1SR6C 4WQ3A 3SG5A 3EK7A 2JTZA 1CFDA 3SJSA 2K2FA 1S6CA 4N5XA 1D1OA 3BYAA 1RTP1 1RK9A 3FWBA 3R72A 3EK8A 2BE6A 3B6XA 3ZWHA 2P71A 3WNXB 4PT1A 1FF1A 4GAOA 1M46A 2PRUA 3PM2A 1F55A 2O5GA 2KGRA 3B86A 3DD4A 2CTNA 5JJGA 2PYQA 1FPWA 1PVAA 1MXLC 1QTXA 2M1UA 1B9AA 2DOQA 2K60A 2A4JA 1EH2A 1QXPA 1XFVO 1QX2A 4OV2A 1F70A 4OVNF 1TNPA 3EKJA 1J1EA 4NDDA 1CLMA 2QEBA 2ZN9A 2LC5A 5I2OA 5I94A 5HL1A 2QPTA 4QJ4B 1YX8A 1K96A 2PASA 3JVTC 3KEVA 5AFPA 1GGWA 3KHEA 3NSIA 1OE9B 1XFRA 1G33A 3LL8B 3EG5B 1WY9A 1RFJA 1NCYA 1U5IA 1T14A 2KAVA 3KF9A 1S5GZ 2M3WA 1CM4A 2KGBC 1SR6B 1WRZA 2LNKA 1L2OB 3E3RA 1WRLA 1F4QA 3CR4X 3C1VA 5HYDA 1DGUA 4YGAA 2BKIB 1QLSA 2LVJA 3SG6A 3BUWB 1JSAA 3UNWA 1C3YA 3CR5X 1UHNA 1DEKA 1UHIA 3BQ3A 3IVTA 3OB1B 5ER4X 1CDPA 1KSMA 2GGMA 3CTNA 1CTRA 5D69A 1G4YR 3BUNB 3LK1A 3GK1A 3DF0A 2BKHB 1OMVA 3I5GB 1B8CA 5F6TA 2K7CA 1SY9A 1SMGA 2KI6D 1K95A 1N2DA 3SIBA 2H61A 1OZOA 3FIAA 3KPXA 4HSZA 1YVHA 2QEVA 3I5FB 2NLNA 1KQMC 2BE4A 4PHNA 2GTEA 2L5YA 5HKWA 3SS3A 3O2PA 2JC2A 5KSZA 2K7OA 3IF7A 4M2QA 4YGBB 2ISDA 3RM1A 1GM0A 1ALWA 2ZN8A 2I94A 3JVTB 3R1VA 2SASA 1DJZA 2MHHA 5AXIA 4JPZB 3SG4A 1M31A 3PM8A 4CPVA 3EVVA 2HPSA 5DKRA 1XYDA 4OCIA 4A4BA 1QV1A 3DY9A 1F4OA 1J1DA 1K8UA 4BY4A 3FWCA 1NX3A 3N7HA 5TNCA 4AOMA 2L50A 1WRKA 3NHIA 2CT9A 4I5KA 3RLZA 3D0YA 1K90D 1NX2A 2LHIA 1XK4C 4QJ3B 3CR2A 1DT7B 2ZNDA 2OTGB 4MZLA 4U8DA 2KAYA 1QVIZ 1MXEA 2LVVA 1QIVA 2WORA 4N1FA 1YR5A 1YUUA 3CLNA 3CZ2A 1OOFA 5CSFA 4FQOA 5FYXA 1WLZA 4JD9A 1QS7A 1NX0A 3GOFA 3FS7A 3EKHA 1DF0B 2KNEA 1QATA 2HQ8A 2WC6A 3S0AA 1BODA 3KO0A 2WCKA 1W7IB 4GGFA 1BG1A 1KQMB 2KBIA 4YBHB 1XFYO 5BPJA 1YURA 2WC5A 4GGNA 2F8PA 1OSAA 3BOWB 1A4PA 2LE9B 1AHRA 4FTGA 1C7WA 4INWA 3OGNA 1S36A 1XA5A 3R1OA 3FE6A 2EGDA 2L2CA 1F71A 3FE8A 1KFXL 1UUSA 1RWYA 1FI5A 4XYNA 2L51A 3OHMB 3L47A 2QEOA 1CKKA 2P70A 3BFBA 1NX1A 1ODBA 1PVBA 2JXCA 2K7BA 1YTZC 3BJHA 1KSOA 1L2OC 2COLB 2LMVA 3DVMA 5PALA 3Q8IA 3OP0A 1B1GA 1XFXO 4PE1A 5CSNA 1BR1B 1TUZA 2R2IA 2JNFA 2MAZA 2VRGA 1EJ3A 1H4BA 2JXLA 1GGZA 3D77A 1B7TZ 1IGVA 1TNQA 5KU1A 1QLKA 3VRPA 1FW4A 1H8BA 1CDLA 4JQ0D 3SS4A 3I5GC 1NIWA 1UHKA 1ALVA 1WLMA 3S0DA 2AUCA 1J7OA 2TN4A 2PVBA 4PHMA 2CBLA 2M9GA 3PJIA 3I5FC 3TUYB 3O6BA 1NSHA 4M2PA 3CWGA 4DUQA 2KSPA 3A8RA 1Y1UA 1IKUA 1A75B 5D7FA 4GPLB 4C0LA 2H8VA 2KBMA 3EVUA 1TRFA 3PFVA 2OS8B 4I5JA 2K61A 1AK8A 4PHKA 2K2AA 1QX7A 2KDHA 3I5HB 1PSBA 4N1GA 1IJ6A 3SS5A 2Y1MA 1B4CA 1MHOA 4MBEA 1ZMZA 1V1FA 1CDMA 4CFQA 2FCDA 4C0KA 4DCKA 2BCXA 2L4IA 2JU0A 1OOGA 3EK4A 3S0GA 1DMOA 1MR8A 3SG3A 2OTGC 2G9BA 2M0RA 1SSEB 4ICBA 1ZUZA 5DKNA 3NXAA 4ORBB 2NCPA 4ORAB 3A4UB 1IWQA 2I18A 3BXKA 3JTDB 4MZKA 3CS1A 3B87A 1BJFA 3CZ1A 1KK7Y 2WCLA 4NQGA 2OPOA 1NPQA 5FI6A 1TCFA 1Y6WA 2BL0C 4PE7A 2JT3A 3NHTA 2LANA 5DKQA 1Z2CB 2HF5A 2HETA 3PALA 1DELA 2JNXA 2KQYA 2WCMA 4HRHA 2ZFDA 2KOTA 3LCPC 1GJYA 4R1EA 1ORGA 4NDBA 1X02A 1XO5A 2PQLA 5B8IB 2B1UA 2BBMA 1JFJA 1JC2A 2G2BA 5HKYA 4XJKA 5K89A 3F45A 1OW4A 4PHJA 2I2RE 2M8UA 1DF0A 2O60A 4MEWA 4JWQA 1SW8A 1CFFA 1S1EA 1V1GA 1QIWA 3TDUA 1QASA 2WNDA 1KFUS 2ZRSA 1NWDA 1SL8A 3PSRA 1DTLA 4YGCB 5HLVA 4I5LB 3VB1A 2ERBA 3BUXB 1OOHA 3HX4A 3QRXA 1LS8A 5I2QA 1TTXA 2BBNA 1VRKA 2MBXA 3AKAA 1TIZA 3WXAA 2KI4B 2BCBA 2KYFA 3I5IB 4PE0A 1SYMA 1SL9A 5CSIA 1Y1XA 3DVJA 3H4SE 3B7AA 1S6IA 1TWOA 4HRGA 1DJIA 1KCYA 1EG4A 2KAXA 1WDCB 2BNXA 2BL0B 2NCOA 3VGOA 2EC6B 1XK4A 3CZ0A 4YGDB 4PALA 2K0JA 4A4CA 2KHNA 2HQWA 4UPGA 2LHLA 1AVSA 1S3PA 1XFUO 1KWOB 4ORCB 3K1EA 4P5OE 1TCOB 3RZSA 2MLFC 4ZCUA 1XFWO 1DGVA 4JKTA 3WHUB 3TUYC 4HREE 1W9ZA 4MLWA 3D73A 1AJ4A 2JULA 4OZDA 2M7LA 3CABA 1CMFA 1PSRA 1C7VA 1K94A 4GNKB 3EVRA 1YRTB 1R2UA 1PULA 2SCPA 1DC1A 2OS8C 1FBVA 1QVIY 2WCEA 1UHJA 3TZ1A 3SG7A 2NXQA 3VRRA 2LV7A 2JT8A 3I5HC 1AUIB 2LM5A 1TNXA 2V53A 1J7QA 2M1KB 4DIRA 1XFZO 5IBWA 4AQIA 1L7ZA 1JF2A 2KI6C 3NGVA 2EHBA 5FI7A 3SG2A 5I8NA 1RROA 1BMOA 4YRUA 1J55A 5AERA 1LA0A 2I7AA 1JF0A 1M39A 2JRFA 3ZNIA 2CXJA 3CZTX 1KFUL 2E6WA 5AANA 2YGUA 4GUKA 3D0YB 4CLNA 3B88A 3GK4X 4TNCA 2PALA 3AKBA 2D8NA 4I5NB 4PCWA 4QJ5B 2KFHA 3JTDC 4AQJA 2AMIA 2CNPA 1LKJA 1SCVA 5CPVA 3DYEA 1HT9A 5G08A 3HCMA 2MJWB 3NSKA 2KFFA 1RECA 1MF8B
chains in the Genus database with same CATH topology
1R6PA 2ZNEA 3O78A 1RJVA 1K9KA 1A2XA 1DJXA 1BU3A 2GGZA 2LAPA 1JWDA 4WRIA 1CFCA 4OR9B 1CFPA 2L5XB 3ICBA 2FJUB 1K93D 2WOSA 1NUBA 1BLQA 5GQQC 4ETOA 4C0JA 2P6BB 3CGAA 4YI8A 1FI6A 1UWOA 2BECA 1IQ5A 1YUTA 1DJWA 2LVIA 4YI9A 1OZSA 2M29A 2M7NA 5J3XA 4MSPA 3TS5B 1PALA 3VROA 2JTTA 3BUMB 1M45A 3DVEA 1AP4A 4NDCA 2H2KA 1PRWA 1MWNA 1B7TY 1SNLA 1ZOTB 1DJHA 3PLFB 2MLEC 1UURA 2PSRA 4P2YB 2JOJA 1OMDA 2M97A 2BCAA 2KQ6A 2LMTA 2Q91A 3O4YA 1KK7Z 2K8MB 2KI4C 3I5IC 2LUCA 1S26D 4PE4A 1IQ3A 3PN7B 3DVKA 5HKZA 3IQOA 1CLLA 1Y1AA 1UP5A 2AAOA 1LA3A 3IQQA 1SPYA 4OKHA 1J7PA 2LCPA 2JQ6A 1UHHA 3VRQA 1F54A 2CCMA 4WQ2A 1SRAA 1ZFSA 1NP8A 1WDCC 3GK2A 2EC6C 3OB2B 2Y5IA 3PATA 1SKTA 4IL1A 2L0PA 2L2EA 2LVKA 1MUXA 4E68A 1KWOC 2LLUA 2F2OA 2QACA 1SCMC 1SBJA 3TDIA 4MVFA 3OX6A 2MRDA 1OMRA 4F0ZB 1S5GY 2H61C 1NYAA 4USLA 1KQVA 1N65A 2L98A 1BR4B 2LP3A 4CFRA 1CDNA 2Y4QA 1JBAA 2NZ0A 1QJTA 3MSEB 1CMGA 3M0WA 1KK8C 4MRXA 1XVJA 1DJGA 2LP2A 2Y1NA 3BOWA 1K9PA 1KFXS 5HLOA 1K2HA 1PK0D 2JPTA 1E8AA 3LK0A 4GFTA 1IJ5A 2LMUA 2FCEA 1YUSA 1EG3A 2F33A 2FOTA 4ZCVA 3D10A 1ZACA 1U5IB 4GBAA 1G8IA 1C07A 1CB1A 2IS9A 1F8HA 1EXRA 1JFKA 2K7DA 2KYCA 3VRNA 3NSOA 1NCZA 1LINA 4Q04A 1IG5A 5I2LA 1Y0VH 4CIDA 3SIAA 2WCBA 1CLBA 1MQ1A 2F3YA 3AAJA 2LLSA 1B8RA 1J7RA 1BT6A 1BF5A 1JUOA 2F3ZA 2Q4UA 1B47A 2JWWA 2PMYA 3DF0B 4PDZA 2M49B 1TNWA 4DS7A 1CM1A 1QV0A 2JT0A 1SCMB 4D1EA 2LUXA 1SL7A 2JZIA 3AAKA 1YX7A 5ER5A 1N0YA 5CSJA 3LLEA 4DRWA 2GV5A 1YRUB 2LLTA 2MA2A 4GGFC 1B8LA 1S6JA 1K9UA 1YVLA 4YGEB 4XJKB 1KK8B 4MZJA 1DJYA 1W7JB 1OQPA 4BY5A 1SK6D 1NCXA 1LVCD 3TS5C 1LXFC 1CNPA 2RGIA 3WHTB 3BUOB 1BOCA 1AJ5A 1OOJA 2L4HA 1A75A 3K21A 1TOPA 1HQVA 1Q80A 2WCFA 2ZRTA 3TDZA 2E30A 1QX5B 1DVIA 3NSLA 1IRJA 4MN0A 2ZKMX 4M2OA 3PN7C 5AEQA 5KTYA 1GQMA 4MRYA 1A03A 1A29A 4L9MA 5JOLA 1IH0A 1EL4A 3OX5A 2F2PA 1M63B 2KFGA 2WC8A 1TN4A 1SR6C 4WQ3A 3SG5A 3EK7A 2JTZA 1CFDA 3SJSA 2K2FA 1S6CA 4N5XA 1D1OA 3BYAA 1RTP1 1RK9A 3FWBA 3EK8A 2BE6A 3ZWHA 3WNXB 1FF1A 4GAOA 1M46A 2PRUA 1F55A 2O5GA 2KGRA 3DD4A 2CTNA 5JJGA 1FPWA 1PVAA 1MXLC 1QTXA 2M1UA 1B9AA 2DOQA 2A4JA 1EH2A 1QXPA 1XFVO 1QX2A 4OV2A 1F70A 4OVNF 1TNPA 3EKJA 1J1EA 4NDDA 1CLMA 2ZN9A 2LC5A 5I2OA 2QPTA 4QJ4B 1YX8A 1K96A 2PASA 3JVTC 3KEVA 5AFPA 1GGWA 3KHEA 3NSIA 1OE9B 1G33A 3LL8B 1WY9A 1RFJA 1NCYA 1U5IA 2KAVA 3KF9A 3QRXA 1S5GZ 2M3WA 1CM4A 2KGBC 1SR6B 1WRZA 2LNKA 1L2OB 3E3RA 1WRLA 1F4QA 3CR4X 3C1VA 5HYDA 1DGUA 4YGAA 2BKIB 1QLSA 2LVJA 3SG6A 3BUWB 1JSAA 3CR5X 1UHNA 1UHIA 3BQ3A 3OB1B 5ER4X 1CDPA 1KSMA 2GGMA 3CTNA 1CTRA 5D69A 1G4YR 3BUNB 3LK1A 3GK1A 3DF0A 2BKHB 1OMVA 3I5GB 1B8CA 5F6TA 2K7CA 1SY9A 1SMGA 2KI6D 1K95A 1N2DA 3SIBA 2H61A 1OZOA 3FIAA 3KPXA 4HSZA 1YVHA 3I5FB 2NLNA 1KQMC 2BE4A 4PHNA 5HKWA 3O2PA 2JC2A 5KSZA 2K7OA 3IF7A 4M2QA 4YGBB 2ISDA 3RM1A 1ALWA 2ZN8A 2I94A 3JVTB 5AXIA 2SASA 1DJZA 2MHHA 4JPZB 3SG4A 1M31A 3PM8A 4CPVA 3EVVA 2HPSA 5DKRA 1XYDA 4OCIA 4A4BA 1QV1A 1F4OA 1J1DA 1K8UA 4BY4A 3FWCA 1NX3A 5TNCA 4AOMA 2L50A 1WRKA 2CT9A 4I5KA 3RLZA 3D0YA 1K90D 1NX2A 2LHIA 1XK4C 4QJ3B 3CR2A 1DT7B 2ZNDA 2OTGB 4MZLA 4U8DA 2KAYA 1QVIZ 1MXEA 2LVVA 1QIVA 2WORA 4N1FA 1YR5A 1YUUA 3CLNA 5CSFA 4FQOA 5FYXA 1WLZA 1QS7A 1NX0A 3GOFA 3FS7A 3EKHA 1DF0B 2KNEA 1QATA 2HQ8A 1BODA 3KO0A 1W7IB 4GGFA 1BG1A 1KQMB 2KBIA 4YBHB 1XFYO 5BPJA 1YURA 4GGNA 2F8PA 1OSAA 3BOWB 1A4PA 2LE9B 1AHRA 4FTGA 1C7WA 1S36A 1XA5A 2EGDA 1F71A 1FI5A 1KFXL 1UUSA 1RWYA 4XYNA 2L51A 3OHMB 1CKKA 1NX1A 1ODBA 1PVBA 2JXCA 2K7BA 1YTZC 1KSOA 1L2OC 2COLB 2LMVA 3DVMA 5PALA 1B1GA 3OP0A 1XFXO 4PE1A 5CSNA 1BR1B 2R2IA 2JNFA 2MAZA 2VRGA 1EJ3A 1H4BA 2JXLA 1GGZA 1B7TZ 1IGVA 1TNQA 5KU1A 1QLKA 3VRPA 1FW4A 1H8BA 1CDLA 4JQ0D 3I5GC 1NIWA 1UHKA 1ALVA 1WLMA 1J7OA 2AUCA 2TN4A 2PVBA 4PHMA 2CBLA 2M9GA 3I5FC 3TUYB 3O6BA 1NSHA 4M2PA 3CWGA 4DUQA 2KSPA 3A8RA 1Y1UA 1IKUA 1A75B 5D7FA 4GPLB 4C0LA 2KBMA 3EVUA 1TRFA 3PFVA 2OS8B 4I5JA 2K61A 1AK8A 4PHKA 2K2AA 1QX7A 2KDHA 3I5HB 1PSBA 4N1GA 1IJ6A 2Y1MA 1B4CA 1MHOA 4MBEA 1ZMZA 1V1FA 1CDMA 4CFQA 2FCDA 4C0KA 4DCKA 2BCXA 2L4IA 2JU0A 3EK4A 1DMOA 1MR8A 3SG3A 2OTGC 2G9BA 2M0RA 4ICBA 1ZUZA 5DKNA 3NXAA 4ORBB 2NCPA 4ORAB 3A4UB 1IWQA 2I18A 3BXKA 3JTDB 4MZKA 3CS1A 1BJFA 1KK7Y 4NQGA 2OPOA 1NPQA 1TCFA 1Y6WA 2BL0C 4PE7A 2JT3A 2LANA 5DKQA 2HF5A 2HETA 3PALA 2JNXA 2KQYA 4HRHA 2ZFDA 2KOTA 3LCPC 1GJYA 4R1EA 4NDBA 1X02A 1XO5A 5B8IB 2B1UA 2BBMA 1JFJA 1JC2A 2G2BA 5HKYA 4XJKA 5K89A 3F45A 4PHJA 2I2RE 2M8UA 1DF0A 2O60A 4MEWA 4JWQA 1SW8A 1S1EA 1V1GA 1QIWA 3TDUA 1QASA 2WNDA 1KFUS 2ZRSA 1NWDA 1SL8A 3PSRA 1DTLA 4YGCB 5HLVA 4I5LB 1CFFA 3BUXB 3HX4A 5I2QA 1TTXA 2BBNA 1VRKA 2MBXA 3AKAA 1TIZA 3WXAA 2KI4B 2BCBA 2KYFA 3I5IB 4PE0A 1SYMA 1SL9A 5CSIA 1Y1XA 3DVJA 3H4SE 1S6IA 4HRGA 1DJIA 1KCYA 1EG4A 2KAXA 1WDCB 2BL0B 2NCOA 3VGOA 2EC6B 1XK4A 4YGDB 4PALA 2K0JA 4A4CA 2KHNA 2HQWA 4UPGA 2LHLA 1AVSA 1S3PA 1XFUO 1KWOB 4ORCB 4P5OE 1TCOB 2MLFC 4ZCUA 1XFWO 1DGVA 3WHUB 3TUYC 4HREE 4MLWA 1AJ4A 2JULA 2M7LA 1CMFA 1PSRA 1C7VA 1K94A 4GNKB 3EVRA 1YRTB 1R2UA 1PULA 2SCPA 2OS8C 1FBVA 1QVIY 2WCEA 1UHJA 3TZ1A 3SG7A 2NXQA 3VRRA 2LV7A 2JT8A 3I5HC 1AUIB 2LM5A 1TNXA 2V53A 1J7QA 2M1KB 4DIRA 1XFZO 5IBWA 4AQIA 1L7ZA 1JF2A 2KI6C 2EHBA 3SG2A 5I8NA 1RROA 1BMOA 4YRUA 1J55A 5AERA 1LA0A 2I7AA 1JF0A 1M39A 2JRFA 3ZNIA 2CXJA 3CZTX 1KFUL 2E6WA 5AANA 4GUKA 3D0YB 4CLNA 3GK4X 4TNCA 2PALA 3AKBA 2D8NA 4I5NB 4PCWA 4QJ5B 2KFHA 3JTDC 4AQJA 2AMIA 2CNPA 1LKJA 1SCVA 5CPVA 5G08A 1HT9A 3HCMA 2MJWB 3NSKA 2KFFA 1RECA 1MF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6P A;  2ZNE A;  3O78 A;  1RJV A;  1K9K A;  1A2X A;  1DJX A;  1BU3 A;  2GGZ A;  2LAP A;  1JWD A;  4WRI A;  1CFC A;  4OR9 B;  1CFP A;  2L5X B;  3ICB A;  2FJU B;  1K93 D;  2WOS A;  1NUB A;  1BLQ A;  5GQQ C;  4ETO A;  4C0J A;  2P6B B;  3CGA A;  4YI8 A;  1FI6 A;  1UWO A;  2BEC A;  1IQ5 A;  1YUT A;  1DJW A;  2LVI A;  4YI9 A;  1OZS A;  2M29 A;  2M7N A;  5J3X A;  4MSP A;  3TS5 B;  1PAL A;  3VRO A;  2JTT A;  3BUM B;  1M45 A;  3DVE A;  1AP4 A;  4NDC A;  2H2K A;  1PRW A;  1MWN A;  1B7T Y;  1SNL A;  1ZOT B;  1DJH A;  3PLF B;  2MLE C;  1UUR A;  2PSR A;  4P2Y B;  2JOJ A;  1OMD A;  2M97 A;  2BCA A;  2KQ6 A;  2LMT A;  2Q91 A;  3O4Y A;  1KK7 Z;  2K8M B;  2KI4 C;  3I5I C;  2LUC A;  1S26 D;  4PE4 A;  1IQ3 A;  3PN7 B;  3DVK A;  5HKZ A;  3IQO A;  1CLL A;  1Y1A A;  1UP5 A;  2AAO A;  1LA3 A;  3IQQ A;  1SPY A;  4OKH A;  1J7P A;  2LCP A;  2JQ6 A;  1UHH A;  3VRQ A;  1F54 A;  2CCM A;  4WQ2 A;  1SRA A;  1ZFS A;  1NP8 A;  1WDC C;  3GK2 A;  2EC6 C;  3OB2 B;  2Y5I A;  3PAT A;  1SKT A;  4IL1 A;  2L0P A;  2L2E A;  2LVK A;  1MUX A;  4E68 A;  1KWO C;  2LLU A;  2F2O A;  2QAC A;  1SCM C;  1SBJ A;  3TDI A;  4MVF A;  3OX6 A;  2MRD A;  1OMR A;  4F0Z B;  1S5G Y;  2H61 C;  1NYA A;  4USL A;  1KQV A;  1N65 A;  2L98 A;  1BR4 B;  2LP3 A;  4CFR A;  1CDN A;  2Y4Q A;  1JBA A;  2NZ0 A;  1QJT A;  3MSE B;  1CMG A;  3M0W A;  1KK8 C;  4MRX A;  1XVJ A;  1DJG A;  2LP2 A;  2Y1N A;  3BOW A;  1K9P A;  1KFX S;  5HLO A;  1K2H A;  1PK0 D;  2JPT A;  1E8A A;  3LK0 A;  4GFT A;  1IJ5 A;  2LMU A;  2FCE A;  1YUS A;  1EG3 A;  2F33 A;  2FOT A;  4ZCV A;  3D10 A;  1ZAC A;  1U5I B;  4GBA A;  1G8I A;  1C07 A;  1CB1 A;  2IS9 A;  1F8H A;  1EXR A;  1JFK A;  2K7D A;  2KYC A;  3VRN A;  3NSO A;  1NCZ A;  1LIN A;  4Q04 A;  1IG5 A;  5I2L A;  1Y0V H;  4CID A;  3SIA A;  2WCB A;  1CLB A;  1MQ1 A;  2F3Y A;  3AAJ A;  2LLS A;  1B8R A;  1J7R A;  1BT6 A;  1BF5 A;  1JUO A;  2F3Z A;  2Q4U A;  1B47 A;  2JWW A;  2PMY A;  3DF0 B;  4PDZ A;  2M49 B;  1TNW A;  4DS7 A;  1CM1 A;  1QV0 A;  2JT0 A;  1SCM B;  4D1E A;  2LUX A;  1SL7 A;  2JZI A;  3AAK A;  1YX7 A;  5ER5 A;  1N0Y A;  5CSJ A;  3LLE A;  4DRW A;  2GV5 A;  1YRU B;  2LLT A;  2MA2 A;  4GGF C;  1B8L A;  1S6J A;  1K9U A;  1YVL A;  4YGE B;  4XJK B;  1KK8 B;  4MZJ A;  1DJY A;  1W7J B;  1OQP A;  4BY5 A;  1SK6 D;  1NCX A;  1LVC D;  3TS5 C;  1LXF C;  1CNP A;  2RGI A;  3WHT B;  3BUO B;  1BOC A;  1AJ5 A;  1OOJ A;  2L4H A;  1A75 A;  3K21 A;  1TOP A;  1HQV A;  1Q80 A;  2WCF A;  2ZRT A;  3TDZ A;  2E30 A;  1QX5 B;  1DVI A;  3NSL A;  1IRJ A;  4MN0 A;  2ZKM X;  4M2O A;  3PN7 C;  5AEQ A;  5KTY A;  1GQM A;  4MRY A;  1A03 A;  1A29 A;  4L9M A;  5JOL A;  1IH0 A;  1EL4 A;  3OX5 A;  2F2P A;  1M63 B;  2KFG A;  2WC8 A;  1TN4 A;  1SR6 C;  4WQ3 A;  3SG5 A;  3EK7 A;  2JTZ A;  1CFD A;  3SJS A;  2K2F A;  1S6C A;  4N5X A;  1D1O A;  3BYA A;  1RTP 1;  1RK9 A;  3FWB A;  3EK8 A;  2BE6 A;  3ZWH A;  3WNX B;  1FF1 A;  4GAO A;  1M46 A;  2PRU A;  1F55 A;  2O5G A;  2KGR A;  3DD4 A;  2CTN A;  5JJG A;  1FPW A;  1PVA A;  1MXL C;  1QTX A;  2M1U A;  1B9A A;  2DOQ A;  2A4J A;  1EH2 A;  1QXP A;  1XFV O;  1QX2 A;  4OV2 A;  1F70 A;  4OVN F;  1TNP A;  3EKJ A;  1J1E A;  4NDD A;  1CLM A;  2ZN9 A;  2LC5 A;  5I2O A;  2QPT A;  4QJ4 B;  1YX8 A;  1K96 A;  2PAS A;  3JVT C;  3KEV A;  5AFP A;  1GGW A;  3KHE A;  3NSI A;  1OE9 B;  1G33 A;  3LL8 B;  1WY9 A;  1RFJ A;  1NCY A;  1U5I A;  2KAV A;  3KF9 A;  3QRX A;  1S5G Z;  2M3W A;  1CM4 A;  2KGB C;  1SR6 B;  1WRZ A;  2LNK A;  1L2O B;  3E3R A;  1WRL A;  1F4Q A;  3CR4 X;  3C1V A;  5HYD A;  1DGU A;  4YGA A;  2BKI B;  1QLS A;  2LVJ A;  3SG6 A;  3BUW B;  1JSA A;  3CR5 X;  1UHN A;  1UHI A;  3BQ3 A;  3OB1 B;  5ER4 X;  1CDP A;  1KSM A;  2GGM A;  3CTN A;  1CTR A;  5D69 A;  1G4Y R;  3BUN B;  3LK1 A;  3GK1 A;  3DF0 A;  2BKH B;  1OMV A;  3I5G B;  1B8C A;  5F6T A;  2K7C A;  1SY9 A;  1SMG A;  2KI6 D;  1K95 A;  1N2D A;  3SIB A;  2H61 A;  1OZO A;  3FIA A;  3KPX A;  4HSZ A;  1YVH A;  3I5F B;  2NLN A;  1KQM C;  2BE4 A;  4PHN A;  5HKW A;  3O2P A;  2JC2 A;  5KSZ A;  2K7O A;  3IF7 A;  4M2Q A;  4YGB B;  2ISD A;  3RM1 A;  1ALW A;  2ZN8 A;  2I94 A;  3JVT B;  5AXI A;  2SAS A;  1DJZ A;  2MHH A;  4JPZ B;  3SG4 A;  1M31 A;  3PM8 A;  4CPV A;  3EVV A;  2HPS A;  5DKR A;  1XYD A;  4OCI A;  4A4B A;  1QV1 A;  1F4O A;  1J1D A;  1K8U A;  4BY4 A;  3FWC A;  1NX3 A;  5TNC A;  4AOM A;  2L50 A;  1WRK A;  2CT9 A;  4I5K A;  3RLZ A;  3D0Y A;  1K90 D;  1NX2 A;  2LHI A;  1XK4 C;  4QJ3 B;  3CR2 A;  1DT7 B;  2ZND A;  2OTG B;  4MZL A;  4U8D A;  2KAY A;  1QVI Z;  1MXE A;  2LVV A;  1QIV A;  2WOR A;  4N1F A;  1YR5 A;  1YUU A;  3CLN A;  5CSF A;  4FQO A;  5FYX A;  1WLZ A;  1QS7 A;  1NX0 A;  3GOF A;  3FS7 A;  3EKH A;  1DF0 B;  2KNE A;  1QAT A;  2HQ8 A;  1BOD A;  3KO0 A;  1W7I B;  4GGF A;  1BG1 A;  1KQM B;  2KBI A;  4YBH B;  1XFY O;  5BPJ A;  1YUR A;  4GGN A;  2F8P A;  1OSA A;  3BOW B;  1A4P A;  2LE9 B;  1AHR A;  4FTG A;  1C7W A;  1S36 A;  1XA5 A;  2EGD A;  1F71 A;  1FI5 A;  1KFX L;  1UUS A;  1RWY A;  4XYN A;  2L51 A;  3OHM B;  1CKK A;  1NX1 A;  1ODB A;  1PVB A;  2JXC A;  2K7B A;  1YTZ C;  1KSO A;  1L2O C;  2COL B;  2LMV A;  3DVM A;  5PAL A;  1B1G A;  3OP0 A;  1XFX O;  4PE1 A;  5CSN A;  1BR1 B;  2R2I A;  2JNF A;  2MAZ A;  2VRG A;  1EJ3 A;  1H4B A;  2JXL A;  1GGZ A;  1B7T Z;  1IGV A;  1TNQ A;  5KU1 A;  1QLK A;  3VRP A;  1FW4 A;  1H8B A;  1CDL A;  4JQ0 D;  3I5G C;  1NIW A;  1UHK A;  1ALV A;  1WLM A;  1J7O A;  2AUC A;  2TN4 A;  2PVB A;  4PHM A;  2CBL A;  2M9G A;  3I5F C;  3TUY B;  3O6B A;  1NSH A;  4M2P A;  3CWG A;  4DUQ A;  2KSP A;  3A8R A;  1Y1U A;  1IKU A;  1A75 B;  5D7F A;  4GPL B;  4C0L A;  2KBM A;  3EVU A;  1TRF A;  3PFV A;  2OS8 B;  4I5J A;  2K61 A;  1AK8 A;  4PHK A;  2K2A A;  1QX7 A;  2KDH A;  3I5H B;  1PSB A;  4N1G A;  1IJ6 A;  2Y1M A;  1B4C A;  1MHO A;  4MBE A;  1ZMZ A;  1V1F A;  1CDM A;  4CFQ A;  2FCD A;  4C0K A;  4DCK A;  2BCX A;  2L4I A;  2JU0 A;  3EK4 A;  1DMO A;  1MR8 A;  3SG3 A;  2OTG C;  2G9B A;  2M0R A;  4ICB A;  1ZUZ A;  5DKN A;  3NXA A;  4ORB B;  2NCP A;  4ORA B;  3A4U B;  1IWQ A;  2I18 A;  3BXK A;  3JTD B;  4MZK A;  3CS1 A;  1BJF A;  1KK7 Y;  4NQG A;  2OPO A;  1NPQ A;  1TCF A;  1Y6W A;  2BL0 C;  4PE7 A;  2JT3 A;  2LAN A;  5DKQ A;  2HF5 A;  2HET A;  3PAL A;  2JNX A;  2KQY A;  4HRH A;  2ZFD A;  2KOT A;  3LCP C;  1GJY A;  4R1E A;  4NDB A;  1X02 A;  1XO5 A;  5B8I B;  2B1U A;  2BBM A;  1JFJ A;  1JC2 A;  2G2B A;  5HKY A;  4XJK A;  5K89 A;  3F45 A;  4PHJ A;  2I2R E;  2M8U A;  1DF0 A;  2O60 A;  4MEW A;  4JWQ A;  1SW8 A;  1S1E A;  1V1G A;  1QIW A;  3TDU A;  1QAS A;  2WND A;  1KFU S;  2ZRS A;  1NWD A;  1SL8 A;  3PSR A;  1DTL A;  4YGC B;  5HLV A;  4I5L B;  1CFF A;  3BUX B;  3HX4 A;  5I2Q A;  1TTX A;  2BBN A;  1VRK A;  2MBX A;  3AKA A;  1TIZ A;  3WXA A;  2KI4 B;  2BCB A;  2KYF A;  3I5I B;  4PE0 A;  1SYM A;  1SL9 A;  5CSI A;  1Y1X A;  3DVJ A;  3H4S E;  1S6I A;  4HRG A;  1DJI A;  1KCY A;  1EG4 A;  2KAX A;  1WDC B;  2BL0 B;  2NCO A;  3VGO A;  2EC6 B;  1XK4 A;  4YGD B;  4PAL A;  2K0J A;  4A4C A;  2KHN A;  2HQW A;  4UPG A;  2LHL A;  1AVS A;  1S3P A;  1XFU O;  1KWO B;  4ORC B;  4P5O E;  1TCO B;  2MLF C;  4ZCU A;  1XFW O;  1DGV A;  3WHU B;  3TUY C;  4HRE E;  4MLW A;  1AJ4 A;  2JUL A;  2M7L A;  1CMF A;  1PSR A;  1C7V A;  1K94 A;  4GNK B;  3EVR A;  1YRT B;  1R2U A;  1PUL A;  2SCP A;  2OS8 C;  1FBV A;  1QVI Y;  2WCE A;  1UHJ A;  3TZ1 A;  3SG7 A;  2NXQ A;  3VRR A;  2LV7 A;  2JT8 A;  3I5H C;  1AUI B;  2LM5 A;  1TNX A;  2V53 A;  1J7Q A;  2M1K B;  4DIR A;  1XFZ O;  5IBW A;  4AQI A;  1L7Z A;  1JF2 A;  2KI6 C;  2EHB A;  3SG2 A;  5I8N A;  1RRO A;  1BMO A;  4YRU A;  1J55 A;  5AER A;  1LA0 A;  2I7A A;  1JF0 A;  1M39 A;  2JRF A;  3ZNI A;  2CXJ A;  3CZT X;  1KFU L;  2E6W A;  5AAN A;  4GUK A;  3D0Y B;  4CLN A;  3GK4 X;  4TNC A;  2PAL A;  3AKB A;  2D8N A;  4I5N B;  4PCW A;  4QJ5 B;  2KFH A;  3JTD C;  4AQJ A;  2AMI A;  2CNP A;  1LKJ A;  1SCV A;  5CPV A;  5G08 A;  1HT9 A;  3HCM A;  2MJW B;  3NSK A;  2KFF A;  1REC A;  1MF8 B; 
#chains in the Genus database with same CATH topology
 1R6P A;  2ZNE A;  3D78 A;  3O78 A;  1RJV A;  4IJ7 A;  2WCH A;  1K9K A;  1A2X A;  1DJX A;  1BU3 A;  2GGZ A;  2LAP A;  3BFH A;  4WRI A;  1CFC A;  4OR9 B;  4FQT A;  1CFP A;  1JWD A;  2L5X B;  3ICB A;  1P28 A;  1K93 D;  2FJU B;  2WOS A;  1NUB A;  3L4L A;  3S0E A;  1BLQ A;  5GQQ C;  4ETO A;  2KPH A;  3FE9 A;  4C0J A;  2BAP A;  2P6B B;  3CGA A;  4YI8 A;  1FI6 A;  1UWO A;  2BEC A;  1IQ5 A;  1YUT A;  1DJW A;  2LVI A;  4YI9 A;  1OZS A;  2M29 A;  2M7N A;  5J3X A;  4MSP A;  3TS5 B;  1PAL A;  3VRO A;  2JTT A;  3BUM B;  1M45 A;  3DVE A;  1AP4 A;  4NDC A;  2H2K A;  1PRW A;  1MWN A;  1B7T Y;  1SNL A;  1TUJ A;  1DJH A;  1ZOT B;  3PLF B;  2MLE C;  2WCJ A;  1UUR A;  2PSR A;  3L4A A;  4P2Y B;  2JOJ A;  1OMD A;  2M97 A;  5FI2 A;  2BCA A;  2KQ6 A;  2LMT A;  2Q91 A;  3D74 A;  3O4Y A;  1KK7 Z;  2K8M B;  2KI4 C;  3I5I C;  2LUC A;  2KLE A;  4KYN A;  1S26 D;  4PE4 A;  1IQ3 A;  3PN7 B;  2KLD A;  3DVK A;  4F7F A;  5HKZ A;  3IQO A;  1CLL A;  1Y1A A;  1UP5 A;  2AAO A;  1LA3 A;  3IQQ A;  1SPY A;  4INX A;  4OKH A;  1J7P A;  2LCP A;  2JQ6 A;  1UHH A;  3VRQ A;  1F54 A;  2CCM A;  4WQ2 A;  1SRA A;  1ZFS A;  1NP8 A;  1WDC C;  3GK2 A;  3CDN A;  2EC6 C;  3OB2 B;  2Y5I A;  3PAT A;  1SKT A;  4IL1 A;  2L0P A;  1OOI X;  2L2E A;  2LVK A;  1MUX A;  4E68 A;  1KWO C;  2LLU A;  2F2O A;  2QAC A;  5EL2 A;  1SCM C;  1SBJ A;  3TDI A;  4MVF A;  3OX6 A;  2MRD A;  1OMR A;  4F0Z B;  1QWV A;  1S5G Y;  2H61 C;  1NYA A;  4USL A;  1KQV A;  1N65 A;  2L98 A;  1BR4 B;  2LP3 A;  2QEH A;  4CFR A;  1CDN A;  2Y4Q A;  1JBA A;  2NZ0 A;  1QJT A;  3MSE B;  1CMG A;  3M0W A;  1KK8 C;  4MRX A;  1XVJ A;  1DJG A;  2LP2 A;  2Y1N A;  3BFA A;  3BOW A;  1K9P A;  1KFX S;  3OBV A;  5HLO A;  1K2H A;  1PK0 D;  2JPT A;  1E8A A;  3LK0 A;  4GFT A;  5DIC A;  1IJ5 A;  2LMU A;  2FCE A;  1YUS A;  1EG3 A;  2F33 A;  2FOT A;  3S0F A;  4ZCV A;  3D10 A;  1ZAC A;  1U5I B;  4GBA A;  1G8I A;  1C07 A;  1IIO A;  1CB1 A;  2IS9 A;  2QDI A;  1F8H A;  3D75 A;  1EXR A;  1JFK A;  2K7D A;  1C3Z A;  2KYC A;  3VRN A;  3NSO A;  2JPO A;  3QME A;  1NCZ A;  1LIN A;  4Q04 A;  1IG5 A;  5I2L A;  3V2L A;  1Y0V H;  4CID A;  3DZT A;  3SIA A;  2WCB A;  1CLB A;  3O4X A;  1MQ1 A;  2F3Y A;  3AAJ A;  2LLS A;  1B8R A;  1J7R A;  1BT6 A;  1BF5 A;  1JUO A;  2F3Z A;  2Q4U A;  1B47 A;  2JWW A;  2PMY A;  3DF0 B;  4PDZ A;  2M49 B;  1TNW A;  4DS7 A;  1CM1 A;  1QV0 A;  2JT0 A;  1SCM B;  4D1E A;  2LUX A;  3DXL A;  1SL7 A;  2JZI A;  3AAK A;  1YX7 A;  5ER5 A;  1N0Y A;  5CSJ A;  3LLE A;  4DRW A;  2GV5 A;  1YRU B;  2LLT A;  2MA2 A;  4GGF C;  1B8L A;  1S6J A;  1K9U A;  1YVL A;  4YGE B;  4XJK B;  1KK8 B;  4MZJ A;  1DJY A;  1W7J B;  3UO9 A;  1OQP A;  4BY5 A;  1SK6 D;  3R1P A;  1NCX A;  1LVC D;  3TS5 C;  1LXF C;  1CNP A;  2RGI A;  1Z4H A;  3WHT B;  3BUO B;  1BOC A;  1AJ5 A;  1OOJ A;  2L4H A;  3D76 A;  1A75 A;  3K21 A;  1TOP A;  5D3O A;  1DQE A;  1HQV A;  1Q80 A;  2WCF A;  2ZRT A;  3TDZ A;  2E30 A;  1QX5 B;  1DVI A;  3CYZ A;  3NSL A;  1IRJ A;  4MN0 A;  2ZKM X;  4M2O A;  3PN7 C;  5AEQ A;  5KTY A;  1GQM A;  4MRY A;  1A03 A;  1A29 A;  4L9M A;  5JOL A;  2FJY A;  1IH0 A;  1EL4 A;  3OX5 A;  2F2P A;  1M63 B;  3S0B A;  2KFG A;  2WC8 A;  1TN4 A;  1SR6 C;  4WQ3 A;  3SG5 A;  3EK7 A;  2JTZ A;  1CFD A;  3SJS A;  2K2F A;  1S6C A;  4N5X A;  1D1O A;  3BYA A;  1RTP 1;  1RK9 A;  3FWB A;  3R72 A;  3EK8 A;  2BE6 A;  3B6X A;  3ZWH A;  2P71 A;  3WNX B;  4PT1 A;  1FF1 A;  4GAO A;  1M46 A;  2PRU A;  3PM2 A;  1F55 A;  2O5G A;  2KGR A;  3B86 A;  3DD4 A;  2CTN A;  5JJG A;  2PYQ A;  1FPW A;  1PVA A;  1MXL C;  1QTX A;  2M1U A;  1B9A A;  2DOQ A;  2K60 A;  2A4J A;  1EH2 A;  1QXP A;  1XFV O;  1QX2 A;  4OV2 A;  1F70 A;  4OVN F;  1TNP A;  3EKJ A;  1J1E A;  4NDD A;  1CLM A;  2QEB A;  2ZN9 A;  2LC5 A;  5I2O A;  5I94 A;  5HL1 A;  2QPT A;  4QJ4 B;  1YX8 A;  1K96 A;  2PAS A;  3JVT C;  3KEV A;  5AFP A;  1GGW A;  3KHE A;  3NSI A;  1OE9 B;  1XFR A;  1G33 A;  3LL8 B;  3EG5 B;  1WY9 A;  1RFJ A;  1NCY A;  1U5I A;  1T14 A;  2KAV A;  3KF9 A;  1S5G Z;  2M3W A;  1CM4 A;  2KGB C;  1SR6 B;  1WRZ A;  2LNK A;  1L2O B;  3E3R A;  1WRL A;  1F4Q A;  3CR4 X;  3C1V A;  5HYD A;  1DGU A;  4YGA A;  2BKI B;  1QLS A;  2LVJ A;  3SG6 A;  3BUW B;  1JSA A;  3UNW A;  1C3Y A;  3CR5 X;  1UHN A;  1DEK A;  1UHI A;  3BQ3 A;  3IVT A;  3OB1 B;  5ER4 X;  1CDP A;  1KSM A;  2GGM A;  3CTN A;  1CTR A;  5D69 A;  1G4Y R;  3BUN B;  3LK1 A;  3GK1 A;  3DF0 A;  2BKH B;  1OMV A;  3I5G B;  1B8C A;  5F6T A;  2K7C A;  1SY9 A;  1SMG A;  2KI6 D;  1K95 A;  1N2D A;  3SIB A;  2H61 A;  1OZO A;  3FIA A;  3KPX A;  4HSZ A;  1YVH A;  2QEV A;  3I5F B;  2NLN A;  1KQM C;  2BE4 A;  4PHN A;  2GTE A;  2L5Y A;  5HKW A;  3SS3 A;  3O2P A;  2JC2 A;  5KSZ A;  2K7O A;  3IF7 A;  4M2Q A;  4YGB B;  2ISD A;  3RM1 A;  1GM0 A;  1ALW A;  2ZN8 A;  2I94 A;  3JVT B;  3R1V A;  2SAS A;  1DJZ A;  2MHH A;  5AXI A;  4JPZ B;  3SG4 A;  1M31 A;  3PM8 A;  4CPV A;  3EVV A;  2HPS A;  5DKR A;  1XYD A;  4OCI A;  4A4B A;  1QV1 A;  3DY9 A;  1F4O A;  1J1D A;  1K8U A;  4BY4 A;  3FWC A;  1NX3 A;  3N7H A;  5TNC A;  4AOM A;  2L50 A;  1WRK A;  3NHI A;  2CT9 A;  4I5K A;  3RLZ A;  3D0Y A;  1K90 D;  1NX2 A;  2LHI A;  1XK4 C;  4QJ3 B;  3CR2 A;  1DT7 B;  2ZND A;  2OTG B;  4MZL A;  4U8D A;  2KAY A;  1QVI Z;  1MXE A;  2LVV A;  1QIV A;  2WOR A;  4N1F A;  1YR5 A;  1YUU A;  3CLN A;  3CZ2 A;  1OOF A;  5CSF A;  4FQO A;  5FYX A;  1WLZ A;  4JD9 A;  1QS7 A;  1NX0 A;  3GOF A;  3FS7 A;  3EKH A;  1DF0 B;  2KNE A;  1QAT A;  2HQ8 A;  2WC6 A;  3S0A A;  1BOD A;  3KO0 A;  2WCK A;  1W7I B;  4GGF A;  1BG1 A;  1KQM B;  2KBI A;  4YBH B;  1XFY O;  5BPJ A;  1YUR A;  2WC5 A;  4GGN A;  2F8P A;  1OSA A;  3BOW B;  1A4P A;  2LE9 B;  1AHR A;  4FTG A;  1C7W A;  4INW A;  3OGN A;  1S36 A;  1XA5 A;  3R1O A;  3FE6 A;  2EGD A;  2L2C A;  1F71 A;  3FE8 A;  1KFX L;  1UUS A;  1RWY A;  1FI5 A;  4XYN A;  2L51 A;  3OHM B;  3L47 A;  2QEO A;  1CKK A;  2P70 A;  3BFB A;  1NX1 A;  1ODB A;  1PVB A;  2JXC A;  2K7B A;  1YTZ C;  3BJH A;  1KSO A;  1L2O C;  2COL B;  2LMV A;  3DVM A;  5PAL A;  3Q8I A;  3OP0 A;  1B1G A;  1XFX O;  4PE1 A;  5CSN A;  1BR1 B;  1TUZ A;  2R2I A;  2JNF A;  2MAZ A;  2VRG A;  1EJ3 A;  1H4B A;  2JXL A;  1GGZ A;  3D77 A;  1B7T Z;  1IGV A;  1TNQ A;  5KU1 A;  1QLK A;  3VRP A;  1FW4 A;  1H8B A;  1CDL A;  4JQ0 D;  3SS4 A;  3I5G C;  1NIW A;  1UHK A;  1ALV A;  1WLM A;  3S0D A;  2AUC A;  1J7O A;  2TN4 A;  2PVB A;  4PHM A;  2CBL A;  2M9G A;  3PJI A;  3I5F C;  3TUY B;  3O6B A;  1NSH A;  4M2P A;  3CWG A;  4DUQ A;  2KSP A;  3A8R A;  1Y1U A;  1IKU A;  1A75 B;  5D7F A;  4GPL B;  4C0L A;  2H8V A;  2KBM A;  3EVU A;  1TRF A;  3PFV A;  2OS8 B;  4I5J A;  2K61 A;  1AK8 A;  4PHK A;  2K2A A;  1QX7 A;  2KDH A;  3I5H B;  1PSB A;  4N1G A;  1IJ6 A;  3SS5 A;  2Y1M A;  1B4C A;  1MHO A;  4MBE A;  1ZMZ A;  1V1F A;  1CDM A;  4CFQ A;  2FCD A;  4C0K A;  4DCK A;  2BCX A;  2L4I A;  2JU0 A;  1OOG A;  3EK4 A;  3S0G A;  1DMO A;  1MR8 A;  3SG3 A;  2OTG C;  2G9B A;  2M0R A;  1SSE B;  4ICB A;  1ZUZ A;  5DKN A;  3NXA A;  4ORB B;  2NCP A;  4ORA B;  3A4U B;  1IWQ A;  2I18 A;  3BXK A;  3JTD B;  4MZK A;  3CS1 A;  3B87 A;  1BJF A;  3CZ1 A;  1KK7 Y;  2WCL A;  4NQG A;  2OPO A;  1NPQ A;  5FI6 A;  1TCF A;  1Y6W A;  2BL0 C;  4PE7 A;  2JT3 A;  3NHT A;  2LAN A;  5DKQ A;  1Z2C B;  2HF5 A;  2HET A;  3PAL A;  1DEL A;  2JNX A;  2KQY A;  2WCM A;  4HRH A;  2ZFD A;  2KOT A;  3LCP C;  1GJY A;  4R1E A;  1ORG A;  4NDB A;  1X02 A;  1XO5 A;  2PQL A;  5B8I B;  2B1U A;  2BBM A;  1JFJ A;  1JC2 A;  2G2B A;  5HKY A;  4XJK A;  5K89 A;  3F45 A;  1OW4 A;  4PHJ A;  2I2R E;  2M8U A;  1DF0 A;  2O60 A;  4MEW A;  4JWQ A;  1SW8 A;  1CFF A;  1S1E A;  1V1G A;  1QIW A;  3TDU A;  1QAS A;  2WND A;  1KFU S;  2ZRS A;  1NWD A;  1SL8 A;  3PSR A;  1DTL A;  4YGC B;  5HLV A;  4I5L B;  3VB1 A;  2ERB A;  3BUX B;  1OOH A;  3HX4 A;  3QRX A;  1LS8 A;  5I2Q A;  1TTX A;  2BBN A;  1VRK A;  2MBX A;  3AKA A;  1TIZ A;  3WXA A;  2KI4 B;  2BCB A;  2KYF A;  3I5I B;  4PE0 A;  1SYM A;  1SL9 A;  5CSI A;  1Y1X A;  3DVJ A;  3H4S E;  3B7A A;  1S6I A;  1TWO A;  4HRG A;  1DJI A;  1KCY A;  1EG4 A;  2KAX A;  1WDC B;  2BNX A;  2BL0 B;  2NCO A;  3VGO A;  2EC6 B;  1XK4 A;  3CZ0 A;  4YGD B;  4PAL A;  2K0J A;  4A4C A;  2KHN A;  2HQW A;  4UPG A;  2LHL A;  1AVS A;  1S3P A;  1XFU O;  1KWO B;  4ORC B;  3K1E A;  4P5O E;  1TCO B;  3RZS A;  2MLF C;  4ZCU A;  1XFW O;  1DGV A;  4JKT A;  3WHU B;  3TUY C;  4HRE E;  1W9Z A;  4MLW A;  3D73 A;  1AJ4 A;  2JUL A;  4OZD A;  2M7L A;  3CAB A;  1CMF A;  1PSR A;  1C7V A;  1K94 A;  4GNK B;  3EVR A;  1YRT B;  1R2U A;  1PUL A;  2SCP A;  1DC1 A;  2OS8 C;  1FBV A;  1QVI Y;  2WCE A;  1UHJ A;  3TZ1 A;  3SG7 A;  2NXQ A;  3VRR A;  2LV7 A;  2JT8 A;  3I5H C;  1AUI B;  2LM5 A;  1TNX A;  2V53 A;  1J7Q A;  2M1K B;  4DIR A;  1XFZ O;  5IBW A;  4AQI A;  1L7Z A;  1JF2 A;  2KI6 C;  3NGV A;  2EHB A;  5FI7 A;  3SG2 A;  5I8N A;  1RRO A;  1BMO A;  4YRU A;  1J55 A;  5AER A;  1LA0 A;  2I7A A;  1JF0 A;  1M39 A;  2JRF A;  3ZNI A;  2CXJ A;  3CZT X;  1KFU L;  2E6W A;  5AAN A;  2YGU A;  4GUK A;  3D0Y B;  4CLN A;  3B88 A;  3GK4 X;  4TNC A;  2PAL A;  3AKB A;  2D8N A;  4I5N B;  4PCW A;  4QJ5 B;  2KFH A;  3JTD C;  4AQJ A;  2AMI A;  2CNP A;  1LKJ A;  1SCV A;  5CPV A;  3DYE A;  1HT9 A;  5G08 A;  3HCM A;  2MJW B;  3NSK A;  2KFF A;  1REC A;  1MF8 B; 
#chains in the Genus database with same CATH homology
 1R6P A;  2ZNE A;  3O78 A;  1RJV A;  1K9K A;  1A2X A;  1DJX A;  1BU3 A;  2GGZ A;  2LAP A;  1JWD A;  4WRI A;  1CFC A;  4OR9 B;  1CFP A;  2L5X B;  3ICB A;  2FJU B;  1K93 D;  2WOS A;  1NUB A;  1BLQ A;  5GQQ C;  4ETO A;  4C0J A;  2P6B B;  3CGA A;  4YI8 A;  1FI6 A;  1UWO A;  2BEC A;  1IQ5 A;  1YUT A;  1DJW A;  2LVI A;  4YI9 A;  1OZS A;  2M29 A;  2M7N A;  5J3X A;  4MSP A;  3TS5 B;  1PAL A;  3VRO A;  2JTT A;  3BUM B;  1M45 A;  3DVE A;  1AP4 A;  4NDC A;  2H2K A;  1PRW A;  1MWN A;  1B7T Y;  1SNL A;  1ZOT B;  1DJH A;  3PLF B;  2MLE C;  1UUR A;  2PSR A;  4P2Y B;  2JOJ A;  1OMD A;  2M97 A;  2BCA A;  2KQ6 A;  2LMT A;  2Q91 A;  3O4Y A;  1KK7 Z;  2K8M B;  2KI4 C;  3I5I C;  2LUC A;  1S26 D;  4PE4 A;  1IQ3 A;  3PN7 B;  3DVK A;  5HKZ A;  3IQO A;  1CLL A;  1Y1A A;  1UP5 A;  2AAO A;  1LA3 A;  3IQQ A;  1SPY A;  4OKH A;  1J7P A;  2LCP A;  2JQ6 A;  1UHH A;  3VRQ A;  1F54 A;  2CCM A;  4WQ2 A;  1SRA A;  1ZFS A;  1NP8 A;  1WDC C;  3GK2 A;  2EC6 C;  3OB2 B;  2Y5I A;  3PAT A;  1SKT A;  4IL1 A;  2L0P A;  2L2E A;  2LVK A;  1MUX A;  4E68 A;  1KWO C;  2LLU A;  2F2O A;  2QAC A;  1SCM C;  1SBJ A;  3TDI A;  4MVF A;  3OX6 A;  2MRD A;  1OMR A;  4F0Z B;  1S5G Y;  2H61 C;  1NYA A;  4USL A;  1KQV A;  1N65 A;  2L98 A;  1BR4 B;  2LP3 A;  4CFR A;  1CDN A;  2Y4Q A;  1JBA A;  2NZ0 A;  1QJT A;  3MSE B;  1CMG A;  3M0W A;  1KK8 C;  4MRX A;  1XVJ A;  1DJG A;  2LP2 A;  2Y1N A;  3BOW A;  1K9P A;  1KFX S;  5HLO A;  1K2H A;  1PK0 D;  2JPT A;  1E8A A;  3LK0 A;  4GFT A;  1IJ5 A;  2LMU A;  2FCE A;  1YUS A;  1EG3 A;  2F33 A;  2FOT A;  4ZCV A;  3D10 A;  1ZAC A;  1U5I B;  4GBA A;  1G8I A;  1C07 A;  1CB1 A;  2IS9 A;  1F8H A;  1EXR A;  1JFK A;  2K7D A;  2KYC A;  3VRN A;  3NSO A;  1NCZ A;  1LIN A;  4Q04 A;  1IG5 A;  5I2L A;  1Y0V H;  4CID A;  3SIA A;  2WCB A;  1CLB A;  1MQ1 A;  2F3Y A;  3AAJ A;  2LLS A;  1B8R A;  1J7R A;  1BT6 A;  1BF5 A;  1JUO A;  2F3Z A;  2Q4U A;  1B47 A;  2JWW A;  2PMY A;  3DF0 B;  4PDZ A;  2M49 B;  1TNW A;  4DS7 A;  1CM1 A;  1QV0 A;  2JT0 A;  1SCM B;  4D1E A;  2LUX A;  1SL7 A;  2JZI A;  3AAK A;  1YX7 A;  5ER5 A;  1N0Y A;  5CSJ A;  3LLE A;  4DRW A;  2GV5 A;  1YRU B;  2LLT A;  2MA2 A;  4GGF C;  1B8L A;  1S6J A;  1K9U A;  1YVL A;  4YGE B;  4XJK B;  1KK8 B;  4MZJ A;  1DJY A;  1W7J B;  1OQP A;  4BY5 A;  1SK6 D;  1NCX A;  1LVC D;  3TS5 C;  1LXF C;  1CNP A;  2RGI A;  3WHT B;  3BUO B;  1BOC A;  1AJ5 A;  1OOJ A;  2L4H A;  1A75 A;  3K21 A;  1TOP A;  1HQV A;  1Q80 A;  2WCF A;  2ZRT A;  3TDZ A;  2E30 A;  1QX5 B;  1DVI A;  3NSL A;  1IRJ A;  4MN0 A;  2ZKM X;  4M2O A;  3PN7 C;  5AEQ A;  5KTY A;  1GQM A;  4MRY A;  1A03 A;  1A29 A;  4L9M A;  5JOL A;  1IH0 A;  1EL4 A;  3OX5 A;  2F2P A;  1M63 B;  2KFG A;  2WC8 A;  1TN4 A;  1SR6 C;  4WQ3 A;  3SG5 A;  3EK7 A;  2JTZ A;  1CFD A;  3SJS A;  2K2F A;  1S6C A;  4N5X A;  1D1O A;  3BYA A;  1RTP 1;  1RK9 A;  3FWB A;  3EK8 A;  2BE6 A;  3ZWH A;  3WNX B;  1FF1 A;  4GAO A;  1M46 A;  2PRU A;  1F55 A;  2O5G A;  2KGR A;  3DD4 A;  2CTN A;  5JJG A;  1FPW A;  1PVA A;  1MXL C;  1QTX A;  2M1U A;  1B9A A;  2DOQ A;  2A4J A;  1EH2 A;  1QXP A;  1XFV O;  1QX2 A;  4OV2 A;  1F70 A;  4OVN F;  1TNP A;  3EKJ A;  1J1E A;  4NDD A;  1CLM A;  2ZN9 A;  2LC5 A;  5I2O A;  2QPT A;  4QJ4 B;  1YX8 A;  1K96 A;  2PAS A;  3JVT C;  3KEV A;  5AFP A;  1GGW A;  3KHE A;  3NSI A;  1OE9 B;  1G33 A;  3LL8 B;  1WY9 A;  1RFJ A;  1NCY A;  1U5I A;  2KAV A;  3KF9 A;  3QRX A;  1S5G Z;  2M3W A;  1CM4 A;  2KGB C;  1SR6 B;  1WRZ A;  2LNK A;  1L2O B;  3E3R A;  1WRL A;  1F4Q A;  3CR4 X;  3C1V A;  5HYD A;  1DGU A;  4YGA A;  2BKI B;  1QLS A;  2LVJ A;  3SG6 A;  3BUW B;  1JSA A;  3CR5 X;  1UHN A;  1UHI A;  3BQ3 A;  3OB1 B;  5ER4 X;  1CDP A;  1KSM A;  2GGM A;  3CTN A;  1CTR A;  5D69 A;  1G4Y R;  3BUN B;  3LK1 A;  3GK1 A;  3DF0 A;  2BKH B;  1OMV A;  3I5G B;  1B8C A;  5F6T A;  2K7C A;  1SY9 A;  1SMG A;  2KI6 D;  1K95 A;  1N2D A;  3SIB A;  2H61 A;  1OZO A;  3FIA A;  3KPX A;  4HSZ A;  1YVH A;  3I5F B;  2NLN A;  1KQM C;  2BE4 A;  4PHN A;  5HKW A;  3O2P A;  2JC2 A;  5KSZ A;  2K7O A;  3IF7 A;  4M2Q A;  4YGB B;  2ISD A;  3RM1 A;  1ALW A;  2ZN8 A;  2I94 A;  3JVT B;  5AXI A;  2SAS A;  1DJZ A;  2MHH A;  4JPZ B;  3SG4 A;  1M31 A;  3PM8 A;  4CPV A;  3EVV A;  2HPS A;  5DKR A;  1XYD A;  4OCI A;  4A4B A;  1QV1 A;  1F4O A;  1J1D A;  1K8U A;  4BY4 A;  3FWC A;  1NX3 A;  5TNC A;  4AOM A;  2L50 A;  1WRK A;  2CT9 A;  4I5K A;  3RLZ A;  3D0Y A;  1K90 D;  1NX2 A;  2LHI A;  1XK4 C;  4QJ3 B;  3CR2 A;  1DT7 B;  2ZND A;  2OTG B;  4MZL A;  4U8D A;  2KAY A;  1QVI Z;  1MXE A;  2LVV A;  1QIV A;  2WOR A;  4N1F A;  1YR5 A;  1YUU A;  3CLN A;  5CSF A;  4FQO A;  5FYX A;  1WLZ A;  1QS7 A;  1NX0 A;  3GOF A;  3FS7 A;  3EKH A;  1DF0 B;  2KNE A;  1QAT A;  2HQ8 A;  1BOD A;  3KO0 A;  1W7I B;  4GGF A;  1BG1 A;  1KQM B;  2KBI A;  4YBH B;  1XFY O;  5BPJ A;  1YUR A;  4GGN A;  2F8P A;  1OSA A;  3BOW B;  1A4P A;  2LE9 B;  1AHR A;  4FTG A;  1C7W A;  1S36 A;  1XA5 A;  2EGD A;  1F71 A;  1FI5 A;  1KFX L;  1UUS A;  1RWY A;  4XYN A;  2L51 A;  3OHM B;  1CKK A;  1NX1 A;  1ODB A;  1PVB A;  2JXC A;  2K7B A;  1YTZ C;  1KSO A;  1L2O C;  2COL B;  2LMV A;  3DVM A;  5PAL A;  1B1G A;  3OP0 A;  1XFX O;  4PE1 A;  5CSN A;  1BR1 B;  2R2I A;  2JNF A;  2MAZ A;  2VRG A;  1EJ3 A;  1H4B A;  2JXL A;  1GGZ A;  1B7T Z;  1IGV A;  1TNQ A;  5KU1 A;  1QLK A;  3VRP A;  1FW4 A;  1H8B A;  1CDL A;  4JQ0 D;  3I5G C;  1NIW A;  1UHK A;  1ALV A;  1WLM A;  1J7O A;  2AUC A;  2TN4 A;  2PVB A;  4PHM A;  2CBL A;  2M9G A;  3I5F C;  3TUY B;  3O6B A;  1NSH A;  4M2P A;  3CWG A;  4DUQ A;  2KSP A;  3A8R A;  1Y1U A;  1IKU A;  1A75 B;  5D7F A;  4GPL B;  4C0L A;  2KBM A;  3EVU A;  1TRF A;  3PFV A;  2OS8 B;  4I5J A;  2K61 A;  1AK8 A;  4PHK A;  2K2A A;  1QX7 A;  2KDH A;  3I5H B;  1PSB A;  4N1G A;  1IJ6 A;  2Y1M A;  1B4C A;  1MHO A;  4MBE A;  1ZMZ A;  1V1F A;  1CDM A;  4CFQ A;  2FCD A;  4C0K A;  4DCK A;  2BCX A;  2L4I A;  2JU0 A;  3EK4 A;  1DMO A;  1MR8 A;  3SG3 A;  2OTG C;  2G9B A;  2M0R A;  4ICB A;  1ZUZ A;  5DKN A;  3NXA A;  4ORB B;  2NCP A;  4ORA B;  3A4U B;  1IWQ A;  2I18 A;  3BXK A;  3JTD B;  4MZK A;  3CS1 A;  1BJF A;  1KK7 Y;  4NQG A;  2OPO A;  1NPQ A;  1TCF A;  1Y6W A;  2BL0 C;  4PE7 A;  2JT3 A;  2LAN A;  5DKQ A;  2HF5 A;  2HET A;  3PAL A;  2JNX A;  2KQY A;  4HRH A;  2ZFD A;  2KOT A;  3LCP C;  1GJY A;  4R1E A;  4NDB A;  1X02 A;  1XO5 A;  5B8I B;  2B1U A;  2BBM A;  1JFJ A;  1JC2 A;  2G2B A;  5HKY A;  4XJK A;  5K89 A;  3F45 A;  4PHJ A;  2I2R E;  2M8U A;  1DF0 A;  2O60 A;  4MEW A;  4JWQ A;  1SW8 A;  1S1E A;  1V1G A;  1QIW A;  3TDU A;  1QAS A;  2WND A;  1KFU S;  2ZRS A;  1NWD A;  1SL8 A;  3PSR A;  1DTL A;  4YGC B;  5HLV A;  4I5L B;  1CFF A;  3BUX B;  3HX4 A;  5I2Q A;  1TTX A;  2BBN A;  1VRK A;  2MBX A;  3AKA A;  1TIZ A;  3WXA A;  2KI4 B;  2BCB A;  2KYF A;  3I5I B;  4PE0 A;  1SYM A;  1SL9 A;  5CSI A;  1Y1X A;  3DVJ A;  3H4S E;  1S6I A;  4HRG A;  1DJI A;  1KCY A;  1EG4 A;  2KAX A;  1WDC B;  2BL0 B;  2NCO A;  3VGO A;  2EC6 B;  1XK4 A;  4YGD B;  4PAL A;  2K0J A;  4A4C A;  2KHN A;  2HQW A;  4UPG A;  2LHL A;  1AVS A;  1S3P A;  1XFU O;  1KWO B;  4ORC B;  4P5O E;  1TCO B;  2MLF C;  4ZCU A;  1XFW O;  1DGV A;  3WHU B;  3TUY C;  4HRE E;  4MLW A;  1AJ4 A;  2JUL A;  2M7L A;  1CMF A;  1PSR A;  1C7V A;  1K94 A;  4GNK B;  3EVR A;  1YRT B;  1R2U A;  1PUL A;  2SCP A;  2OS8 C;  1FBV A;  1QVI Y;  2WCE A;  1UHJ A;  3TZ1 A;  3SG7 A;  2NXQ A;  3VRR A;  2LV7 A;  2JT8 A;  3I5H C;  1AUI B;  2LM5 A;  1TNX A;  2V53 A;  1J7Q A;  2M1K B;  4DIR A;  1XFZ O;  5IBW A;  4AQI A;  1L7Z A;  1JF2 A;  2KI6 C;  2EHB A;  3SG2 A;  5I8N A;  1RRO A;  1BMO A;  4YRU A;  1J55 A;  5AER A;  1LA0 A;  2I7A A;  1JF0 A;  1M39 A;  2JRF A;  3ZNI A;  2CXJ A;  3CZT X;  1KFU L;  2E6W A;  5AAN A;  4GUK A;  3D0Y B;  4CLN A;  3GK4 X;  4TNC A;  2PAL A;  3AKB A;  2D8N A;  4I5N B;  4PCW A;  4QJ5 B;  2KFH A;  3JTD C;  4AQJ A;  2AMI A;  2CNP A;  1LKJ A;  1SCV A;  5CPV A;  5G08 A;  1HT9 A;  3HCM A;  2MJW B;  3NSK A;  2KFF A;  1REC A;  1MF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...