1JFJA

Nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords CALCIUM-BINDING PROTEIN
publication title NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 37
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jfjA02
3PALA 1BOCA 2FJUB 3BOWB 4ZCUA 4PHNA 1TIZA 3I5FC 5I8NA 4YBHB 1ZUZA 3VRQA 5IBWA 5KTYA 1DTLA 1K9UA 2MBXA 4A4BA 4YI9A 3MSEB 2MRDA 5D7FA 1J7QA 1YX8A 4E68A 4ICBA 4U8DA 1A29A 1K96A 2KQ6A 3EKHA 1BG1A 1DMOA 1A4PA 1R6PA 1KK8C 3PN7C 1DF0B 5I2LA 1F4QA 1QS7A 5CSNA 1G4YR 1LINA 4M2PA 4PHJA 2VRGA 2KSPA 4XYNA 1IJ6A 2PVBA 1TCOB 1H4BA 5CPVA 2LP3A 1ODBA 1JWDA 1UURA 2K8MB 4F0ZB 3RM1A 1NUBA 1IQ5A 1KFXS 1WRZA 4HRGA 2ZNEA 1KK7Z 1DF0A 2M8UA 1SMGA 2R2IA 2KAYA 4MBEA 4ETOA 1WRKA 2KBIA 1CLMA 4BY4A 2LNKA 1IGVA 2IS9A 1D1OA 2E30A 1PK0D 4QJ5B 2JULA 3EVRA 3A8RA 1QX2A 1KQMC 1SRAA 2V53A 4A4CA 1SCMC 2ZN9A 1XFZO 4JQ0D 5J3XA 1NPQA 2G2BA 1G8IA 3FIAA 1NP8A 4P5OE 2LAPA 1BLQA 1WLZA 1LKJA 1FI6A 1UP5A 3NSIA 1SBJA 3TUYC 4NQGA 1S6CA 1XO5A 2JC2A 3OX5A 1QV0A 2WOSA 2COLB 4FTGA 5DKNA 1JSAA 1NSHA 2JXLA 3EVVA 1W7JB 4PHMA 4MSPA 1SKTA 1TOPA 2Q91A 1DJXA 2FCEA 4GGFC 2BCBA 4MRYA 2I94A 1IJ5A 1S36A 2CT9A 1AHRA 1OZSA 1Y1XA 1UUSA 1YTZC 4HSZA 5HLVA 1S5GZ 1K8UA 1MXLC 2JRFA 4M2OA 2MHHA 1S6JA 3IF7A 3FS7A 1SR6B 1PULA 1KSOA 2KOTA 1IG5A 1FBVA 4OV2A 4NDCA 3SIAA 2KYFA 1ZMZA 4NDDA 5JOLA 3C1VA 2MLFC 1EXRA 4PE0A 3VRRA 3I5HC 3EVUA 2ZRSA 3GK4X 1XFVO 1PALA 1Y1AA 2I7AA 2JXCA 5AXIA 3WXAA 1JBAA 2K2AA 3ZWHA 5HKZA 2LVJA 3ZNIA 5HKYA 1M31A 1B47A 4AQIA 1SYMA 2HETA 1LXFC 3EK4A 4OR9B 2BBNA 3CR2A 1TRFA 1DJIA 3VRPA 1AP4A 3F45A 2BL0C 1OQPA 4N5XA 2PALA 1OMDA 1PVAA 3JTDC 2F3YA 1OZOA 1TNXA 2MJWB 2TN4A 1CFFA 2BKIB 5KSZA 3HCMA 2KFFA 2ZNDA 2BE6A 2E6WA 1PVBA 3KPXA 3BUXB 1LA0A 3O78A 5GQQC 2KI4C 4FQOA 3EK7A 4JWQA 4AOMA 4DS7A 1KFXL 1J1EA 3OB2B 1WY9A 1YVHA 1CKKA 1SPYA 2F2PA 3OX6A 4P2YB 1QX5B 1S1EA 2CBLA 1F55A 2NZ0A 3RLZA 1B8LA 3PATA 5I2QA 1Y6WA 4NDBA 2L50A 1N0YA 1V1GA 2FCDA 3HX4A 3SG3A 1EJ3A 2Q4UA 3AAKA 1CFDA 4PE7A 2OS8B 4C0LA 2KBMA 2M7NA 1DJWA 4MRXA 4WRIA 4I5KA 2O5GA 2OPOA 1B4CA 2LVVA 4MVFA 1NCYA 4YGEB 1MQ1A 1SL8A 3O6BA 4PALA 1J1DA 1L2OB 5I2OA 3NSLA 2LLTA 4OKHA 4CFQA 2H2KA 4GUKA 3O4YA 2L2EA 1QASA 1R2UA 2ZN8A 3BOWA 2ISDA 2KFHA 5CSJA 1OSAA 4DRWA 1K94A 2M3WA 2AAOA 3BUOB 4GFTA 1CFPA 1BMOA 1YUUA 1AUIB 1OE9B 4AQJA 1M39A 1BJFA 4USLA 1QLKA 2F2OA 3WHTB 1RECA 2WCEA 3BYAA 3GK1A 1SNLA 1QV1A 4CPVA 2BCAA 1OOJA 1NX0A 1B7TZ 1QJTA 1C07A 4CIDA 4UPGA 1CMFA 2JTTA 3TDZA 1OMRA 3DVMA 2L98A 2LUXA 2WORA 1PRWA 3CGAA 2KGBC 1ALWA 1M63B 2MA2A 1XFYO 4PHKA 4C0JA 5F6TA 1DJYA 4I5NB 3VGOA 1GGZA 2ZRTA 1S26D 2LHLA 1IQ3A 2L51A 1IRJA 2SASA 2MAZA 3CS1A 2FOTA 2CTNA 2K7BA 1QATA 3DD4A 1CLBA 2M1UA 1YVLA 3DVEA 3GOFA 3PLFB 1BR4B 3EK8A 1YUSA 2K7DA 1MF8B 4DIRA 1MWNA 1RWYA 3BUNB 2BKHB 1QIVA 1SR6C 1ALVA 1B8RA 1XFWO 4ORBB 4CLNA 3TZ1A 5B8IB 2KDHA 1RFJA 1TNQA 1AK8A 1LVCD 4R1EA 2LE9B 1QVIZ 1B9AA 1EG4A 2ZKMX 5DKQA 2PASA 3AAJA 1YUTA 1FW4A 3IQOA 3LLEA 1K9PA 4PE1A 1FF1A 2I2RE 1K93D 1YX7A 1L7ZA 1XYDA 2RGIA 2BCXA 3SG7A 3SJSA 1EG3A 4DCKA 1F70A 4D1EA 1YRUB 5PALA 1NX2A 3SG5A 1JFKA 2KHNA 2NCPA 3SIBA 4YGAA 4ZCVA 5JJGA 3SG2A 2F8PA 4I5JA 1CB1A 1LA3A 2KAVA 1W7IB 1CDNA 3BUMB 1YR5A 2F3ZA 3CLNA 3K21A 4Q04A 1F8HA 1WLMA 3KF9A 3DF0B 1DT7B 2JNFA 4OVNF 1N65A 1RROA 3E3RA 3WHUB 4PE4A 3LL8B 4MLWA 1K2HA 2H61A 1QTXA 2JNXA 2KAXA 3I5IB 1S6IA 2K7OA 5CSFA 3TDUA 1SK6D 2LCPA 4C0KA 1VRKA 2HQWA 1GJYA 1F4OA 1K9KA 1DJGA 1GGWA 3DF0A 2MLEC 1JF2A 1EL4A 1QLSA 2F33A 5HKWA 1E8AA 3H4SE 1KQVA 1HT9A 1ZACA 2CNPA 4WQ3A 1KWOB 2M0RA 2OS8C 2I18A 3TS5B 4CFRA 4GAOA 1RJVA 2D8NA 1CDMA 3ICBA 4HREE 2LLSA 2AMIA 4MZKA 2EC6B 2OTGB 3KO0A 2LV7A 2M7LA 3DVJA 1KSMA 3AKBA 1BR1B 5AEQA 3BUWB 4MZJA 1A75B 1H8BA 3PM8A 1K90D 3TDIA 4ORCB 1V1FA 5TNCA 3FWCA 5HYDA 1L2OC 2M9GA 2KI6C 1AJ4A 3CR4X 1MXEA 1NX1A 1KK7Y 2Y1NA 1WRLA 3JVTB 3I5GB 1BU3A 2JT8A 2KNEA 2AUCA 2PMYA 1A75A 1XFXO 1QX7A 2GV5A 2JU0A 5ER5A 1A2XA 3FWBA 4TNCA 2JOJA 4HRHA 3JTDB 1KFUS 1UHKA 1U5IB 1UWOA 2EGDA 2G9BA 2NLNA 2CCMA 1AJ5A 1WDCB 3O2PA 1XFUO 1YURA 2KFGA 1FI5A 1IWQA 2PSRA 1RTP1 2LM5A 1XK4A 1M45A 2L5XB 2NCOA 4ORAB 5AANA 4WQ2A 4N1FA 1CTRA 1QIWA 4BY5A 1F71A 1TNWA 5AFPA 2HF5A 1B8CA 3NSOA 1CLLA 5DKRA 1RK9A 2L4HA 4MZLA 3KHEA 4JPZB 1QVIY 2KYCA 1Q80A 1TNPA 1UHHA 1NYAA 2Y1MA 3VROA 5KU1A 3LCPC 1S5GY 3CTNA 1FPWA 3CZTX 3EKJA 3PSRA 2M97A 1Y0VH 1AVSA 3I5FB 1S3PA 5HLOA 2LHIA 2HPSA 5D69A 2JTZA 2K7CA 1MR8A 4PDZA 1CDPA 2JT0A 2LMVA 3PFVA 1KK8B 3GK2A 3PN7B 3NXAA 1J7RA 1PSRA 4GPLB 2CXJA 1CM4A 2EHBA 3OHMB 1SW8A 2O60A 1A03A 1EH2A 1SL7A 1YRTB 2L4IA 1XVJA 2LP2A 4M2QA 1ZFSA 2H61C 1K95A 4YGDB 2LANA 1DGUA 2LUCA 4QJ4B 2K61A 2SCPA 2LMTA 4YGBB 4IL1A 3BQ3A 3SG6A 1J55A 3BXKA 1ZOTB 2Y5IA 3LK0A 1SCVA 2JT3A 1TCFA 2JWWA 1C7VA 3M0WA 1DJZA 1PSBA 3I5IC 1KQMB 2WCBA 1DVIA 1SCMB 2ZFDA 4YGCB 1CMGA 3AKAA 1C7WA 1DJHA 1G33A 2GGZA 2JQ6A 1J7PA 3D10A 1CDLA 1JFJA 1KFUL 4MN0A 3TUYB 2M49B 1KWOC 3KEVA 3TS5C 5BPJA 2JZIA 1NCXA 2EC6C 1KCYA 1IH0A 2B1UA 2OTGC 2M29A 4OCIA 1OMVA 2WNDA 3DVKA 3D0YB 1MHOA 5FYXA 2A4JA 1CM1A 4L9MA 4DUQA 3SG4A 2PRUA 4GNKB 2LC5A 1DGVA 1CFCA 1Y1UA 3JVTC 1HQVA 2K0JA 3D0YA 4QJ3B 2KGRA 3I5GC 1SL9A 2JPTA 1MUXA 5CSIA 1J7OA 4GGFA 1NIWA 2WCFA 2LMUA 1XK4C 2LVIA 3LK1A 4GGNA 1JC2A 5G08A 1NWDA 1NX3A 1F54A 3I5HB 1UHJA 3VRNA 2BECA 2KI6D 3A4UB 2K2FA 2Y4QA 1B7TY 1WDCC 5ER4X 3OP0A 1TTXA 2DOQA 3WNXB 1JF0A 1IKUA 5K89A 2LVKA 4N1GA 1CNPA 3NSKA 2BL0B 2GGMA 4XJKB 1JUOA 2L0PA 4YI8A 1NCZA 1GQMA 1TN4A 1XA5A 2BE4A 2M1KB 4PCWA 2QACA 1M46A 2BBMA 2LLUA 3IQQA 1UHNA 3QRXA 3CR5X 4GBAA 1N2DA 4YRUA 1BT6A 2KQYA 2HQ8A 4XJKA 3OB1B 1UHIA 4I5LB 1BODA 2WC8A 2KI4B 1QXPA 2QPTA 3CWGA 1B1GA 1U5IA 4MEWA 1X02A 1SY9A 2NXQA 1BF5A 2P6BB 5AERA
chains in the Genus database with same CATH superfamily
3PALA 1BOCA 2FJUB 3BOWB 4ZCUA 4PHNA 2QEBA 1TIZA 3I5FC 5I8NA 4YBHB 1ZUZA 3VRQA 5IBWA 5KTYA 1DTLA 1K9UA 2MBXA 5DICA 4A4BA 4YI9A 3MSEB 2MRDA 5D7FA 1J7QA 1YX8A 4E68A 4ICBA 4U8DA 1A29A 1K96A 2KQ6A 3EKHA 1BG1A 1DMOA 3R72A 1A4PA 1R6PA 5I94A 1KK8C 3PN7C 1DF0B 5I2LA 1F4QA 1QS7A 5CSNA 2WC5A 2P71A 1G4YR 1LINA 4M2PA 4PHJA 2VRGA 2KSPA 4XYNA 1IJ6A 2PVBA 1TCOB 1H4BA 5CPVA 2LP3A 1ODBA 2KLEA 1UURA 2K8MB 4F0ZB 1JWDA 3RM1A 1NUBA 1IQ5A 1KFXS 1WRZA 4HRGA 2ZNEA 1KK7Z 1DF0A 2M8UA 3D78A 1SMGA 2R2IA 2KAYA 4MBEA 4ETOA 1WRKA 2KBIA 1CLMA 4BY4A 2LNKA 1IGVA 2IS9A 1D1OA 2WCJA 2E30A 1PK0D 4QJ5B 2JULA 3S0EA 3EVRA 1DELA 3A8RA 1QX2A 1KQMC 1SRAA 2V53A 4A4CA 1SCMC 2ZN9A 1XFZO 4JQ0D 5J3XA 1NPQA 2G2BA 1G8IA 3FIAA 1NP8A 3NHTA 4P5OE 2LAPA 1BLQA 1WLZA 1LKJA 1FI6A 1UP5A 3NSIA 1SBJA 3TUYC 4NQGA 1S6CA 1XO5A 2JC2A 3OX5A 1QV0A 4IJ7A 1DC1A 2WOSA 2COLB 4FTGA 5DKNA 1JSAA 3FE6A 5FI7A 1NSHA 2JXLA 3EVVA 1W7JB 4PHMA 4MSPA 1SKTA 1TOPA 2Q91A 1DJXA 2FCEA 4GGFC 2BCBA 4MRYA 2I94A 1IJ5A 1S36A 2CT9A 1AHRA 1OZSA 1Y1XA 1UUSA 1YTZC 3CZ0A 4HSZA 4JKTA 5HLVA 1S5GZ 1K8UA 1MXLC 2JRFA 4M2OA 2MHHA 1S6JA 3IF7A 3FS7A 1SR6B 1PULA 1KSOA 2KOTA 1IG5A 1FBVA 4OV2A 4NDCA 1Z2CB 3SIAA 2KYFA 1ZMZA 4NDDA 5JOLA 3C1VA 2MLFC 3FE9A 1EXRA 4PE0A 3VRRA 3I5HC 2WC6A 3EVUA 2ZRSA 3GK4X 2BNXA 1XFVO 1PALA 1Y1AA 2I7AA 2JXCA 5AXIA 3WXAA 1JBAA 4INXA 2K2AA 1OOHA 3BJHA 5HKZA 2LVJA 3ZNIA 3ZWHA 1M31A 1B47A 4AQIA 1SYMA 2HETA 1LXFC 3EK4A 4OR9B 2BBNA 3CR2A 1TRFA 1DJIA 3VRPA 1AP4A 3F45A 2BL0C 1OQPA 4N5XA 2PALA 1OMDA 1PVAA 3JTDC 2F3YA 1OZOA 2WCLA 1TNXA 2MJWB 2TN4A 3PM2A 1CFFA 2BKIB 5KSZA 3HCMA 2KFFA 2ZNDA 2BE6A 2E6WA 1PVBA 3CZ2A 3KPXA 3BUXB 1LA0A 1OOFA 3O78A 5GQQC 2KI4C 4FQOA 3EK7A 3BFHA 4JWQA 4AOMA 4DS7A 1KFXL 1J1EA 3OB2B 1WY9A 1YVHA 1CKKA 1SPYA 2F2PA 3OX6A 4P2YB 1QX5B 1S1EA 2CBLA 1F55A 2NZ0A 3RLZA 1B8LA 3D77A 3QMEA 3PATA 5I2QA 1Y6WA 4NDBA 2L50A 1N0YA 1V1GA 2FCDA 3HX4A 3SG3A 3V2LA 1EJ3A 2Q4UA 3AAKA 1CFDA 4PE7A 2OS8B 4C0LA 2KBMA 2M7NA 1DJWA 4MRXA 3SS5A 4WRIA 3B87A 4I5KA 2O5GA 2OPOA 3S0BA 3DZTA 1B4CA 2LVVA 4MVFA 3L4LA 1NCYA 4YGEB 1MQ1A 1SL8A 3O6BA 4PALA 1J1DA 1L2OB 5I2OA 3NSLA 2LLTA 4OKHA 4CFQA 1OOGA 2H2KA 4GUKA 3O4YA 2L2EA 1QASA 1R2UA 2ZN8A 3BOWA 2ISDA 2KFHA 5CSJA 1OSAA 4DRWA 1K94A 2M3WA 2AAOA 3BUOB 4GFTA 1CFPA 1BMOA 1YUUA 1AUIB 1OE9B 3BFBA 4AQJA 1M39A 1BJFA 4USLA 1QLKA 2F2OA 3WHTB 1RECA 2WCEA 3BYAA 3GK1A 1SNLA 1QV1A 4CPVA 2BCAA 1OOJA 1NX0A 1Z4HA 1B7TZ 2YGUA 1QJTA 1C07A 4CIDA 3S0GA 4UPGA 1CMFA 2JTTA 3K1EA 3TDZA 1OMRA 3DVMA 1GM0A 2L98A 2LUXA 3VB1A 2WORA 1PRWA 3CGAA 2KGBC 1ALWA 1M63B 2MA2A 1XFYO 4PHKA 3UNWA 4C0JA 5F6TA 1DJYA 4I5NB 3VGOA 1GGZA 2ZRTA 1S26D 2LHLA 1IQ3A 2L51A 1IRJA 2SASA 2MAZA 3CS1A 2FOTA 2CTNA 2K7BA 1QATA 3DD4A 1CLBA 2M1UA 1YVLA 3DVEA 3GOFA 3PLFB 1BR4B 3EK8A 1YUSA 2K7DA 3R1PA 1MF8B 4DIRA 1MWNA 1RWYA 1OW4A 3BUNB 2BKHB 1QIVA 1SR6C 1ALVA 1B8RA 1XFWO 1T14A 3L47A 4ORBB 3TZ1A 4CLNA 5B8IB 3D73A 1C3YA 2KDHA 1RFJA 1TNQA 1AK8A 1LVCD 4R1EA 2LE9B 1QVIZ 1B9AA 3BFAA 1EG4A 2ZKMX 5DKQA 2PASA 3AAJA 1YUTA 5HKYA 1FW4A 3IQOA 3LLEA 3DY9A 1K9PA 4PE1A 1FF1A 2I2RE 3OBVA 1K93D 1YX7A 1L7ZA 1XYDA 2ERBA 2BCXA 2RGIA 3SG7A 1EG3A 3SJSA 4DCKA 1F70A 1C3ZA 1YRUB 2WCMA 3B7AA 1NX2A 5PALA 4D1EA 3SG5A 1JFKA 2KHNA 2NCPA 1QWVA 3SIBA 4YGAA 4ZCVA 5JJGA 3SG2A 2F8PA 4I5JA 1CB1A 1LA3A 2KAVA 1W7IB 1CDNA 3BUMB 1YR5A 2F3ZA 3CLNA 3K21A 4Q04A 1F8HA 1WLMA 3KF9A 3DF0B 1DT7B 2JNFA 4OVNF 1TWOA 1N65A 1RROA 3E3RA 3WHUB 4PE4A 3S0AA 3LL8B 4MLWA 1K2HA 2H61A 1QTXA 2JNXA 2KAXA 3I5IB 1S6IA 2K7OA 5CSFA 3TDUA 1SK6D 2LCPA 4C0KA 1VRKA 2HQWA 1GJYA 1F4OA 1K9KA 1DJGA 3RZSA 1GGWA 3DF0A 2MLEC 1JF2A 1EL4A 1QLSA 3NHIA 5FI2A 2F33A 5HKWA 1E8AA 3H4SE 1KQVA 1HT9A 1ZACA 2CNPA 4WQ3A 3CYZA 1KWOB 2M0RA 2OS8C 2I18A 3TS5B 3D74A 4GAOA 1RJVA 4CFRA 2D8NA 1CDMA 3ICBA 4HREE 2LLSA 2AMIA 4MZKA 2EC6B 2OTGB 3KO0A 2LV7A 2M7LA 3DVJA 1KSMA 3AKBA 1BR1B 5AEQA 3BUWB 4MZJA 1A75B 1H8BA 3PM8A 1K90D 3TDIA 4ORCB 1V1FA 5TNCA 3FWCA 5HYDA 1L2OC 4INWA 2M9GA 2KI6C 3R1VA 1AJ4A 3CR4X 1MXEA 1NX1A 1KK7Y 2Y1NA 1WRLA 3JVTB 3D76A 5FI6A 3I5GB 1DEKA 1BU3A 2JT8A 2KNEA 2AUCA 2PMYA 1A75A 1XFXO 3CDNA 1QX7A 2GV5A 2JU0A 5ER5A 1A2XA 4OZDA 3FWBA 4TNCA 2JOJA 4HRHA 3JTDB 1KFUS 1UHKA 1U5IB 1UWOA 2EGDA 1TUJA 2G9BA 2NLNA 3PJIA 2GTEA 2CCMA 1AJ5A 3UO9A 1WDCB 2FJYA 3O2PA 1XFUO 1YURA 2KFGA 1FI5A 4FQTA 1IWQA 2PSRA 3D75A 1RTP1 2BAPA 2LM5A 2WCKA 1OOIX 1XK4A 1M45A 2L5XB 2NCOA 4ORAB 5AANA 4WQ2A 4N1FA 1CTRA 1LS8A 1QIWA 4BY5A 1F71A 1TNWA 2QEHA 2L5YA 5AFPA 2HF5A 3DXLA 1B8CA 3NSOA 1CLLA 5DKRA 1RK9A 2L4HA 4MZLA 3KHEA 4JPZB 4JD9A 1QVIY 2KYCA 2L2CA 1Q80A 1TNPA 1UHHA 1NYAA 2Y1MA 3VROA 5KU1A 3LCPC 1S5GY 3CTNA 5D3OA 1FPWA 3CZTX 3EKJA 3PSRA 2M97A 1Y0VH 1AVSA 3I5FB 3CABA 1S3PA 3S0DA 3NGVA 5HLOA 2LHIA 2HPSA 5D69A 2JTZA 2K7CA 1MR8A 4PDZA 1CDPA 2JT0A 2LMVA 3PFVA 2P70A 1KK8B 3GK2A 3PN7B 3NXAA 1J7RA 1PSRA 3EG5B 4GPLB 2CXJA 1CM4A 1DQEA 2EHBA 3OHMB 1SW8A 2O60A 1A03A 1EH2A 1SL7A 3SS3A 1YRTB 2L4IA 1XVJA 2LP2A 4M2QA 1ZFSA 2H61C 3S0FA 1K95A 4YGDB 2LANA 1DGUA 2LUCA 4QJ4B 2K61A 2SCPA 2LMTA 3OGNA 4YGBB 1TUZA 3CZ1A 4IL1A 3BQ3A 3SG6A 1J55A 3BXKA 1ZOTB 2Y5IA 3LK0A 4PT1A 1SCVA 1W9ZA 2JT3A 2QDIA 1TCFA 2JWWA 1C7VA 3M0WA 1DJZA 1PSBA 1IIOA 3I5IC 1KQMB 2WCBA 3Q8IA 2QEVA 1DVIA 1SCMB 2ZFDA 4YGCB 1CMGA 3AKAA 5HL1A 1C7WA 3R1OA 3B88A 1DJHA 1G33A 2GGZA 2JQ6A 1J7PA 3D10A 2PYQA 2H8VA 3B6XA 1CDLA 1XFRA 1JFJA 3SS4A 1KFUL 4MN0A 3TUYB 2M49B 1KWOC 3KEVA 3TS5C 5BPJA 2JZIA 2QEOA 1NCXA 2EC6C 3B86A 1IH0A 2B1UA 2OTGC 3DYEA 1KCYA 2M29A 4OCIA 1OMVA 2WNDA 3DVKA 3D0YB 1MHOA 5FYXA 2A4JA 1CM1A 4L9MA 4DUQA 3SG4A 2PRUA 2WCHA 4GNKB 2LC5A 1DGVA 1CFCA 1Y1UA 3FE8A 3JVTC 1HQVA 2K0JA 2KLDA 5EL2A 3D0YA 4QJ3B 2KGRA 3I5GC 1SL9A 2JPTA 1MUXA 5CSIA 1J7OA 4GGFA 1NIWA 2WCFA 2KPHA 2LMUA 1XK4C 2LVIA 3LK1A 4GGNA 4KYNA 1JC2A 5G08A 1NWDA 1NX3A 1F54A 3I5HB 1UHJA 3VRNA 2BECA 2KI6D 3A4UB 2K2FA 2Y4QA 1B7TY 1WDCC 5ER4X 3OP0A 1TTXA 2DOQA 3N7HA 1JF0A 3WNXB 1IKUA 5K89A 2LVKA 4N1GA 1CNPA 4F7FA 3NSKA 2K60A 2BL0B 2GGMA 2PQLA 4XJKB 1JUOA 2L0PA 1SSEB 2JPOA 4YI8A 1NCZA 1GQMA 1TN4A 1XA5A 2BE4A 3O4XA 2M1KB 3L4AA 4PCWA 2QACA 1M46A 1ORGA 2BBMA 2LLUA 3IQQA 1UHNA 3QRXA 3CR5X 4GBAA 1N2DA 4YRUA 1BT6A 2KQYA 2HQ8A 4XJKA 3OB1B 1UHIA 4I5LB 1BODA 2WC8A 2KI4B 1P28A 1QXPA 2QPTA 3CWGA 3IVTA 1B1GA 1U5IA 4MEWA 1X02A 1SY9A 2NXQA 1BF5A 2P6BB 5AERA
chains in the Genus database with same CATH topology
3PALA 1BOCA 2FJUB 3BOWB 4ZCUA 4PHNA 1TIZA 3I5FC 5I8NA 4YBHB 1ZUZA 3VRQA 5IBWA 5KTYA 1DTLA 1K9UA 2MBXA 4A4BA 4YI9A 3MSEB 2MRDA 5D7FA 1J7QA 1YX8A 4E68A 4ICBA 4U8DA 1A29A 1K96A 2KQ6A 3EKHA 1BG1A 1DMOA 1A4PA 1R6PA 1KK8C 3PN7C 1DF0B 5I2LA 1F4QA 1QS7A 5CSNA 1G4YR 1LINA 4M2PA 4PHJA 2VRGA 2KSPA 4XYNA 1IJ6A 2PVBA 1TCOB 1H4BA 5CPVA 2LP3A 1ODBA 1JWDA 1UURA 2K8MB 4F0ZB 3RM1A 1NUBA 1IQ5A 1KFXS 1WRZA 4HRGA 2ZNEA 1KK7Z 1DF0A 2M8UA 1SMGA 2R2IA 2KAYA 4MBEA 4ETOA 1WRKA 2KBIA 1CLMA 4BY4A 2LNKA 1IGVA 2IS9A 1D1OA 2E30A 1PK0D 4QJ5B 2JULA 3EVRA 3A8RA 1QX2A 1KQMC 1SRAA 2V53A 4A4CA 1SCMC 2ZN9A 1XFZO 4JQ0D 5J3XA 1NPQA 2G2BA 1G8IA 3FIAA 1NP8A 4P5OE 2LAPA 1BLQA 1WLZA 1LKJA 1FI6A 1UP5A 3NSIA 1SBJA 3TUYC 4NQGA 1S6CA 1XO5A 2JC2A 3OX5A 1QV0A 2WOSA 2COLB 4FTGA 5DKNA 1JSAA 1NSHA 2JXLA 3EVVA 1W7JB 4PHMA 4MSPA 1SKTA 1TOPA 2Q91A 1DJXA 2FCEA 4GGFC 2BCBA 4MRYA 2I94A 1IJ5A 1S36A 2CT9A 1AHRA 1OZSA 1Y1XA 1UUSA 1YTZC 4HSZA 5HLVA 1S5GZ 1K8UA 1MXLC 2JRFA 4M2OA 2MHHA 1S6JA 3IF7A 3FS7A 1SR6B 1PULA 1KSOA 2KOTA 1IG5A 1FBVA 4OV2A 4NDCA 3SIAA 2KYFA 1ZMZA 4NDDA 5JOLA 3C1VA 2MLFC 1EXRA 4PE0A 3VRRA 3I5HC 3EVUA 2ZRSA 3GK4X 1XFVO 1PALA 1Y1AA 2I7AA 2JXCA 5AXIA 3WXAA 1JBAA 2K2AA 3ZWHA 5HKZA 2LVJA 3ZNIA 5HKYA 1M31A 1B47A 4AQIA 1SYMA 2HETA 1LXFC 3EK4A 4OR9B 2BBNA 3CR2A 1TRFA 1DJIA 3VRPA 1AP4A 3F45A 2BL0C 1OQPA 4N5XA 2PALA 1OMDA 1PVAA 3JTDC 2F3YA 1OZOA 1TNXA 2MJWB 2TN4A 1CFFA 2BKIB 5KSZA 3HCMA 2KFFA 2ZNDA 2BE6A 2E6WA 1PVBA 3KPXA 3BUXB 1LA0A 3O78A 5GQQC 2KI4C 4FQOA 3EK7A 4JWQA 4AOMA 4DS7A 1KFXL 1J1EA 3OB2B 1WY9A 1YVHA 1CKKA 1SPYA 2F2PA 3OX6A 4P2YB 1QX5B 1S1EA 2CBLA 1F55A 2NZ0A 3RLZA 1B8LA 3PATA 5I2QA 1Y6WA 4NDBA 2L50A 1N0YA 1V1GA 2FCDA 3HX4A 3SG3A 1EJ3A 2Q4UA 3AAKA 1CFDA 4PE7A 2OS8B 4C0LA 2KBMA 2M7NA 1DJWA 4MRXA 4WRIA 4I5KA 2O5GA 2OPOA 1B4CA 2LVVA 4MVFA 1NCYA 4YGEB 1MQ1A 1SL8A 3O6BA 4PALA 1J1DA 1L2OB 5I2OA 3NSLA 2LLTA 4OKHA 4CFQA 2H2KA 4GUKA 3O4YA 2L2EA 1QASA 1R2UA 2ZN8A 3BOWA 2ISDA 2KFHA 5CSJA 1OSAA 4DRWA 1K94A 2M3WA 2AAOA 3BUOB 4GFTA 1CFPA 1BMOA 1YUUA 1AUIB 1OE9B 4AQJA 1M39A 1BJFA 4USLA 1QLKA 2F2OA 3WHTB 1RECA 2WCEA 3BYAA 3GK1A 1SNLA 1QV1A 4CPVA 2BCAA 1OOJA 1NX0A 1B7TZ 1QJTA 1C07A 4CIDA 4UPGA 1CMFA 2JTTA 3TDZA 1OMRA 3DVMA 2L98A 2LUXA 2WORA 1PRWA 3CGAA 2KGBC 1ALWA 1M63B 2MA2A 1XFYO 4PHKA 4C0JA 5F6TA 1DJYA 4I5NB 3VGOA 1GGZA 2ZRTA 1S26D 2LHLA 1IQ3A 2L51A 1IRJA 2SASA 2MAZA 3CS1A 2FOTA 2CTNA 2K7BA 1QATA 3DD4A 1CLBA 2M1UA 1YVLA 3DVEA 3GOFA 3PLFB 1BR4B 3EK8A 1YUSA 2K7DA 1MF8B 4DIRA 1MWNA 1RWYA 3BUNB 2BKHB 1QIVA 1SR6C 1ALVA 1B8RA 1XFWO 4ORBB 4CLNA 3TZ1A 5B8IB 2KDHA 1RFJA 1TNQA 1AK8A 1LVCD 4R1EA 2LE9B 1QVIZ 1B9AA 1EG4A 2ZKMX 5DKQA 2PASA 3AAJA 1YUTA 1FW4A 3IQOA 3LLEA 1K9PA 4PE1A 1FF1A 2I2RE 1K93D 1YX7A 1L7ZA 1XYDA 2RGIA 2BCXA 3SG7A 3SJSA 1EG3A 4DCKA 1F70A 4D1EA 1YRUB 5PALA 1NX2A 3SG5A 1JFKA 2KHNA 2NCPA 3SIBA 4YGAA 4ZCVA 5JJGA 3SG2A 2F8PA 4I5JA 1CB1A 1LA3A 2KAVA 1W7IB 1CDNA 3BUMB 1YR5A 2F3ZA 3CLNA 3K21A 4Q04A 1F8HA 1WLMA 3KF9A 3DF0B 1DT7B 2JNFA 4OVNF 1N65A 1RROA 3E3RA 3WHUB 4PE4A 3LL8B 4MLWA 1K2HA 2H61A 1QTXA 2JNXA 2KAXA 3I5IB 1S6IA 2K7OA 5CSFA 3TDUA 1SK6D 2LCPA 4C0KA 1VRKA 2HQWA 1GJYA 1F4OA 1K9KA 1DJGA 1GGWA 3DF0A 2MLEC 1JF2A 1EL4A 1QLSA 2F33A 5HKWA 1E8AA 3H4SE 1KQVA 1HT9A 1ZACA 2CNPA 4WQ3A 1KWOB 2M0RA 2OS8C 2I18A 3TS5B 4CFRA 4GAOA 1RJVA 2D8NA 1CDMA 3ICBA 4HREE 2LLSA 2AMIA 4MZKA 2EC6B 2OTGB 3KO0A 2LV7A 2M7LA 3DVJA 1KSMA 3AKBA 1BR1B 5AEQA 3BUWB 4MZJA 1A75B 1H8BA 3PM8A 1K90D 3TDIA 4ORCB 1V1FA 5TNCA 3FWCA 5HYDA 1L2OC 2M9GA 2KI6C 1AJ4A 3CR4X 1MXEA 1NX1A 1KK7Y 2Y1NA 1WRLA 3JVTB 3I5GB 1BU3A 2JT8A 2KNEA 2AUCA 2PMYA 1A75A 1XFXO 1QX7A 2GV5A 2JU0A 5ER5A 1A2XA 3FWBA 4TNCA 2JOJA 4HRHA 3JTDB 1KFUS 1UHKA 1U5IB 1UWOA 2EGDA 2G9BA 2NLNA 2CCMA 1AJ5A 1WDCB 3O2PA 1XFUO 1YURA 2KFGA 1FI5A 1IWQA 2PSRA 1RTP1 2LM5A 1XK4A 1M45A 2L5XB 2NCOA 4ORAB 5AANA 4WQ2A 4N1FA 1CTRA 1QIWA 4BY5A 1F71A 1TNWA 5AFPA 2HF5A 1B8CA 3NSOA 1CLLA 5DKRA 1RK9A 2L4HA 4MZLA 3KHEA 4JPZB 1QVIY 2KYCA 1Q80A 1TNPA 1UHHA 1NYAA 2Y1MA 3VROA 5KU1A 3LCPC 1S5GY 3CTNA 1FPWA 3CZTX 3EKJA 3PSRA 2M97A 1Y0VH 1AVSA 3I5FB 1S3PA 5HLOA 2LHIA 2HPSA 5D69A 2JTZA 2K7CA 1MR8A 4PDZA 1CDPA 2JT0A 2LMVA 3PFVA 1KK8B 3GK2A 3PN7B 3NXAA 1J7RA 1PSRA 4GPLB 2CXJA 1CM4A 2EHBA 3OHMB 1SW8A 2O60A 1A03A 1EH2A 1SL7A 1YRTB 2L4IA 1XVJA 2LP2A 4M2QA 1ZFSA 2H61C 1K95A 4YGDB 2LANA 1DGUA 2LUCA 4QJ4B 2K61A 2SCPA 2LMTA 4YGBB 4IL1A 3BQ3A 3SG6A 1J55A 3BXKA 1ZOTB 2Y5IA 3LK0A 1SCVA 2JT3A 1TCFA 2JWWA 1C7VA 3M0WA 1DJZA 1PSBA 3I5IC 1KQMB 2WCBA 1DVIA 1SCMB 2ZFDA 4YGCB 1CMGA 3AKAA 1C7WA 1DJHA 1G33A 2GGZA 2JQ6A 1J7PA 3D10A 1CDLA 1JFJA 1KFUL 4MN0A 3TUYB 2M49B 1KWOC 3KEVA 3TS5C 5BPJA 2JZIA 1NCXA 2EC6C 1KCYA 1IH0A 2B1UA 2OTGC 2M29A 4OCIA 1OMVA 2WNDA 3DVKA 3D0YB 1MHOA 5FYXA 2A4JA 1CM1A 4L9MA 4DUQA 3SG4A 2PRUA 4GNKB 2LC5A 1DGVA 1CFCA 1Y1UA 3JVTC 1HQVA 2K0JA 3D0YA 4QJ3B 2KGRA 3I5GC 1SL9A 2JPTA 1MUXA 5CSIA 1J7OA 4GGFA 1NIWA 2WCFA 2LMUA 1XK4C 2LVIA 3LK1A 4GGNA 1JC2A 5G08A 1NWDA 1NX3A 1F54A 3I5HB 1UHJA 3VRNA 2BECA 2KI6D 3A4UB 2K2FA 2Y4QA 1B7TY 1WDCC 5ER4X 3OP0A 1TTXA 2DOQA 3WNXB 1JF0A 1IKUA 5K89A 2LVKA 4N1GA 1CNPA 3NSKA 2BL0B 2GGMA 4XJKB 1JUOA 2L0PA 4YI8A 1NCZA 1GQMA 1TN4A 1XA5A 2BE4A 2M1KB 4PCWA 2QACA 1M46A 2BBMA 2LLUA 3IQQA 1UHNA 3QRXA 3CR5X 4GBAA 1N2DA 4YRUA 1BT6A 2KQYA 2HQ8A 4XJKA 3OB1B 1UHIA 4I5LB 1BODA 2WC8A 2KI4B 1QXPA 2QPTA 3CWGA 1B1GA 1U5IA 4MEWA 1X02A 1SY9A 2NXQA 1BF5A 2P6BB 5AERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAL A;  1BOC A;  2FJU B;  3BOW B;  4ZCU A;  4PHN A;  1TIZ A;  3I5F C;  5I8N A;  4YBH B;  1ZUZ A;  3VRQ A;  5IBW A;  5KTY A;  1DTL A;  1K9U A;  2MBX A;  4A4B A;  4YI9 A;  3MSE B;  2MRD A;  5D7F A;  1J7Q A;  1YX8 A;  4E68 A;  4ICB A;  4U8D A;  1A29 A;  1K96 A;  2KQ6 A;  3EKH A;  1BG1 A;  1DMO A;  1A4P A;  1R6P A;  1KK8 C;  3PN7 C;  1DF0 B;  5I2L A;  1F4Q A;  1QS7 A;  5CSN A;  1G4Y R;  1LIN A;  4M2P A;  4PHJ A;  2VRG A;  2KSP A;  4XYN A;  1IJ6 A;  2PVB A;  1TCO B;  1H4B A;  5CPV A;  2LP3 A;  1ODB A;  1JWD A;  1UUR A;  2K8M B;  4F0Z B;  3RM1 A;  1NUB A;  1IQ5 A;  1KFX S;  1WRZ A;  4HRG A;  2ZNE A;  1KK7 Z;  1DF0 A;  2M8U A;  1SMG A;  2R2I A;  2KAY A;  4MBE A;  4ETO A;  1WRK A;  2KBI A;  1CLM A;  4BY4 A;  2LNK A;  1IGV A;  2IS9 A;  1D1O A;  2E30 A;  1PK0 D;  4QJ5 B;  2JUL A;  3EVR A;  3A8R A;  1QX2 A;  1KQM C;  1SRA A;  2V53 A;  4A4C A;  1SCM C;  2ZN9 A;  1XFZ O;  4JQ0 D;  5J3X A;  1NPQ A;  2G2B A;  1G8I A;  3FIA A;  1NP8 A;  4P5O E;  2LAP A;  1BLQ A;  1WLZ A;  1LKJ A;  1FI6 A;  1UP5 A;  3NSI A;  1SBJ A;  3TUY C;  4NQG A;  1S6C A;  1XO5 A;  2JC2 A;  3OX5 A;  1QV0 A;  2WOS A;  2COL B;  4FTG A;  5DKN A;  1JSA A;  1NSH A;  2JXL A;  3EVV A;  1W7J B;  4PHM A;  4MSP A;  1SKT A;  1TOP A;  2Q91 A;  1DJX A;  2FCE A;  4GGF C;  2BCB A;  4MRY A;  2I94 A;  1IJ5 A;  1S36 A;  2CT9 A;  1AHR A;  1OZS A;  1Y1X A;  1UUS A;  1YTZ C;  4HSZ A;  5HLV A;  1S5G Z;  1K8U A;  1MXL C;  2JRF A;  4M2O A;  2MHH A;  1S6J A;  3IF7 A;  3FS7 A;  1SR6 B;  1PUL A;  1KSO A;  2KOT A;  1IG5 A;  1FBV A;  4OV2 A;  4NDC A;  3SIA A;  2KYF A;  1ZMZ A;  4NDD A;  5JOL A;  3C1V A;  2MLF C;  1EXR A;  4PE0 A;  3VRR A;  3I5H C;  3EVU A;  2ZRS A;  3GK4 X;  1XFV O;  1PAL A;  1Y1A A;  2I7A A;  2JXC A;  5AXI A;  3WXA A;  1JBA A;  2K2A A;  3ZWH A;  5HKZ A;  2LVJ A;  3ZNI A;  5HKY A;  1M31 A;  1B47 A;  4AQI A;  1SYM A;  2HET A;  1LXF C;  3EK4 A;  4OR9 B;  2BBN A;  3CR2 A;  1TRF A;  1DJI A;  3VRP A;  1AP4 A;  3F45 A;  2BL0 C;  1OQP A;  4N5X A;  2PAL A;  1OMD A;  1PVA A;  3JTD C;  2F3Y A;  1OZO A;  1TNX A;  2MJW B;  2TN4 A;  1CFF A;  2BKI B;  5KSZ A;  3HCM A;  2KFF A;  2ZND A;  2BE6 A;  2E6W A;  1PVB A;  3KPX A;  3BUX B;  1LA0 A;  3O78 A;  5GQQ C;  2KI4 C;  4FQO A;  3EK7 A;  4JWQ A;  4AOM A;  4DS7 A;  1KFX L;  1J1E A;  3OB2 B;  1WY9 A;  1YVH A;  1CKK A;  1SPY A;  2F2P A;  3OX6 A;  4P2Y B;  1QX5 B;  1S1E A;  2CBL A;  1F55 A;  2NZ0 A;  3RLZ A;  1B8L A;  3PAT A;  5I2Q A;  1Y6W A;  4NDB A;  2L50 A;  1N0Y A;  1V1G A;  2FCD A;  3HX4 A;  3SG3 A;  1EJ3 A;  2Q4U A;  3AAK A;  1CFD A;  4PE7 A;  2OS8 B;  4C0L A;  2KBM A;  2M7N A;  1DJW A;  4MRX A;  4WRI A;  4I5K A;  2O5G A;  2OPO A;  1B4C A;  2LVV A;  4MVF A;  1NCY A;  4YGE B;  1MQ1 A;  1SL8 A;  3O6B A;  4PAL A;  1J1D A;  1L2O B;  5I2O A;  3NSL A;  2LLT A;  4OKH A;  4CFQ A;  2H2K A;  4GUK A;  3O4Y A;  2L2E A;  1QAS A;  1R2U A;  2ZN8 A;  3BOW A;  2ISD A;  2KFH A;  5CSJ A;  1OSA A;  4DRW A;  1K94 A;  2M3W A;  2AAO A;  3BUO B;  4GFT A;  1CFP A;  1BMO A;  1YUU A;  1AUI B;  1OE9 B;  4AQJ A;  1M39 A;  1BJF A;  4USL A;  1QLK A;  2F2O A;  3WHT B;  1REC A;  2WCE A;  3BYA A;  3GK1 A;  1SNL A;  1QV1 A;  4CPV A;  2BCA A;  1OOJ A;  1NX0 A;  1B7T Z;  1QJT A;  1C07 A;  4CID A;  4UPG A;  1CMF A;  2JTT A;  3TDZ A;  1OMR A;  3DVM A;  2L98 A;  2LUX A;  2WOR A;  1PRW A;  3CGA A;  2KGB C;  1ALW A;  1M63 B;  2MA2 A;  1XFY O;  4PHK A;  4C0J A;  5F6T A;  1DJY A;  4I5N B;  3VGO A;  1GGZ A;  2ZRT A;  1S26 D;  2LHL A;  1IQ3 A;  2L51 A;  1IRJ A;  2SAS A;  2MAZ A;  3CS1 A;  2FOT A;  2CTN A;  2K7B A;  1QAT A;  3DD4 A;  1CLB A;  2M1U A;  1YVL A;  3DVE A;  3GOF A;  3PLF B;  1BR4 B;  3EK8 A;  1YUS A;  2K7D A;  1MF8 B;  4DIR A;  1MWN A;  1RWY A;  3BUN B;  2BKH B;  1QIV A;  1SR6 C;  1ALV A;  1B8R A;  1XFW O;  4ORB B;  4CLN A;  3TZ1 A;  5B8I B;  2KDH A;  1RFJ A;  1TNQ A;  1AK8 A;  1LVC D;  4R1E A;  2LE9 B;  1QVI Z;  1B9A A;  1EG4 A;  2ZKM X;  5DKQ A;  2PAS A;  3AAJ A;  1YUT A;  1FW4 A;  3IQO A;  3LLE A;  1K9P A;  4PE1 A;  1FF1 A;  2I2R E;  1K93 D;  1YX7 A;  1L7Z A;  1XYD A;  2RGI A;  2BCX A;  3SG7 A;  3SJS A;  1EG3 A;  4DCK A;  1F70 A;  4D1E A;  1YRU B;  5PAL A;  1NX2 A;  3SG5 A;  1JFK A;  2KHN A;  2NCP A;  3SIB A;  4YGA A;  4ZCV A;  5JJG A;  3SG2 A;  2F8P A;  4I5J A;  1CB1 A;  1LA3 A;  2KAV A;  1W7I B;  1CDN A;  3BUM B;  1YR5 A;  2F3Z A;  3CLN A;  3K21 A;  4Q04 A;  1F8H A;  1WLM A;  3KF9 A;  3DF0 B;  1DT7 B;  2JNF A;  4OVN F;  1N65 A;  1RRO A;  3E3R A;  3WHU B;  4PE4 A;  3LL8 B;  4MLW A;  1K2H A;  2H61 A;  1QTX A;  2JNX A;  2KAX A;  3I5I B;  1S6I A;  2K7O A;  5CSF A;  3TDU A;  1SK6 D;  2LCP A;  4C0K A;  1VRK A;  2HQW A;  1GJY A;  1F4O A;  1K9K A;  1DJG A;  1GGW A;  3DF0 A;  2MLE C;  1JF2 A;  1EL4 A;  1QLS A;  2F33 A;  5HKW A;  1E8A A;  3H4S E;  1KQV A;  1HT9 A;  1ZAC A;  2CNP A;  4WQ3 A;  1KWO B;  2M0R A;  2OS8 C;  2I18 A;  3TS5 B;  4CFR A;  4GAO A;  1RJV A;  2D8N A;  1CDM A;  3ICB A;  4HRE E;  2LLS A;  2AMI A;  4MZK A;  2EC6 B;  2OTG B;  3KO0 A;  2LV7 A;  2M7L A;  3DVJ A;  1KSM A;  3AKB A;  1BR1 B;  5AEQ A;  3BUW B;  4MZJ A;  1A75 B;  1H8B A;  3PM8 A;  1K90 D;  3TDI A;  4ORC B;  1V1F A;  5TNC A;  3FWC A;  5HYD A;  1L2O C;  2M9G A;  2KI6 C;  1AJ4 A;  3CR4 X;  1MXE A;  1NX1 A;  1KK7 Y;  2Y1N A;  1WRL A;  3JVT B;  3I5G B;  1BU3 A;  2JT8 A;  2KNE A;  2AUC A;  2PMY A;  1A75 A;  1XFX O;  1QX7 A;  2GV5 A;  2JU0 A;  5ER5 A;  1A2X A;  3FWB A;  4TNC A;  2JOJ A;  4HRH A;  3JTD B;  1KFU S;  1UHK A;  1U5I B;  1UWO A;  2EGD A;  2G9B A;  2NLN A;  2CCM A;  1AJ5 A;  1WDC B;  3O2P A;  1XFU O;  1YUR A;  2KFG A;  1FI5 A;  1IWQ A;  2PSR A;  1RTP 1;  2LM5 A;  1XK4 A;  1M45 A;  2L5X B;  2NCO A;  4ORA B;  5AAN A;  4WQ2 A;  4N1F A;  1CTR A;  1QIW A;  4BY5 A;  1F71 A;  1TNW A;  5AFP A;  2HF5 A;  1B8C A;  3NSO A;  1CLL A;  5DKR A;  1RK9 A;  2L4H A;  4MZL A;  3KHE A;  4JPZ B;  1QVI Y;  2KYC A;  1Q80 A;  1TNP A;  1UHH A;  1NYA A;  2Y1M A;  3VRO A;  5KU1 A;  3LCP C;  1S5G Y;  3CTN A;  1FPW A;  3CZT X;  3EKJ A;  3PSR A;  2M97 A;  1Y0V H;  1AVS A;  3I5F B;  1S3P A;  5HLO A;  2LHI A;  2HPS A;  5D69 A;  2JTZ A;  2K7C A;  1MR8 A;  4PDZ A;  1CDP A;  2JT0 A;  2LMV A;  3PFV A;  1KK8 B;  3GK2 A;  3PN7 B;  3NXA A;  1J7R A;  1PSR A;  4GPL B;  2CXJ A;  1CM4 A;  2EHB A;  3OHM B;  1SW8 A;  2O60 A;  1A03 A;  1EH2 A;  1SL7 A;  1YRT B;  2L4I A;  1XVJ A;  2LP2 A;  4M2Q A;  1ZFS A;  2H61 C;  1K95 A;  4YGD B;  2LAN A;  1DGU A;  2LUC A;  4QJ4 B;  2K61 A;  2SCP A;  2LMT A;  4YGB B;  4IL1 A;  3BQ3 A;  3SG6 A;  1J55 A;  3BXK A;  1ZOT B;  2Y5I A;  3LK0 A;  1SCV A;  2JT3 A;  1TCF A;  2JWW A;  1C7V A;  3M0W A;  1DJZ A;  1PSB A;  3I5I C;  1KQM B;  2WCB A;  1DVI A;  1SCM B;  2ZFD A;  4YGC B;  1CMG A;  3AKA A;  1C7W A;  1DJH A;  1G33 A;  2GGZ A;  2JQ6 A;  1J7P A;  3D10 A;  1CDL A;  1JFJ A;  1KFU L;  4MN0 A;  3TUY B;  2M49 B;  1KWO C;  3KEV A;  3TS5 C;  5BPJ A;  2JZI A;  1NCX A;  2EC6 C;  1KCY A;  1IH0 A;  2B1U A;  2OTG C;  2M29 A;  4OCI A;  1OMV A;  2WND A;  3DVK A;  3D0Y B;  1MHO A;  5FYX A;  2A4J A;  1CM1 A;  4L9M A;  4DUQ A;  3SG4 A;  2PRU A;  4GNK B;  2LC5 A;  1DGV A;  1CFC A;  1Y1U A;  3JVT C;  1HQV A;  2K0J A;  3D0Y A;  4QJ3 B;  2KGR A;  3I5G C;  1SL9 A;  2JPT A;  1MUX A;  5CSI A;  1J7O A;  4GGF A;  1NIW A;  2WCF A;  2LMU A;  1XK4 C;  2LVI A;  3LK1 A;  4GGN A;  1JC2 A;  5G08 A;  1NWD A;  1NX3 A;  1F54 A;  3I5H B;  1UHJ A;  3VRN A;  2BEC A;  2KI6 D;  3A4U B;  2K2F A;  2Y4Q A;  1B7T Y;  1WDC C;  5ER4 X;  3OP0 A;  1TTX A;  2DOQ A;  3WNX B;  1JF0 A;  1IKU A;  5K89 A;  2LVK A;  4N1G A;  1CNP A;  3NSK A;  2BL0 B;  2GGM A;  4XJK B;  1JUO A;  2L0P A;  4YI8 A;  1NCZ A;  1GQM A;  1TN4 A;  1XA5 A;  2BE4 A;  2M1K B;  4PCW A;  2QAC A;  1M46 A;  2BBM A;  2LLU A;  3IQQ A;  1UHN A;  3QRX A;  3CR5 X;  4GBA A;  1N2D A;  4YRU A;  1BT6 A;  2KQY A;  2HQ8 A;  4XJK A;  3OB1 B;  1UHI A;  4I5L B;  1BOD A;  2WC8 A;  2KI4 B;  1QXP A;  2QPT A;  3CWG A;  1B1G A;  1U5I A;  4MEW A;  1X02 A;  1SY9 A;  2NXQ A;  1BF5 A;  2P6B B;  5AER A; 
#chains in the Genus database with same CATH topology
 3PAL A;  1BOC A;  2FJU B;  3BOW B;  4ZCU A;  4PHN A;  2QEB A;  1TIZ A;  3I5F C;  5I8N A;  4YBH B;  1ZUZ A;  3VRQ A;  5IBW A;  5KTY A;  1DTL A;  1K9U A;  2MBX A;  5DIC A;  4A4B A;  4YI9 A;  3MSE B;  2MRD A;  5D7F A;  1J7Q A;  1YX8 A;  4E68 A;  4ICB A;  4U8D A;  1A29 A;  1K96 A;  2KQ6 A;  3EKH A;  1BG1 A;  1DMO A;  3R72 A;  1A4P A;  1R6P A;  5I94 A;  1KK8 C;  3PN7 C;  1DF0 B;  5I2L A;  1F4Q A;  1QS7 A;  5CSN A;  2WC5 A;  2P71 A;  1G4Y R;  1LIN A;  4M2P A;  4PHJ A;  2VRG A;  2KSP A;  4XYN A;  1IJ6 A;  2PVB A;  1TCO B;  1H4B A;  5CPV A;  2LP3 A;  1ODB A;  2KLE A;  1UUR A;  2K8M B;  4F0Z B;  1JWD A;  3RM1 A;  1NUB A;  1IQ5 A;  1KFX S;  1WRZ A;  4HRG A;  2ZNE A;  1KK7 Z;  1DF0 A;  2M8U A;  3D78 A;  1SMG A;  2R2I A;  2KAY A;  4MBE A;  4ETO A;  1WRK A;  2KBI A;  1CLM A;  4BY4 A;  2LNK A;  1IGV A;  2IS9 A;  1D1O A;  2WCJ A;  2E30 A;  1PK0 D;  4QJ5 B;  2JUL A;  3S0E A;  3EVR A;  1DEL A;  3A8R A;  1QX2 A;  1KQM C;  1SRA A;  2V53 A;  4A4C A;  1SCM C;  2ZN9 A;  1XFZ O;  4JQ0 D;  5J3X A;  1NPQ A;  2G2B A;  1G8I A;  3FIA A;  1NP8 A;  3NHT A;  4P5O E;  2LAP A;  1BLQ A;  1WLZ A;  1LKJ A;  1FI6 A;  1UP5 A;  3NSI A;  1SBJ A;  3TUY C;  4NQG A;  1S6C A;  1XO5 A;  2JC2 A;  3OX5 A;  1QV0 A;  4IJ7 A;  1DC1 A;  2WOS A;  2COL B;  4FTG A;  5DKN A;  1JSA A;  3FE6 A;  5FI7 A;  1NSH A;  2JXL A;  3EVV A;  1W7J B;  4PHM A;  4MSP A;  1SKT A;  1TOP A;  2Q91 A;  1DJX A;  2FCE A;  4GGF C;  2BCB A;  4MRY A;  2I94 A;  1IJ5 A;  1S36 A;  2CT9 A;  1AHR A;  1OZS A;  1Y1X A;  1UUS A;  1YTZ C;  3CZ0 A;  4HSZ A;  4JKT A;  5HLV A;  1S5G Z;  1K8U A;  1MXL C;  2JRF A;  4M2O A;  2MHH A;  1S6J A;  3IF7 A;  3FS7 A;  1SR6 B;  1PUL A;  1KSO A;  2KOT A;  1IG5 A;  1FBV A;  4OV2 A;  4NDC A;  1Z2C B;  3SIA A;  2KYF A;  1ZMZ A;  4NDD A;  5JOL A;  3C1V A;  2MLF C;  3FE9 A;  1EXR A;  4PE0 A;  3VRR A;  3I5H C;  2WC6 A;  3EVU A;  2ZRS A;  3GK4 X;  2BNX A;  1XFV O;  1PAL A;  1Y1A A;  2I7A A;  2JXC A;  5AXI A;  3WXA A;  1JBA A;  4INX A;  2K2A A;  1OOH A;  3BJH A;  5HKZ A;  2LVJ A;  3ZNI A;  3ZWH A;  1M31 A;  1B47 A;  4AQI A;  1SYM A;  2HET A;  1LXF C;  3EK4 A;  4OR9 B;  2BBN A;  3CR2 A;  1TRF A;  1DJI A;  3VRP A;  1AP4 A;  3F45 A;  2BL0 C;  1OQP A;  4N5X A;  2PAL A;  1OMD A;  1PVA A;  3JTD C;  2F3Y A;  1OZO A;  2WCL A;  1TNX A;  2MJW B;  2TN4 A;  3PM2 A;  1CFF A;  2BKI B;  5KSZ A;  3HCM A;  2KFF A;  2ZND A;  2BE6 A;  2E6W A;  1PVB A;  3CZ2 A;  3KPX A;  3BUX B;  1LA0 A;  1OOF A;  3O78 A;  5GQQ C;  2KI4 C;  4FQO A;  3EK7 A;  3BFH A;  4JWQ A;  4AOM A;  4DS7 A;  1KFX L;  1J1E A;  3OB2 B;  1WY9 A;  1YVH A;  1CKK A;  1SPY A;  2F2P A;  3OX6 A;  4P2Y B;  1QX5 B;  1S1E A;  2CBL A;  1F55 A;  2NZ0 A;  3RLZ A;  1B8L A;  3D77 A;  3QME A;  3PAT A;  5I2Q A;  1Y6W A;  4NDB A;  2L50 A;  1N0Y A;  1V1G A;  2FCD A;  3HX4 A;  3SG3 A;  3V2L A;  1EJ3 A;  2Q4U A;  3AAK A;  1CFD A;  4PE7 A;  2OS8 B;  4C0L A;  2KBM A;  2M7N A;  1DJW A;  4MRX A;  3SS5 A;  4WRI A;  3B87 A;  4I5K A;  2O5G A;  2OPO A;  3S0B A;  3DZT A;  1B4C A;  2LVV A;  4MVF A;  3L4L A;  1NCY A;  4YGE B;  1MQ1 A;  1SL8 A;  3O6B A;  4PAL A;  1J1D A;  1L2O B;  5I2O A;  3NSL A;  2LLT A;  4OKH A;  4CFQ A;  1OOG A;  2H2K A;  4GUK A;  3O4Y A;  2L2E A;  1QAS A;  1R2U A;  2ZN8 A;  3BOW A;  2ISD A;  2KFH A;  5CSJ A;  1OSA A;  4DRW A;  1K94 A;  2M3W A;  2AAO A;  3BUO B;  4GFT A;  1CFP A;  1BMO A;  1YUU A;  1AUI B;  1OE9 B;  3BFB A;  4AQJ A;  1M39 A;  1BJF A;  4USL A;  1QLK A;  2F2O A;  3WHT B;  1REC A;  2WCE A;  3BYA A;  3GK1 A;  1SNL A;  1QV1 A;  4CPV A;  2BCA A;  1OOJ A;  1NX0 A;  1Z4H A;  1B7T Z;  2YGU A;  1QJT A;  1C07 A;  4CID A;  3S0G A;  4UPG A;  1CMF A;  2JTT A;  3K1E A;  3TDZ A;  1OMR A;  3DVM A;  1GM0 A;  2L98 A;  2LUX A;  3VB1 A;  2WOR A;  1PRW A;  3CGA A;  2KGB C;  1ALW A;  1M63 B;  2MA2 A;  1XFY O;  4PHK A;  3UNW A;  4C0J A;  5F6T A;  1DJY A;  4I5N B;  3VGO A;  1GGZ A;  2ZRT A;  1S26 D;  2LHL A;  1IQ3 A;  2L51 A;  1IRJ A;  2SAS A;  2MAZ A;  3CS1 A;  2FOT A;  2CTN A;  2K7B A;  1QAT A;  3DD4 A;  1CLB A;  2M1U A;  1YVL A;  3DVE A;  3GOF A;  3PLF B;  1BR4 B;  3EK8 A;  1YUS A;  2K7D A;  3R1P A;  1MF8 B;  4DIR A;  1MWN A;  1RWY A;  1OW4 A;  3BUN B;  2BKH B;  1QIV A;  1SR6 C;  1ALV A;  1B8R A;  1XFW O;  1T14 A;  3L47 A;  4ORB B;  3TZ1 A;  4CLN A;  5B8I B;  3D73 A;  1C3Y A;  2KDH A;  1RFJ A;  1TNQ A;  1AK8 A;  1LVC D;  4R1E A;  2LE9 B;  1QVI Z;  1B9A A;  3BFA A;  1EG4 A;  2ZKM X;  5DKQ A;  2PAS A;  3AAJ A;  1YUT A;  5HKY A;  1FW4 A;  3IQO A;  3LLE A;  3DY9 A;  1K9P A;  4PE1 A;  1FF1 A;  2I2R E;  3OBV A;  1K93 D;  1YX7 A;  1L7Z A;  1XYD A;  2ERB A;  2BCX A;  2RGI A;  3SG7 A;  1EG3 A;  3SJS A;  4DCK A;  1F70 A;  1C3Z A;  1YRU B;  2WCM A;  3B7A A;  1NX2 A;  5PAL A;  4D1E A;  3SG5 A;  1JFK A;  2KHN A;  2NCP A;  1QWV A;  3SIB A;  4YGA A;  4ZCV A;  5JJG A;  3SG2 A;  2F8P A;  4I5J A;  1CB1 A;  1LA3 A;  2KAV A;  1W7I B;  1CDN A;  3BUM B;  1YR5 A;  2F3Z A;  3CLN A;  3K21 A;  4Q04 A;  1F8H A;  1WLM A;  3KF9 A;  3DF0 B;  1DT7 B;  2JNF A;  4OVN F;  1TWO A;  1N65 A;  1RRO A;  3E3R A;  3WHU B;  4PE4 A;  3S0A A;  3LL8 B;  4MLW A;  1K2H A;  2H61 A;  1QTX A;  2JNX A;  2KAX A;  3I5I B;  1S6I A;  2K7O A;  5CSF A;  3TDU A;  1SK6 D;  2LCP A;  4C0K A;  1VRK A;  2HQW A;  1GJY A;  1F4O A;  1K9K A;  1DJG A;  3RZS A;  1GGW A;  3DF0 A;  2MLE C;  1JF2 A;  1EL4 A;  1QLS A;  3NHI A;  5FI2 A;  2F33 A;  5HKW A;  1E8A A;  3H4S E;  1KQV A;  1HT9 A;  1ZAC A;  2CNP A;  4WQ3 A;  3CYZ A;  1KWO B;  2M0R A;  2OS8 C;  2I18 A;  3TS5 B;  3D74 A;  4GAO A;  1RJV A;  4CFR A;  2D8N A;  1CDM A;  3ICB A;  4HRE E;  2LLS A;  2AMI A;  4MZK A;  2EC6 B;  2OTG B;  3KO0 A;  2LV7 A;  2M7L A;  3DVJ A;  1KSM A;  3AKB A;  1BR1 B;  5AEQ A;  3BUW B;  4MZJ A;  1A75 B;  1H8B A;  3PM8 A;  1K90 D;  3TDI A;  4ORC B;  1V1F A;  5TNC A;  3FWC A;  5HYD A;  1L2O C;  4INW A;  2M9G A;  2KI6 C;  3R1V A;  1AJ4 A;  3CR4 X;  1MXE A;  1NX1 A;  1KK7 Y;  2Y1N A;  1WRL A;  3JVT B;  3D76 A;  5FI6 A;  3I5G B;  1DEK A;  1BU3 A;  2JT8 A;  2KNE A;  2AUC A;  2PMY A;  1A75 A;  1XFX O;  3CDN A;  1QX7 A;  2GV5 A;  2JU0 A;  5ER5 A;  1A2X A;  4OZD A;  3FWB A;  4TNC A;  2JOJ A;  4HRH A;  3JTD B;  1KFU S;  1UHK A;  1U5I B;  1UWO A;  2EGD A;  1TUJ A;  2G9B A;  2NLN A;  3PJI A;  2GTE A;  2CCM A;  1AJ5 A;  3UO9 A;  1WDC B;  2FJY A;  3O2P A;  1XFU O;  1YUR A;  2KFG A;  1FI5 A;  4FQT A;  1IWQ A;  2PSR A;  3D75 A;  1RTP 1;  2BAP A;  2LM5 A;  2WCK A;  1OOI X;  1XK4 A;  1M45 A;  2L5X B;  2NCO A;  4ORA B;  5AAN A;  4WQ2 A;  4N1F A;  1CTR A;  1LS8 A;  1QIW A;  4BY5 A;  1F71 A;  1TNW A;  2QEH A;  2L5Y A;  5AFP A;  2HF5 A;  3DXL A;  1B8C A;  3NSO A;  1CLL A;  5DKR A;  1RK9 A;  2L4H A;  4MZL A;  3KHE A;  4JPZ B;  4JD9 A;  1QVI Y;  2KYC A;  2L2C A;  1Q80 A;  1TNP A;  1UHH A;  1NYA A;  2Y1M A;  3VRO A;  5KU1 A;  3LCP C;  1S5G Y;  3CTN A;  5D3O A;  1FPW A;  3CZT X;  3EKJ A;  3PSR A;  2M97 A;  1Y0V H;  1AVS A;  3I5F B;  3CAB A;  1S3P A;  3S0D A;  3NGV A;  5HLO A;  2LHI A;  2HPS A;  5D69 A;  2JTZ A;  2K7C A;  1MR8 A;  4PDZ A;  1CDP A;  2JT0 A;  2LMV A;  3PFV A;  2P70 A;  1KK8 B;  3GK2 A;  3PN7 B;  3NXA A;  1J7R A;  1PSR A;  3EG5 B;  4GPL B;  2CXJ A;  1CM4 A;  1DQE A;  2EHB A;  3OHM B;  1SW8 A;  2O60 A;  1A03 A;  1EH2 A;  1SL7 A;  3SS3 A;  1YRT B;  2L4I A;  1XVJ A;  2LP2 A;  4M2Q A;  1ZFS A;  2H61 C;  3S0F A;  1K95 A;  4YGD B;  2LAN A;  1DGU A;  2LUC A;  4QJ4 B;  2K61 A;  2SCP A;  2LMT A;  3OGN A;  4YGB B;  1TUZ A;  3CZ1 A;  4IL1 A;  3BQ3 A;  3SG6 A;  1J55 A;  3BXK A;  1ZOT B;  2Y5I A;  3LK0 A;  4PT1 A;  1SCV A;  1W9Z A;  2JT3 A;  2QDI A;  1TCF A;  2JWW A;  1C7V A;  3M0W A;  1DJZ A;  1PSB A;  1IIO A;  3I5I C;  1KQM B;  2WCB A;  3Q8I A;  2QEV A;  1DVI A;  1SCM B;  2ZFD A;  4YGC B;  1CMG A;  3AKA A;  5HL1 A;  1C7W A;  3R1O A;  3B88 A;  1DJH A;  1G33 A;  2GGZ A;  2JQ6 A;  1J7P A;  3D10 A;  2PYQ A;  2H8V A;  3B6X A;  1CDL A;  1XFR A;  1JFJ A;  3SS4 A;  1KFU L;  4MN0 A;  3TUY B;  2M49 B;  1KWO C;  3KEV A;  3TS5 C;  5BPJ A;  2JZI A;  2QEO A;  1NCX A;  2EC6 C;  3B86 A;  1IH0 A;  2B1U A;  2OTG C;  3DYE A;  1KCY A;  2M29 A;  4OCI A;  1OMV A;  2WND A;  3DVK A;  3D0Y B;  1MHO A;  5FYX A;  2A4J A;  1CM1 A;  4L9M A;  4DUQ A;  3SG4 A;  2PRU A;  2WCH A;  4GNK B;  2LC5 A;  1DGV A;  1CFC A;  1Y1U A;  3FE8 A;  3JVT C;  1HQV A;  2K0J A;  2KLD A;  5EL2 A;  3D0Y A;  4QJ3 B;  2KGR A;  3I5G C;  1SL9 A;  2JPT A;  1MUX A;  5CSI A;  1J7O A;  4GGF A;  1NIW A;  2WCF A;  2KPH A;  2LMU A;  1XK4 C;  2LVI A;  3LK1 A;  4GGN A;  4KYN A;  1JC2 A;  5G08 A;  1NWD A;  1NX3 A;  1F54 A;  3I5H B;  1UHJ A;  3VRN A;  2BEC A;  2KI6 D;  3A4U B;  2K2F A;  2Y4Q A;  1B7T Y;  1WDC C;  5ER4 X;  3OP0 A;  1TTX A;  2DOQ A;  3N7H A;  1JF0 A;  3WNX B;  1IKU A;  5K89 A;  2LVK A;  4N1G A;  1CNP A;  4F7F A;  3NSK A;  2K60 A;  2BL0 B;  2GGM A;  2PQL A;  4XJK B;  1JUO A;  2L0P A;  1SSE B;  2JPO A;  4YI8 A;  1NCZ A;  1GQM A;  1TN4 A;  1XA5 A;  2BE4 A;  3O4X A;  2M1K B;  3L4A A;  4PCW A;  2QAC A;  1M46 A;  1ORG A;  2BBM A;  2LLU A;  3IQQ A;  1UHN A;  3QRX A;  3CR5 X;  4GBA A;  1N2D A;  4YRU A;  1BT6 A;  2KQY A;  2HQ8 A;  4XJK A;  3OB1 B;  1UHI A;  4I5L B;  1BOD A;  2WC8 A;  2KI4 B;  1P28 A;  1QXP A;  2QPT A;  3CWG A;  3IVT A;  1B1G A;  1U5I A;  4MEW A;  1X02 A;  1SY9 A;  2NXQ A;  1BF5 A;  2P6B B;  5AER A; 
#chains in the Genus database with same CATH homology
 3PAL A;  1BOC A;  2FJU B;  3BOW B;  4ZCU A;  4PHN A;  1TIZ A;  3I5F C;  5I8N A;  4YBH B;  1ZUZ A;  3VRQ A;  5IBW A;  5KTY A;  1DTL A;  1K9U A;  2MBX A;  4A4B A;  4YI9 A;  3MSE B;  2MRD A;  5D7F A;  1J7Q A;  1YX8 A;  4E68 A;  4ICB A;  4U8D A;  1A29 A;  1K96 A;  2KQ6 A;  3EKH A;  1BG1 A;  1DMO A;  1A4P A;  1R6P A;  1KK8 C;  3PN7 C;  1DF0 B;  5I2L A;  1F4Q A;  1QS7 A;  5CSN A;  1G4Y R;  1LIN A;  4M2P A;  4PHJ A;  2VRG A;  2KSP A;  4XYN A;  1IJ6 A;  2PVB A;  1TCO B;  1H4B A;  5CPV A;  2LP3 A;  1ODB A;  1JWD A;  1UUR A;  2K8M B;  4F0Z B;  3RM1 A;  1NUB A;  1IQ5 A;  1KFX S;  1WRZ A;  4HRG A;  2ZNE A;  1KK7 Z;  1DF0 A;  2M8U A;  1SMG A;  2R2I A;  2KAY A;  4MBE A;  4ETO A;  1WRK A;  2KBI A;  1CLM A;  4BY4 A;  2LNK A;  1IGV A;  2IS9 A;  1D1O A;  2E30 A;  1PK0 D;  4QJ5 B;  2JUL A;  3EVR A;  3A8R A;  1QX2 A;  1KQM C;  1SRA A;  2V53 A;  4A4C A;  1SCM C;  2ZN9 A;  1XFZ O;  4JQ0 D;  5J3X A;  1NPQ A;  2G2B A;  1G8I A;  3FIA A;  1NP8 A;  4P5O E;  2LAP A;  1BLQ A;  1WLZ A;  1LKJ A;  1FI6 A;  1UP5 A;  3NSI A;  1SBJ A;  3TUY C;  4NQG A;  1S6C A;  1XO5 A;  2JC2 A;  3OX5 A;  1QV0 A;  2WOS A;  2COL B;  4FTG A;  5DKN A;  1JSA A;  1NSH A;  2JXL A;  3EVV A;  1W7J B;  4PHM A;  4MSP A;  1SKT A;  1TOP A;  2Q91 A;  1DJX A;  2FCE A;  4GGF C;  2BCB A;  4MRY A;  2I94 A;  1IJ5 A;  1S36 A;  2CT9 A;  1AHR A;  1OZS A;  1Y1X A;  1UUS A;  1YTZ C;  4HSZ A;  5HLV A;  1S5G Z;  1K8U A;  1MXL C;  2JRF A;  4M2O A;  2MHH A;  1S6J A;  3IF7 A;  3FS7 A;  1SR6 B;  1PUL A;  1KSO A;  2KOT A;  1IG5 A;  1FBV A;  4OV2 A;  4NDC A;  3SIA A;  2KYF A;  1ZMZ A;  4NDD A;  5JOL A;  3C1V A;  2MLF C;  1EXR A;  4PE0 A;  3VRR A;  3I5H C;  3EVU A;  2ZRS A;  3GK4 X;  1XFV O;  1PAL A;  1Y1A A;  2I7A A;  2JXC A;  5AXI A;  3WXA A;  1JBA A;  2K2A A;  3ZWH A;  5HKZ A;  2LVJ A;  3ZNI A;  5HKY A;  1M31 A;  1B47 A;  4AQI A;  1SYM A;  2HET A;  1LXF C;  3EK4 A;  4OR9 B;  2BBN A;  3CR2 A;  1TRF A;  1DJI A;  3VRP A;  1AP4 A;  3F45 A;  2BL0 C;  1OQP A;  4N5X A;  2PAL A;  1OMD A;  1PVA A;  3JTD C;  2F3Y A;  1OZO A;  1TNX A;  2MJW B;  2TN4 A;  1CFF A;  2BKI B;  5KSZ A;  3HCM A;  2KFF A;  2ZND A;  2BE6 A;  2E6W A;  1PVB A;  3KPX A;  3BUX B;  1LA0 A;  3O78 A;  5GQQ C;  2KI4 C;  4FQO A;  3EK7 A;  4JWQ A;  4AOM A;  4DS7 A;  1KFX L;  1J1E A;  3OB2 B;  1WY9 A;  1YVH A;  1CKK A;  1SPY A;  2F2P A;  3OX6 A;  4P2Y B;  1QX5 B;  1S1E A;  2CBL A;  1F55 A;  2NZ0 A;  3RLZ A;  1B8L A;  3PAT A;  5I2Q A;  1Y6W A;  4NDB A;  2L50 A;  1N0Y A;  1V1G A;  2FCD A;  3HX4 A;  3SG3 A;  1EJ3 A;  2Q4U A;  3AAK A;  1CFD A;  4PE7 A;  2OS8 B;  4C0L A;  2KBM A;  2M7N A;  1DJW A;  4MRX A;  4WRI A;  4I5K A;  2O5G A;  2OPO A;  1B4C A;  2LVV A;  4MVF A;  1NCY A;  4YGE B;  1MQ1 A;  1SL8 A;  3O6B A;  4PAL A;  1J1D A;  1L2O B;  5I2O A;  3NSL A;  2LLT A;  4OKH A;  4CFQ A;  2H2K A;  4GUK A;  3O4Y A;  2L2E A;  1QAS A;  1R2U A;  2ZN8 A;  3BOW A;  2ISD A;  2KFH A;  5CSJ A;  1OSA A;  4DRW A;  1K94 A;  2M3W A;  2AAO A;  3BUO B;  4GFT A;  1CFP A;  1BMO A;  1YUU A;  1AUI B;  1OE9 B;  4AQJ A;  1M39 A;  1BJF A;  4USL A;  1QLK A;  2F2O A;  3WHT B;  1REC A;  2WCE A;  3BYA A;  3GK1 A;  1SNL A;  1QV1 A;  4CPV A;  2BCA A;  1OOJ A;  1NX0 A;  1B7T Z;  1QJT A;  1C07 A;  4CID A;  4UPG A;  1CMF A;  2JTT A;  3TDZ A;  1OMR A;  3DVM A;  2L98 A;  2LUX A;  2WOR A;  1PRW A;  3CGA A;  2KGB C;  1ALW A;  1M63 B;  2MA2 A;  1XFY O;  4PHK A;  4C0J A;  5F6T A;  1DJY A;  4I5N B;  3VGO A;  1GGZ A;  2ZRT A;  1S26 D;  2LHL A;  1IQ3 A;  2L51 A;  1IRJ A;  2SAS A;  2MAZ A;  3CS1 A;  2FOT A;  2CTN A;  2K7B A;  1QAT A;  3DD4 A;  1CLB A;  2M1U A;  1YVL A;  3DVE A;  3GOF A;  3PLF B;  1BR4 B;  3EK8 A;  1YUS A;  2K7D A;  1MF8 B;  4DIR A;  1MWN A;  1RWY A;  3BUN B;  2BKH B;  1QIV A;  1SR6 C;  1ALV A;  1B8R A;  1XFW O;  4ORB B;  4CLN A;  3TZ1 A;  5B8I B;  2KDH A;  1RFJ A;  1TNQ A;  1AK8 A;  1LVC D;  4R1E A;  2LE9 B;  1QVI Z;  1B9A A;  1EG4 A;  2ZKM X;  5DKQ A;  2PAS A;  3AAJ A;  1YUT A;  1FW4 A;  3IQO A;  3LLE A;  1K9P A;  4PE1 A;  1FF1 A;  2I2R E;  1K93 D;  1YX7 A;  1L7Z A;  1XYD A;  2RGI A;  2BCX A;  3SG7 A;  3SJS A;  1EG3 A;  4DCK A;  1F70 A;  4D1E A;  1YRU B;  5PAL A;  1NX2 A;  3SG5 A;  1JFK A;  2KHN A;  2NCP A;  3SIB A;  4YGA A;  4ZCV A;  5JJG A;  3SG2 A;  2F8P A;  4I5J A;  1CB1 A;  1LA3 A;  2KAV A;  1W7I B;  1CDN A;  3BUM B;  1YR5 A;  2F3Z A;  3CLN A;  3K21 A;  4Q04 A;  1F8H A;  1WLM A;  3KF9 A;  3DF0 B;  1DT7 B;  2JNF A;  4OVN F;  1N65 A;  1RRO A;  3E3R A;  3WHU B;  4PE4 A;  3LL8 B;  4MLW A;  1K2H A;  2H61 A;  1QTX A;  2JNX A;  2KAX A;  3I5I B;  1S6I A;  2K7O A;  5CSF A;  3TDU A;  1SK6 D;  2LCP A;  4C0K A;  1VRK A;  2HQW A;  1GJY A;  1F4O A;  1K9K A;  1DJG A;  1GGW A;  3DF0 A;  2MLE C;  1JF2 A;  1EL4 A;  1QLS A;  2F33 A;  5HKW A;  1E8A A;  3H4S E;  1KQV A;  1HT9 A;  1ZAC A;  2CNP A;  4WQ3 A;  1KWO B;  2M0R A;  2OS8 C;  2I18 A;  3TS5 B;  4CFR A;  4GAO A;  1RJV A;  2D8N A;  1CDM A;  3ICB A;  4HRE E;  2LLS A;  2AMI A;  4MZK A;  2EC6 B;  2OTG B;  3KO0 A;  2LV7 A;  2M7L A;  3DVJ A;  1KSM A;  3AKB A;  1BR1 B;  5AEQ A;  3BUW B;  4MZJ A;  1A75 B;  1H8B A;  3PM8 A;  1K90 D;  3TDI A;  4ORC B;  1V1F A;  5TNC A;  3FWC A;  5HYD A;  1L2O C;  2M9G A;  2KI6 C;  1AJ4 A;  3CR4 X;  1MXE A;  1NX1 A;  1KK7 Y;  2Y1N A;  1WRL A;  3JVT B;  3I5G B;  1BU3 A;  2JT8 A;  2KNE A;  2AUC A;  2PMY A;  1A75 A;  1XFX O;  1QX7 A;  2GV5 A;  2JU0 A;  5ER5 A;  1A2X A;  3FWB A;  4TNC A;  2JOJ A;  4HRH A;  3JTD B;  1KFU S;  1UHK A;  1U5I B;  1UWO A;  2EGD A;  2G9B A;  2NLN A;  2CCM A;  1AJ5 A;  1WDC B;  3O2P A;  1XFU O;  1YUR A;  2KFG A;  1FI5 A;  1IWQ A;  2PSR A;  1RTP 1;  2LM5 A;  1XK4 A;  1M45 A;  2L5X B;  2NCO A;  4ORA B;  5AAN A;  4WQ2 A;  4N1F A;  1CTR A;  1QIW A;  4BY5 A;  1F71 A;  1TNW A;  5AFP A;  2HF5 A;  1B8C A;  3NSO A;  1CLL A;  5DKR A;  1RK9 A;  2L4H A;  4MZL A;  3KHE A;  4JPZ B;  1QVI Y;  2KYC A;  1Q80 A;  1TNP A;  1UHH A;  1NYA A;  2Y1M A;  3VRO A;  5KU1 A;  3LCP C;  1S5G Y;  3CTN A;  1FPW A;  3CZT X;  3EKJ A;  3PSR A;  2M97 A;  1Y0V H;  1AVS A;  3I5F B;  1S3P A;  5HLO A;  2LHI A;  2HPS A;  5D69 A;  2JTZ A;  2K7C A;  1MR8 A;  4PDZ A;  1CDP A;  2JT0 A;  2LMV A;  3PFV A;  1KK8 B;  3GK2 A;  3PN7 B;  3NXA A;  1J7R A;  1PSR A;  4GPL B;  2CXJ A;  1CM4 A;  2EHB A;  3OHM B;  1SW8 A;  2O60 A;  1A03 A;  1EH2 A;  1SL7 A;  1YRT B;  2L4I A;  1XVJ A;  2LP2 A;  4M2Q A;  1ZFS A;  2H61 C;  1K95 A;  4YGD B;  2LAN A;  1DGU A;  2LUC A;  4QJ4 B;  2K61 A;  2SCP A;  2LMT A;  4YGB B;  4IL1 A;  3BQ3 A;  3SG6 A;  1J55 A;  3BXK A;  1ZOT B;  2Y5I A;  3LK0 A;  1SCV A;  2JT3 A;  1TCF A;  2JWW A;  1C7V A;  3M0W A;  1DJZ A;  1PSB A;  3I5I C;  1KQM B;  2WCB A;  1DVI A;  1SCM B;  2ZFD A;  4YGC B;  1CMG A;  3AKA A;  1C7W A;  1DJH A;  1G33 A;  2GGZ A;  2JQ6 A;  1J7P A;  3D10 A;  1CDL A;  1JFJ A;  1KFU L;  4MN0 A;  3TUY B;  2M49 B;  1KWO C;  3KEV A;  3TS5 C;  5BPJ A;  2JZI A;  1NCX A;  2EC6 C;  1KCY A;  1IH0 A;  2B1U A;  2OTG C;  2M29 A;  4OCI A;  1OMV A;  2WND A;  3DVK A;  3D0Y B;  1MHO A;  5FYX A;  2A4J A;  1CM1 A;  4L9M A;  4DUQ A;  3SG4 A;  2PRU A;  4GNK B;  2LC5 A;  1DGV A;  1CFC A;  1Y1U A;  3JVT C;  1HQV A;  2K0J A;  3D0Y A;  4QJ3 B;  2KGR A;  3I5G C;  1SL9 A;  2JPT A;  1MUX A;  5CSI A;  1J7O A;  4GGF A;  1NIW A;  2WCF A;  2LMU A;  1XK4 C;  2LVI A;  3LK1 A;  4GGN A;  1JC2 A;  5G08 A;  1NWD A;  1NX3 A;  1F54 A;  3I5H B;  1UHJ A;  3VRN A;  2BEC A;  2KI6 D;  3A4U B;  2K2F A;  2Y4Q A;  1B7T Y;  1WDC C;  5ER4 X;  3OP0 A;  1TTX A;  2DOQ A;  3WNX B;  1JF0 A;  1IKU A;  5K89 A;  2LVK A;  4N1G A;  1CNP A;  3NSK A;  2BL0 B;  2GGM A;  4XJK B;  1JUO A;  2L0P A;  4YI8 A;  1NCZ A;  1GQM A;  1TN4 A;  1XA5 A;  2BE4 A;  2M1K B;  4PCW A;  2QAC A;  1M46 A;  2BBM A;  2LLU A;  3IQQ A;  1UHN A;  3QRX A;  3CR5 X;  4GBA A;  1N2D A;  4YRU A;  1BT6 A;  2KQY A;  2HQ8 A;  4XJK A;  3OB1 B;  1UHI A;  4I5L B;  1BOD A;  2WC8 A;  2KI4 B;  1QXP A;  2QPT A;  3CWG A;  1B1G A;  1U5I A;  4MEW A;  1X02 A;  1SY9 A;  2NXQ A;  1BF5 A;  2P6B B;  5AER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...