1JFJA

Nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Metal binding protein
molecule keywords CALCIUM-BINDING PROTEIN
total genus 37
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA02
1Y1XA 3OP0A 3I5HC 1IRJA 1JF2A 2LLSA 1F8HA 4JPZB 2O5GA 3VROA 3CWGA 3TUYC 5AFPA 1YX8A 1XA5A 4CPVA 1B7TZ 1U5IB 4ETOA 1CM1A 2LAPA 3D0YA 4YGEB 4YGBB 4ZCUA 1QVIY 1W7JB 1A29A 2M7LA 1YR5A 2JTTA 2LVIA 3VGOA 2JT3A 1MUXA 2CT9A 1DVIA 2HQ8A 1G4YR 3FIAA 1UHNA 4DCKA 2ZRTA 3OHMB 1J55A 3JTDC 3BUOB 2E6WA 2M1UA 4YRUA 2LMUA 2ZN8A 1QTXA 3SIAA 1RFJA 5AANA 3ZWHA 3WHUB 1A75A 1TNWA 3C1VA 1PVAA 5HKYA 1QIVA 3BUMB 3KO0A 1CMGA 1UHKA 1QASA 3PATA 1F4QA 4C0KA 1TNPA 3LL8B 1HQVA 1Y6WA 1CLBA 2BBNA 1GQMA 1JFKA 2HQWA 2F33A 1NWDA 1KFXL 2CXJA 3RLZA 1KSMA 2OPOA 1B8CA 1FI6A 2LE9B 1Y0VH 2WCEA 2JT8A 1PVBA 2KI4B 3TDUA 1F71A 1WDCC 3KEVA 4C0LA 4CFQA 2JXCA 1HT9A 1UURA 2BE6A 1XFVO 2LNKA 3PFVA 2FCEA 4GFTA 1KQMC 1KQVA 1RTP1 2H61A 4A4CA 1WDCB 2BCAA 4OVNF 3BQ3A 4GUKA 2GV5A 2NLNA 1K90D 3TS5B 1QV1A 3IF7A 1R2UA 3EKJA 4PE0A 1SPYA 2ISDA 2AAOA 4DS7A 2L51A 1L7ZA 3AKBA 3D10A 1SL7A 1OSAA 1TRFA 1AUIB 2K2FA 1SYMA 1SW8A 2WORA 1KSOA 2LHIA 1NIWA 2MBXA 2K0JA 5I8NA 2ZN9A 1X02A 1A2XA 4ORBB 1LXFC 2G2BA 2M8UA 4GGNA 1YUTA 4M2PA 4P5OE 1EJ3A 1JWDA 1CLMA 2PVBA 5HKZA 1NX0A 3VRPA 2I18A 1YRTB 2OTGB 2BL0C 2LLUA 2ZNEA 4DUQA 1LVCD 1FPWA 4R1EA 1WRLA 1AVSA 2KDHA 2BL0B 2JULA 4PHMA 3AAJA 2HPSA 3GK2A 1K9PA 4MSPA 1XFWO 2Q91A 4BY4A 4HSZA 1RWYA 5I2LA 1QJTA 1ALVA 1PULA 3EKHA 1CB1A 2JNFA 2LC5A 2KI6C 1NP8A 4JQ0D 1OMRA 1OZSA 3CLNA 4ZCVA 1GGWA 5F6TA 4HRGA 1EG4A 1IJ5A 1KFXS 4N1GA 3WXAA 3F45A 5HLVA 2P6BB 5I2QA 2L4IA 3LK1A 3NSOA 4MN0A 2OS8C 1ZUZA 1CLLA 4WQ2A 1RECA 2KI4C 4DIRA 1A4PA 1ODBA 1BMOA 2KGBC 2JU0A 3BYAA 1DGVA 1FW4A 1SY9A 1S5GZ 1S1EA 4MBEA 1GJYA 3VRNA 1R6PA 2MAZA 2H2KA 1M46A 1QS7A 1V1FA 1RJVA 1DJWA 1YVHA 1LINA 1SCVA 1IQ5A 4JWQA 3BUWB 1CTRA 3KF9A 2M97A 1TIZA 1CFPA 1J7RA 3AAKA 4P2YB 4HREE 1H4BA 1XYDA 2KYCA 1JF0A 1YVLA 5ER4X 4MVFA 1SCMC 5KTYA 1BLQA 1OOJA 2SASA 1SK6D 1KQMB 2MJWB 2PRUA 4GBAA 3DF0A 5AEQA 1SL8A 1YTZC 4XYNA 3LLEA 2F3YA 2JC2A 4OKHA 1NPQA 3O6BA 1L2OB 3PALA 1A75B 3SIBA 3VRRA 3PSRA 2JNXA 2LVVA 1QXPA 2FOTA 2BCXA 4QJ4B 1QV0A 2I7AA 3NSIA 1L2OC 1QX2A 1SNLA 1QATA 1NCZA 1YUUA 2G9BA 4OCIA 2QPTA 3ZNIA 1QLSA 2KOTA 1ALWA 2M29A 5DKNA 3EK7A 1BR4B 1FBVA 4I5LB 1MHOA 1B8LA 2KFFA 4GGFA 4CFRA 1KK7Z 1NSHA 4YI8A 1DF0B 1V1GA 1CFCA 4M2QA 2JXLA 1DT7B 2JTZA 3PLFB 1XK4A 2WC8A 1QX7A 4MZLA 1GGZA 4PE4A 2K7OA 1JFJA 3DVEA 2K7BA 4C0JA 4GPLB 2L50A 1KFUL 4FTGA 3SG6A 2QACA 2WNDA 2M1KB 1C07A 2KI6D 3EVVA 3NSKA 4FQOA 1XFZO 2KGRA 1NX1A 2M9GA 1BODA 2MLEC 1SKTA 3HX4A 3PN7C 2JPTA 1BR1B 1Q80A 4YBHB 4L9MA 1PRWA 1AJ5A 2BBMA 2LVJA 4PHNA 2WCFA 3HCMA 3PN7B 2LMVA 1M31A 1WY9A 1F55A 5AERA 2BKIB 3RM1A 3SJSA 1QIWA 4WQ3A 1MWNA 1AHRA 1Y1UA 2WOSA 2MLFC 2F3ZA 2EC6B 5JJGA 1K94A 4N1FA 2K7CA 2L98A 1SL9A 2JT0A 3VRQA 3KHEA 3I5HB 2OTGC 5ER5A 1YURA 1WLZA 2F2PA 3DVJA 1OE9B 1TCFA 1BT6A 3I5FB 1OMDA 1SRAA 3CR4X 2HETA 2BECA 4E68A 2K8MB 5CSNA 4I5JA 3NSLA 1CMFA 3BUXB 1DGUA 2JOJA 1C7WA 4MRYA 2KFGA 3I5FC 2MA2A 1EL4A 1M45A 1SR6B 4OR9B 4GNKB 4PCWA 3SG4A 1XFYO 1DF0A 2BKHB 2VRGA 4NDBA 2KSPA 3OX5A 2KAVA 3MSEB 1IWQA 2A4JA 3KPXA 4CIDA 3JTDB 2F8PA 3DVKA 1DJIA 1CNPA 1NX2A 1K9UA 5D69A 2RGIA 2IS9A 1ZMZA 2KHNA 5PALA 3O4YA 4GGFC 2LLTA 4Q04A 4TNCA 4MZJA 5J3XA 2KFHA 4PDZA 1CFFA 1XO5A 1FI5A 5HYDA 1OQPA 3A8RA 1CM4A 1B1GA 3ICBA 2MHHA 1G8IA 2EHBA 1UHIA 1ZFSA 3BOWA 3M0WA 1PK0D 1MQ1A 1XFXO 1F4OA 1N65A 1LA3A 1RK9A 3BOWB 1KFUS 4MZKA 3LK0A 1K9KA 4MEWA 2LP3A 3TDIA 3WNXB 1CKKA 4N5XA 1SMGA 1IGVA 1MR8A 1NUBA 1TCOB 2AMIA 4PE1A 2NXQA 3EVUA 1QLKA 1XVJA 2L0PA 3DD4A 2KQYA 2Y1MA 2TN4A 2LCPA 4DRWA 4XJKB 1ZOTB 1E8AA 2HF5A 1LKJA 2L5XB 1WLMA 3OX6A 1H8BA 4QJ5B 1J7QA 2PASA 2COLB 3TDZA 1YUSA 5B8IB 1BU3A 2LUXA 3CGAA 2DOQA 1UHJA 1SR6C 4ORCB 4PHJA 5G08A 2Y1NA 4YGDB 5K89A 3A4UB 4NDCA 5TNCA 2NZ0A 2V53A 4OV2A 2MRDA 3SG5A 1QVIZ 3DF0B 4NDDA 1N2DA 1JUOA 2KNEA 4QJ3B 2KAXA 3CR5X 2WCBA 3D0YB 3GOFA 3H4SE 1IQ3A 1UUSA 1DTLA 2ZKMX 3JVTB 2CBLA 1B9AA 3AKAA 4YGAA 2EGDA 1A03A 1UWOA 4MRXA 2FCDA 1RROA 5CSFA 3CZTX 3PM8A 1TN4A 3DVMA 3IQQA 1KWOB 3I5IC 4AQJA 2K61A 1IH0A 4XJKA 1CDMA 3GK1A 1C7VA 2LANA 2JRFA 2O60A 2PMYA 2ZNDA 1YRUB 3CTNA 5KU1A 2NCOA 3EK4A 4AOMA 1K8UA 4YGCB 2CNPA 2KQ6A 4IL1A 1M63B 1S5GY 3TZ1A 5HKWA 1F54A 1D1OA 1TOPA 4PE7A 1WRKA 1OMVA 1DJHA 1AP4A 1J7PA 4D1EA 5BPJA 2GGMA 1J1EA 1WRZA 2L2EA 2M3WA 4WRIA 1S3PA 4PHKA 1BG1A 1DJXA 1NCXA 2KBMA 3TUYB 3BXKA 2LUCA 3LCPC 3EK8A 1S6CA 2D8NA 1TNXA 1SCMB 2JZIA 2SCPA 2LM5A 2H61C 1IJ6A 1FF1A 2ZFDA 1BF5A 1CDNA 1J7OA 5GQQC 2Y5IA 2EC6C 4I5KA 5D7FA 3FS7A 3O78A 1AK8A 4U8DA 1PALA 3IQOA 4M2OA 1BJFA 4AQIA 1J1DA 4CLNA 3QRXA 4BY5A 1JSAA 3FWBA 1B7TY 1S26D 3SG2A 1W7IB 2BE4A 1OZOA 2KBIA 4ICBA 5CPVA 2PSRA 4USLA 4A4BA 1M39A 1CDLA 3BUNB 3GK4X 1MXEA 1UP5A 2I2RE 1TTXA 2Q4UA 3OB2B 4F0ZB 1BOCA 1K95A 1JC2A 1S6IA 5JOLA 1B8RA 2M49B 1B47A 3CR2A 1DJYA 2JWWA 2K2AA 5I2OA 1NYAA 2FJUB 1IKUA 2B1UA 1CFDA 3CS1A 5FYXA 1JBAA 1TNQA 2AUCA 1KCYA 1XK4C 4HRHA 3SG3A 2K7DA 2GGZA 2KYFA 1EH2A 3OB1B 1K2HA 4UPGA 1CDPA 1EXRA 1DJGA 1ZACA 2LV7A 1XFUO 2CTNA 1PSRA 2OS8B 3EVRA 1F70A 3I5IB 2JQ6A 2LVKA 3E3RA 1PSBA 2NCPA 2ZRSA 1VRKA 2R2IA 4PALA 4NQGA 4YI9A 1UHHA 3TS5C 3WHTB 1DMOA 3JVTC 3SG7A 1DJZA 1S36A 2BCBA 4MLWA 1NX3A 1YX7A 1K93D 1B4CA 2KAYA 2L4HA 5AXIA 5KSZA 5DKRA 4ORAB 1MXLC 1K96A 2LP2A 3O2PA 4GAOA 3FWCA 1LA0A 1KWOC 1S6JA 2LMTA 3NXAA 1KK7Y 5IBWA 2E30A 1SBJA 1IG5A 1KK8C 2I94A 2M7NA 1Y1AA 5CSJA 2CCMA 1AJ4A 4I5NB 3I5GB 1NCYA 2LHLA 2Y4QA 1G33A 1N0YA 1EG3A 2M0RA 1KK8B 5CSIA 3K21A 5DKQA 1MF8B 1U5IA 1QX5B 2F2OA 2PALA 5HLOA 3I5GC
chains in the Genus database with same CATH superfamily
1Y1XA 3OP0A 3I5HC 1IRJA 1JF2A 2LLSA 3CZ1A 4JPZB 1F8HA 2O5GA 3VROA 3CWGA 3TUYC 5AFPA 1YX8A 1XA5A 2QEBA 4CPVA 1B7TZ 1U5IB 4ETOA 1CM1A 2LAPA 3D0YA 3N7HA 4YGEB 3OGNA 4YGBB 4ZCUA 1QVIY 3PJIA 1W7JB 1P28A 1A29A 2M7LA 1YR5A 2JTTA 2LVIA 2FJYA 2JT3A 3VGOA 1MUXA 3O4XA 2CT9A 1DVIA 2HQ8A 1G4YR 3FIAA 1UHNA 4DCKA 5HL1A 2ZRTA 3OHMB 1J55A 3JTDC 3BUOB 2E6WA 2M1UA 4YRUA 2LMUA 2ZN8A 1QTXA 3SIAA 1RFJA 1OOFA 5AANA 3WHUB 1A75A 1TNWA 3C1VA 1PVAA 3BJHA 3ZWHA 1QIVA 3BUMB 3KO0A 1CMGA 1UHKA 1QASA 3PATA 1F4QA 3S0BA 1TNPA 3LL8B 4C0KA 1TUZA 2JPOA 1HQVA 1Y6WA 3R1OA 1CLBA 2BBNA 1GQMA 1JFKA 2HQWA 2F33A 1NWDA 1KFXL 2CXJA 3BFBA 3RLZA 1KSMA 2OPOA 1B8CA 1FI6A 2LE9B 1Y0VH 3FE6A 4INWA 2WCEA 5EL2A 2JT8A 1PVBA 2KI4B 3TDUA 1F71A 1WDCC 3KEVA 4C0LA 4CFQA 2JXCA 1HT9A 1UURA 2BE6A 1XFVO 2LNKA 3PFVA 2FCEA 4GFTA 1KQMC 1KQVA 1RTP1 2H61A 4A4CA 1WDCB 4JKTA 1TUJA 2BCAA 4OVNF 3BQ3A 4GUKA 3NGVA 2GV5A 2NLNA 1K90D 3TS5B 1QV1A 3IF7A 1R2UA 3EKJA 4PE0A 1SPYA 1ORGA 1OOIX 2AAOA 2ISDA 2L51A 2PQLA 3L4LA 1L7ZA 3AKBA 3D10A 1SL7A 1OSAA 1DC1A 1TRFA 1AUIB 2K2FA 1SYMA 1SW8A 2WORA 1KSOA 2LHIA 3RZSA 1NIWA 3V2LA 3CDNA 2MBXA 2K0JA 5I8NA 2ZN9A 1X02A 1A2XA 4ORBB 1LXFC 2G2BA 2M8UA 4GGNA 1DQEA 1YUTA 4M2PA 4P5OE 1EJ3A 1JWDA 1CLMA 2PVBA 2KPHA 5HKZA 1NX0A 3VRPA 2I18A 1YRTB 2OTGB 2BL0C 2LLUA 2ZNEA 4DUQA 1JFJA 1LVCD 1FPWA 2P71A 4R1EA 4KYNA 1LS8A 1WRLA 1AVSA 2KDHA 2BL0B 2JULA 4PHMA 3AAJA 2HPSA 3GK2A 1K9PA 3OBVA 4MSPA 1XFWO 2Q91A 5FI6A 4BY4A 4HSZA 1RWYA 5I2LA 1QJTA 1ALVA 1PULA 3EKHA 1CB1A 2JNFA 2LC5A 1C3ZA 2KI6C 1NP8A 3R1VA 4JQ0D 1OMRA 3B6XA 1OZSA 3CLNA 4ZCVA 1GGWA 5F6TA 4HRGA 1EG4A 1IJ5A 1KFXS 4N1GA 3WXAA 3F45A 5HLVA 2P6BB 5I2QA 2L4IA 3LK1A 3NSOA 4MN0A 2OS8C 1ZUZA 1CLLA 3BFAA 4WQ2A 1RECA 2KI4C 4DIRA 1A4PA 1ODBA 1BMOA 2KGBC 2JU0A 3BYAA 1DGVA 1FW4A 1SY9A 1S5GZ 1S1EA 3L4AA 1GJYA 4MBEA 1R6PA 2MAZA 1M46A 1QS7A 1V1FA 2H2KA 1RJVA 2WCMA 1DJWA 1YVHA 1LINA 1SCVA 1Z4HA 1IQ5A 4JWQA 2P70A 3BUWB 1CTRA 3KF9A 2M97A 1TIZA 1CFPA 1J7RA 3AAKA 4P2YB 4HREE 1W9ZA 4PT1A 2WC6A 1H4BA 3CYZA 2KYCA 1JF0A 1YVLA 5ER4X 4MVFA 1SCMC 5KTYA 4INXA 1BLQA 1OOJA 2SASA 1SK6D 1KQMB 2MJWB 2PRUA 4GBAA 2WCHA 3DF0A 3DXLA 5AEQA 1SL8A 1YTZC 4XYNA 1DEKA 3LLEA 2F3YA 2JC2A 4OKHA 1NPQA 3O6BA 1L2OB 3PALA 1A75B 3SIBA 3VRRA 3PSRA 2JNXA 2LVVA 1QXPA 2FOTA 1Z2CB 2BCXA 4QJ4B 1QV0A 2I7AA 3B87A 3NSIA 1L2OC 1QX2A 1SNLA 1QATA 1NCZA 1YUUA 2G9BA 3DY9A 4OCIA 2QPTA 3ZNIA 1QLSA 2KOTA 1ALWA 2M29A 5DKNA 3EK7A 1BR4B 1FBVA 4I5LB 1MHOA 1B8LA 2KFFA 4GGFA 4CFRA 1KK7Z 1NSHA 4YI8A 1DF0B 1V1GA 5I94A 3SS4A 1CFCA 4M2QA 2JXLA 1DT7B 2JTZA 3PLFB 1XK4A 2WC8A 1QX7A 1QWVA 1GGZA 4MZLA 2K7OA 4PE4A 3DVEA 2K7BA 4C0JA 1IIOA 4GPLB 2L50A 1KFUL 3CABA 4FTGA 3SG6A 2QACA 2WNDA 2M1KB 1C07A 2KI6D 3EVVA 3NSKA 3R72A 4FQOA 1XFZO 2KGRA 1NX1A 2M9GA 1BODA 2MLEC 4OZDA 1SKTA 3HX4A 3PN7C 2JPTA 1BR1B 1Q80A 4YBHB 4L9MA 5D3OA 1PRWA 1AJ5A 2BBMA 2LVJA 4PHNA 2WCFA 3HCMA 3PN7B 2LMVA 1M31A 3VRNA 1WY9A 1F55A 5AERA 2BKIB 3RM1A 3SJSA 1QIWA 4WQ3A 1MWNA 1AHRA 1Y1UA 2WOSA 3D78A 2MLFC 2H8VA 2F3ZA 2WCLA 2EC6B 5JJGA 1K94A 1OOGA 2K7CA 4N1FA 2L98A 1SL9A 2JT0A 3VRQA 2GTEA 3QMEA 3KHEA 3I5HB 2K60A 2OTGC 5ER5A 1YURA 1WLZA 2F2PA 3DVJA 1OE9B 1TCFA 1C3YA 1BT6A 3I5FB 1OMDA 1SRAA 3CR4X 2HETA 2BECA 4E68A 2K8MB 5CSNA 4I5JA 5DICA 3NSLA 1CMFA 3BUXB 1DGUA 2JOJA 1C7WA 4MRYA 2KFGA 3I5FC 2MA2A 1EL4A 1M45A 1SR6B 4OR9B 4GNKB 4PCWA 3SG4A 1XFYO 1DF0A 2BKHB 2VRGA 4NDBA 2KSPA 3OX5A 2KAVA 3MSEB 1IWQA 2A4JA 3KPXA 4CIDA 3JTDB 2F8PA 3DVKA 1DJIA 1CNPA 1NX2A 2KLDA 1K9UA 5HKYA 5D69A 2RGIA 2IS9A 1ZMZA 2KHNA 5PALA 3O4YA 4GGFC 5FI7A 2LLTA 4Q04A 3DZTA 4MZJA 4TNCA 2KFHA 4PDZA 5J3XA 1XO5A 1CFFA 1FI5A 3UNWA 5HYDA 1OW4A 1OQPA 3A8RA 1CM4A 3FE8A 1B1GA 3ICBA 2MHHA 1G8IA 2EHBA 1UHIA 1ZFSA 3BOWA 3M0WA 4DS7A 1PK0D 1MQ1A 1XFXO 1F4OA 1N65A 1LA3A 1RK9A 3BOWB 1KFUS 3EG5B 4MZKA 2BNXA 3LK0A 1K9KA 4MEWA 2LP3A 3TDIA 3D73A 3WNXB 1CKKA 3DYEA 4N5XA 3FE9A 1SMGA 3S0AA 1IGVA 1MR8A 1NUBA 1TCOB 2AMIA 4PE1A 2NXQA 3EVUA 1QLKA 1XVJA 3UO9A 2L0PA 3DD4A 2KQYA 2Y1MA 2TN4A 2LCPA 4DRWA 4XJKB 1ZOTB 3D76A 1E8AA 2HF5A 1LKJA 2L5XB 1WLMA 3OX6A 1H8BA 4QJ5B 1J7QA 2PASA 1DELA 2COLB 1SSEB 3TDZA 1YUSA 5B8IB 1BU3A 2LUXA 3CGAA 2DOQA 1UHJA 1SR6C 4ORCB 4PHJA 5G08A 3B7AA 2Y1NA 4YGDB 2BAPA 5K89A 3A4UB 2L2CA 4NDCA 5TNCA 2NZ0A 2V53A 4OV2A 2MRDA 3SG5A 1QVIZ 3DF0B 4NDDA 1N2DA 1JUOA 2KNEA 4QJ3B 3B86A 2KAXA 3CR5X 2WCBA 3D0YB 3GOFA 3H4SE 1IQ3A 1UUSA 1DTLA 2KLEA 2ZKMX 3JVTB 2CBLA 1B9AA 3AKAA 3SS5A 4YGAA 2EGDA 1A03A 1UWOA 4MRXA 2FCDA 1RROA 5CSFA 3CZTX 2WCKA 1TN4A 3PM8A 2QEOA 3DVMA 3IQQA 3NHTA 1KWOB 3I5IC 4AQJA 2K61A 1IH0A 4XJKA 1CDMA 3GK1A 1C7VA 2LANA 2JRFA 2O60A 2PMYA 3NHIA 2ZNDA 1YRUB 3CTNA 5KU1A 2NCOA 3EK4A 4AOMA 1K8UA 4YGCB 2CNPA 2KQ6A 4IL1A 1M63B 1S5GY 2L5YA 3TZ1A 3Q8IA 5HKWA 1F54A 1D1OA 1TOPA 4PE7A 1WRKA 1OMVA 1DJHA 1AP4A 1J7PA 4D1EA 5BPJA 2GGMA 1J1EA 1WRZA 2L2EA 2M3WA 4WRIA 1S3PA 4PHKA 2F2OA 1BG1A 4JD9A 1DJXA 1NCXA 2KBMA 3TUYB 3BXKA 2LUCA 3CZ2A 3LCPC 3EK8A 2ERBA 1S6CA 2D8NA 1TNXA 1SCMB 2JZIA 2SCPA 2LM5A 2H61C 1IJ6A 3D74A 2ZFDA 1BF5A 1FF1A 1CDNA 2QEHA 1J7OA 4IJ7A 3D75A 3IVTA 5GQQC 2Y5IA 2EC6C 4I5KA 5D7FA 3FS7A 3O78A 3D77A 3S0EA 4U8DA 1PALA 3IQOA 4M2OA 1AK8A 1BJFA 4AQIA 1J1DA 4CLNA 3QRXA 3K1EA 4BY5A 1JSAA 3FWBA 1B7TY 1S26D 3SG2A 1W7IB 2BE4A 1OZOA 2KBIA 1OOHA 4ICBA 2PSRA 5CPVA 4USLA 4A4BA 1TWOA 1M39A 1CDLA 3BUNB 3GK4X 1MXEA 1UP5A 2I2RE 1TTXA 2Q4UA 3OB2B 4F0ZB 1BOCA 1K95A 1JC2A 1S6IA 5JOLA 1B8RA 2M49B 1B47A 3R1PA 3CR2A 1DJYA 2JWWA 2K2AA 5I2OA 2YGUA 1NYAA 2FJUB 2WC5A 1IKUA 1GM0A 4FQTA 2B1UA 1CFDA 3CS1A 5FYXA 1JBAA 1TNQA 3S0DA 2AUCA 3S0GA 1XK4C 3B88A 5FI2A 1KCYA 4HRHA 3SG3A 2K7DA 2GGZA 2KYFA 3BFHA 1EH2A 3OB1B 1K2HA 4UPGA 1CDPA 3L47A 1EXRA 2PYQA 1DJGA 1ZACA 2LV7A 1XFUO 2CTNA 1PSRA 2OS8B 3EVRA 1F70A 3I5IB 1XFRA 2JQ6A 2LVKA 3E3RA 1PSBA 2NCPA 2ZRSA 1VRKA 4F7FA 2QDIA 2R2IA 3VB1A 4PALA 4NQGA 4YI9A 1UHHA 3TS5C 3WHTB 1DMOA 3JVTC 3S0FA 3SG7A 1DJZA 1S36A 2BCBA 2QEVA 4MLWA 1NX3A 1YX7A 1K93D 1B4CA 2KAYA 2L4HA 5AXIA 5KSZA 5DKRA 4ORAB 1MXLC 1K96A 2LP2A 3O2PA 4GAOA 3FWCA 1LA0A 3PM2A 1KWOC 1S6JA 2LMTA 2WCJA 3NXAA 1KK7Y 5IBWA 2E30A 1SBJA 1IG5A 1KK8C 2I94A 2M7NA 1Y1AA 5CSJA 2CCMA 1AJ4A 4I5NB 1T14A 3I5GB 1NCYA 2LHLA 2Y4QA 1G33A 1N0YA 3SS3A 1EG3A 2M0RA 1KK8B 5CSIA 3K21A 5DKQA 1MF8B 1U5IA 1QX5B 1XYDA 2PALA 5HLOA 3I5GC 3CZ0A
chains in the Genus database with same CATH topology
1Y1XA 3OP0A 3I5HC 1IRJA 1JF2A 2LLSA 1F8HA 4JPZB 2O5GA 3VROA 3CWGA 3TUYC 5AFPA 1YX8A 1XA5A 4CPVA 1B7TZ 1U5IB 4ETOA 1CM1A 2LAPA 3D0YA 4YGEB 4YGBB 4ZCUA 1QVIY 1W7JB 1A29A 2M7LA 1YR5A 2JTTA 2LVIA 3VGOA 2JT3A 1MUXA 2CT9A 1DVIA 2HQ8A 1G4YR 3FIAA 1UHNA 4DCKA 2ZRTA 3OHMB 1J55A 3JTDC 3BUOB 2E6WA 2M1UA 4YRUA 2LMUA 2ZN8A 1QTXA 3SIAA 1RFJA 5AANA 3ZWHA 3WHUB 1A75A 1TNWA 3C1VA 1PVAA 5HKYA 1QIVA 3BUMB 3KO0A 1CMGA 1UHKA 1QASA 3PATA 1F4QA 4C0KA 1TNPA 3LL8B 1HQVA 1Y6WA 1CLBA 2BBNA 1GQMA 1JFKA 2HQWA 2F33A 1NWDA 1KFXL 2CXJA 3RLZA 1KSMA 2OPOA 1B8CA 1FI6A 2LE9B 1Y0VH 2WCEA 2JT8A 1PVBA 2KI4B 3TDUA 1F71A 1WDCC 3KEVA 4C0LA 4CFQA 2JXCA 1HT9A 1UURA 2BE6A 1XFVO 2LNKA 3PFVA 2FCEA 4GFTA 1KQMC 1KQVA 1RTP1 2H61A 4A4CA 1WDCB 2BCAA 4OVNF 3BQ3A 4GUKA 2GV5A 2NLNA 1K90D 3TS5B 1QV1A 3IF7A 1R2UA 3EKJA 4PE0A 1SPYA 2ISDA 2AAOA 4DS7A 2L51A 1L7ZA 3AKBA 3D10A 1SL7A 1OSAA 1TRFA 1AUIB 2K2FA 1SYMA 1SW8A 2WORA 1KSOA 2LHIA 1NIWA 2MBXA 2K0JA 5I8NA 2ZN9A 1X02A 1A2XA 4ORBB 1LXFC 2G2BA 2M8UA 4GGNA 1YUTA 4M2PA 4P5OE 1EJ3A 1JWDA 1CLMA 2PVBA 5HKZA 1NX0A 3VRPA 2I18A 1YRTB 2OTGB 2BL0C 2LLUA 2ZNEA 4DUQA 1LVCD 1FPWA 4R1EA 1WRLA 1AVSA 2KDHA 2BL0B 2JULA 4PHMA 3AAJA 2HPSA 3GK2A 1K9PA 4MSPA 1XFWO 2Q91A 4BY4A 4HSZA 1RWYA 5I2LA 1QJTA 1ALVA 1PULA 3EKHA 1CB1A 2JNFA 2LC5A 2KI6C 1NP8A 4JQ0D 1OMRA 1OZSA 3CLNA 4ZCVA 1GGWA 5F6TA 4HRGA 1EG4A 1IJ5A 1KFXS 4N1GA 3WXAA 3F45A 5HLVA 2P6BB 5I2QA 2L4IA 3LK1A 3NSOA 4MN0A 2OS8C 1ZUZA 1CLLA 4WQ2A 1RECA 2KI4C 4DIRA 1A4PA 1ODBA 1BMOA 2KGBC 2JU0A 3BYAA 1DGVA 1FW4A 1SY9A 1S5GZ 1S1EA 4MBEA 1GJYA 3VRNA 1R6PA 2MAZA 2H2KA 1M46A 1QS7A 1V1FA 1RJVA 1DJWA 1YVHA 1LINA 1SCVA 1IQ5A 4JWQA 3BUWB 1CTRA 3KF9A 2M97A 1TIZA 1CFPA 1J7RA 3AAKA 4P2YB 4HREE 1H4BA 1XYDA 2KYCA 1JF0A 1YVLA 5ER4X 4MVFA 1SCMC 5KTYA 1BLQA 1OOJA 2SASA 1SK6D 1KQMB 2MJWB 2PRUA 4GBAA 3DF0A 5AEQA 1SL8A 1YTZC 4XYNA 3LLEA 2F3YA 2JC2A 4OKHA 1NPQA 3O6BA 1L2OB 3PALA 1A75B 3SIBA 3VRRA 3PSRA 2JNXA 2LVVA 1QXPA 2FOTA 2BCXA 4QJ4B 1QV0A 2I7AA 3NSIA 1L2OC 1QX2A 1SNLA 1QATA 1NCZA 1YUUA 2G9BA 4OCIA 2QPTA 3ZNIA 1QLSA 2KOTA 1ALWA 2M29A 5DKNA 3EK7A 1BR4B 1FBVA 4I5LB 1MHOA 1B8LA 2KFFA 4GGFA 4CFRA 1KK7Z 1NSHA 4YI8A 1DF0B 1V1GA 1CFCA 4M2QA 2JXLA 1DT7B 2JTZA 3PLFB 1XK4A 2WC8A 1QX7A 4MZLA 1GGZA 4PE4A 2K7OA 1JFJA 3DVEA 2K7BA 4C0JA 4GPLB 2L50A 1KFUL 4FTGA 3SG6A 2QACA 2WNDA 2M1KB 1C07A 2KI6D 3EVVA 3NSKA 4FQOA 1XFZO 2KGRA 1NX1A 2M9GA 1BODA 2MLEC 1SKTA 3HX4A 3PN7C 2JPTA 1BR1B 1Q80A 4YBHB 4L9MA 1PRWA 1AJ5A 2BBMA 2LVJA 4PHNA 2WCFA 3HCMA 3PN7B 2LMVA 1M31A 1WY9A 1F55A 5AERA 2BKIB 3RM1A 3SJSA 1QIWA 4WQ3A 1MWNA 1AHRA 1Y1UA 2WOSA 2MLFC 2F3ZA 2EC6B 5JJGA 1K94A 4N1FA 2K7CA 2L98A 1SL9A 2JT0A 3VRQA 3KHEA 3I5HB 2OTGC 5ER5A 1YURA 1WLZA 2F2PA 3DVJA 1OE9B 1TCFA 1BT6A 3I5FB 1OMDA 1SRAA 3CR4X 2HETA 2BECA 4E68A 2K8MB 5CSNA 4I5JA 3NSLA 1CMFA 3BUXB 1DGUA 2JOJA 1C7WA 4MRYA 2KFGA 3I5FC 2MA2A 1EL4A 1M45A 1SR6B 4OR9B 4GNKB 4PCWA 3SG4A 1XFYO 1DF0A 2BKHB 2VRGA 4NDBA 2KSPA 3OX5A 2KAVA 3MSEB 1IWQA 2A4JA 3KPXA 4CIDA 3JTDB 2F8PA 3DVKA 1DJIA 1CNPA 1NX2A 1K9UA 5D69A 2RGIA 2IS9A 1ZMZA 2KHNA 5PALA 3O4YA 4GGFC 2LLTA 4Q04A 4TNCA 4MZJA 5J3XA 2KFHA 4PDZA 1CFFA 1XO5A 1FI5A 5HYDA 1OQPA 3A8RA 1CM4A 1B1GA 3ICBA 2MHHA 1G8IA 2EHBA 1UHIA 1ZFSA 3BOWA 3M0WA 1PK0D 1MQ1A 1XFXO 1F4OA 1N65A 1LA3A 1RK9A 3BOWB 1KFUS 4MZKA 3LK0A 1K9KA 4MEWA 2LP3A 3TDIA 3WNXB 1CKKA 4N5XA 1SMGA 1IGVA 1MR8A 1NUBA 1TCOB 2AMIA 4PE1A 2NXQA 3EVUA 1QLKA 1XVJA 2L0PA 3DD4A 2KQYA 2Y1MA 2TN4A 2LCPA 4DRWA 4XJKB 1ZOTB 1E8AA 2HF5A 1LKJA 2L5XB 1WLMA 3OX6A 1H8BA 4QJ5B 1J7QA 2PASA 2COLB 3TDZA 1YUSA 5B8IB 1BU3A 2LUXA 3CGAA 2DOQA 1UHJA 1SR6C 4ORCB 4PHJA 5G08A 2Y1NA 4YGDB 5K89A 3A4UB 4NDCA 5TNCA 2NZ0A 2V53A 4OV2A 2MRDA 3SG5A 1QVIZ 3DF0B 4NDDA 1N2DA 1JUOA 2KNEA 4QJ3B 2KAXA 3CR5X 2WCBA 3D0YB 3GOFA 3H4SE 1IQ3A 1UUSA 1DTLA 2ZKMX 3JVTB 2CBLA 1B9AA 3AKAA 4YGAA 2EGDA 1A03A 1UWOA 4MRXA 2FCDA 1RROA 5CSFA 3CZTX 3PM8A 1TN4A 3DVMA 3IQQA 1KWOB 3I5IC 4AQJA 2K61A 1IH0A 4XJKA 1CDMA 3GK1A 1C7VA 2LANA 2JRFA 2O60A 2PMYA 2ZNDA 1YRUB 3CTNA 5KU1A 2NCOA 3EK4A 4AOMA 1K8UA 4YGCB 2CNPA 2KQ6A 4IL1A 1M63B 1S5GY 3TZ1A 5HKWA 1F54A 1D1OA 1TOPA 4PE7A 1WRKA 1OMVA 1DJHA 1AP4A 1J7PA 4D1EA 5BPJA 2GGMA 1J1EA 1WRZA 2L2EA 2M3WA 4WRIA 1S3PA 4PHKA 1BG1A 1DJXA 1NCXA 2KBMA 3TUYB 3BXKA 2LUCA 3LCPC 3EK8A 1S6CA 2D8NA 1TNXA 1SCMB 2JZIA 2SCPA 2LM5A 2H61C 1IJ6A 1FF1A 2ZFDA 1BF5A 1CDNA 1J7OA 5GQQC 2Y5IA 2EC6C 4I5KA 5D7FA 3FS7A 3O78A 1AK8A 4U8DA 1PALA 3IQOA 4M2OA 1BJFA 4AQIA 1J1DA 4CLNA 3QRXA 4BY5A 1JSAA 3FWBA 1B7TY 1S26D 3SG2A 1W7IB 2BE4A 1OZOA 2KBIA 4ICBA 5CPVA 2PSRA 4USLA 4A4BA 1M39A 1CDLA 3BUNB 3GK4X 1MXEA 1UP5A 2I2RE 1TTXA 2Q4UA 3OB2B 4F0ZB 1BOCA 1K95A 1JC2A 1S6IA 5JOLA 1B8RA 2M49B 1B47A 3CR2A 1DJYA 2JWWA 2K2AA 5I2OA 1NYAA 2FJUB 1IKUA 2B1UA 1CFDA 3CS1A 5FYXA 1JBAA 1TNQA 2AUCA 1KCYA 1XK4C 4HRHA 3SG3A 2K7DA 2GGZA 2KYFA 1EH2A 3OB1B 1K2HA 4UPGA 1CDPA 1EXRA 1DJGA 1ZACA 2LV7A 1XFUO 2CTNA 1PSRA 2OS8B 3EVRA 1F70A 3I5IB 2JQ6A 2LVKA 3E3RA 1PSBA 2NCPA 2ZRSA 1VRKA 2R2IA 4PALA 4NQGA 4YI9A 1UHHA 3TS5C 3WHTB 1DMOA 3JVTC 3SG7A 1DJZA 1S36A 2BCBA 4MLWA 1NX3A 1YX7A 1K93D 1B4CA 2KAYA 2L4HA 5AXIA 5KSZA 5DKRA 4ORAB 1MXLC 1K96A 2LP2A 3O2PA 4GAOA 3FWCA 1LA0A 1KWOC 1S6JA 2LMTA 3NXAA 1KK7Y 5IBWA 2E30A 1SBJA 1IG5A 1KK8C 2I94A 2M7NA 1Y1AA 5CSJA 2CCMA 1AJ4A 4I5NB 3I5GB 1NCYA 2LHLA 2Y4QA 1G33A 1N0YA 1EG3A 2M0RA 1KK8B 5CSIA 3K21A 5DKQA 1MF8B 1U5IA 1QX5B 2F2OA 2PALA 5HLOA 3I5GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1X A;  3OP0 A;  3I5H C;  1IRJ A;  1JF2 A;  2LLS A;  1F8H A;  4JPZ B;  2O5G A;  3VRO A;  3CWG A;  3TUY C;  5AFP A;  1YX8 A;  1XA5 A;  4CPV A;  1B7T Z;  1U5I B;  4ETO A;  1CM1 A;  2LAP A;  3D0Y A;  4YGE B;  4YGB B;  4ZCU A;  1QVI Y;  1W7J B;  1A29 A;  2M7L A;  1YR5 A;  2JTT A;  2LVI A;  3VGO A;  2JT3 A;  1MUX A;  2CT9 A;  1DVI A;  2HQ8 A;  1G4Y R;  3FIA A;  1UHN A;  4DCK A;  2ZRT A;  3OHM B;  1J55 A;  3JTD C;  3BUO B;  2E6W A;  2M1U A;  4YRU A;  2LMU A;  2ZN8 A;  1QTX A;  3SIA A;  1RFJ A;  5AAN A;  3ZWH A;  3WHU B;  1A75 A;  1TNW A;  3C1V A;  1PVA A;  5HKY A;  1QIV A;  3BUM B;  3KO0 A;  1CMG A;  1UHK A;  1QAS A;  3PAT A;  1F4Q A;  4C0K A;  1TNP A;  3LL8 B;  1HQV A;  1Y6W A;  1CLB A;  2BBN A;  1GQM A;  1JFK A;  2HQW A;  2F33 A;  1NWD A;  1KFX L;  2CXJ A;  3RLZ A;  1KSM A;  2OPO A;  1B8C A;  1FI6 A;  2LE9 B;  1Y0V H;  2WCE A;  2JT8 A;  1PVB A;  2KI4 B;  3TDU A;  1F71 A;  1WDC C;  3KEV A;  4C0L A;  4CFQ A;  2JXC A;  1HT9 A;  1UUR A;  2BE6 A;  1XFV O;  2LNK A;  3PFV A;  2FCE A;  4GFT A;  1KQM C;  1KQV A;  1RTP 1;  2H61 A;  4A4C A;  1WDC B;  2BCA A;  4OVN F;  3BQ3 A;  4GUK A;  2GV5 A;  2NLN A;  1K90 D;  3TS5 B;  1QV1 A;  3IF7 A;  1R2U A;  3EKJ A;  4PE0 A;  1SPY A;  2ISD A;  2AAO A;  4DS7 A;  2L51 A;  1L7Z A;  3AKB A;  3D10 A;  1SL7 A;  1OSA A;  1TRF A;  1AUI B;  2K2F A;  1SYM A;  1SW8 A;  2WOR A;  1KSO A;  2LHI A;  1NIW A;  2MBX A;  2K0J A;  5I8N A;  2ZN9 A;  1X02 A;  1A2X A;  4ORB B;  1LXF C;  2G2B A;  2M8U A;  4GGN A;  1YUT A;  4M2P A;  4P5O E;  1EJ3 A;  1JWD A;  1CLM A;  2PVB A;  5HKZ A;  1NX0 A;  3VRP A;  2I18 A;  1YRT B;  2OTG B;  2BL0 C;  2LLU A;  2ZNE A;  4DUQ A;  1LVC D;  1FPW A;  4R1E A;  1WRL A;  1AVS A;  2KDH A;  2BL0 B;  2JUL A;  4PHM A;  3AAJ A;  2HPS A;  3GK2 A;  1K9P A;  4MSP A;  1XFW O;  2Q91 A;  4BY4 A;  4HSZ A;  1RWY A;  5I2L A;  1QJT A;  1ALV A;  1PUL A;  3EKH A;  1CB1 A;  2JNF A;  2LC5 A;  2KI6 C;  1NP8 A;  4JQ0 D;  1OMR A;  1OZS A;  3CLN A;  4ZCV A;  1GGW A;  5F6T A;  4HRG A;  1EG4 A;  1IJ5 A;  1KFX S;  4N1G A;  3WXA A;  3F45 A;  5HLV A;  2P6B B;  5I2Q A;  2L4I A;  3LK1 A;  3NSO A;  4MN0 A;  2OS8 C;  1ZUZ A;  1CLL A;  4WQ2 A;  1REC A;  2KI4 C;  4DIR A;  1A4P A;  1ODB A;  1BMO A;  2KGB C;  2JU0 A;  3BYA A;  1DGV A;  1FW4 A;  1SY9 A;  1S5G Z;  1S1E A;  4MBE A;  1GJY A;  3VRN A;  1R6P A;  2MAZ A;  2H2K A;  1M46 A;  1QS7 A;  1V1F A;  1RJV A;  1DJW A;  1YVH A;  1LIN A;  1SCV A;  1IQ5 A;  4JWQ A;  3BUW B;  1CTR A;  3KF9 A;  2M97 A;  1TIZ A;  1CFP A;  1J7R A;  3AAK A;  4P2Y B;  4HRE E;  1H4B A;  1XYD A;  2KYC A;  1JF0 A;  1YVL A;  5ER4 X;  4MVF A;  1SCM C;  5KTY A;  1BLQ A;  1OOJ A;  2SAS A;  1SK6 D;  1KQM B;  2MJW B;  2PRU A;  4GBA A;  3DF0 A;  5AEQ A;  1SL8 A;  1YTZ C;  4XYN A;  3LLE A;  2F3Y A;  2JC2 A;  4OKH A;  1NPQ A;  3O6B A;  1L2O B;  3PAL A;  1A75 B;  3SIB A;  3VRR A;  3PSR A;  2JNX A;  2LVV A;  1QXP A;  2FOT A;  2BCX A;  4QJ4 B;  1QV0 A;  2I7A A;  3NSI A;  1L2O C;  1QX2 A;  1SNL A;  1QAT A;  1NCZ A;  1YUU A;  2G9B A;  4OCI A;  2QPT A;  3ZNI A;  1QLS A;  2KOT A;  1ALW A;  2M29 A;  5DKN A;  3EK7 A;  1BR4 B;  1FBV A;  4I5L B;  1MHO A;  1B8L A;  2KFF A;  4GGF A;  4CFR A;  1KK7 Z;  1NSH A;  4YI8 A;  1DF0 B;  1V1G A;  1CFC A;  4M2Q A;  2JXL A;  1DT7 B;  2JTZ A;  3PLF B;  1XK4 A;  2WC8 A;  1QX7 A;  4MZL A;  1GGZ A;  4PE4 A;  2K7O A;  1JFJ A;  3DVE A;  2K7B A;  4C0J A;  4GPL B;  2L50 A;  1KFU L;  4FTG A;  3SG6 A;  2QAC A;  2WND A;  2M1K B;  1C07 A;  2KI6 D;  3EVV A;  3NSK A;  4FQO A;  1XFZ O;  2KGR A;  1NX1 A;  2M9G A;  1BOD A;  2MLE C;  1SKT A;  3HX4 A;  3PN7 C;  2JPT A;  1BR1 B;  1Q80 A;  4YBH B;  4L9M A;  1PRW A;  1AJ5 A;  2BBM A;  2LVJ A;  4PHN A;  2WCF A;  3HCM A;  3PN7 B;  2LMV A;  1M31 A;  1WY9 A;  1F55 A;  5AER A;  2BKI B;  3RM1 A;  3SJS A;  1QIW A;  4WQ3 A;  1MWN A;  1AHR A;  1Y1U A;  2WOS A;  2MLF C;  2F3Z A;  2EC6 B;  5JJG A;  1K94 A;  4N1F A;  2K7C A;  2L98 A;  1SL9 A;  2JT0 A;  3VRQ A;  3KHE A;  3I5H B;  2OTG C;  5ER5 A;  1YUR A;  1WLZ A;  2F2P A;  3DVJ A;  1OE9 B;  1TCF A;  1BT6 A;  3I5F B;  1OMD A;  1SRA A;  3CR4 X;  2HET A;  2BEC A;  4E68 A;  2K8M B;  5CSN A;  4I5J A;  3NSL A;  1CMF A;  3BUX B;  1DGU A;  2JOJ A;  1C7W A;  4MRY A;  2KFG A;  3I5F C;  2MA2 A;  1EL4 A;  1M45 A;  1SR6 B;  4OR9 B;  4GNK B;  4PCW A;  3SG4 A;  1XFY O;  1DF0 A;  2BKH B;  2VRG A;  4NDB A;  2KSP A;  3OX5 A;  2KAV A;  3MSE B;  1IWQ A;  2A4J A;  3KPX A;  4CID A;  3JTD B;  2F8P A;  3DVK A;  1DJI A;  1CNP A;  1NX2 A;  1K9U A;  5D69 A;  2RGI A;  2IS9 A;  1ZMZ A;  2KHN A;  5PAL A;  3O4Y A;  4GGF C;  2LLT A;  4Q04 A;  4TNC A;  4MZJ A;  5J3X A;  2KFH A;  4PDZ A;  1CFF A;  1XO5 A;  1FI5 A;  5HYD A;  1OQP A;  3A8R A;  1CM4 A;  1B1G A;  3ICB A;  2MHH A;  1G8I A;  2EHB A;  1UHI A;  1ZFS A;  3BOW A;  3M0W A;  1PK0 D;  1MQ1 A;  1XFX O;  1F4O A;  1N65 A;  1LA3 A;  1RK9 A;  3BOW B;  1KFU S;  4MZK A;  3LK0 A;  1K9K A;  4MEW A;  2LP3 A;  3TDI A;  3WNX B;  1CKK A;  4N5X A;  1SMG A;  1IGV A;  1MR8 A;  1NUB A;  1TCO B;  2AMI A;  4PE1 A;  2NXQ A;  3EVU A;  1QLK A;  1XVJ A;  2L0P A;  3DD4 A;  2KQY A;  2Y1M A;  2TN4 A;  2LCP A;  4DRW A;  4XJK B;  1ZOT B;  1E8A A;  2HF5 A;  1LKJ A;  2L5X B;  1WLM A;  3OX6 A;  1H8B A;  4QJ5 B;  1J7Q A;  2PAS A;  2COL B;  3TDZ A;  1YUS A;  5B8I B;  1BU3 A;  2LUX A;  3CGA A;  2DOQ A;  1UHJ A;  1SR6 C;  4ORC B;  4PHJ A;  5G08 A;  2Y1N A;  4YGD B;  5K89 A;  3A4U B;  4NDC A;  5TNC A;  2NZ0 A;  2V53 A;  4OV2 A;  2MRD A;  3SG5 A;  1QVI Z;  3DF0 B;  4NDD A;  1N2D A;  1JUO A;  2KNE A;  4QJ3 B;  2KAX A;  3CR5 X;  2WCB A;  3D0Y B;  3GOF A;  3H4S E;  1IQ3 A;  1UUS A;  1DTL A;  2ZKM X;  3JVT B;  2CBL A;  1B9A A;  3AKA A;  4YGA A;  2EGD A;  1A03 A;  1UWO A;  4MRX A;  2FCD A;  1RRO A;  5CSF A;  3CZT X;  3PM8 A;  1TN4 A;  3DVM A;  3IQQ A;  1KWO B;  3I5I C;  4AQJ A;  2K61 A;  1IH0 A;  4XJK A;  1CDM A;  3GK1 A;  1C7V A;  2LAN A;  2JRF A;  2O60 A;  2PMY A;  2ZND A;  1YRU B;  3CTN A;  5KU1 A;  2NCO A;  3EK4 A;  4AOM A;  1K8U A;  4YGC B;  2CNP A;  2KQ6 A;  4IL1 A;  1M63 B;  1S5G Y;  3TZ1 A;  5HKW A;  1F54 A;  1D1O A;  1TOP A;  4PE7 A;  1WRK A;  1OMV A;  1DJH A;  1AP4 A;  1J7P A;  4D1E A;  5BPJ A;  2GGM A;  1J1E A;  1WRZ A;  2L2E A;  2M3W A;  4WRI A;  1S3P A;  4PHK A;  1BG1 A;  1DJX A;  1NCX A;  2KBM A;  3TUY B;  3BXK A;  2LUC A;  3LCP C;  3EK8 A;  1S6C A;  2D8N A;  1TNX A;  1SCM B;  2JZI A;  2SCP A;  2LM5 A;  2H61 C;  1IJ6 A;  1FF1 A;  2ZFD A;  1BF5 A;  1CDN A;  1J7O A;  5GQQ C;  2Y5I A;  2EC6 C;  4I5K A;  5D7F A;  3FS7 A;  3O78 A;  1AK8 A;  4U8D A;  1PAL A;  3IQO A;  4M2O A;  1BJF A;  4AQI A;  1J1D A;  4CLN A;  3QRX A;  4BY5 A;  1JSA A;  3FWB A;  1B7T Y;  1S26 D;  3SG2 A;  1W7I B;  2BE4 A;  1OZO A;  2KBI A;  4ICB A;  5CPV A;  2PSR A;  4USL A;  4A4B A;  1M39 A;  1CDL A;  3BUN B;  3GK4 X;  1MXE A;  1UP5 A;  2I2R E;  1TTX A;  2Q4U A;  3OB2 B;  4F0Z B;  1BOC A;  1K95 A;  1JC2 A;  1S6I A;  5JOL A;  1B8R A;  2M49 B;  1B47 A;  3CR2 A;  1DJY A;  2JWW A;  2K2A A;  5I2O A;  1NYA A;  2FJU B;  1IKU A;  2B1U A;  1CFD A;  3CS1 A;  5FYX A;  1JBA A;  1TNQ A;  2AUC A;  1KCY A;  1XK4 C;  4HRH A;  3SG3 A;  2K7D A;  2GGZ A;  2KYF A;  1EH2 A;  3OB1 B;  1K2H A;  4UPG A;  1CDP A;  1EXR A;  1DJG A;  1ZAC A;  2LV7 A;  1XFU O;  2CTN A;  1PSR A;  2OS8 B;  3EVR A;  1F70 A;  3I5I B;  2JQ6 A;  2LVK A;  3E3R A;  1PSB A;  2NCP A;  2ZRS A;  1VRK A;  2R2I A;  4PAL A;  4NQG A;  4YI9 A;  1UHH A;  3TS5 C;  3WHT B;  1DMO A;  3JVT C;  3SG7 A;  1DJZ A;  1S36 A;  2BCB A;  4MLW A;  1NX3 A;  1YX7 A;  1K93 D;  1B4C A;  2KAY A;  2L4H A;  5AXI A;  5KSZ A;  5DKR A;  4ORA B;  1MXL C;  1K96 A;  2LP2 A;  3O2P A;  4GAO A;  3FWC A;  1LA0 A;  1KWO C;  1S6J A;  2LMT A;  3NXA A;  1KK7 Y;  5IBW A;  2E30 A;  1SBJ A;  1IG5 A;  1KK8 C;  2I94 A;  2M7N A;  1Y1A A;  5CSJ A;  2CCM A;  1AJ4 A;  4I5N B;  3I5G B;  1NCY A;  2LHL A;  2Y4Q A;  1G33 A;  1N0Y A;  1EG3 A;  2M0R A;  1KK8 B;  5CSI A;  3K21 A;  5DKQ A;  1MF8 B;  1U5I A;  1QX5 B;  2F2O A;  2PAL A;  5HLO A;  3I5G C; 
#chains in the Genus database with same CATH topology
 1Y1X A;  3OP0 A;  3I5H C;  1IRJ A;  1JF2 A;  2LLS A;  3CZ1 A;  4JPZ B;  1F8H A;  2O5G A;  3VRO A;  3CWG A;  3TUY C;  5AFP A;  1YX8 A;  1XA5 A;  2QEB A;  4CPV A;  1B7T Z;  1U5I B;  4ETO A;  1CM1 A;  2LAP A;  3D0Y A;  3N7H A;  4YGE B;  3OGN A;  4YGB B;  4ZCU A;  1QVI Y;  3PJI A;  1W7J B;  1P28 A;  1A29 A;  2M7L A;  1YR5 A;  2JTT A;  2LVI A;  2FJY A;  2JT3 A;  3VGO A;  1MUX A;  3O4X A;  2CT9 A;  1DVI A;  2HQ8 A;  1G4Y R;  3FIA A;  1UHN A;  4DCK A;  5HL1 A;  2ZRT A;  3OHM B;  1J55 A;  3JTD C;  3BUO B;  2E6W A;  2M1U A;  4YRU A;  2LMU A;  2ZN8 A;  1QTX A;  3SIA A;  1RFJ A;  1OOF A;  5AAN A;  3WHU B;  1A75 A;  1TNW A;  3C1V A;  1PVA A;  3BJH A;  3ZWH A;  1QIV A;  3BUM B;  3KO0 A;  1CMG A;  1UHK A;  1QAS A;  3PAT A;  1F4Q A;  3S0B A;  1TNP A;  3LL8 B;  4C0K A;  1TUZ A;  2JPO A;  1HQV A;  1Y6W A;  3R1O A;  1CLB A;  2BBN A;  1GQM A;  1JFK A;  2HQW A;  2F33 A;  1NWD A;  1KFX L;  2CXJ A;  3BFB A;  3RLZ A;  1KSM A;  2OPO A;  1B8C A;  1FI6 A;  2LE9 B;  1Y0V H;  3FE6 A;  4INW A;  2WCE A;  5EL2 A;  2JT8 A;  1PVB A;  2KI4 B;  3TDU A;  1F71 A;  1WDC C;  3KEV A;  4C0L A;  4CFQ A;  2JXC A;  1HT9 A;  1UUR A;  2BE6 A;  1XFV O;  2LNK A;  3PFV A;  2FCE A;  4GFT A;  1KQM C;  1KQV A;  1RTP 1;  2H61 A;  4A4C A;  1WDC B;  4JKT A;  1TUJ A;  2BCA A;  4OVN F;  3BQ3 A;  4GUK A;  3NGV A;  2GV5 A;  2NLN A;  1K90 D;  3TS5 B;  1QV1 A;  3IF7 A;  1R2U A;  3EKJ A;  4PE0 A;  1SPY A;  1ORG A;  1OOI X;  2AAO A;  2ISD A;  2L51 A;  2PQL A;  3L4L A;  1L7Z A;  3AKB A;  3D10 A;  1SL7 A;  1OSA A;  1DC1 A;  1TRF A;  1AUI B;  2K2F A;  1SYM A;  1SW8 A;  2WOR A;  1KSO A;  2LHI A;  3RZS A;  1NIW A;  3V2L A;  3CDN A;  2MBX A;  2K0J A;  5I8N A;  2ZN9 A;  1X02 A;  1A2X A;  4ORB B;  1LXF C;  2G2B A;  2M8U A;  4GGN A;  1DQE A;  1YUT A;  4M2P A;  4P5O E;  1EJ3 A;  1JWD A;  1CLM A;  2PVB A;  2KPH A;  5HKZ A;  1NX0 A;  3VRP A;  2I18 A;  1YRT B;  2OTG B;  2BL0 C;  2LLU A;  2ZNE A;  4DUQ A;  1JFJ A;  1LVC D;  1FPW A;  2P71 A;  4R1E A;  4KYN A;  1LS8 A;  1WRL A;  1AVS A;  2KDH A;  2BL0 B;  2JUL A;  4PHM A;  3AAJ A;  2HPS A;  3GK2 A;  1K9P A;  3OBV A;  4MSP A;  1XFW O;  2Q91 A;  5FI6 A;  4BY4 A;  4HSZ A;  1RWY A;  5I2L A;  1QJT A;  1ALV A;  1PUL A;  3EKH A;  1CB1 A;  2JNF A;  2LC5 A;  1C3Z A;  2KI6 C;  1NP8 A;  3R1V A;  4JQ0 D;  1OMR A;  3B6X A;  1OZS A;  3CLN A;  4ZCV A;  1GGW A;  5F6T A;  4HRG A;  1EG4 A;  1IJ5 A;  1KFX S;  4N1G A;  3WXA A;  3F45 A;  5HLV A;  2P6B B;  5I2Q A;  2L4I A;  3LK1 A;  3NSO A;  4MN0 A;  2OS8 C;  1ZUZ A;  1CLL A;  3BFA A;  4WQ2 A;  1REC A;  2KI4 C;  4DIR A;  1A4P A;  1ODB A;  1BMO A;  2KGB C;  2JU0 A;  3BYA A;  1DGV A;  1FW4 A;  1SY9 A;  1S5G Z;  1S1E A;  3L4A A;  1GJY A;  4MBE A;  1R6P A;  2MAZ A;  1M46 A;  1QS7 A;  1V1F A;  2H2K A;  1RJV A;  2WCM A;  1DJW A;  1YVH A;  1LIN A;  1SCV A;  1Z4H A;  1IQ5 A;  4JWQ A;  2P70 A;  3BUW B;  1CTR A;  3KF9 A;  2M97 A;  1TIZ A;  1CFP A;  1J7R A;  3AAK A;  4P2Y B;  4HRE E;  1W9Z A;  4PT1 A;  2WC6 A;  1H4B A;  3CYZ A;  2KYC A;  1JF0 A;  1YVL A;  5ER4 X;  4MVF A;  1SCM C;  5KTY A;  4INX A;  1BLQ A;  1OOJ A;  2SAS A;  1SK6 D;  1KQM B;  2MJW B;  2PRU A;  4GBA A;  2WCH A;  3DF0 A;  3DXL A;  5AEQ A;  1SL8 A;  1YTZ C;  4XYN A;  1DEK A;  3LLE A;  2F3Y A;  2JC2 A;  4OKH A;  1NPQ A;  3O6B A;  1L2O B;  3PAL A;  1A75 B;  3SIB A;  3VRR A;  3PSR A;  2JNX A;  2LVV A;  1QXP A;  2FOT A;  1Z2C B;  2BCX A;  4QJ4 B;  1QV0 A;  2I7A A;  3B87 A;  3NSI A;  1L2O C;  1QX2 A;  1SNL A;  1QAT A;  1NCZ A;  1YUU A;  2G9B A;  3DY9 A;  4OCI A;  2QPT A;  3ZNI A;  1QLS A;  2KOT A;  1ALW A;  2M29 A;  5DKN A;  3EK7 A;  1BR4 B;  1FBV A;  4I5L B;  1MHO A;  1B8L A;  2KFF A;  4GGF A;  4CFR A;  1KK7 Z;  1NSH A;  4YI8 A;  1DF0 B;  1V1G A;  5I94 A;  3SS4 A;  1CFC A;  4M2Q A;  2JXL A;  1DT7 B;  2JTZ A;  3PLF B;  1XK4 A;  2WC8 A;  1QX7 A;  1QWV A;  1GGZ A;  4MZL A;  2K7O A;  4PE4 A;  3DVE A;  2K7B A;  4C0J A;  1IIO A;  4GPL B;  2L50 A;  1KFU L;  3CAB A;  4FTG A;  3SG6 A;  2QAC A;  2WND A;  2M1K B;  1C07 A;  2KI6 D;  3EVV A;  3NSK A;  3R72 A;  4FQO A;  1XFZ O;  2KGR A;  1NX1 A;  2M9G A;  1BOD A;  2MLE C;  4OZD A;  1SKT A;  3HX4 A;  3PN7 C;  2JPT A;  1BR1 B;  1Q80 A;  4YBH B;  4L9M A;  5D3O A;  1PRW A;  1AJ5 A;  2BBM A;  2LVJ A;  4PHN A;  2WCF A;  3HCM A;  3PN7 B;  2LMV A;  1M31 A;  3VRN A;  1WY9 A;  1F55 A;  5AER A;  2BKI B;  3RM1 A;  3SJS A;  1QIW A;  4WQ3 A;  1MWN A;  1AHR A;  1Y1U A;  2WOS A;  3D78 A;  2MLF C;  2H8V A;  2F3Z A;  2WCL A;  2EC6 B;  5JJG A;  1K94 A;  1OOG A;  2K7C A;  4N1F A;  2L98 A;  1SL9 A;  2JT0 A;  3VRQ A;  2GTE A;  3QME A;  3KHE A;  3I5H B;  2K60 A;  2OTG C;  5ER5 A;  1YUR A;  1WLZ A;  2F2P A;  3DVJ A;  1OE9 B;  1TCF A;  1C3Y A;  1BT6 A;  3I5F B;  1OMD A;  1SRA A;  3CR4 X;  2HET A;  2BEC A;  4E68 A;  2K8M B;  5CSN A;  4I5J A;  5DIC A;  3NSL A;  1CMF A;  3BUX B;  1DGU A;  2JOJ A;  1C7W A;  4MRY A;  2KFG A;  3I5F C;  2MA2 A;  1EL4 A;  1M45 A;  1SR6 B;  4OR9 B;  4GNK B;  4PCW A;  3SG4 A;  1XFY O;  1DF0 A;  2BKH B;  2VRG A;  4NDB A;  2KSP A;  3OX5 A;  2KAV A;  3MSE B;  1IWQ A;  2A4J A;  3KPX A;  4CID A;  3JTD B;  2F8P A;  3DVK A;  1DJI A;  1CNP A;  1NX2 A;  2KLD A;  1K9U A;  5HKY A;  5D69 A;  2RGI A;  2IS9 A;  1ZMZ A;  2KHN A;  5PAL A;  3O4Y A;  4GGF C;  5FI7 A;  2LLT A;  4Q04 A;  3DZT A;  4MZJ A;  4TNC A;  2KFH A;  4PDZ A;  5J3X A;  1XO5 A;  1CFF A;  1FI5 A;  3UNW A;  5HYD A;  1OW4 A;  1OQP A;  3A8R A;  1CM4 A;  3FE8 A;  1B1G A;  3ICB A;  2MHH A;  1G8I A;  2EHB A;  1UHI A;  1ZFS A;  3BOW A;  3M0W A;  4DS7 A;  1PK0 D;  1MQ1 A;  1XFX O;  1F4O A;  1N65 A;  1LA3 A;  1RK9 A;  3BOW B;  1KFU S;  3EG5 B;  4MZK A;  2BNX A;  3LK0 A;  1K9K A;  4MEW A;  2LP3 A;  3TDI A;  3D73 A;  3WNX B;  1CKK A;  3DYE A;  4N5X A;  3FE9 A;  1SMG A;  3S0A A;  1IGV A;  1MR8 A;  1NUB A;  1TCO B;  2AMI A;  4PE1 A;  2NXQ A;  3EVU A;  1QLK A;  1XVJ A;  3UO9 A;  2L0P A;  3DD4 A;  2KQY A;  2Y1M A;  2TN4 A;  2LCP A;  4DRW A;  4XJK B;  1ZOT B;  3D76 A;  1E8A A;  2HF5 A;  1LKJ A;  2L5X B;  1WLM A;  3OX6 A;  1H8B A;  4QJ5 B;  1J7Q A;  2PAS A;  1DEL A;  2COL B;  1SSE B;  3TDZ A;  1YUS A;  5B8I B;  1BU3 A;  2LUX A;  3CGA A;  2DOQ A;  1UHJ A;  1SR6 C;  4ORC B;  4PHJ A;  5G08 A;  3B7A A;  2Y1N A;  4YGD B;  2BAP A;  5K89 A;  3A4U B;  2L2C A;  4NDC A;  5TNC A;  2NZ0 A;  2V53 A;  4OV2 A;  2MRD A;  3SG5 A;  1QVI Z;  3DF0 B;  4NDD A;  1N2D A;  1JUO A;  2KNE A;  4QJ3 B;  3B86 A;  2KAX A;  3CR5 X;  2WCB A;  3D0Y B;  3GOF A;  3H4S E;  1IQ3 A;  1UUS A;  1DTL A;  2KLE A;  2ZKM X;  3JVT B;  2CBL A;  1B9A A;  3AKA A;  3SS5 A;  4YGA A;  2EGD A;  1A03 A;  1UWO A;  4MRX A;  2FCD A;  1RRO A;  5CSF A;  3CZT X;  2WCK A;  1TN4 A;  3PM8 A;  2QEO A;  3DVM A;  3IQQ A;  3NHT A;  1KWO B;  3I5I C;  4AQJ A;  2K61 A;  1IH0 A;  4XJK A;  1CDM A;  3GK1 A;  1C7V A;  2LAN A;  2JRF A;  2O60 A;  2PMY A;  3NHI A;  2ZND A;  1YRU B;  3CTN A;  5KU1 A;  2NCO A;  3EK4 A;  4AOM A;  1K8U A;  4YGC B;  2CNP A;  2KQ6 A;  4IL1 A;  1M63 B;  1S5G Y;  2L5Y A;  3TZ1 A;  3Q8I A;  5HKW A;  1F54 A;  1D1O A;  1TOP A;  4PE7 A;  1WRK A;  1OMV A;  1DJH A;  1AP4 A;  1J7P A;  4D1E A;  5BPJ A;  2GGM A;  1J1E A;  1WRZ A;  2L2E A;  2M3W A;  4WRI A;  1S3P A;  4PHK A;  2F2O A;  1BG1 A;  4JD9 A;  1DJX A;  1NCX A;  2KBM A;  3TUY B;  3BXK A;  2LUC A;  3CZ2 A;  3LCP C;  3EK8 A;  2ERB A;  1S6C A;  2D8N A;  1TNX A;  1SCM B;  2JZI A;  2SCP A;  2LM5 A;  2H61 C;  1IJ6 A;  3D74 A;  2ZFD A;  1BF5 A;  1FF1 A;  1CDN A;  2QEH A;  1J7O A;  4IJ7 A;  3D75 A;  3IVT A;  5GQQ C;  2Y5I A;  2EC6 C;  4I5K A;  5D7F A;  3FS7 A;  3O78 A;  3D77 A;  3S0E A;  4U8D A;  1PAL A;  3IQO A;  4M2O A;  1AK8 A;  1BJF A;  4AQI A;  1J1D A;  4CLN A;  3QRX A;  3K1E A;  4BY5 A;  1JSA A;  3FWB A;  1B7T Y;  1S26 D;  3SG2 A;  1W7I B;  2BE4 A;  1OZO A;  2KBI A;  1OOH A;  4ICB A;  2PSR A;  5CPV A;  4USL A;  4A4B A;  1TWO A;  1M39 A;  1CDL A;  3BUN B;  3GK4 X;  1MXE A;  1UP5 A;  2I2R E;  1TTX A;  2Q4U A;  3OB2 B;  4F0Z B;  1BOC A;  1K95 A;  1JC2 A;  1S6I A;  5JOL A;  1B8R A;  2M49 B;  1B47 A;  3R1P A;  3CR2 A;  1DJY A;  2JWW A;  2K2A A;  5I2O A;  2YGU A;  1NYA A;  2FJU B;  2WC5 A;  1IKU A;  1GM0 A;  4FQT A;  2B1U A;  1CFD A;  3CS1 A;  5FYX A;  1JBA A;  1TNQ A;  3S0D A;  2AUC A;  3S0G A;  1XK4 C;  3B88 A;  5FI2 A;  1KCY A;  4HRH A;  3SG3 A;  2K7D A;  2GGZ A;  2KYF A;  3BFH A;  1EH2 A;  3OB1 B;  1K2H A;  4UPG A;  1CDP A;  3L47 A;  1EXR A;  2PYQ A;  1DJG A;  1ZAC A;  2LV7 A;  1XFU O;  2CTN A;  1PSR A;  2OS8 B;  3EVR A;  1F70 A;  3I5I B;  1XFR A;  2JQ6 A;  2LVK A;  3E3R A;  1PSB A;  2NCP A;  2ZRS A;  1VRK A;  4F7F A;  2QDI A;  2R2I A;  3VB1 A;  4PAL A;  4NQG A;  4YI9 A;  1UHH A;  3TS5 C;  3WHT B;  1DMO A;  3JVT C;  3S0F A;  3SG7 A;  1DJZ A;  1S36 A;  2BCB A;  2QEV A;  4MLW A;  1NX3 A;  1YX7 A;  1K93 D;  1B4C A;  2KAY A;  2L4H A;  5AXI A;  5KSZ A;  5DKR A;  4ORA B;  1MXL C;  1K96 A;  2LP2 A;  3O2P A;  4GAO A;  3FWC A;  1LA0 A;  3PM2 A;  1KWO C;  1S6J A;  2LMT A;  2WCJ A;  3NXA A;  1KK7 Y;  5IBW A;  2E30 A;  1SBJ A;  1IG5 A;  1KK8 C;  2I94 A;  2M7N A;  1Y1A A;  5CSJ A;  2CCM A;  1AJ4 A;  4I5N B;  1T14 A;  3I5G B;  1NCY A;  2LHL A;  2Y4Q A;  1G33 A;  1N0Y A;  3SS3 A;  1EG3 A;  2M0R A;  1KK8 B;  5CSI A;  3K21 A;  5DKQ A;  1MF8 B;  1U5I A;  1QX5 B;  1XYD A;  2PAL A;  5HLO A;  3I5G C;  3CZ0 A; 
#chains in the Genus database with same CATH homology
 1Y1X A;  3OP0 A;  3I5H C;  1IRJ A;  1JF2 A;  2LLS A;  1F8H A;  4JPZ B;  2O5G A;  3VRO A;  3CWG A;  3TUY C;  5AFP A;  1YX8 A;  1XA5 A;  4CPV A;  1B7T Z;  1U5I B;  4ETO A;  1CM1 A;  2LAP A;  3D0Y A;  4YGE B;  4YGB B;  4ZCU A;  1QVI Y;  1W7J B;  1A29 A;  2M7L A;  1YR5 A;  2JTT A;  2LVI A;  3VGO A;  2JT3 A;  1MUX A;  2CT9 A;  1DVI A;  2HQ8 A;  1G4Y R;  3FIA A;  1UHN A;  4DCK A;  2ZRT A;  3OHM B;  1J55 A;  3JTD C;  3BUO B;  2E6W A;  2M1U A;  4YRU A;  2LMU A;  2ZN8 A;  1QTX A;  3SIA A;  1RFJ A;  5AAN A;  3ZWH A;  3WHU B;  1A75 A;  1TNW A;  3C1V A;  1PVA A;  5HKY A;  1QIV A;  3BUM B;  3KO0 A;  1CMG A;  1UHK A;  1QAS A;  3PAT A;  1F4Q A;  4C0K A;  1TNP A;  3LL8 B;  1HQV A;  1Y6W A;  1CLB A;  2BBN A;  1GQM A;  1JFK A;  2HQW A;  2F33 A;  1NWD A;  1KFX L;  2CXJ A;  3RLZ A;  1KSM A;  2OPO A;  1B8C A;  1FI6 A;  2LE9 B;  1Y0V H;  2WCE A;  2JT8 A;  1PVB A;  2KI4 B;  3TDU A;  1F71 A;  1WDC C;  3KEV A;  4C0L A;  4CFQ A;  2JXC A;  1HT9 A;  1UUR A;  2BE6 A;  1XFV O;  2LNK A;  3PFV A;  2FCE A;  4GFT A;  1KQM C;  1KQV A;  1RTP 1;  2H61 A;  4A4C A;  1WDC B;  2BCA A;  4OVN F;  3BQ3 A;  4GUK A;  2GV5 A;  2NLN A;  1K90 D;  3TS5 B;  1QV1 A;  3IF7 A;  1R2U A;  3EKJ A;  4PE0 A;  1SPY A;  2ISD A;  2AAO A;  4DS7 A;  2L51 A;  1L7Z A;  3AKB A;  3D10 A;  1SL7 A;  1OSA A;  1TRF A;  1AUI B;  2K2F A;  1SYM A;  1SW8 A;  2WOR A;  1KSO A;  2LHI A;  1NIW A;  2MBX A;  2K0J A;  5I8N A;  2ZN9 A;  1X02 A;  1A2X A;  4ORB B;  1LXF C;  2G2B A;  2M8U A;  4GGN A;  1YUT A;  4M2P A;  4P5O E;  1EJ3 A;  1JWD A;  1CLM A;  2PVB A;  5HKZ A;  1NX0 A;  3VRP A;  2I18 A;  1YRT B;  2OTG B;  2BL0 C;  2LLU A;  2ZNE A;  4DUQ A;  1LVC D;  1FPW A;  4R1E A;  1WRL A;  1AVS A;  2KDH A;  2BL0 B;  2JUL A;  4PHM A;  3AAJ A;  2HPS A;  3GK2 A;  1K9P A;  4MSP A;  1XFW O;  2Q91 A;  4BY4 A;  4HSZ A;  1RWY A;  5I2L A;  1QJT A;  1ALV A;  1PUL A;  3EKH A;  1CB1 A;  2JNF A;  2LC5 A;  2KI6 C;  1NP8 A;  4JQ0 D;  1OMR A;  1OZS A;  3CLN A;  4ZCV A;  1GGW A;  5F6T A;  4HRG A;  1EG4 A;  1IJ5 A;  1KFX S;  4N1G A;  3WXA A;  3F45 A;  5HLV A;  2P6B B;  5I2Q A;  2L4I A;  3LK1 A;  3NSO A;  4MN0 A;  2OS8 C;  1ZUZ A;  1CLL A;  4WQ2 A;  1REC A;  2KI4 C;  4DIR A;  1A4P A;  1ODB A;  1BMO A;  2KGB C;  2JU0 A;  3BYA A;  1DGV A;  1FW4 A;  1SY9 A;  1S5G Z;  1S1E A;  4MBE A;  1GJY A;  3VRN A;  1R6P A;  2MAZ A;  2H2K A;  1M46 A;  1QS7 A;  1V1F A;  1RJV A;  1DJW A;  1YVH A;  1LIN A;  1SCV A;  1IQ5 A;  4JWQ A;  3BUW B;  1CTR A;  3KF9 A;  2M97 A;  1TIZ A;  1CFP A;  1J7R A;  3AAK A;  4P2Y B;  4HRE E;  1H4B A;  1XYD A;  2KYC A;  1JF0 A;  1YVL A;  5ER4 X;  4MVF A;  1SCM C;  5KTY A;  1BLQ A;  1OOJ A;  2SAS A;  1SK6 D;  1KQM B;  2MJW B;  2PRU A;  4GBA A;  3DF0 A;  5AEQ A;  1SL8 A;  1YTZ C;  4XYN A;  3LLE A;  2F3Y A;  2JC2 A;  4OKH A;  1NPQ A;  3O6B A;  1L2O B;  3PAL A;  1A75 B;  3SIB A;  3VRR A;  3PSR A;  2JNX A;  2LVV A;  1QXP A;  2FOT A;  2BCX A;  4QJ4 B;  1QV0 A;  2I7A A;  3NSI A;  1L2O C;  1QX2 A;  1SNL A;  1QAT A;  1NCZ A;  1YUU A;  2G9B A;  4OCI A;  2QPT A;  3ZNI A;  1QLS A;  2KOT A;  1ALW A;  2M29 A;  5DKN A;  3EK7 A;  1BR4 B;  1FBV A;  4I5L B;  1MHO A;  1B8L A;  2KFF A;  4GGF A;  4CFR A;  1KK7 Z;  1NSH A;  4YI8 A;  1DF0 B;  1V1G A;  1CFC A;  4M2Q A;  2JXL A;  1DT7 B;  2JTZ A;  3PLF B;  1XK4 A;  2WC8 A;  1QX7 A;  4MZL A;  1GGZ A;  4PE4 A;  2K7O A;  1JFJ A;  3DVE A;  2K7B A;  4C0J A;  4GPL B;  2L50 A;  1KFU L;  4FTG A;  3SG6 A;  2QAC A;  2WND A;  2M1K B;  1C07 A;  2KI6 D;  3EVV A;  3NSK A;  4FQO A;  1XFZ O;  2KGR A;  1NX1 A;  2M9G A;  1BOD A;  2MLE C;  1SKT A;  3HX4 A;  3PN7 C;  2JPT A;  1BR1 B;  1Q80 A;  4YBH B;  4L9M A;  1PRW A;  1AJ5 A;  2BBM A;  2LVJ A;  4PHN A;  2WCF A;  3HCM A;  3PN7 B;  2LMV A;  1M31 A;  1WY9 A;  1F55 A;  5AER A;  2BKI B;  3RM1 A;  3SJS A;  1QIW A;  4WQ3 A;  1MWN A;  1AHR A;  1Y1U A;  2WOS A;  2MLF C;  2F3Z A;  2EC6 B;  5JJG A;  1K94 A;  4N1F A;  2K7C A;  2L98 A;  1SL9 A;  2JT0 A;  3VRQ A;  3KHE A;  3I5H B;  2OTG C;  5ER5 A;  1YUR A;  1WLZ A;  2F2P A;  3DVJ A;  1OE9 B;  1TCF A;  1BT6 A;  3I5F B;  1OMD A;  1SRA A;  3CR4 X;  2HET A;  2BEC A;  4E68 A;  2K8M B;  5CSN A;  4I5J A;  3NSL A;  1CMF A;  3BUX B;  1DGU A;  2JOJ A;  1C7W A;  4MRY A;  2KFG A;  3I5F C;  2MA2 A;  1EL4 A;  1M45 A;  1SR6 B;  4OR9 B;  4GNK B;  4PCW A;  3SG4 A;  1XFY O;  1DF0 A;  2BKH B;  2VRG A;  4NDB A;  2KSP A;  3OX5 A;  2KAV A;  3MSE B;  1IWQ A;  2A4J A;  3KPX A;  4CID A;  3JTD B;  2F8P A;  3DVK A;  1DJI A;  1CNP A;  1NX2 A;  1K9U A;  5D69 A;  2RGI A;  2IS9 A;  1ZMZ A;  2KHN A;  5PAL A;  3O4Y A;  4GGF C;  2LLT A;  4Q04 A;  4TNC A;  4MZJ A;  5J3X A;  2KFH A;  4PDZ A;  1CFF A;  1XO5 A;  1FI5 A;  5HYD A;  1OQP A;  3A8R A;  1CM4 A;  1B1G A;  3ICB A;  2MHH A;  1G8I A;  2EHB A;  1UHI A;  1ZFS A;  3BOW A;  3M0W A;  1PK0 D;  1MQ1 A;  1XFX O;  1F4O A;  1N65 A;  1LA3 A;  1RK9 A;  3BOW B;  1KFU S;  4MZK A;  3LK0 A;  1K9K A;  4MEW A;  2LP3 A;  3TDI A;  3WNX B;  1CKK A;  4N5X A;  1SMG A;  1IGV A;  1MR8 A;  1NUB A;  1TCO B;  2AMI A;  4PE1 A;  2NXQ A;  3EVU A;  1QLK A;  1XVJ A;  2L0P A;  3DD4 A;  2KQY A;  2Y1M A;  2TN4 A;  2LCP A;  4DRW A;  4XJK B;  1ZOT B;  1E8A A;  2HF5 A;  1LKJ A;  2L5X B;  1WLM A;  3OX6 A;  1H8B A;  4QJ5 B;  1J7Q A;  2PAS A;  2COL B;  3TDZ A;  1YUS A;  5B8I B;  1BU3 A;  2LUX A;  3CGA A;  2DOQ A;  1UHJ A;  1SR6 C;  4ORC B;  4PHJ A;  5G08 A;  2Y1N A;  4YGD B;  5K89 A;  3A4U B;  4NDC A;  5TNC A;  2NZ0 A;  2V53 A;  4OV2 A;  2MRD A;  3SG5 A;  1QVI Z;  3DF0 B;  4NDD A;  1N2D A;  1JUO A;  2KNE A;  4QJ3 B;  2KAX A;  3CR5 X;  2WCB A;  3D0Y B;  3GOF A;  3H4S E;  1IQ3 A;  1UUS A;  1DTL A;  2ZKM X;  3JVT B;  2CBL A;  1B9A A;  3AKA A;  4YGA A;  2EGD A;  1A03 A;  1UWO A;  4MRX A;  2FCD A;  1RRO A;  5CSF A;  3CZT X;  3PM8 A;  1TN4 A;  3DVM A;  3IQQ A;  1KWO B;  3I5I C;  4AQJ A;  2K61 A;  1IH0 A;  4XJK A;  1CDM A;  3GK1 A;  1C7V A;  2LAN A;  2JRF A;  2O60 A;  2PMY A;  2ZND A;  1YRU B;  3CTN A;  5KU1 A;  2NCO A;  3EK4 A;  4AOM A;  1K8U A;  4YGC B;  2CNP A;  2KQ6 A;  4IL1 A;  1M63 B;  1S5G Y;  3TZ1 A;  5HKW A;  1F54 A;  1D1O A;  1TOP A;  4PE7 A;  1WRK A;  1OMV A;  1DJH A;  1AP4 A;  1J7P A;  4D1E A;  5BPJ A;  2GGM A;  1J1E A;  1WRZ A;  2L2E A;  2M3W A;  4WRI A;  1S3P A;  4PHK A;  1BG1 A;  1DJX A;  1NCX A;  2KBM A;  3TUY B;  3BXK A;  2LUC A;  3LCP C;  3EK8 A;  1S6C A;  2D8N A;  1TNX A;  1SCM B;  2JZI A;  2SCP A;  2LM5 A;  2H61 C;  1IJ6 A;  1FF1 A;  2ZFD A;  1BF5 A;  1CDN A;  1J7O A;  5GQQ C;  2Y5I A;  2EC6 C;  4I5K A;  5D7F A;  3FS7 A;  3O78 A;  1AK8 A;  4U8D A;  1PAL A;  3IQO A;  4M2O A;  1BJF A;  4AQI A;  1J1D A;  4CLN A;  3QRX A;  4BY5 A;  1JSA A;  3FWB A;  1B7T Y;  1S26 D;  3SG2 A;  1W7I B;  2BE4 A;  1OZO A;  2KBI A;  4ICB A;  5CPV A;  2PSR A;  4USL A;  4A4B A;  1M39 A;  1CDL A;  3BUN B;  3GK4 X;  1MXE A;  1UP5 A;  2I2R E;  1TTX A;  2Q4U A;  3OB2 B;  4F0Z B;  1BOC A;  1K95 A;  1JC2 A;  1S6I A;  5JOL A;  1B8R A;  2M49 B;  1B47 A;  3CR2 A;  1DJY A;  2JWW A;  2K2A A;  5I2O A;  1NYA A;  2FJU B;  1IKU A;  2B1U A;  1CFD A;  3CS1 A;  5FYX A;  1JBA A;  1TNQ A;  2AUC A;  1KCY A;  1XK4 C;  4HRH A;  3SG3 A;  2K7D A;  2GGZ A;  2KYF A;  1EH2 A;  3OB1 B;  1K2H A;  4UPG A;  1CDP A;  1EXR A;  1DJG A;  1ZAC A;  2LV7 A;  1XFU O;  2CTN A;  1PSR A;  2OS8 B;  3EVR A;  1F70 A;  3I5I B;  2JQ6 A;  2LVK A;  3E3R A;  1PSB A;  2NCP A;  2ZRS A;  1VRK A;  2R2I A;  4PAL A;  4NQG A;  4YI9 A;  1UHH A;  3TS5 C;  3WHT B;  1DMO A;  3JVT C;  3SG7 A;  1DJZ A;  1S36 A;  2BCB A;  4MLW A;  1NX3 A;  1YX7 A;  1K93 D;  1B4C A;  2KAY A;  2L4H A;  5AXI A;  5KSZ A;  5DKR A;  4ORA B;  1MXL C;  1K96 A;  2LP2 A;  3O2P A;  4GAO A;  3FWC A;  1LA0 A;  1KWO C;  1S6J A;  2LMT A;  3NXA A;  1KK7 Y;  5IBW A;  2E30 A;  1SBJ A;  1IG5 A;  1KK8 C;  2I94 A;  2M7N A;  1Y1A A;  5CSJ A;  2CCM A;  1AJ4 A;  4I5N B;  3I5G B;  1NCY A;  2LHL A;  2Y4Q A;  1G33 A;  1N0Y A;  1EG3 A;  2M0R A;  1KK8 B;  5CSI A;  3K21 A;  5DKQ A;  1MF8 B;  1U5I A;  1QX5 B;  2F2O A;  2PAL A;  5HLO A;  3I5G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...