4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor 12
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
2MLFC 4HRHA 1AJ4A 2KGBC 1FI6A 4HSZA 4PCWA 1SR6C 3ZWHA 3EK4A 1YUTA 1NIWA 2WCEA 1GGWA 3H4SE 1JWDA 2LE9B 1KFUS 4MLWA 3VRNA 1QLKA 4C0LA 2BCXA 3HCMA 1B4CA 3PFVA 1CLBA 4IL1A 1LA3A 1UHNA 5DKQA 5CSFA 1JF2A 1F4OA 1DJYA 1H8BA 3BUWB 2K7BA 4WQ2A 1IJ6A 2NCOA 1S36A 2PMYA 2H61A 4DRWA 4F0ZB 1F54A 2M9GA 3JVTB 2M7LA 2AMIA 3FS7A 4AOMA 2B1UA 3PSRA 1NX1A 4M2QA 4M2OA 1SYMA 5BPJA 2MLEC 2TN4A 2KBMA 2KOTA 3DF0B 1DF0B 3JTDB 3OB1B 4CFRA 1IQ3A 1K95A 4I5JA 3BOWA 1JC2A 2KYCA 4JQ0D 2Y4QA 4XYNA 5KSZA 2KFFA 1BU3A 2LVVA 4XJKA 3A4UB 1W7IB 1JF0A 4L9MA 3I5FB 2LMVA 2L50A 3I5GB 1OE9B 3LCPC 4OKHA 3BUNB 2LMUA 1K90D 1KK7Y 2KFHA 3O6BA 4ICBA 3HX4A 2BBMA 2KDHA 3SG4A 2FCDA 4QJ4B 4GGNA 3NSKA 2KSPA 5CSNA 2I94A 2GV5A 1KCYA 3CLNA 5G08A 1C7WA 1Y1AA 1YTZC 2D8NA 4YI8A 1Y0VH 2JTZA 1J1EA 1JBAA 1EG4A 2MAZA 3CZTX 3I5HC 1IWQA 3EKJA 1NSHA 1AJ5A 2CTNA 4QJ3B 1J55A 1BOCA 1CFDA 1GJYA 1PRWA 3EVVA 3TDZA 1XVJA 2E6WA 1XK4A 1NUBA 2EGDA 3BQ3A 4ETOA 1FW4A 2M29A 1XFZO 1AHRA 1U5IB 1KFXS 1J7OA 2JQ6A 3O4YA 3BUOB 2M1KB 3IQQA 2BE4A 1YUSA 1SW8A 1TCFA 2EC6C 3NSLA 2LC5A 2R2IA 3OP0A 4UPGA 1D1OA 2K7DA 1A2XA 2CT9A 1M46A 2MJWB 1CDMA 2LP3A 2L4IA 1TCOB 1WRKA 1YURA 1OMRA 1KK7Z 1B1GA 1UWOA 3DD4A 1AP4A 2FJUB 3TUYB 1N65A 5PALA 4A4CA 1U5IA 2H2KA 2HQWA 1C7VA 1KSOA 3WXAA 1S6IA 1MR8A 1QJTA 2KI6C 1QXPA 4PHJA 1FI5A 2JXCA 4HREE 1EG3A 2Q4UA 1G4YR 2BCAA 1RWYA 3WNXB 2BBNA 4OR9B 3RLZA 4TNCA 4MBEA 2G2BA 1KK8B 2PVBA 2V53A 1TNWA 2LAPA 2KAXA 3FWBA 3JVTC 4OCIA 2F2PA 1WRLA 1N0YA 2K7CA 4MVFA 1B7TY 2M7NA 3IQOA 3VGOA 1CB1A 2F2OA 1CNPA 3FWCA 1IJ5A 2M8UA 3JTDC 3O78A 4GFTA 5JJGA 1Y1XA 5D7FA 2BE6A 2LMTA 1QVIY 2L5XB 2KBIA 2SASA 1OZOA 3I5FC 2LHIA 1LA0A 3I5GC 4AQJA 3K21A 4ORBB 1DMOA 2F33A 3I5IB 3VRPA 4I5NB 4DUQA 2MHHA 3OX5A 1IG5A 1TNQA 3MSEB 2CBLA 5HKYA 1YX7A 2LVIA 3BOWB 1MWNA 5B8IB 1XK4C 2KI4B 1S5GY 2ZN8A 1S26D 1PK0D 4WRIA 4XJKB 3TS5B 1MHOA 5HKZA 2FOTA 1NX0A 3TZ1A 2JWWA 1YUUA 3ICBA 3SJSA 2GGZA 2JPTA 4N1FA 1UURA 3SG6A 4MEWA 1F4QA 1K9KA 4DS7A 1AK8A 1KQVA 2F3YA 1QTXA 3AAJA 2JC2A 3GK4X 4I5KA 1Q80A 2KAYA 2M0RA 2JU0A 2K7OA 4PDZA 1K8UA 2WCFA 3DVJA 4PE0A 1DJHA 4NDBA 2JNFA 1TRFA 2ZNEA 3EK8A 2COLB 3SG5A 1RECA 2KGRA 2SCPA 1GGZA 3KEVA 2NLNA 5JOLA 4ORAB 2JT3A 3LK0A 1OMVA 1DJGA 1QASA 2JNXA 1WLMA 1G33A 1B7TZ 3SG2A 5I8NA 1NYAA 5J3XA 4YGBB 1CDPA 3KHEA 1WRZA 3D0YA 2QACA 1DGVA 4AQIA 1BLQA 2KQYA 1SCVA 1VRKA 2BKHB 2WORA 1FPWA 1QVIZ 2OTGB 1R2UA 1QS7A 2KAVA 1CDLA 4NDDA 1KFUL 2CNPA 4YI9A 2LLSA 4PE7A 1YVHA 3C1VA 1PVAA 4YGCB 1KQMB 2HPSA 1QV1A 4ORCB 3TUYC 2EHBA 1XYDA 1LINA 3PALA 2HF5A 2Y1NA 2LLUA 4GAOA 1CLLA 2L2EA 1S5GZ 3SIBA 2A4JA 4N5XA 1K9UA 2CXJA 3PN7B 1CTRA 1DJXA 4HRGA 4MSPA 2KNEA 3CR5X 4MZKA 1F70A 1FBVA 2PRUA 2K2AA 2LNKA 2M3WA 1UP5A 2JULA 1KK8C 2LCPA 5KU1A 2Y1MA 2MBXA 1JFJA 2DOQA 1SMGA 1SPYA 4GGFA 1NCXA 1ZMZA 2G9BA 1B8CA 4PALA 2O60A 2ZRSA 1CFPA 1CLMA 1YRUB 3VRQA 2LUCA 4NQGA 5F6TA 1JSAA 1TTXA 2H61C 1NCZA 2BL0B 2E30A 2I7AA 2QPTA 4CFQA 3I5IC 2FCEA 2OPOA 3VROA 1L2OB 1J1DA 3M0WA 4JWQA 5CSJA 1DGUA 1SL9A 2F8PA 1Y1UA 2AUCA 2Y5IA 1J7QA 2KI4C 2RGIA 1M39A 3TS5C 2LVJA 1UUSA 1NCYA 4N1GA 1JUOA 2K2FA 2AAOA 1TNPA 3BUMB 1B9AA 3SG3A 3FIAA 1QX2A 1XO5A 1UHKA 1KFXL 4D1EA 2JZIA 1NPQA 2NXQA 2LHLA 2M97A 3KPXA 5HLOA 1YR5A 4NDCA 3E3RA 1K9PA 1CKKA 1SCMB 3PM8A 1L7ZA 5AANA 4GNKB 3GOFA 2L51A 3DVKA 1C07A 1QATA 2KYFA 1CM4A 1UHJA 1CMGA 2ZFDA 5I2OA 1CDNA 1BR1B 1UHIA 4GPLB 3SG7A 1CFCA 1HQVA 3IF7A 1CMFA 4CLNA 1X02A 3BXKA 2JT0A 3D10A 2OTGC 1F55A 5DKNA 4JPZB 1BR4B 2L0PA 4QJ5B 1QV0A 1W7JB 3AAKA 5AFPA 3DVMA 1F8HA 2HETA 5FYXA 1IRJA 2LANA 2BKIB 4C0KA 1K96A 1KQMC 4GGFC 2VRGA 1RJVA 3D0YB 3GK2A 2LVKA 1MXLC 2F3ZA 1BF5A 1DJZA 1K93D 2JXLA 1BG1A 1XFUO 4YBHB 1WDCB 3QRXA 1BT6A 2K0JA 4MN0A 3A8RA 3CWGA 3PN7C 1S6CA 5CSIA 1ZUZA 2M49B 1XFVO 1A4PA 1M31A 3CGAA 1XA5A 2MA2A 1BMOA 3DVEA 1ALWA 1PSBA 1R6PA 3CS1A 1RK9A 1DVIA 4FTGA 1TIZA 4CPVA 1S6JA 2KHNA 4GBAA 2ZN9A 1B8RA 1QX7A 1KWOB 1EXRA 1BJFA 1EJ3A 1YX8A 3EVUA 3NSOA 2OS8B 1ZOTB 1K2HA 3PATA 1XFWO 1MF8B 1PVBA 3PLFB 1QX5B 5AXIA 4YRUA 3LL8B 2BL0C 2KFGA 2NCPA 4YGAA 1A03A 2ISDA 1GQMA 3LLEA 2PSRA 1K94A 1RTP1 2I2RE 3NSIA 2PALA 5D69A 1L2OC 1KSMA 4E68A 1JFKA 1QLSA 1SR6B 1QIWA 1ODBA 1XFYO 2ZNDA 2IS9A 3KF9A 2KQ6A 2LLTA 1S3PA 1SL7A 2WOSA 3DF0A 1DF0A 1J7PA 4PHNA 4YGEB 3CR2A 1ZFSA 5HLVA 5I2LA 1CFFA 1IQ5A 2PASA 3BUXB 2CCMA 3EVRA 1A75B 2KI6D 1N2DA 5K89A 4DIRA 1ALVA 1YRTB 2WC8A 4P5OE 4OV2A 1PULA 5AEQA 2LV7A 2LP2A 1AVSA 1SCMC 4BY5A 5IBWA 2Y9ZA 1XFXO 2JRFA 5ER5A 1OZSA 4M2PA 1NP8A 3OX6A 1CM1A 3KO0A 3VRRA 1A75A 1SKTA 4R1EA 3WHUB 1B47A 1ZACA 1IGVA 2JT8A 1PALA 5DKRA 1M45A 3EKHA 1AUIB 1J7RA 3CR4X 4MRYA 4USLA 2Y9YA 5KTYA 5HKWA 1IH0A 1QIVA 4A4BA 2JOJA 1SNLA 2LM5A 3RM1A 1V1GA 4MRXA 1OFCX 4Q04A 1A29A 1LXFC 1PSRA 2L4HA 4PHKA 4PHMA 2HQ8A 2ZRTA 4I5LB 1SBJA 1OMDA 3TDUA 3BYAA 1G8IA 2WCBA 2BCBA 1DJWA 1MUXA 2LUXA 1WDCC 1S1EA 3I5HB 1EL4A 1NWDA 2I18A 3WHTB 1SRAA 1DTLA 1B8LA 1IKUA 1FF1A 1WY9A 4DCKA 2GGMA 2L98A 1BODA 1Y6WA 4OVNF 5ER4X 3SIAA 3TDIA 1M63B 4MZJA 4U8DA 3ZNIA 1DJIA 5CPVA 4WQ3A 3O2PA 4PE4A 2NZ0A 1LKJA 1SK6D 4MZLA 1EH2A 3LK1A 1DT7B 1NX3A 5GQQC 2Q91A 4FQOA 4CIDA 1TN4A 4BY4A 1MQ1A 2ZKMX 1KWOC 4PE1A 1TNXA 4C0JA 1SL8A 4P2YB 2O5GA 2BECA 2EC6B 2OS8C 1F71A 2K61A 1TOPA 3GK1A 5HYDA 1MXEA 5AERA 4ZCUA 2MRDA 1RROA 2JTTA 1WLZA 2P6BB 3NXAA 5I2QA 1YVLA 4ZCVA 1E8AA 3CTNA 1OOJA 1HT9A 3OHMB 1NX2A 4GUKA 3AKAA 1SY9A 1OQPA 5TNCA 1OSAA 1V1FA 4YGDB 1UHHA 3AKBA 2M1UA 1H4BA 2WNDA 3OB2B 3F45A 1RFJA 1LVCD 2K8MB 3EK7A
chains in the Genus database with same CATH superfamily
5BVZA 1FI6A 3V4QA 4HSZA 2WSCJ 3TK1A 2E43A 1G1IA 4GT1A 2WCEA 1U7MA 3U1AA 2LE9B 1KFUS 3H1KD 2Z5HA 4C0LA 4MN4C 2FYZA 5E79E 1F4OA 4H13C 1M90Q 3OA7A 3BUWB 1JY2O 3TGUD 1SSEB 2PMYA 4DRWA 1RF1B 3RL0D 1J1DC 1M57D 1BDDA 2M7LA 2OQQA 1KB9H 3F89A 2B1UA 2M0BA 4CFRA 3DF0B 2KOTA 1IQ3A 3CCMP 1NTZG 3BOWA 1JEKA 5KLIC 2KYCA 4JQ0D 2Y4QA 1SS1A 1H88A 2KFFA 2LVVA 2PP6A 3USSA 1KMIZ 1N86A 3LCPC 4NPDA 2XNDH 3HX4A 4PD4E 2BBMA 2KDHA 3QMEA 3LW5J 3SG4A 2FXMA 3L72J 3NSKA 2I8DA 1SQBE 2K9JA 4HJGH 5G08A 1OZHA 2D8NA 3FWLA 2PRRA 3I5HC 1M1KQ 1AJ5A 3DYEA 3CWBJ 1J55A 3CZ2A 1GJYA 4KJMA 2E6WA 3CCVP 1N73B 3TNUA 1FW4A 1U57A 1DIPA 5FI7A 1KFXS 3Q1MA 1L0LJ 3O4YA 1SW8A 1TCFA 3NSLA 2LC5A 3C8VA 1DX7A 3D77A 1TUZA 3M9HA 3HD7A 1TCOB 1FZBA 5AW4B 1BGYD 3CCRP 1SP4A 1OMRA 3CXHD 1KK7Z 1OX3A 2OYHA 2IBZG 3B6XA 3EFGA 1JY3O 3SSUA 3TUYB 1N65A 1P84E 2BEQD 5B5EH 2YGUA 1PP9J 3CDNA 2N1TD 1OVRA 4L75A 3OAKA 1EXIA 1KILD 3G4SP 4OR9B 2JO1A 1KK8B 1RF1C 4OCIA 1JMMA 2KSEA 4BXLA 1PGJA 2K7CA 2V4HA 1B7TY 1N7SD 1CB1A 2Y0EA 5JJGA 3O78A 1YTZI 3GG2A 2GUSA 1QGKB 1AA0A 3GF7A 1QVIY 2L5XB 2KBIA 4C7NB 3L70D 1FZCB 1LA0A 2KNCA 4AQJA 1DMOA 2RH0A 3K5BA 1JM0A 3I5IB 3VRPA 3L71E 3KZIH 1Q7YQ 2LVIA 2N9BA 1MWNA 1NTME 3L74G 2FFDB 2KI4B 3CC7P 3H1LD 4WRIA 1GW4A 4XJKB 1SQQJ 3M9QA 1MHOA 3KHUA 5AW7B 4ASWA 1VF5B 2JPTA 1HH0A 2JEEA 1LTAC 3ZDMA 4MEWA 1F4QA 1K9KA 4DS7A 4I1LA 3VN0A 1S72P 2F3YA 1Q80A 4PE0A 3L75D 2GUVA 4PJ0E 2ZNEA 2COLB 3L73E 3SG5A 1N73C 1IFIA 2WMMA 4DZOA 3EQ2A 1OMVA 3DZTA 5KAIH 3LIDA 5J3XA 3B5NB 1J1EB 1USDA 1Q82Q 1WRZA 3D0YA 3HTKA 1DGVA 2AXTH 4AQIA 1LJ2A 2BKHB 1FPWA 2Q9IA 2QEVA 1JNMA 1ZOYC 4NDDA 4I6MC 1VQ9P 4PE7A 1M7LA 1YVHA 2LKMA 1KQMB 3F5HA 2N1TB 3TUYC 2MJZA 1CSBA 2Y1NA 2LLUA 2M3EA 1WT6A 3E1IA 1S5GZ 1KILB 1FBMA 3A0BH 1JUNA 4K35A 4BRYB 3L72D 2W6BA 1N7SB 1BSHA 1KK8C 2DOQA 4GGFA 1L0NG 1QL2A 3CZ1A 1ZMZA 4GOFA 1B8CA 3E1RA 1IFJA 2G8YA 5CHXA 3QWOC 3L4AA 2E30A 1NTZE 2NRGA 2QPTA 3I5IC 1L0LD 1SQVK 1J1DA 1H0TA 1FJKA 2CK3H 4EOTA 2O01H 2AUCA 4EDFA 2FFDC 2KI4C 1R8EA 2PAJA 3D71A 3L47A 2LVJA 1UUSA 1NCYA 4N1GA 2YNYA 2JKVA 2AAOA 1B9AA 1OVVA 1VF5C 1FAVA 2YO2A 1H89A 3PH0A 1JOCA 3P8CE 4AYCA 5HLOA 1PP9D 4KYNA 1TWOA 3PM8A 1L7ZA 1SQBJ 1Q86Q 4GNKB 1MV8A 3V2NA 1NHLA 2L51A 1FZEA 4C7RA 1CMGA 1KQGB 3B5NC 1NVOA 1J1EC 3VP9A 3VP8A 1HQVA 1CMFA 2KS1A 1OOGA 3D10A 3HE5B 2L0PA 3VMAA 3O6QB 2C9NY 1KQMC 2N1TC 2LVKA 3O8ZA 3RBZA 3N7NA 3WUTA 1KILC 1BF5A 2JXLA 2W8ZA 1WDCB 3QRXA 3BFHA 2K1AA 3BFBA 2E75D 2C0XA 1S6CA 1ZUZA 1GL2D 3SFEC 1SQQD 1N7SC 1ZV8A 3A5TA 2OTJP 4PV1B 1DVIA 4FTGA 1M56D 1B8RA 1KWOB 1EXRA 1EJ3A 1YX8A 1NOHA 1NH4A 2NPSD 1QX5B 2KFGA 2IFNA 3V2LA 4YGAA 1PGOA 1VQ5P 1LTSC 3LLEA 3W67A 1KC8Q 2PALA 3BJHA 1SQPG 1RF1A 1JFKA 5TISH 1ODBA 1XFYO 4WBAA 3A0HE 3D76A 2POHA 5M1BA 1JCDA 4EI2A 1S3PA 3DF0A 1J7PA 2E42A 3BASA 4JKTA 1ZFSA 5I2LA 3BUXB 3GW6A 3L74E 1GW3A 1IJDB 4P5OE 3L71J 3MUDC 3D74A 2LV7A 5GTIH 1AVSA 1NTMJ 2FKWB 1MKMA 3VMZA 4IOIH 4JYCA 2Y9ZA 1OMIA 4JF7A 2JRFA 1YQ4C 1NP8A 3AEEC 2QM8A 3V5BA 4YXWH 1A75A 3WHUB 4INXA 1IGVA 5DKRA 1AUIB 4USLA 3WU2H 5HKWA 3KDPB 3TYYA 3L73J 4AQRD 2JOJA 1DD4A 2LM5A 3RM1A 1RE4A 1VQ4P 2GA1A 2ZFCA 4Q04A 1G1JA 4UB8E 3UO9A 3Q3DA 4PHKA 2B87B 1OMDA 1GL2B 2XNXA 2WCBA 1DJWA 3CCLP 1MUXA 4H13D 1WDCC 1S1EA 1J2JB 3L37A 2WCMA 1NWDA 1IKUA 1DTLA 2WC5A 2L98A 1BODA 3SIAA 3TDIA 3PM2A 5C39A 4PV1C 1NU1G 3CL3D 3OW2O 1SK6D 4R4MA 5GTHH 3MHVA 1NX3A 1KD1Q 2RN0A 4FQOA 4CIDA 1KWOC 1DELA 1BE3D 3EWKA 4L73A 4DJGA 4P2YB 1SQBG 1L0NE 1Z4HA 5HYDA 4Y28J 4ZCUA 2MRDA 5I2QA 1YVLA 4GUKA 1IC2A 2K9YA 1NX2A 3AKAA 1OQPA 1OSAA 1V1FA 1H4BA 2IYOA 3NHTA 1T6AA 4HRHA 3G3ZA 1EDLA 3PJIA 3EK4A 4OZDA 2HLOA 1NIWA 1VQMP 4IFFA 3CMAP 4MLWA 3VRNA 1SQXE 2WC6A 3IR9A 1NTZJ 3HCMA 1HTLC 3PFVA 1CLBA 1UHNA 1H8BA 5CSFA 1DJYA 2CPSA 2K7BA 1IJ6A 2NCOA 1XTGB 2M9GA 2R44A 2AMIA 4WY4D 3PHLA 1NX1A 1AQ5A 2YKQA 2MLEC 2KBMA 1YYCA 1DF0B 3FE8A 1K95A 1S5LH 3PTZA 5KLVK 4XJKA 3A4UB 1KB9I 4OKHA 4PT1A 1K90D 3CZ0A 2KFHA 3O6BA 4ICBA 1RQUA 5CCGC 4QJ4B 4GGNA 5AVVB 1K04A 2I94A 3EG5B 5I94A 3CLNA 1C7WA 1Y1AA 2W27A 1GL2C 1LTJA 1ZN5A 2C9LY 1J1EA 1JBAA 1UIXA 2Q3EA 3EKJA 2CTNA 4L74A 1XK4A 1LT9A 2EGDA 2M29A 1KYOH 1AHRA 2JDIH 3L71D 1NO4A 2N1TA 3BUOB 2M1KB 1JY2N 1YUSA 2R3SA 4UPGA 1A2XA 2CT9A 2Q5UA 2MJWB 2L4IA 2PQLA 1UWOA 1N7SA 4ZKPA 1K8AQ 3B4SA 1U5IA 1KSOA 4U7JA 4N3YB 1MR8A 3L36A 4NPEA 1QXPA 2HPCB 3L73D 2P70A 1AVYA 1FI5A 1SQPE 2I1JA 1EG3A 2Q4UA 1FC2C 1NTKG 1G4YR 4WY4B 5KLVD 1A02J 2E5TA 4MBEA 5FI6A 1GDTA 2QSIA 1VQLP 2LAPA 3CC2P 3FWBA 3SS3A 1AVOA 3VB1A 1XTCC 4LGDE 2F2OA 3FWCA 1IJ5A 4GFTA 1LWUA 5AVQB 3L74J 1JTHB 2KLEA 4OH8B 4D6TD 5EFWB 5AW2B 1PL5A 4N78D 4ORBB 3H32A 4RESB 2F33A 5AW1B 2MHHA 1IG5A 3MUDA 1GK4A 3WMM0 1QWVA 1ZR4A 2FYNB 3NGVA 3FXEA 1YQ3C 3TS5B 5HKZA 1NX0A 5APYA 1YUUA 3ICBA 2GGZA 4IL6H 3JCUH 3GLMA 1QTXA 2JC2A 3GK4X 2JJLA 1T8ZA 2FYUG 2JU0A 1JY3N 1T3JA 2K7OA 2WCFA 3HE4A 1YJNP 2L2CA 1HGZA 3C1LA 2JNFA 1TRFA 3H1KG 3EK8A 1RECA 3AE2C 1JB0J 5JOLA 2AXCA 3LK0A 3CX5H 3O6QA 3TGUG 1G33A 1B7TZ 3OBVA 5I8NA 2XU6A 4DT0A 1GD2E 1CDPA 5KJ7D 1NU1E 5APVA 1BLQA 2M5AB 1VRKA 2WORA 1QVIZ 1LP1B 3I55P 1HJBA 1KFUL 1S1CX 3H1HG 5APSA 4YI9A 3C1VA 5DJTB 3AE4C 3P8CD 2HPSA 2EHBA 1LINA 2HF5A 3MGNA 2L2EA 1L0NJ 2WQYC 1VF5D 3E7KA 4I2LC 2CXJA 1DJXA 3P7KA 3CR5X 3AEDC 4WY4C 1F70A 1ORGA 2K2AA 1UP5A 1ZP0C 2JULA 2LCPA 2MBXA 2C0WA 1NCXA 4PALA 1S9KE 1Y9BA 1SQXJ 1CLMA 3VRQA 3B5ND 1BCCG 1JO5A 4HYTB 3VOPA 1C3ZA 2KLUA 2RKLA 3S4RA 1JSAA 2H61C 2BL0B 1OIPA 3AE8C 3RK3E 2I7AA 1KN7A 2IBZD 3FX0A 4CFQA 2FCEA 2OPOA 1L2OB 1QVGO 2W83C 3JSVC 1DGUA 1GU4A 4RKUJ 2YO3A 2FYNC 1J7QA 2Y5IA 2HODA 2RGIA 1HUCA 1M39A 3TS5C 3VYIA 2K2FA 1QX2A 1KFXL 4D1EA 2JZIA 3O4XA 1NPQA 1K9PA 3CPWO 1SCMB 2ZYDA 2HFED 1NGMB 3CLQA 2QDIA 2L91A 2ZFDA 5I2OA 1BR1B 4GPLB 1CFCA 1IFNA 3JCUE 2KXPB 2B87A 3M06A 3MD0A 2O3JA 1KB9E 2P58A 4HB1A 4XE5B 1GL2A 5DKNA 1BSNA 4QJ5B 1QV0A 1W5CE 2QJKB 3B71A 5AFPA 3L74D 4IJ7A 2M8RA 1K96A 2QEXP 3B86A 2VRGA 2WPRA 1L0LK 5AW9B 5H2FH 1MXLC 3IF4A 1IFMA 1RHZB 1BG1A 2NPSA 5B66H 3A8RA 4WB4A 5CSIA 2Q6QA 4JBZA 2M49B 2FJYA 2VRSA 2A06D 3DVEA 1BMOA 1RQVA 1NTKE 2V7QH 1CI6B 1S6JA 2OGUA 1S4XA 4YTPC 2ZN9A 1QX7A 1HJ0A 3GMAA 1SQPJ 1NKZB 1BJFA 3L75G 1ZOTB 3PATA 1MF8B 1PVBA 5AXIA 1YTZT 2BL0C 2NCPA 2H88C 1JY2P 1A03A 3NXSA 2KZIA 1GQMA 3CXHH 2PSRA 3NSIA 1FS0E 3ABVC 1L2OC 3C9IA 1SR6B 5AW6B 2ZNDA 2IS9A 3KF9A 1T3UA 2YXQB 2KQ6A 1Q81Q 1SL7A 1DF0A 1N7LA 3TF5A 4PHNA 5AVWB 4YGEB 3WUVA 1MUUA 1CFFA 2PASA 2CCMA 3EVRA 1L4AB 2KI6D 5K89A 3U1CA 1ALVA 1W9ZA 1YRTB 4U3FG 1PULA 5AEQA 3NHIA 3LIEA 2ZJSE 3V6IA 3PLNA 4H0LD 5B5EE 2LP2A 1L0ND 4HKZH 4PV1D 2J59M 1SCMC 2WSEJ 3UIAA 4BY5A 3CWBD 1YHQP 3A2AA 3S1KA 3BRVB 1SQQK 5KJ7C 1OZSA 2FYUE 2O1JA 1FZCC 4Y99B 3H1KE 5K5GB 3VRRA 3AE3C 1ZACA 2JT8A 1QEXA 2OTLP 3TGUE 1E79H 4MRYA 1SQXG 2Y9YA 3PP5A 3B87A 1IH0A 1DD3A 2K37A 2ZVNB 2QJKC 1UIIA 1OFCX 1A29A 1LXFC 4YXDC 1NU1J 3H1HE 4N6JA 3PRJA 4PHMA 1FDIA 3KZIE 5AVXB 1KTMA 1X22A 2WT7A 2I18A 4C46A 2WSCH 1B8LA 1WY9A 1Y6WA 4OVNF 1M63B 3ZNIA 1DJIA 1JY3P 5CPVA 4PE4A 2NZ0A 2QVAA 2OARA 5GQQC 3DY9A 3KYQA 1G2CA 1MQ1A 3HRNA 2O5GA 2K61A 1TOPA 1PFIA 4L76A 2JTTA 1NKNA 1EZVD 2KZJA 1OOJA 5TNCA 1VQ8P 5CCGD 1BCCE 4DOJA 1JMBA 3II6A 3AKBA 4WY4A 2M1UA 2WNDA 5KAIE 3H6PA 1RFJA 2QA4P 1NJIQ 1AJ4A 2AXTE 2P1JA 2WSFJ 1OOIX 1SR6C 1YIJP 5APTA 1GGWA 1JWDA 1ZRTE 3LW5H 1QLKA 4H0LB 2BCXA 1B4CA 1JTHA 4IL1A 5DKQA 1L4AC 1JF2A 4WQ2A 1PGPA 3KQGA 2H61A 1HBWA 3JVTB 3A0BE 1RF0C 3PSRA 2TN4A 1JFJA 3D6ZA 4I5JA 1JC2A 1GTWA 4XYNA 5AVSB 4Y99C 1W7IB 1JF0A 4L9MA 3I5FB 2FY8A 3H1JG 3I5GB 5CCHC 1DEKA 1OE9B 5AW3B 2MKVA 1OW4A 1SQVG 2OYIB 1SQBK 3MTUE 2FCDA 3AEFC 1URQD 3SS4A 2WPVB 5CSNA 1KCYA 1PIXA 2IX7C 1YTZC 2YMKA 3MIWA 4YI8A 1Y0VH 2JTZA 1EG4A 2K3RA 1P28A 1IWQA 1NAFA 1NSHA 4QJ3B 1K73Q 1BOCA 1LP1A 1FZAA 3EVVA 3TDZA 1XVJA 1NUBA 2OYHB 5KAFH 3CC4P 1XFZO 1J7OA 3CCSP 2JQ6A 4KT0J 4IFMA 3BCCG 1KQSO 1M46A 2LP3A 1KYOI 1WRKA 1ZW0A 1NTKJ 3L75E 1NWQA 4UB6H 1N73A 2B9BA 3RGUA 3DD4A 3M91A 2J5UA 2FJUB 5PALA 2HQWA 2H2KA 1PGQA 2KP8A 1YITP 2QEOA 1QJTA 2KI6C 2IDBA 1HWTC 4O9BA 1LGHB 1Z2CB 4HREE 2Q1KA 2J58A 3BRTB 4H0LC 2BCAA 1K9MQ 2KNCB 1RWYA 2BBNA 1SLQA 3D70A 3RLZA 1PPJG 4TNCA 1W2BO 2G2BA 1Y47A 2V53A 1NU1D 4PD4D 3JVTC 3H1IG 2UWJE 2I1KA 3AEBC 4U3FE 2BAPA 3IQOA 3VGOA 1GK6A 2M8UA 4OWFA 1Y1XA 1SQBD 4A7PA 2L5YA 2LMTA 1N2DC 2Q7CA 3I5FC 3I5GC 3FE6A 2KIKA 3K21A 1URQB 1FOSE 3MZWB 1OOHA 1NTMK 1BE3G 4I5NB 4DUQA 4JD9A 1M8OB 3OX5A 3MSEB 5AVRB 1Y8AA 2OYIC 1M1JB 5APUA 2FYUJ 1CZQA 5B8IB 1A02F 1CW5A 3S0AA 2ITAA 2ZN8A 1K05A 1U7JA 3H1KJ 2P71A 5KJ7A 1LT1A 3TZ1A 3V4WA 2JWWA 4C7NA 4N1FA 3TGUJ 4JYBA 1S9KD 1FZCA 1AK8A 2WSSH 3L35A 5TISE 4PDZA 3KXDA 3RZSA 1OVUA 2FFDA 2OYHC 2KGRA 2SCPA 1GGZA 3KEVA 2NLNA 3H1HJ 4ORAB 1P84D 1QASA 1X9VA 3SG2A 2W6JH 1NYAA 2JWDA 4YGBB 3KHEA 2QACA 3VMXA 4XFJA 1XFRA 5GTIE 2KQYA 3R2PA 1SCVA 3M9BA 3QH9A 2KUBA 3B88A 1CDLA 1FU1A 2B89A 3CX5I 2CNPA 3CD6P 1L2PA 2ZYGA 5E79H 1PVAA 4YGCB 3W68A 1QV1A 4ORCB 3PALA 1S5LX 3B5NA 1CLLA 2KSJA 3WU2E 1CI6A 2LR2A 2A4JA 2K88A 2ZT9D 1QX8A 5KTBA 1OOFA 1BCCJ 3IVTA 3PN7B 4HRGA 3L4LA 1RE3C 5KU1A 1RH5B 3AE9C 2JP3A 3NFQA 1KB9D 1SPYA 3CCJP 2WCKA 2FBWC 1IK7A 1MFTA 1NTMD 4PD4H 2ZRSA 1KILA 1WRGA 5DJUB 1YRUB 2IYPA 2LUCA 4NQGA 1NTZK 4BRYA 3TSIA 5BU8B 5AW8B 1AQTA 1KV4A 5DICA 1URQC 1Q2NA 5GTHE 2YXRB 3H1JE 4JWQA 2HYNA 5CSJA 1M1JC 2F8PA 3I5CA 2QIWA 1Y1UA 1RF0A 2H7HA 1SQVE 2BCCG 2K60A 2N9YB 3L4FA 3P32A 2M3BA 1JUOA 2BASA 1TNPA 3FIAA 3AE1C 3AEAC 2D2CB 1UHKA 2KS1B 5AVZB 2QRXA 2NXQA 2QE7H 1T14A 3KPXA 4R4LA 3RK3B 4NDCA 2A45H 3GF3A 2KPHA 5AANA 5APXA 2AEJA 2IZ0A 2W90A 1C07A 1QATA 2KYFA 3L70J 2PGDA 1QVFO 5D3OA 1CDNA 2YKPA 3SG7A 3P8MC 1P84H 2ZYAA 1SVFA 2KLVA 1X02A 1IFDA 2O01J 3BXKA 2QJYB 4LC1A 1F55A 1DQEA 1S5LE 1FDMA 3DVMA 2HETA 5FYXA 2LANA 2BKIB 4C0KA 3BCCE 1PZQA 4GGFC 1RJVA 2ZT9B 3SWYA 5AVTB 3R1PA 4H44B 1T2KD 2F3ZA 3CCEP 2QG4A 1K93D 3OGNA 4YBHB 1BT6A 2K0JA 4MN0A 2FYUD 3L75J 3CWGA 3PN7C 3HE5A 3CMEP 1NTZD 2XKMA 2Q3IA 2JWAA 1A4PA 1M31A 1XA5A 2MA2A 3SWKA 1R6PA 3CS1A 2IZ1A 1TUJA 4CPVA 1TIZA 1SFCD 1X8YA 2KHNA 1S2EA 1PPJE 3SWFA 1USEA 2GM4A 3NSOA 3H1IE 1K2HA 4IL6X 1H8AA 3PLFB 2JR8A 2O01N 3H1HD 4YRUA 3JC22 3AE5C 2ISDA 1KYOE 2OTKE 1IK9A 4U3FJ 1RTP1 1KSMA 1QLSA 1QIWA 2YIUB 4K3AA 4EIJA 3HUSB 1BE3E 4PJ0H 3D75A 1LNQA 1HVVA 3CXHI 4RJTA 3AE6C 4TT3H 3M0DC 1A75B 1N2DA 4DIRA 2D2CC 3AEGC 2IBZI 3B7AA 1KZUB 3RK3C 2ZAEB 3IFMA 2P10A 5IBWA 2OYIA 5ER5A 1BCCD 1YBKA 3GHGB 4M2PA 1VL2A 3T97B 1FZGA 3CCUP 3S0FA 2KB7P 1B47A 2CPBA 1M45A 4EYYQ 1J7RA 3CR4X 2QJYC 1W2EA 3K1EA 3V2PA 1ZRTD 1QIVA 1VDFA 3BVHA 2H8VA 4A4BA 1MFZA 1SNLA 1BGYG 3UNWA 4MRXA 2ZT9C 2Z5IA 1YI2P 1BDCA 4H44C 2HQ8A 2ZRTA 4I5LB 1SBJA 3TDUA 1L4AD 3WHTB 1FF1A 5CCGA 1SFCB 2P2UA 1OXZA 2GGMA 2KK7A 3RL0B 4MZJA 3IN6A 1LTGC 3O2PA 1LKJA 4IL6E 4MZLA 1L0NK 3LK1A 1DT7B 1DC1A 2Q91A 4BY4A 4PE1A 1SL8A 2QEBA 1GM0A 2EC6B 2BNXA 1F71A 3GK1A 5CCHD 1WLZA 2P6BB 3NXAA 3Q8IA 2KYVA 3L70G 1FZFA 1OW8A 1AFOA 1E8AA 4FQTA 3OHMB 2XZRA 3CX5E 4YGDB 1RE3A 5TJHA 3OB2B 3F45A 1LVCD 3EK7A 2GTEA 2MLFC 2KGBC 4CPGA 4PCWA 1SQXK 3CYZA 3ZWHA 2YIUC 1YUTA 3HUSC 3H1LG 3H4SE 1R5LA 1Q90D 1LA3A 1S3JA 2BCCE 4F0ZB 1S36A 1F54A 1WMKA 3H1JJ 3V2RA 3AE7C 1URQA 3BFAA 3FS7A 4AOMA 2AEFA 4M2QA 2YMYA 4M2OA 1SQVJ 1SYMA 5BPJA 2LXBA 1RE4C 3JTDB 3OB1B 1M1JA 3GHGC 5CMZA 5KSZA 2A06G 1BU3A 2LMVA 2L50A 1LTJB 3BUNB 2LMUA 5KLVE 1KK7Y 2WCHA 1LT9B 1T2KC 2KSPA 2GV5A 5CBNA 1VPCA 1IFPA 2E74D 1VQPP 5AVUB 4U3FD 2H8PD 4D6TE 2WCJA 3NTNA 4TLFA 5EL2A 2MAZA 3CZTX 3M0AA 4N78E 3RBXA 3L72G 3NMDA 1SFCC 1CFDA 1PRWA 3BCCJ 3RL0C 1EDJA 5CJ4A 5FI2A 3BQ3A 4ETOA 1KORA 1U5IB 3PJSK 4WVZA 2ZVOB 1EXJA 5APWA 3IQQA 2BE4A 3OP0A 1SQXD 2EC6C 3CWBG 2R2IA 1D1OA 3A0HH 2K7DA 1C3YA 1EDKA 2XV5A 3FGAD 1CDMA 4F7FA 1YURA 1B1GA 4IFDK 1AP4A 1L0LG 1E5WA 4A4CA 1C7VA 3WXAA 1SQPK 1S6IA 3H1IJ 2YKOA 4W80A 5BU5A 1HGVA 1GU5A 2FXPA 1IO4A 4PHJA 1LWUB 2WZ7A 3RK2D 2JXCA 3AECC 2PFXA 2WTYA 1EZVI 3WNXB 2R5BA 5APQA 2PVBA 3S0GA 3S0EA 3H32B 2E76D 3HD7D 1TNWA 5H2FE 2KAXA 1PP9G 2F2PA 1WRLA 1N0YA 1EDIA 4MVFA 2M7NA 1BE3J 4GIFA 1CNPA 4GODA 3A7OA 3JTDC 5B66E 2HPCA 5D7FA 2BE6A 2LXCB 2SASA 1OZOA 2LHIA 4UB8H 1LTJC 2BEZF 3M0DA 1QL1A 5CJ0A 2E5YA 3S0DA 3VMYA 4HH2A 1TNQA 3CABA 3HE4B 2CBLA 5HKYA 1YX7A 3BOWB 1EQ7A 1FDOA 1X0TA 2E74B 1EZVG 4GKGA 1XK4C 1LT9C 1HF9A 1S5GY 1S26D 1PK0D 3MP7B 2FOTA 4OGQD 4ZNCA 3DXLA 3SJSA 1BGYE 3CXHE 3Q5RA 1KQLA 1UURA 3SG6A 1KQVA 3AAJA 4I5KA 1JCCA 2IBZE 2KAYA 2M0RA 3S9OA 1K8UA 3DVJA 1DJHA 4NDBA 1SQQG 2K9JB 1FE6A 2JT3A 1NU1K 3OJAB 1DJGA 1D7MA 2JNXA 1WLMA 1KILE 1PV3A 3A3YB 4I7ZB 3H1JD 2B88A 4QMAA 4GDOA 1KQFB 2QJPB 1SQPD 2WWWA 2OTGB 1SQVD 1R2UA 1QS7A 3CI9A 2KAVA 3TNUB 2LLSA 4INWA 3EFFK 3L70E 3TDKA 3RK2B 3WUUA 1XYDA 4GAOA 1OW6A 5L8RJ 1Z56A 3Q5PA 3SIBA 1MZ9A 3SS5A 2M5AA 4N5XA 1LWUC 3HD7B 1K9UA 2E76B 1TU3F 1CTRA 4MSPA 3G9RA 2KNEA 2L5GB 4MZKA 2WCLA 1FBVA 2PRUA 2M3WA 2LNKA 3H1LE 2Y1MA 1SMGA 5KKZB 2HG5D 2G9BA 2Y0DA 5AVYB 3G6EP 2O60A 1ZLLA 1CFPA 2HODB 2HR3A 3BCCD 3HUSA 2BCCJ 5F6TA 1TTXA 1NCZA 3B8EB 3R1OA 4PD4I 2A06E 3ITKA 3VROA 3S0BA 2WVRA 3M0WA 4OGQB 2QEHA 1SL9A 2E74C 1DH3A 1RY3A 3GHGA 3BUMB 3SG3A 5KLVJ 1XO5A 3T97A 1PPJD 2R3CA 2E75B 2LHLA 2M97A 3H1ID 2G3AA 1YR5A 3E3RA 1CKKA 2ZXEB 3I56P 4LLHA 1QLED 1NAYA 4RO0A 1LTBC 3Q5SA 3GOFA 1KYOD 3DVKA 1CM4A 3L72E 1UHJA 4D6TJ 5HL1A 4I7ZC 3G71P 1UHIA 2W6AA 2A45I 4YPCA 1VQ7P 3IF7A 1R5SA 4CLNA 2NPSB 1LTTC 1DEBA 2QJPC 1ZXGA 3CCQP 1ZR2A 2JT0A 2OTGC 4JPZB 1BR4B 2IFMA 1W7JB 3AAKA 5CBOA 4W7ZA 1F8HA 3BATA 1IRJA 3CWBE 1LTIC 3FXDA 1SFCA 1P84I 3RK2C 1VQOP 3D0YB 3GK2A 3HTKB 1YJ9P 4NPFX 3KPEA 1FJPA 4AUWA 1DJZA 2QM7A 1XFUO 1LS8A 1L0LE 2D2CD 3HD7C 1AJYA 2E76C 2O1KA 2NZ2A 1NTKK 5AW5B 3RK3D 1XFVO 1DEEG 3D73A 3CGAA 1ALWA 1PSBA 2A45G 4GOEA 1RK9A 5KKZC 3FE9A 4GBAA 1AV1A 1GZLA 4ASVA 2FXOA 3VTPC 5AW0B 2WPSA 3EVUA 2OS8B 2SPZA 1PP9E 1NYHA 3D6YA 3N7HA 1XFWO 3RL0g 2WSEH 2KLDA 3R4YA 2DW3A 5KAFE 3LL8B 1K94A 2P7JA 2I2RE 1IZNB 5D69A 2H89C 4E68A 2Y0CA 4OGQC 2WPQA 3N4XA 4H44D 2LLTA 2WOSA 4XA4A 2R5DA 3CR2A 5HLVA 2V7QJ 1IQ5A 4UB6E 1EZVE 4H13B 2ERBA 2WC8A 4OV2A 2AEMA 2JPOA 2E75C 1J1DB 3H25A 1H0TB 3R1VA 2FYUK 1EC5A 1VQKP 4ZMDA 2PYQA 1XFXO 3CX5D 1N8RQ 5KLIB 1BGYJ 2KI7B 3R72A 3OX6A 1X79B 3SFDC 1ZMEC 1CM1A 3KO0A 3L71G 1SQQE 2Z4EA 1L4AA 1SKTA 4R1EA 2IPPA 2R32A 4BWNA 1PALA 2NPSC 3EKHA 1NTMG 1OWAA 2WT7B 1OW7A 5KTYA 1YJWP 1FOSF 3U59A 4Z1MH 1V1GA 3IAOA 1NTKD 2RMZA 2BCCD 3Q2YA 1PSRA 2L4HA 1VQ6P 4ZKUA 1G2CB 5CCHA 3BYAA 3D78A 1G8IA 2BCBA 3L73G 2LUXA 1IIOA 3V2QA 3I5HB 1EL4A 2WSFH 2H43A 1SRAA 4B86A 4DCKA 2OYOA 1VQNP 5ER4X 5KLVG 1KFMA 1KFNA 4U8DA 1GMJA 4WQ3A 4M3LA 2ZXXA 1EH2A 1TN4A 2ZKMX 4KHXA 1TNXA 4C0JA 2XDJA 2BECA 2OS8C 4W7YA 1MXEA 5AERA 2P67A 1RROA 3H1LJ 2WITA 3FWNA 4ZCVA 3CTNA 4D6TG 1SY9A 4WWIA 1UHHA 1HT9A 2K8MB 2KOGA
chains in the Genus database with same CATH topology
2MLFC 4HRHA 1AJ4A 2KGBC 1FI6A 4HSZA 4PCWA 1SR6C 3ZWHA 3EK4A 1YUTA 1NIWA 2WCEA 1GGWA 3H4SE 1JWDA 2LE9B 1KFUS 4MLWA 3VRNA 1QLKA 4C0LA 2BCXA 3HCMA 1B4CA 3PFVA 1CLBA 4IL1A 1LA3A 1UHNA 5DKQA 5CSFA 1JF2A 1F4OA 1DJYA 1H8BA 3BUWB 2K7BA 4WQ2A 1IJ6A 2NCOA 1S36A 2PMYA 2H61A 4DRWA 4F0ZB 1F54A 2M9GA 3JVTB 2M7LA 2AMIA 3FS7A 4AOMA 2B1UA 3PSRA 1NX1A 4M2QA 4M2OA 1SYMA 5BPJA 2MLEC 2TN4A 2KBMA 2KOTA 3DF0B 1DF0B 3JTDB 3OB1B 4CFRA 1IQ3A 1K95A 4I5JA 3BOWA 1JC2A 2KYCA 4JQ0D 2Y4QA 4XYNA 5KSZA 2KFFA 1BU3A 2LVVA 4XJKA 3A4UB 1W7IB 1JF0A 4L9MA 3I5FB 2LMVA 2L50A 3I5GB 1OE9B 3LCPC 4OKHA 3BUNB 2LMUA 1K90D 1KK7Y 2KFHA 3O6BA 4ICBA 3HX4A 2BBMA 2KDHA 3SG4A 2FCDA 4QJ4B 4GGNA 3NSKA 2KSPA 5CSNA 2I94A 2GV5A 1KCYA 3CLNA 5G08A 1C7WA 1Y1AA 1YTZC 2D8NA 4YI8A 1Y0VH 2JTZA 1J1EA 1JBAA 1EG4A 2MAZA 3CZTX 3I5HC 1IWQA 3EKJA 1NSHA 1AJ5A 2CTNA 4QJ3B 1J55A 1BOCA 1CFDA 1GJYA 1PRWA 3EVVA 3TDZA 1XVJA 2E6WA 1XK4A 1NUBA 2EGDA 3BQ3A 4ETOA 1FW4A 2M29A 1XFZO 1AHRA 1U5IB 1KFXS 1J7OA 2JQ6A 3O4YA 3BUOB 2M1KB 3IQQA 2BE4A 1YUSA 1SW8A 1TCFA 2EC6C 3NSLA 2LC5A 2R2IA 3OP0A 4UPGA 1D1OA 2K7DA 1A2XA 2CT9A 1M46A 2MJWB 1CDMA 2LP3A 2L4IA 1TCOB 1WRKA 1YURA 1OMRA 1KK7Z 1B1GA 1UWOA 3DD4A 1AP4A 2FJUB 3TUYB 1N65A 5PALA 4A4CA 1U5IA 2H2KA 2HQWA 1C7VA 1KSOA 3WXAA 1S6IA 1MR8A 1QJTA 2KI6C 1QXPA 4PHJA 1FI5A 2JXCA 4HREE 1EG3A 2Q4UA 1G4YR 2BCAA 1RWYA 3WNXB 2BBNA 4OR9B 3RLZA 4TNCA 4MBEA 2G2BA 1KK8B 2PVBA 2V53A 1TNWA 2LAPA 2KAXA 3FWBA 3JVTC 4OCIA 2F2PA 1WRLA 1N0YA 2K7CA 4MVFA 1B7TY 2M7NA 3IQOA 3VGOA 1CB1A 2F2OA 1CNPA 3FWCA 1IJ5A 2M8UA 3JTDC 3O78A 4GFTA 5JJGA 1Y1XA 5D7FA 2BE6A 2LMTA 1QVIY 2L5XB 2KBIA 2SASA 1OZOA 3I5FC 2LHIA 1LA0A 3I5GC 4AQJA 3K21A 4ORBB 1DMOA 2F33A 3I5IB 3VRPA 4I5NB 4DUQA 2MHHA 3OX5A 1IG5A 1TNQA 3MSEB 2CBLA 5HKYA 1YX7A 2LVIA 3BOWB 1MWNA 5B8IB 1XK4C 2KI4B 1S5GY 2ZN8A 1S26D 1PK0D 4WRIA 4XJKB 3TS5B 1MHOA 5HKZA 2FOTA 1NX0A 3TZ1A 2JWWA 1YUUA 3ICBA 3SJSA 2GGZA 2JPTA 4N1FA 1UURA 3SG6A 4MEWA 1F4QA 1K9KA 4DS7A 1AK8A 1KQVA 2F3YA 1QTXA 3AAJA 2JC2A 3GK4X 4I5KA 1Q80A 2KAYA 2M0RA 2JU0A 2K7OA 4PDZA 1K8UA 2WCFA 3DVJA 4PE0A 1DJHA 4NDBA 2JNFA 1TRFA 2ZNEA 3EK8A 2COLB 3SG5A 1RECA 2KGRA 2SCPA 1GGZA 3KEVA 2NLNA 5JOLA 4ORAB 2JT3A 3LK0A 1OMVA 1DJGA 1QASA 2JNXA 1WLMA 1G33A 1B7TZ 3SG2A 5I8NA 1NYAA 5J3XA 4YGBB 1CDPA 3KHEA 1WRZA 3D0YA 2QACA 1DGVA 4AQIA 1BLQA 2KQYA 1SCVA 1VRKA 2BKHB 2WORA 1FPWA 1QVIZ 2OTGB 1R2UA 1QS7A 2KAVA 1CDLA 4NDDA 1KFUL 2CNPA 4YI9A 2LLSA 4PE7A 1YVHA 3C1VA 1PVAA 4YGCB 1KQMB 2HPSA 1QV1A 4ORCB 3TUYC 2EHBA 1XYDA 1LINA 3PALA 2HF5A 2Y1NA 2LLUA 4GAOA 1CLLA 2L2EA 1S5GZ 3SIBA 2A4JA 4N5XA 1K9UA 2CXJA 3PN7B 1CTRA 1DJXA 4HRGA 4MSPA 2KNEA 3CR5X 4MZKA 1F70A 1FBVA 2PRUA 2K2AA 2LNKA 2M3WA 1UP5A 2JULA 1KK8C 2LCPA 5KU1A 2Y1MA 2MBXA 1JFJA 2DOQA 1SMGA 1SPYA 4GGFA 1NCXA 1ZMZA 2G9BA 1B8CA 4PALA 2O60A 2ZRSA 1CFPA 1CLMA 1YRUB 3VRQA 2LUCA 4NQGA 5F6TA 1JSAA 1TTXA 2H61C 1NCZA 2BL0B 2E30A 2I7AA 2QPTA 4CFQA 3I5IC 2FCEA 2OPOA 3VROA 1L2OB 1J1DA 3M0WA 4JWQA 5CSJA 1DGUA 1SL9A 2F8PA 1Y1UA 2AUCA 2Y5IA 1J7QA 2KI4C 2RGIA 1M39A 3TS5C 2LVJA 1UUSA 1NCYA 4N1GA 1JUOA 2K2FA 2AAOA 1TNPA 3BUMB 1B9AA 3SG3A 3FIAA 1QX2A 1XO5A 1UHKA 1KFXL 4D1EA 2JZIA 1NPQA 2NXQA 2LHLA 2M97A 3KPXA 5HLOA 1YR5A 4NDCA 3E3RA 1K9PA 1CKKA 1SCMB 3PM8A 1L7ZA 5AANA 4GNKB 3GOFA 2L51A 3DVKA 1C07A 1QATA 2KYFA 1CM4A 1UHJA 1CMGA 2ZFDA 5I2OA 1CDNA 1BR1B 1UHIA 4GPLB 3SG7A 1CFCA 1HQVA 3IF7A 1CMFA 4CLNA 1X02A 3BXKA 2JT0A 3D10A 2OTGC 1F55A 5DKNA 4JPZB 1BR4B 2L0PA 4QJ5B 1QV0A 1W7JB 3AAKA 5AFPA 3DVMA 1F8HA 2HETA 5FYXA 1IRJA 2LANA 2BKIB 4C0KA 1K96A 1KQMC 4GGFC 2VRGA 1RJVA 3D0YB 3GK2A 2LVKA 1MXLC 2F3ZA 1BF5A 1DJZA 1K93D 2JXLA 1BG1A 1XFUO 4YBHB 1WDCB 3QRXA 1BT6A 2K0JA 4MN0A 3A8RA 3CWGA 3PN7C 1S6CA 5CSIA 1ZUZA 2M49B 1XFVO 1A4PA 1M31A 3CGAA 1XA5A 2MA2A 1BMOA 3DVEA 1ALWA 1PSBA 1R6PA 3CS1A 1RK9A 1DVIA 4FTGA 1TIZA 4CPVA 1S6JA 2KHNA 4GBAA 2ZN9A 1B8RA 1QX7A 1KWOB 1EXRA 1BJFA 1EJ3A 1YX8A 3EVUA 3NSOA 2OS8B 1ZOTB 1K2HA 3PATA 1XFWO 1MF8B 1PVBA 3PLFB 1QX5B 5AXIA 4YRUA 3LL8B 2BL0C 2KFGA 2NCPA 4YGAA 1A03A 2ISDA 1GQMA 3LLEA 2PSRA 1K94A 1RTP1 2I2RE 3NSIA 2PALA 5D69A 1L2OC 1KSMA 4E68A 1JFKA 1QLSA 1SR6B 1QIWA 1ODBA 1XFYO 2ZNDA 2IS9A 3KF9A 2KQ6A 2LLTA 1S3PA 1SL7A 2WOSA 3DF0A 1DF0A 1J7PA 4PHNA 4YGEB 3CR2A 1ZFSA 5HLVA 5I2LA 1CFFA 1IQ5A 2PASA 3BUXB 2CCMA 3EVRA 1A75B 2KI6D 1N2DA 5K89A 4DIRA 1ALVA 1YRTB 2WC8A 4P5OE 4OV2A 1PULA 5AEQA 2LV7A 2LP2A 1AVSA 1SCMC 4BY5A 5IBWA 2Y9ZA 1XFXO 2JRFA 5ER5A 1OZSA 4M2PA 1NP8A 3OX6A 1CM1A 3KO0A 3VRRA 1A75A 1SKTA 4R1EA 3WHUB 1B47A 1ZACA 1IGVA 2JT8A 1PALA 5DKRA 1M45A 3EKHA 1AUIB 1J7RA 3CR4X 4MRYA 4USLA 2Y9YA 5KTYA 5HKWA 1IH0A 1QIVA 4A4BA 2JOJA 1SNLA 2LM5A 3RM1A 1V1GA 4MRXA 1OFCX 4Q04A 1A29A 1LXFC 1PSRA 2L4HA 4PHKA 4PHMA 2HQ8A 2ZRTA 4I5LB 1SBJA 1OMDA 3TDUA 3BYAA 1G8IA 2WCBA 2BCBA 1DJWA 1MUXA 2LUXA 1WDCC 1S1EA 3I5HB 1EL4A 1NWDA 2I18A 3WHTB 1SRAA 1DTLA 1B8LA 1IKUA 1FF1A 1WY9A 4DCKA 2GGMA 2L98A 1BODA 1Y6WA 4OVNF 5ER4X 3SIAA 3TDIA 1M63B 4MZJA 4U8DA 3ZNIA 1DJIA 5CPVA 4WQ3A 3O2PA 4PE4A 2NZ0A 1LKJA 1SK6D 4MZLA 1EH2A 3LK1A 1DT7B 1NX3A 5GQQC 2Q91A 4FQOA 4CIDA 1TN4A 4BY4A 1MQ1A 2ZKMX 1KWOC 4PE1A 1TNXA 4C0JA 1SL8A 4P2YB 2O5GA 2BECA 2EC6B 2OS8C 1F71A 2K61A 1TOPA 3GK1A 5HYDA 1MXEA 5AERA 4ZCUA 2MRDA 1RROA 2JTTA 1WLZA 2P6BB 3NXAA 5I2QA 1YVLA 4ZCVA 1E8AA 3CTNA 1OOJA 1HT9A 3OHMB 1NX2A 4GUKA 3AKAA 1SY9A 1OQPA 5TNCA 1OSAA 1V1FA 4YGDB 1UHHA 3AKBA 2M1UA 1H4BA 2WNDA 3OB2B 3F45A 1RFJA 1LVCD 2K8MB 3EK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLF C;  4HRH A;  1AJ4 A;  2KGB C;  1FI6 A;  4HSZ A;  4PCW A;  1SR6 C;  3ZWH A;  3EK4 A;  1YUT A;  1NIW A;  2WCE A;  1GGW A;  3H4S E;  1JWD A;  2LE9 B;  1KFU S;  4MLW A;  3VRN A;  1QLK A;  4C0L A;  2BCX A;  3HCM A;  1B4C A;  3PFV A;  1CLB A;  4IL1 A;  1LA3 A;  1UHN A;  5DKQ A;  5CSF A;  1JF2 A;  1F4O A;  1DJY A;  1H8B A;  3BUW B;  2K7B A;  4WQ2 A;  1IJ6 A;  2NCO A;  1S36 A;  2PMY A;  2H61 A;  4DRW A;  4F0Z B;  1F54 A;  2M9G A;  3JVT B;  2M7L A;  2AMI A;  3FS7 A;  4AOM A;  2B1U A;  3PSR A;  1NX1 A;  4M2Q A;  4M2O A;  1SYM A;  5BPJ A;  2MLE C;  2TN4 A;  2KBM A;  2KOT A;  3DF0 B;  1DF0 B;  3JTD B;  3OB1 B;  4CFR A;  1IQ3 A;  1K95 A;  4I5J A;  3BOW A;  1JC2 A;  2KYC A;  4JQ0 D;  2Y4Q A;  4XYN A;  5KSZ A;  2KFF A;  1BU3 A;  2LVV A;  4XJK A;  3A4U B;  1W7I B;  1JF0 A;  4L9M A;  3I5F B;  2LMV A;  2L50 A;  3I5G B;  1OE9 B;  3LCP C;  4OKH A;  3BUN B;  2LMU A;  1K90 D;  1KK7 Y;  2KFH A;  3O6B A;  4ICB A;  3HX4 A;  2BBM A;  2KDH A;  3SG4 A;  2FCD A;  4QJ4 B;  4GGN A;  3NSK A;  2KSP A;  5CSN A;  2I94 A;  2GV5 A;  1KCY A;  3CLN A;  5G08 A;  1C7W A;  1Y1A A;  1YTZ C;  2D8N A;  4YI8 A;  1Y0V H;  2JTZ A;  1J1E A;  1JBA A;  1EG4 A;  2MAZ A;  3CZT X;  3I5H C;  1IWQ A;  3EKJ A;  1NSH A;  1AJ5 A;  2CTN A;  4QJ3 B;  1J55 A;  1BOC A;  1CFD A;  1GJY A;  1PRW A;  3EVV A;  3TDZ A;  1XVJ A;  2E6W A;  1XK4 A;  1NUB A;  2EGD A;  3BQ3 A;  4ETO A;  1FW4 A;  2M29 A;  1XFZ O;  1AHR A;  1U5I B;  1KFX S;  1J7O A;  2JQ6 A;  3O4Y A;  3BUO B;  2M1K B;  3IQQ A;  2BE4 A;  1YUS A;  1SW8 A;  1TCF A;  2EC6 C;  3NSL A;  2LC5 A;  2R2I A;  3OP0 A;  4UPG A;  1D1O A;  2K7D A;  1A2X A;  2CT9 A;  1M46 A;  2MJW B;  1CDM A;  2LP3 A;  2L4I A;  1TCO B;  1WRK A;  1YUR A;  1OMR A;  1KK7 Z;  1B1G A;  1UWO A;  3DD4 A;  1AP4 A;  2FJU B;  3TUY B;  1N65 A;  5PAL A;  4A4C A;  1U5I A;  2H2K A;  2HQW A;  1C7V A;  1KSO A;  3WXA A;  1S6I A;  1MR8 A;  1QJT A;  2KI6 C;  1QXP A;  4PHJ A;  1FI5 A;  2JXC A;  4HRE E;  1EG3 A;  2Q4U A;  1G4Y R;  2BCA A;  1RWY A;  3WNX B;  2BBN A;  4OR9 B;  3RLZ A;  4TNC A;  4MBE A;  2G2B A;  1KK8 B;  2PVB A;  2V53 A;  1TNW A;  2LAP A;  2KAX A;  3FWB A;  3JVT C;  4OCI A;  2F2P A;  1WRL A;  1N0Y A;  2K7C A;  4MVF A;  1B7T Y;  2M7N A;  3IQO A;  3VGO A;  1CB1 A;  2F2O A;  1CNP A;  3FWC A;  1IJ5 A;  2M8U A;  3JTD C;  3O78 A;  4GFT A;  5JJG A;  1Y1X A;  5D7F A;  2BE6 A;  2LMT A;  1QVI Y;  2L5X B;  2KBI A;  2SAS A;  1OZO A;  3I5F C;  2LHI A;  1LA0 A;  3I5G C;  4AQJ A;  3K21 A;  4ORB B;  1DMO A;  2F33 A;  3I5I B;  3VRP A;  4I5N B;  4DUQ A;  2MHH A;  3OX5 A;  1IG5 A;  1TNQ A;  3MSE B;  2CBL A;  5HKY A;  1YX7 A;  2LVI A;  3BOW B;  1MWN A;  5B8I B;  1XK4 C;  2KI4 B;  1S5G Y;  2ZN8 A;  1S26 D;  1PK0 D;  4WRI A;  4XJK B;  3TS5 B;  1MHO A;  5HKZ A;  2FOT A;  1NX0 A;  3TZ1 A;  2JWW A;  1YUU A;  3ICB A;  3SJS A;  2GGZ A;  2JPT A;  4N1F A;  1UUR A;  3SG6 A;  4MEW A;  1F4Q A;  1K9K A;  4DS7 A;  1AK8 A;  1KQV A;  2F3Y A;  1QTX A;  3AAJ A;  2JC2 A;  3GK4 X;  4I5K A;  1Q80 A;  2KAY A;  2M0R A;  2JU0 A;  2K7O A;  4PDZ A;  1K8U A;  2WCF A;  3DVJ A;  4PE0 A;  1DJH A;  4NDB A;  2JNF A;  1TRF A;  2ZNE A;  3EK8 A;  2COL B;  3SG5 A;  1REC A;  2KGR A;  2SCP A;  1GGZ A;  3KEV A;  2NLN A;  5JOL A;  4ORA B;  2JT3 A;  3LK0 A;  1OMV A;  1DJG A;  1QAS A;  2JNX A;  1WLM A;  1G33 A;  1B7T Z;  3SG2 A;  5I8N A;  1NYA A;  5J3X A;  4YGB B;  1CDP A;  3KHE A;  1WRZ A;  3D0Y A;  2QAC A;  1DGV A;  4AQI A;  1BLQ A;  2KQY A;  1SCV A;  1VRK A;  2BKH B;  2WOR A;  1FPW A;  1QVI Z;  2OTG B;  1R2U A;  1QS7 A;  2KAV A;  1CDL A;  4NDD A;  1KFU L;  2CNP A;  4YI9 A;  2LLS A;  4PE7 A;  1YVH A;  3C1V A;  1PVA A;  4YGC B;  1KQM B;  2HPS A;  1QV1 A;  4ORC B;  3TUY C;  2EHB A;  1XYD A;  1LIN A;  3PAL A;  2HF5 A;  2Y1N A;  2LLU A;  4GAO A;  1CLL A;  2L2E A;  1S5G Z;  3SIB A;  2A4J A;  4N5X A;  1K9U A;  2CXJ A;  3PN7 B;  1CTR A;  1DJX A;  4HRG A;  4MSP A;  2KNE A;  3CR5 X;  4MZK A;  1F70 A;  1FBV A;  2PRU A;  2K2A A;  2LNK A;  2M3W A;  1UP5 A;  2JUL A;  1KK8 C;  2LCP A;  5KU1 A;  2Y1M A;  2MBX A;  1JFJ A;  2DOQ A;  1SMG A;  1SPY A;  4GGF A;  1NCX A;  1ZMZ A;  2G9B A;  1B8C A;  4PAL A;  2O60 A;  2ZRS A;  1CFP A;  1CLM A;  1YRU B;  3VRQ A;  2LUC A;  4NQG A;  5F6T A;  1JSA A;  1TTX A;  2H61 C;  1NCZ A;  2BL0 B;  2E30 A;  2I7A A;  2QPT A;  4CFQ A;  3I5I C;  2FCE A;  2OPO A;  3VRO A;  1L2O B;  1J1D A;  3M0W A;  4JWQ A;  5CSJ A;  1DGU A;  1SL9 A;  2F8P A;  1Y1U A;  2AUC A;  2Y5I A;  1J7Q A;  2KI4 C;  2RGI A;  1M39 A;  3TS5 C;  2LVJ A;  1UUS A;  1NCY A;  4N1G A;  1JUO A;  2K2F A;  2AAO A;  1TNP A;  3BUM B;  1B9A A;  3SG3 A;  3FIA A;  1QX2 A;  1XO5 A;  1UHK A;  1KFX L;  4D1E A;  2JZI A;  1NPQ A;  2NXQ A;  2LHL A;  2M97 A;  3KPX A;  5HLO A;  1YR5 A;  4NDC A;  3E3R A;  1K9P A;  1CKK A;  1SCM B;  3PM8 A;  1L7Z A;  5AAN A;  4GNK B;  3GOF A;  2L51 A;  3DVK A;  1C07 A;  1QAT A;  2KYF A;  1CM4 A;  1UHJ A;  1CMG A;  2ZFD A;  5I2O A;  1CDN A;  1BR1 B;  1UHI A;  4GPL B;  3SG7 A;  1CFC A;  1HQV A;  3IF7 A;  1CMF A;  4CLN A;  1X02 A;  3BXK A;  2JT0 A;  3D10 A;  2OTG C;  1F55 A;  5DKN A;  4JPZ B;  1BR4 B;  2L0P A;  4QJ5 B;  1QV0 A;  1W7J B;  3AAK A;  5AFP A;  3DVM A;  1F8H A;  2HET A;  5FYX A;  1IRJ A;  2LAN A;  2BKI B;  4C0K A;  1K96 A;  1KQM C;  4GGF C;  2VRG A;  1RJV A;  3D0Y B;  3GK2 A;  2LVK A;  1MXL C;  2F3Z A;  1BF5 A;  1DJZ A;  1K93 D;  2JXL A;  1BG1 A;  1XFU O;  4YBH B;  1WDC B;  3QRX A;  1BT6 A;  2K0J A;  4MN0 A;  3A8R A;  3CWG A;  3PN7 C;  1S6C A;  5CSI A;  1ZUZ A;  2M49 B;  1XFV O;  1A4P A;  1M31 A;  3CGA A;  1XA5 A;  2MA2 A;  1BMO A;  3DVE A;  1ALW A;  1PSB A;  1R6P A;  3CS1 A;  1RK9 A;  1DVI A;  4FTG A;  1TIZ A;  4CPV A;  1S6J A;  2KHN A;  4GBA A;  2ZN9 A;  1B8R A;  1QX7 A;  1KWO B;  1EXR A;  1BJF A;  1EJ3 A;  1YX8 A;  3EVU A;  3NSO A;  2OS8 B;  1ZOT B;  1K2H A;  3PAT A;  1XFW O;  1MF8 B;  1PVB A;  3PLF B;  1QX5 B;  5AXI A;  4YRU A;  3LL8 B;  2BL0 C;  2KFG A;  2NCP A;  4YGA A;  1A03 A;  2ISD A;  1GQM A;  3LLE A;  2PSR A;  1K94 A;  1RTP 1;  2I2R E;  3NSI A;  2PAL A;  5D69 A;  1L2O C;  1KSM A;  4E68 A;  1JFK A;  1QLS A;  1SR6 B;  1QIW A;  1ODB A;  1XFY O;  2ZND A;  2IS9 A;  3KF9 A;  2KQ6 A;  2LLT A;  1S3P A;  1SL7 A;  2WOS A;  3DF0 A;  1DF0 A;  1J7P A;  4PHN A;  4YGE B;  3CR2 A;  1ZFS A;  5HLV A;  5I2L A;  1CFF A;  1IQ5 A;  2PAS A;  3BUX B;  2CCM A;  3EVR A;  1A75 B;  2KI6 D;  1N2D A;  5K89 A;  4DIR A;  1ALV A;  1YRT B;  2WC8 A;  4P5O E;  4OV2 A;  1PUL A;  5AEQ A;  2LV7 A;  2LP2 A;  1AVS A;  1SCM C;  4BY5 A;  5IBW A;  2Y9Z A;  1XFX O;  2JRF A;  5ER5 A;  1OZS A;  4M2P A;  1NP8 A;  3OX6 A;  1CM1 A;  3KO0 A;  3VRR A;  1A75 A;  1SKT A;  4R1E A;  3WHU B;  1B47 A;  1ZAC A;  1IGV A;  2JT8 A;  1PAL A;  5DKR A;  1M45 A;  3EKH A;  1AUI B;  1J7R A;  3CR4 X;  4MRY A;  4USL A;  2Y9Y A;  5KTY A;  5HKW A;  1IH0 A;  1QIV A;  4A4B A;  2JOJ A;  1SNL A;  2LM5 A;  3RM1 A;  1V1G A;  4MRX A;  1OFC X;  4Q04 A;  1A29 A;  1LXF C;  1PSR A;  2L4H A;  4PHK A;  4PHM A;  2HQ8 A;  2ZRT A;  4I5L B;  1SBJ A;  1OMD A;  3TDU A;  3BYA A;  1G8I A;  2WCB A;  2BCB A;  1DJW A;  1MUX A;  2LUX A;  1WDC C;  1S1E A;  3I5H B;  1EL4 A;  1NWD A;  2I18 A;  3WHT B;  1SRA A;  1DTL A;  1B8L A;  1IKU A;  1FF1 A;  1WY9 A;  4DCK A;  2GGM A;  2L98 A;  1BOD A;  1Y6W A;  4OVN F;  5ER4 X;  3SIA A;  3TDI A;  1M63 B;  4MZJ A;  4U8D A;  3ZNI A;  1DJI A;  5CPV A;  4WQ3 A;  3O2P A;  4PE4 A;  2NZ0 A;  1LKJ A;  1SK6 D;  4MZL A;  1EH2 A;  3LK1 A;  1DT7 B;  1NX3 A;  5GQQ C;  2Q91 A;  4FQO A;  4CID A;  1TN4 A;  4BY4 A;  1MQ1 A;  2ZKM X;  1KWO C;  4PE1 A;  1TNX A;  4C0J A;  1SL8 A;  4P2Y B;  2O5G A;  2BEC A;  2EC6 B;  2OS8 C;  1F71 A;  2K61 A;  1TOP A;  3GK1 A;  5HYD A;  1MXE A;  5AER A;  4ZCU A;  2MRD A;  1RRO A;  2JTT A;  1WLZ A;  2P6B B;  3NXA A;  5I2Q A;  1YVL A;  4ZCV A;  1E8A A;  3CTN A;  1OOJ A;  1HT9 A;  3OHM B;  1NX2 A;  4GUK A;  3AKA A;  1SY9 A;  1OQP A;  5TNC A;  1OSA A;  1V1F A;  4YGD B;  1UHH A;  3AKB A;  2M1U A;  1H4B A;  2WND A;  3OB2 B;  3F45 A;  1RFJ A;  1LVC D;  2K8M B;  3EK7 A; 
#chains in the Genus database with same CATH topology
 5BVZ A;  1FI6 A;  3V4Q A;  4HSZ A;  2WSC J;  3TK1 A;  2E43 A;  1G1I A;  4GT1 A;  2WCE A;  1U7M A;  3U1A A;  2LE9 B;  1KFU S;  3H1K D;  2Z5H A;  4C0L A;  4MN4 C;  2FYZ A;  5E79 E;  1F4O A;  4H13 C;  1M90 Q;  3OA7 A;  3BUW B;  1JY2 O;  3TGU D;  1SSE B;  2PMY A;  4DRW A;  1RF1 B;  3RL0 D;  1J1D C;  1M57 D;  1BDD A;  2M7L A;  2OQQ A;  1KB9 H;  3F89 A;  2B1U A;  2M0B A;  4CFR A;  3DF0 B;  2KOT A;  1IQ3 A;  3CCM P;  1NTZ G;  3BOW A;  1JEK A;  5KLI C;  2KYC A;  4JQ0 D;  2Y4Q A;  1SS1 A;  1H88 A;  2KFF A;  2LVV A;  2PP6 A;  3USS A;  1KMI Z;  1N86 A;  3LCP C;  4NPD A;  2XND H;  3HX4 A;  4PD4 E;  2BBM A;  2KDH A;  3QME A;  3LW5 J;  3SG4 A;  2FXM A;  3L72 J;  3NSK A;  2I8D A;  1SQB E;  2K9J A;  4HJG H;  5G08 A;  1OZH A;  2D8N A;  3FWL A;  2PRR A;  3I5H C;  1M1K Q;  1AJ5 A;  3DYE A;  3CWB J;  1J55 A;  3CZ2 A;  1GJY A;  4KJM A;  2E6W A;  3CCV P;  1N73 B;  3TNU A;  1FW4 A;  1U57 A;  1DIP A;  5FI7 A;  1KFX S;  3Q1M A;  1L0L J;  3O4Y A;  1SW8 A;  1TCF A;  3NSL A;  2LC5 A;  3C8V A;  1DX7 A;  3D77 A;  1TUZ A;  3M9H A;  3HD7 A;  1TCO B;  1FZB A;  5AW4 B;  1BGY D;  3CCR P;  1SP4 A;  1OMR A;  3CXH D;  1KK7 Z;  1OX3 A;  2OYH A;  2IBZ G;  3B6X A;  3EFG A;  1JY3 O;  3SSU A;  3TUY B;  1N65 A;  1P84 E;  2BEQ D;  5B5E H;  2YGU A;  1PP9 J;  3CDN A;  2N1T D;  1OVR A;  4L75 A;  3OAK A;  1EXI A;  1KIL D;  3G4S P;  4OR9 B;  2JO1 A;  1KK8 B;  1RF1 C;  4OCI A;  1JMM A;  2KSE A;  4BXL A;  1PGJ A;  2K7C A;  2V4H A;  1B7T Y;  1N7S D;  1CB1 A;  2Y0E A;  5JJG A;  3O78 A;  1YTZ I;  3GG2 A;  2GUS A;  1QGK B;  1AA0 A;  3GF7 A;  1QVI Y;  2L5X B;  2KBI A;  4C7N B;  3L70 D;  1FZC B;  1LA0 A;  2KNC A;  4AQJ A;  1DMO A;  2RH0 A;  3K5B A;  1JM0 A;  3I5I B;  3VRP A;  3L71 E;  3KZI H;  1Q7Y Q;  2LVI A;  2N9B A;  1MWN A;  1NTM E;  3L74 G;  2FFD B;  2KI4 B;  3CC7 P;  3H1L D;  4WRI A;  1GW4 A;  4XJK B;  1SQQ J;  3M9Q A;  1MHO A;  3KHU A;  5AW7 B;  4ASW A;  1VF5 B;  2JPT A;  1HH0 A;  2JEE A;  1LTA C;  3ZDM A;  4MEW A;  1F4Q A;  1K9K A;  4DS7 A;  4I1L A;  3VN0 A;  1S72 P;  2F3Y A;  1Q80 A;  4PE0 A;  3L75 D;  2GUV A;  4PJ0 E;  2ZNE A;  2COL B;  3L73 E;  3SG5 A;  1N73 C;  1IFI A;  2WMM A;  4DZO A;  3EQ2 A;  1OMV A;  3DZT A;  5KAI H;  3LID A;  5J3X A;  3B5N B;  1J1E B;  1USD A;  1Q82 Q;  1WRZ A;  3D0Y A;  3HTK A;  1DGV A;  2AXT H;  4AQI A;  1LJ2 A;  2BKH B;  1FPW A;  2Q9I A;  2QEV A;  1JNM A;  1ZOY C;  4NDD A;  4I6M C;  1VQ9 P;  4PE7 A;  1M7L A;  1YVH A;  2LKM A;  1KQM B;  3F5H A;  2N1T B;  3TUY C;  2MJZ A;  1CSB A;  2Y1N A;  2LLU A;  2M3E A;  1WT6 A;  3E1I A;  1S5G Z;  1KIL B;  1FBM A;  3A0B H;  1JUN A;  4K35 A;  4BRY B;  3L72 D;  2W6B A;  1N7S B;  1BSH A;  1KK8 C;  2DOQ A;  4GGF A;  1L0N G;  1QL2 A;  3CZ1 A;  1ZMZ A;  4GOF A;  1B8C A;  3E1R A;  1IFJ A;  2G8Y A;  5CHX A;  3QWO C;  3L4A A;  2E30 A;  1NTZ E;  2NRG A;  2QPT A;  3I5I C;  1L0L D;  1SQV K;  1J1D A;  1H0T A;  1FJK A;  2CK3 H;  4EOT A;  2O01 H;  2AUC A;  4EDF A;  2FFD C;  2KI4 C;  1R8E A;  2PAJ A;  3D71 A;  3L47 A;  2LVJ A;  1UUS A;  1NCY A;  4N1G A;  2YNY A;  2JKV A;  2AAO A;  1B9A A;  1OVV A;  1VF5 C;  1FAV A;  2YO2 A;  1H89 A;  3PH0 A;  1JOC A;  3P8C E;  4AYC A;  5HLO A;  1PP9 D;  4KYN A;  1TWO A;  3PM8 A;  1L7Z A;  1SQB J;  1Q86 Q;  4GNK B;  1MV8 A;  3V2N A;  1NHL A;  2L51 A;  1FZE A;  4C7R A;  1CMG A;  1KQG B;  3B5N C;  1NVO A;  1J1E C;  3VP9 A;  3VP8 A;  1HQV A;  1CMF A;  2KS1 A;  1OOG A;  3D10 A;  3HE5 B;  2L0P A;  3VMA A;  3O6Q B;  2C9N Y;  1KQM C;  2N1T C;  2LVK A;  3O8Z A;  3RBZ A;  3N7N A;  3WUT A;  1KIL C;  1BF5 A;  2JXL A;  2W8Z A;  1WDC B;  3QRX A;  3BFH A;  2K1A A;  3BFB A;  2E75 D;  2C0X A;  1S6C A;  1ZUZ A;  1GL2 D;  3SFE C;  1SQQ D;  1N7S C;  1ZV8 A;  3A5T A;  2OTJ P;  4PV1 B;  1DVI A;  4FTG A;  1M56 D;  1B8R A;  1KWO B;  1EXR A;  1EJ3 A;  1YX8 A;  1NOH A;  1NH4 A;  2NPS D;  1QX5 B;  2KFG A;  2IFN A;  3V2L A;  4YGA A;  1PGO A;  1VQ5 P;  1LTS C;  3LLE A;  3W67 A;  1KC8 Q;  2PAL A;  3BJH A;  1SQP G;  1RF1 A;  1JFK A;  5TIS H;  1ODB A;  1XFY O;  4WBA A;  3A0H E;  3D76 A;  2POH A;  5M1B A;  1JCD A;  4EI2 A;  1S3P A;  3DF0 A;  1J7P A;  2E42 A;  3BAS A;  4JKT A;  1ZFS A;  5I2L A;  3BUX B;  3GW6 A;  3L74 E;  1GW3 A;  1IJD B;  4P5O E;  3L71 J;  3MUD C;  3D74 A;  2LV7 A;  5GTI H;  1AVS A;  1NTM J;  2FKW B;  1MKM A;  3VMZ A;  4IOI H;  4JYC A;  2Y9Z A;  1OMI A;  4JF7 A;  2JRF A;  1YQ4 C;  1NP8 A;  3AEE C;  2QM8 A;  3V5B A;  4YXW H;  1A75 A;  3WHU B;  4INX A;  1IGV A;  5DKR A;  1AUI B;  4USL A;  3WU2 H;  5HKW A;  3KDP B;  3TYY A;  3L73 J;  4AQR D;  2JOJ A;  1DD4 A;  2LM5 A;  3RM1 A;  1RE4 A;  1VQ4 P;  2GA1 A;  2ZFC A;  4Q04 A;  1G1J A;  4UB8 E;  3UO9 A;  3Q3D A;  4PHK A;  2B87 B;  1OMD A;  1GL2 B;  2XNX A;  2WCB A;  1DJW A;  3CCL P;  1MUX A;  4H13 D;  1WDC C;  1S1E A;  1J2J B;  3L37 A;  2WCM A;  1NWD A;  1IKU A;  1DTL A;  2WC5 A;  2L98 A;  1BOD A;  3SIA A;  3TDI A;  3PM2 A;  5C39 A;  4PV1 C;  1NU1 G;  3CL3 D;  3OW2 O;  1SK6 D;  4R4M A;  5GTH H;  3MHV A;  1NX3 A;  1KD1 Q;  2RN0 A;  4FQO A;  4CID A;  1KWO C;  1DEL A;  1BE3 D;  3EWK A;  4L73 A;  4DJG A;  4P2Y B;  1SQB G;  1L0N E;  1Z4H A;  5HYD A;  4Y28 J;  4ZCU A;  2MRD A;  5I2Q A;  1YVL A;  4GUK A;  1IC2 A;  2K9Y A;  1NX2 A;  3AKA A;  1OQP A;  1OSA A;  1V1F A;  1H4B A;  2IYO A;  3NHT A;  1T6A A;  4HRH A;  3G3Z A;  1EDL A;  3PJI A;  3EK4 A;  4OZD A;  2HLO A;  1NIW A;  1VQM P;  4IFF A;  3CMA P;  4MLW A;  3VRN A;  1SQX E;  2WC6 A;  3IR9 A;  1NTZ J;  3HCM A;  1HTL C;  3PFV A;  1CLB A;  1UHN A;  1H8B A;  5CSF A;  1DJY A;  2CPS A;  2K7B A;  1IJ6 A;  2NCO A;  1XTG B;  2M9G A;  2R44 A;  2AMI A;  4WY4 D;  3PHL A;  1NX1 A;  1AQ5 A;  2YKQ A;  2MLE C;  2KBM A;  1YYC A;  1DF0 B;  3FE8 A;  1K95 A;  1S5L H;  3PTZ A;  5KLV K;  4XJK A;  3A4U B;  1KB9 I;  4OKH A;  4PT1 A;  1K90 D;  3CZ0 A;  2KFH A;  3O6B A;  4ICB A;  1RQU A;  5CCG C;  4QJ4 B;  4GGN A;  5AVV B;  1K04 A;  2I94 A;  3EG5 B;  5I94 A;  3CLN A;  1C7W A;  1Y1A A;  2W27 A;  1GL2 C;  1LTJ A;  1ZN5 A;  2C9L Y;  1J1E A;  1JBA A;  1UIX A;  2Q3E A;  3EKJ A;  2CTN A;  4L74 A;  1XK4 A;  1LT9 A;  2EGD A;  2M29 A;  1KYO H;  1AHR A;  2JDI H;  3L71 D;  1NO4 A;  2N1T A;  3BUO B;  2M1K B;  1JY2 N;  1YUS A;  2R3S A;  4UPG A;  1A2X A;  2CT9 A;  2Q5U A;  2MJW B;  2L4I A;  2PQL A;  1UWO A;  1N7S A;  4ZKP A;  1K8A Q;  3B4S A;  1U5I A;  1KSO A;  4U7J A;  4N3Y B;  1MR8 A;  3L36 A;  4NPE A;  1QXP A;  2HPC B;  3L73 D;  2P70 A;  1AVY A;  1FI5 A;  1SQP E;  2I1J A;  1EG3 A;  2Q4U A;  1FC2 C;  1NTK G;  1G4Y R;  4WY4 B;  5KLV D;  1A02 J;  2E5T A;  4MBE A;  5FI6 A;  1GDT A;  2QSI A;  1VQL P;  2LAP A;  3CC2 P;  3FWB A;  3SS3 A;  1AVO A;  3VB1 A;  1XTC C;  4LGD E;  2F2O A;  3FWC A;  1IJ5 A;  4GFT A;  1LWU A;  5AVQ B;  3L74 J;  1JTH B;  2KLE A;  4OH8 B;  4D6T D;  5EFW B;  5AW2 B;  1PL5 A;  4N78 D;  4ORB B;  3H32 A;  4RES B;  2F33 A;  5AW1 B;  2MHH A;  1IG5 A;  3MUD A;  1GK4 A;  3WMM 0;  1QWV A;  1ZR4 A;  2FYN B;  3NGV A;  3FXE A;  1YQ3 C;  3TS5 B;  5HKZ A;  1NX0 A;  5APY A;  1YUU A;  3ICB A;  2GGZ A;  4IL6 H;  3JCU H;  3GLM A;  1QTX A;  2JC2 A;  3GK4 X;  2JJL A;  1T8Z A;  2FYU G;  2JU0 A;  1JY3 N;  1T3J A;  2K7O A;  2WCF A;  3HE4 A;  1YJN P;  2L2C A;  1HGZ A;  3C1L A;  2JNF A;  1TRF A;  3H1K G;  3EK8 A;  1REC A;  3AE2 C;  1JB0 J;  5JOL A;  2AXC A;  3LK0 A;  3CX5 H;  3O6Q A;  3TGU G;  1G33 A;  1B7T Z;  3OBV A;  5I8N A;  2XU6 A;  4DT0 A;  1GD2 E;  1CDP A;  5KJ7 D;  1NU1 E;  5APV A;  1BLQ A;  2M5A B;  1VRK A;  2WOR A;  1QVI Z;  1LP1 B;  3I55 P;  1HJB A;  1KFU L;  1S1C X;  3H1H G;  5APS A;  4YI9 A;  3C1V A;  5DJT B;  3AE4 C;  3P8C D;  2HPS A;  2EHB A;  1LIN A;  2HF5 A;  3MGN A;  2L2E A;  1L0N J;  2WQY C;  1VF5 D;  3E7K A;  4I2L C;  2CXJ A;  1DJX A;  3P7K A;  3CR5 X;  3AED C;  4WY4 C;  1F70 A;  1ORG A;  2K2A A;  1UP5 A;  1ZP0 C;  2JUL A;  2LCP A;  2MBX A;  2C0W A;  1NCX A;  4PAL A;  1S9K E;  1Y9B A;  1SQX J;  1CLM A;  3VRQ A;  3B5N D;  1BCC G;  1JO5 A;  4HYT B;  3VOP A;  1C3Z A;  2KLU A;  2RKL A;  3S4R A;  1JSA A;  2H61 C;  2BL0 B;  1OIP A;  3AE8 C;  3RK3 E;  2I7A A;  1KN7 A;  2IBZ D;  3FX0 A;  4CFQ A;  2FCE A;  2OPO A;  1L2O B;  1QVG O;  2W83 C;  3JSV C;  1DGU A;  1GU4 A;  4RKU J;  2YO3 A;  2FYN C;  1J7Q A;  2Y5I A;  2HOD A;  2RGI A;  1HUC A;  1M39 A;  3TS5 C;  3VYI A;  2K2F A;  1QX2 A;  1KFX L;  4D1E A;  2JZI A;  3O4X A;  1NPQ A;  1K9P A;  3CPW O;  1SCM B;  2ZYD A;  2HFE D;  1NGM B;  3CLQ A;  2QDI A;  2L91 A;  2ZFD A;  5I2O A;  1BR1 B;  4GPL B;  1CFC A;  1IFN A;  3JCU E;  2KXP B;  2B87 A;  3M06 A;  3MD0 A;  2O3J A;  1KB9 E;  2P58 A;  4HB1 A;  4XE5 B;  1GL2 A;  5DKN A;  1BSN A;  4QJ5 B;  1QV0 A;  1W5C E;  2QJK B;  3B71 A;  5AFP A;  3L74 D;  4IJ7 A;  2M8R A;  1K96 A;  2QEX P;  3B86 A;  2VRG A;  2WPR A;  1L0L K;  5AW9 B;  5H2F H;  1MXL C;  3IF4 A;  1IFM A;  1RHZ B;  1BG1 A;  2NPS A;  5B66 H;  3A8R A;  4WB4 A;  5CSI A;  2Q6Q A;  4JBZ A;  2M49 B;  2FJY A;  2VRS A;  2A06 D;  3DVE A;  1BMO A;  1RQV A;  1NTK E;  2V7Q H;  1CI6 B;  1S6J A;  2OGU A;  1S4X A;  4YTP C;  2ZN9 A;  1QX7 A;  1HJ0 A;  3GMA A;  1SQP J;  1NKZ B;  1BJF A;  3L75 G;  1ZOT B;  3PAT A;  1MF8 B;  1PVB A;  5AXI A;  1YTZ T;  2BL0 C;  2NCP A;  2H88 C;  1JY2 P;  1A03 A;  3NXS A;  2KZI A;  1GQM A;  3CXH H;  2PSR A;  3NSI A;  1FS0 E;  3ABV C;  1L2O C;  3C9I A;  1SR6 B;  5AW6 B;  2ZND A;  2IS9 A;  3KF9 A;  1T3U A;  2YXQ B;  2KQ6 A;  1Q81 Q;  1SL7 A;  1DF0 A;  1N7L A;  3TF5 A;  4PHN A;  5AVW B;  4YGE B;  3WUV A;  1MUU A;  1CFF A;  2PAS A;  2CCM A;  3EVR A;  1L4A B;  2KI6 D;  5K89 A;  3U1C A;  1ALV A;  1W9Z A;  1YRT B;  4U3F G;  1PUL A;  5AEQ A;  3NHI A;  3LIE A;  2ZJS E;  3V6I A;  3PLN A;  4H0L D;  5B5E E;  2LP2 A;  1L0N D;  4HKZ H;  4PV1 D;  2J59 M;  1SCM C;  2WSE J;  3UIA A;  4BY5 A;  3CWB D;  1YHQ P;  3A2A A;  3S1K A;  3BRV B;  1SQQ K;  5KJ7 C;  1OZS A;  2FYU E;  2O1J A;  1FZC C;  4Y99 B;  3H1K E;  5K5G B;  3VRR A;  3AE3 C;  1ZAC A;  2JT8 A;  1QEX A;  2OTL P;  3TGU E;  1E79 H;  4MRY A;  1SQX G;  2Y9Y A;  3PP5 A;  3B87 A;  1IH0 A;  1DD3 A;  2K37 A;  2ZVN B;  2QJK C;  1UII A;  1OFC X;  1A29 A;  1LXF C;  4YXD C;  1NU1 J;  3H1H E;  4N6J A;  3PRJ A;  4PHM A;  1FDI A;  3KZI E;  5AVX B;  1KTM A;  1X22 A;  2WT7 A;  2I18 A;  4C46 A;  2WSC H;  1B8L A;  1WY9 A;  1Y6W A;  4OVN F;  1M63 B;  3ZNI A;  1DJI A;  1JY3 P;  5CPV A;  4PE4 A;  2NZ0 A;  2QVA A;  2OAR A;  5GQQ C;  3DY9 A;  3KYQ A;  1G2C A;  1MQ1 A;  3HRN A;  2O5G A;  2K61 A;  1TOP A;  1PFI A;  4L76 A;  2JTT A;  1NKN A;  1EZV D;  2KZJ A;  1OOJ A;  5TNC A;  1VQ8 P;  5CCG D;  1BCC E;  4DOJ A;  1JMB A;  3II6 A;  3AKB A;  4WY4 A;  2M1U A;  2WND A;  5KAI E;  3H6P A;  1RFJ A;  2QA4 P;  1NJI Q;  1AJ4 A;  2AXT E;  2P1J A;  2WSF J;  1OOI X;  1SR6 C;  1YIJ P;  5APT A;  1GGW A;  1JWD A;  1ZRT E;  3LW5 H;  1QLK A;  4H0L B;  2BCX A;  1B4C A;  1JTH A;  4IL1 A;  5DKQ A;  1L4A C;  1JF2 A;  4WQ2 A;  1PGP A;  3KQG A;  2H61 A;  1HBW A;  3JVT B;  3A0B E;  1RF0 C;  3PSR A;  2TN4 A;  1JFJ A;  3D6Z A;  4I5J A;  1JC2 A;  1GTW A;  4XYN A;  5AVS B;  4Y99 C;  1W7I B;  1JF0 A;  4L9M A;  3I5F B;  2FY8 A;  3H1J G;  3I5G B;  5CCH C;  1DEK A;  1OE9 B;  5AW3 B;  2MKV A;  1OW4 A;  1SQV G;  2OYI B;  1SQB K;  3MTU E;  2FCD A;  3AEF C;  1URQ D;  3SS4 A;  2WPV B;  5CSN A;  1KCY A;  1PIX A;  2IX7 C;  1YTZ C;  2YMK A;  3MIW A;  4YI8 A;  1Y0V H;  2JTZ A;  1EG4 A;  2K3R A;  1P28 A;  1IWQ A;  1NAF A;  1NSH A;  4QJ3 B;  1K73 Q;  1BOC A;  1LP1 A;  1FZA A;  3EVV A;  3TDZ A;  1XVJ A;  1NUB A;  2OYH B;  5KAF H;  3CC4 P;  1XFZ O;  1J7O A;  3CCS P;  2JQ6 A;  4KT0 J;  4IFM A;  3BCC G;  1KQS O;  1M46 A;  2LP3 A;  1KYO I;  1WRK A;  1ZW0 A;  1NTK J;  3L75 E;  1NWQ A;  4UB6 H;  1N73 A;  2B9B A;  3RGU A;  3DD4 A;  3M91 A;  2J5U A;  2FJU B;  5PAL A;  2HQW A;  2H2K A;  1PGQ A;  2KP8 A;  1YIT P;  2QEO A;  1QJT A;  2KI6 C;  2IDB A;  1HWT C;  4O9B A;  1LGH B;  1Z2C B;  4HRE E;  2Q1K A;  2J58 A;  3BRT B;  4H0L C;  2BCA A;  1K9M Q;  2KNC B;  1RWY A;  2BBN A;  1SLQ A;  3D70 A;  3RLZ A;  1PPJ G;  4TNC A;  1W2B O;  2G2B A;  1Y47 A;  2V53 A;  1NU1 D;  4PD4 D;  3JVT C;  3H1I G;  2UWJ E;  2I1K A;  3AEB C;  4U3F E;  2BAP A;  3IQO A;  3VGO A;  1GK6 A;  2M8U A;  4OWF A;  1Y1X A;  1SQB D;  4A7P A;  2L5Y A;  2LMT A;  1N2D C;  2Q7C A;  3I5F C;  3I5G C;  3FE6 A;  2KIK A;  3K21 A;  1URQ B;  1FOS E;  3MZW B;  1OOH A;  1NTM K;  1BE3 G;  4I5N B;  4DUQ A;  4JD9 A;  1M8O B;  3OX5 A;  3MSE B;  5AVR B;  1Y8A A;  2OYI C;  1M1J B;  5APU A;  2FYU J;  1CZQ A;  5B8I B;  1A02 F;  1CW5 A;  3S0A A;  2ITA A;  2ZN8 A;  1K05 A;  1U7J A;  3H1K J;  2P71 A;  5KJ7 A;  1LT1 A;  3TZ1 A;  3V4W A;  2JWW A;  4C7N A;  4N1F A;  3TGU J;  4JYB A;  1S9K D;  1FZC A;  1AK8 A;  2WSS H;  3L35 A;  5TIS E;  4PDZ A;  3KXD A;  3RZS A;  1OVU A;  2FFD A;  2OYH C;  2KGR A;  2SCP A;  1GGZ A;  3KEV A;  2NLN A;  3H1H J;  4ORA B;  1P84 D;  1QAS A;  1X9V A;  3SG2 A;  2W6J H;  1NYA A;  2JWD A;  4YGB B;  3KHE A;  2QAC A;  3VMX A;  4XFJ A;  1XFR A;  5GTI E;  2KQY A;  3R2P A;  1SCV A;  3M9B A;  3QH9 A;  2KUB A;  3B88 A;  1CDL A;  1FU1 A;  2B89 A;  3CX5 I;  2CNP A;  3CD6 P;  1L2P A;  2ZYG A;  5E79 H;  1PVA A;  4YGC B;  3W68 A;  1QV1 A;  4ORC B;  3PAL A;  1S5L X;  3B5N A;  1CLL A;  2KSJ A;  3WU2 E;  1CI6 A;  2LR2 A;  2A4J A;  2K88 A;  2ZT9 D;  1QX8 A;  5KTB A;  1OOF A;  1BCC J;  3IVT A;  3PN7 B;  4HRG A;  3L4L A;  1RE3 C;  5KU1 A;  1RH5 B;  3AE9 C;  2JP3 A;  3NFQ A;  1KB9 D;  1SPY A;  3CCJ P;  2WCK A;  2FBW C;  1IK7 A;  1MFT A;  1NTM D;  4PD4 H;  2ZRS A;  1KIL A;  1WRG A;  5DJU B;  1YRU B;  2IYP A;  2LUC A;  4NQG A;  1NTZ K;  4BRY A;  3TSI A;  5BU8 B;  5AW8 B;  1AQT A;  1KV4 A;  5DIC A;  1URQ C;  1Q2N A;  5GTH E;  2YXR B;  3H1J E;  4JWQ A;  2HYN A;  5CSJ A;  1M1J C;  2F8P A;  3I5C A;  2QIW A;  1Y1U A;  1RF0 A;  2H7H A;  1SQV E;  2BCC G;  2K60 A;  2N9Y B;  3L4F A;  3P32 A;  2M3B A;  1JUO A;  2BAS A;  1TNP A;  3FIA A;  3AE1 C;  3AEA C;  2D2C B;  1UHK A;  2KS1 B;  5AVZ B;  2QRX A;  2NXQ A;  2QE7 H;  1T14 A;  3KPX A;  4R4L A;  3RK3 B;  4NDC A;  2A45 H;  3GF3 A;  2KPH A;  5AAN A;  5APX A;  2AEJ A;  2IZ0 A;  2W90 A;  1C07 A;  1QAT A;  2KYF A;  3L70 J;  2PGD A;  1QVF O;  5D3O A;  1CDN A;  2YKP A;  3SG7 A;  3P8M C;  1P84 H;  2ZYA A;  1SVF A;  2KLV A;  1X02 A;  1IFD A;  2O01 J;  3BXK A;  2QJY B;  4LC1 A;  1F55 A;  1DQE A;  1S5L E;  1FDM A;  3DVM A;  2HET A;  5FYX A;  2LAN A;  2BKI B;  4C0K A;  3BCC E;  1PZQ A;  4GGF C;  1RJV A;  2ZT9 B;  3SWY A;  5AVT B;  3R1P A;  4H44 B;  1T2K D;  2F3Z A;  3CCE P;  2QG4 A;  1K93 D;  3OGN A;  4YBH B;  1BT6 A;  2K0J A;  4MN0 A;  2FYU D;  3L75 J;  3CWG A;  3PN7 C;  3HE5 A;  3CME P;  1NTZ D;  2XKM A;  2Q3I A;  2JWA A;  1A4P A;  1M31 A;  1XA5 A;  2MA2 A;  3SWK A;  1R6P A;  3CS1 A;  2IZ1 A;  1TUJ A;  4CPV A;  1TIZ A;  1SFC D;  1X8Y A;  2KHN A;  1S2E A;  1PPJ E;  3SWF A;  1USE A;  2GM4 A;  3NSO A;  3H1I E;  1K2H A;  4IL6 X;  1H8A A;  3PLF B;  2JR8 A;  2O01 N;  3H1H D;  4YRU A;  3JC2 2;  3AE5 C;  2ISD A;  1KYO E;  2OTK E;  1IK9 A;  4U3F J;  1RTP 1;  1KSM A;  1QLS A;  1QIW A;  2YIU B;  4K3A A;  4EIJ A;  3HUS B;  1BE3 E;  4PJ0 H;  3D75 A;  1LNQ A;  1HVV A;  3CXH I;  4RJT A;  3AE6 C;  4TT3 H;  3M0D C;  1A75 B;  1N2D A;  4DIR A;  2D2C C;  3AEG C;  2IBZ I;  3B7A A;  1KZU B;  3RK3 C;  2ZAE B;  3IFM A;  2P10 A;  5IBW A;  2OYI A;  5ER5 A;  1BCC D;  1YBK A;  3GHG B;  4M2P A;  1VL2 A;  3T97 B;  1FZG A;  3CCU P;  3S0F A;  2KB7 P;  1B47 A;  2CPB A;  1M45 A;  4EYY Q;  1J7R A;  3CR4 X;  2QJY C;  1W2E A;  3K1E A;  3V2P A;  1ZRT D;  1QIV A;  1VDF A;  3BVH A;  2H8V A;  4A4B A;  1MFZ A;  1SNL A;  1BGY G;  3UNW A;  4MRX A;  2ZT9 C;  2Z5I A;  1YI2 P;  1BDC A;  4H44 C;  2HQ8 A;  2ZRT A;  4I5L B;  1SBJ A;  3TDU A;  1L4A D;  3WHT B;  1FF1 A;  5CCG A;  1SFC B;  2P2U A;  1OXZ A;  2GGM A;  2KK7 A;  3RL0 B;  4MZJ A;  3IN6 A;  1LTG C;  3O2P A;  1LKJ A;  4IL6 E;  4MZL A;  1L0N K;  3LK1 A;  1DT7 B;  1DC1 A;  2Q91 A;  4BY4 A;  4PE1 A;  1SL8 A;  2QEB A;  1GM0 A;  2EC6 B;  2BNX A;  1F71 A;  3GK1 A;  5CCH D;  1WLZ A;  2P6B B;  3NXA A;  3Q8I A;  2KYV A;  3L70 G;  1FZF A;  1OW8 A;  1AFO A;  1E8A A;  4FQT A;  3OHM B;  2XZR A;  3CX5 E;  4YGD B;  1RE3 A;  5TJH A;  3OB2 B;  3F45 A;  1LVC D;  3EK7 A;  2GTE A;  2MLF C;  2KGB C;  4CPG A;  4PCW A;  1SQX K;  3CYZ A;  3ZWH A;  2YIU C;  1YUT A;  3HUS C;  3H1L G;  3H4S E;  1R5L A;  1Q90 D;  1LA3 A;  1S3J A;  2BCC E;  4F0Z B;  1S36 A;  1F54 A;  1WMK A;  3H1J J;  3V2R A;  3AE7 C;  1URQ A;  3BFA A;  3FS7 A;  4AOM A;  2AEF A;  4M2Q A;  2YMY A;  4M2O A;  1SQV J;  1SYM A;  5BPJ A;  2LXB A;  1RE4 C;  3JTD B;  3OB1 B;  1M1J A;  3GHG C;  5CMZ A;  5KSZ A;  2A06 G;  1BU3 A;  2LMV A;  2L50 A;  1LTJ B;  3BUN B;  2LMU A;  5KLV E;  1KK7 Y;  2WCH A;  1LT9 B;  1T2K C;  2KSP A;  2GV5 A;  5CBN A;  1VPC A;  1IFP A;  2E74 D;  1VQP P;  5AVU B;  4U3F D;  2H8P D;  4D6T E;  2WCJ A;  3NTN A;  4TLF A;  5EL2 A;  2MAZ A;  3CZT X;  3M0A A;  4N78 E;  3RBX A;  3L72 G;  3NMD A;  1SFC C;  1CFD A;  1PRW A;  3BCC J;  3RL0 C;  1EDJ A;  5CJ4 A;  5FI2 A;  3BQ3 A;  4ETO A;  1KOR A;  1U5I B;  3PJS K;  4WVZ A;  2ZVO B;  1EXJ A;  5APW A;  3IQQ A;  2BE4 A;  3OP0 A;  1SQX D;  2EC6 C;  3CWB G;  2R2I A;  1D1O A;  3A0H H;  2K7D A;  1C3Y A;  1EDK A;  2XV5 A;  3FGA D;  1CDM A;  4F7F A;  1YUR A;  1B1G A;  4IFD K;  1AP4 A;  1L0L G;  1E5W A;  4A4C A;  1C7V A;  3WXA A;  1SQP K;  1S6I A;  3H1I J;  2YKO A;  4W80 A;  5BU5 A;  1HGV A;  1GU5 A;  2FXP A;  1IO4 A;  4PHJ A;  1LWU B;  2WZ7 A;  3RK2 D;  2JXC A;  3AEC C;  2PFX A;  2WTY A;  1EZV I;  3WNX B;  2R5B A;  5APQ A;  2PVB A;  3S0G A;  3S0E A;  3H32 B;  2E76 D;  3HD7 D;  1TNW A;  5H2F E;  2KAX A;  1PP9 G;  2F2P A;  1WRL A;  1N0Y A;  1EDI A;  4MVF A;  2M7N A;  1BE3 J;  4GIF A;  1CNP A;  4GOD A;  3A7O A;  3JTD C;  5B66 E;  2HPC A;  5D7F A;  2BE6 A;  2LXC B;  2SAS A;  1OZO A;  2LHI A;  4UB8 H;  1LTJ C;  2BEZ F;  3M0D A;  1QL1 A;  5CJ0 A;  2E5Y A;  3S0D A;  3VMY A;  4HH2 A;  1TNQ A;  3CAB A;  3HE4 B;  2CBL A;  5HKY A;  1YX7 A;  3BOW B;  1EQ7 A;  1FDO A;  1X0T A;  2E74 B;  1EZV G;  4GKG A;  1XK4 C;  1LT9 C;  1HF9 A;  1S5G Y;  1S26 D;  1PK0 D;  3MP7 B;  2FOT A;  4OGQ D;  4ZNC A;  3DXL A;  3SJS A;  1BGY E;  3CXH E;  3Q5R A;  1KQL A;  1UUR A;  3SG6 A;  1KQV A;  3AAJ A;  4I5K A;  1JCC A;  2IBZ E;  2KAY A;  2M0R A;  3S9O A;  1K8U A;  3DVJ A;  1DJH A;  4NDB A;  1SQQ G;  2K9J B;  1FE6 A;  2JT3 A;  1NU1 K;  3OJA B;  1DJG A;  1D7M A;  2JNX A;  1WLM A;  1KIL E;  1PV3 A;  3A3Y B;  4I7Z B;  3H1J D;  2B88 A;  4QMA A;  4GDO A;  1KQF B;  2QJP B;  1SQP D;  2WWW A;  2OTG B;  1SQV D;  1R2U A;  1QS7 A;  3CI9 A;  2KAV A;  3TNU B;  2LLS A;  4INW A;  3EFF K;  3L70 E;  3TDK A;  3RK2 B;  3WUU A;  1XYD A;  4GAO A;  1OW6 A;  5L8R J;  1Z56 A;  3Q5P A;  3SIB A;  1MZ9 A;  3SS5 A;  2M5A A;  4N5X A;  1LWU C;  3HD7 B;  1K9U A;  2E76 B;  1TU3 F;  1CTR A;  4MSP A;  3G9R A;  2KNE A;  2L5G B;  4MZK A;  2WCL A;  1FBV A;  2PRU A;  2M3W A;  2LNK A;  3H1L E;  2Y1M A;  1SMG A;  5KKZ B;  2HG5 D;  2G9B A;  2Y0D A;  5AVY B;  3G6E P;  2O60 A;  1ZLL A;  1CFP A;  2HOD B;  2HR3 A;  3BCC D;  3HUS A;  2BCC J;  5F6T A;  1TTX A;  1NCZ A;  3B8E B;  3R1O A;  4PD4 I;  2A06 E;  3ITK A;  3VRO A;  3S0B A;  2WVR A;  3M0W A;  4OGQ B;  2QEH A;  1SL9 A;  2E74 C;  1DH3 A;  1RY3 A;  3GHG A;  3BUM B;  3SG3 A;  5KLV J;  1XO5 A;  3T97 A;  1PPJ D;  2R3C A;  2E75 B;  2LHL A;  2M97 A;  3H1I D;  2G3A A;  1YR5 A;  3E3R A;  1CKK A;  2ZXE B;  3I56 P;  4LLH A;  1QLE D;  1NAY A;  4RO0 A;  1LTB C;  3Q5S A;  3GOF A;  1KYO D;  3DVK A;  1CM4 A;  3L72 E;  1UHJ A;  4D6T J;  5HL1 A;  4I7Z C;  3G71 P;  1UHI A;  2W6A A;  2A45 I;  4YPC A;  1VQ7 P;  3IF7 A;  1R5S A;  4CLN A;  2NPS B;  1LTT C;  1DEB A;  2QJP C;  1ZXG A;  3CCQ P;  1ZR2 A;  2JT0 A;  2OTG C;  4JPZ B;  1BR4 B;  2IFM A;  1W7J B;  3AAK A;  5CBO A;  4W7Z A;  1F8H A;  3BAT A;  1IRJ A;  3CWB E;  1LTI C;  3FXD A;  1SFC A;  1P84 I;  3RK2 C;  1VQO P;  3D0Y B;  3GK2 A;  3HTK B;  1YJ9 P;  4NPF X;  3KPE A;  1FJP A;  4AUW A;  1DJZ A;  2QM7 A;  1XFU O;  1LS8 A;  1L0L E;  2D2C D;  3HD7 C;  1AJY A;  2E76 C;  2O1K A;  2NZ2 A;  1NTK K;  5AW5 B;  3RK3 D;  1XFV O;  1DEE G;  3D73 A;  3CGA A;  1ALW A;  1PSB A;  2A45 G;  4GOE A;  1RK9 A;  5KKZ C;  3FE9 A;  4GBA A;  1AV1 A;  1GZL A;  4ASV A;  2FXO A;  3VTP C;  5AW0 B;  2WPS A;  3EVU A;  2OS8 B;  2SPZ A;  1PP9 E;  1NYH A;  3D6Y A;  3N7H A;  1XFW O;  3RL0 g;  2WSE H;  2KLD A;  3R4Y A;  2DW3 A;  5KAF E;  3LL8 B;  1K94 A;  2P7J A;  2I2R E;  1IZN B;  5D69 A;  2H89 C;  4E68 A;  2Y0C A;  4OGQ C;  2WPQ A;  3N4X A;  4H44 D;  2LLT A;  2WOS A;  4XA4 A;  2R5D A;  3CR2 A;  5HLV A;  2V7Q J;  1IQ5 A;  4UB6 E;  1EZV E;  4H13 B;  2ERB A;  2WC8 A;  4OV2 A;  2AEM A;  2JPO A;  2E75 C;  1J1D B;  3H25 A;  1H0T B;  3R1V A;  2FYU K;  1EC5 A;  1VQK P;  4ZMD A;  2PYQ A;  1XFX O;  3CX5 D;  1N8R Q;  5KLI B;  1BGY J;  2KI7 B;  3R72 A;  3OX6 A;  1X79 B;  3SFD C;  1ZME C;  1CM1 A;  3KO0 A;  3L71 G;  1SQQ E;  2Z4E A;  1L4A A;  1SKT A;  4R1E A;  2IPP A;  2R32 A;  4BWN A;  1PAL A;  2NPS C;  3EKH A;  1NTM G;  1OWA A;  2WT7 B;  1OW7 A;  5KTY A;  1YJW P;  1FOS F;  3U59 A;  4Z1M H;  1V1G A;  3IAO A;  1NTK D;  2RMZ A;  2BCC D;  3Q2Y A;  1PSR A;  2L4H A;  1VQ6 P;  4ZKU A;  1G2C B;  5CCH A;  3BYA A;  3D78 A;  1G8I A;  2BCB A;  3L73 G;  2LUX A;  1IIO A;  3V2Q A;  3I5H B;  1EL4 A;  2WSF H;  2H43 A;  1SRA A;  4B86 A;  4DCK A;  2OYO A;  1VQN P;  5ER4 X;  5KLV G;  1KFM A;  1KFN A;  4U8D A;  1GMJ A;  4WQ3 A;  4M3L A;  2ZXX A;  1EH2 A;  1TN4 A;  2ZKM X;  4KHX A;  1TNX A;  4C0J A;  2XDJ A;  2BEC A;  2OS8 C;  4W7Y A;  1MXE A;  5AER A;  2P67 A;  1RRO A;  3H1L J;  2WIT A;  3FWN A;  4ZCV A;  3CTN A;  4D6T G;  1SY9 A;  4WWI A;  1UHH A;  1HT9 A;  2K8M B;  2KOG A; 
#chains in the Genus database with same CATH homology
 2MLF C;  4HRH A;  1AJ4 A;  2KGB C;  1FI6 A;  4HSZ A;  4PCW A;  1SR6 C;  3ZWH A;  3EK4 A;  1YUT A;  1NIW A;  2WCE A;  1GGW A;  3H4S E;  1JWD A;  2LE9 B;  1KFU S;  4MLW A;  3VRN A;  1QLK A;  4C0L A;  2BCX A;  3HCM A;  1B4C A;  3PFV A;  1CLB A;  4IL1 A;  1LA3 A;  1UHN A;  5DKQ A;  5CSF A;  1JF2 A;  1F4O A;  1DJY A;  1H8B A;  3BUW B;  2K7B A;  4WQ2 A;  1IJ6 A;  2NCO A;  1S36 A;  2PMY A;  2H61 A;  4DRW A;  4F0Z B;  1F54 A;  2M9G A;  3JVT B;  2M7L A;  2AMI A;  3FS7 A;  4AOM A;  2B1U A;  3PSR A;  1NX1 A;  4M2Q A;  4M2O A;  1SYM A;  5BPJ A;  2MLE C;  2TN4 A;  2KBM A;  2KOT A;  3DF0 B;  1DF0 B;  3JTD B;  3OB1 B;  4CFR A;  1IQ3 A;  1K95 A;  4I5J A;  3BOW A;  1JC2 A;  2KYC A;  4JQ0 D;  2Y4Q A;  4XYN A;  5KSZ A;  2KFF A;  1BU3 A;  2LVV A;  4XJK A;  3A4U B;  1W7I B;  1JF0 A;  4L9M A;  3I5F B;  2LMV A;  2L50 A;  3I5G B;  1OE9 B;  3LCP C;  4OKH A;  3BUN B;  2LMU A;  1K90 D;  1KK7 Y;  2KFH A;  3O6B A;  4ICB A;  3HX4 A;  2BBM A;  2KDH A;  3SG4 A;  2FCD A;  4QJ4 B;  4GGN A;  3NSK A;  2KSP A;  5CSN A;  2I94 A;  2GV5 A;  1KCY A;  3CLN A;  5G08 A;  1C7W A;  1Y1A A;  1YTZ C;  2D8N A;  4YI8 A;  1Y0V H;  2JTZ A;  1J1E A;  1JBA A;  1EG4 A;  2MAZ A;  3CZT X;  3I5H C;  1IWQ A;  3EKJ A;  1NSH A;  1AJ5 A;  2CTN A;  4QJ3 B;  1J55 A;  1BOC A;  1CFD A;  1GJY A;  1PRW A;  3EVV A;  3TDZ A;  1XVJ A;  2E6W A;  1XK4 A;  1NUB A;  2EGD A;  3BQ3 A;  4ETO A;  1FW4 A;  2M29 A;  1XFZ O;  1AHR A;  1U5I B;  1KFX S;  1J7O A;  2JQ6 A;  3O4Y A;  3BUO B;  2M1K B;  3IQQ A;  2BE4 A;  1YUS A;  1SW8 A;  1TCF A;  2EC6 C;  3NSL A;  2LC5 A;  2R2I A;  3OP0 A;  4UPG A;  1D1O A;  2K7D A;  1A2X A;  2CT9 A;  1M46 A;  2MJW B;  1CDM A;  2LP3 A;  2L4I A;  1TCO B;  1WRK A;  1YUR A;  1OMR A;  1KK7 Z;  1B1G A;  1UWO A;  3DD4 A;  1AP4 A;  2FJU B;  3TUY B;  1N65 A;  5PAL A;  4A4C A;  1U5I A;  2H2K A;  2HQW A;  1C7V A;  1KSO A;  3WXA A;  1S6I A;  1MR8 A;  1QJT A;  2KI6 C;  1QXP A;  4PHJ A;  1FI5 A;  2JXC A;  4HRE E;  1EG3 A;  2Q4U A;  1G4Y R;  2BCA A;  1RWY A;  3WNX B;  2BBN A;  4OR9 B;  3RLZ A;  4TNC A;  4MBE A;  2G2B A;  1KK8 B;  2PVB A;  2V53 A;  1TNW A;  2LAP A;  2KAX A;  3FWB A;  3JVT C;  4OCI A;  2F2P A;  1WRL A;  1N0Y A;  2K7C A;  4MVF A;  1B7T Y;  2M7N A;  3IQO A;  3VGO A;  1CB1 A;  2F2O A;  1CNP A;  3FWC A;  1IJ5 A;  2M8U A;  3JTD C;  3O78 A;  4GFT A;  5JJG A;  1Y1X A;  5D7F A;  2BE6 A;  2LMT A;  1QVI Y;  2L5X B;  2KBI A;  2SAS A;  1OZO A;  3I5F C;  2LHI A;  1LA0 A;  3I5G C;  4AQJ A;  3K21 A;  4ORB B;  1DMO A;  2F33 A;  3I5I B;  3VRP A;  4I5N B;  4DUQ A;  2MHH A;  3OX5 A;  1IG5 A;  1TNQ A;  3MSE B;  2CBL A;  5HKY A;  1YX7 A;  2LVI A;  3BOW B;  1MWN A;  5B8I B;  1XK4 C;  2KI4 B;  1S5G Y;  2ZN8 A;  1S26 D;  1PK0 D;  4WRI A;  4XJK B;  3TS5 B;  1MHO A;  5HKZ A;  2FOT A;  1NX0 A;  3TZ1 A;  2JWW A;  1YUU A;  3ICB A;  3SJS A;  2GGZ A;  2JPT A;  4N1F A;  1UUR A;  3SG6 A;  4MEW A;  1F4Q A;  1K9K A;  4DS7 A;  1AK8 A;  1KQV A;  2F3Y A;  1QTX A;  3AAJ A;  2JC2 A;  3GK4 X;  4I5K A;  1Q80 A;  2KAY A;  2M0R A;  2JU0 A;  2K7O A;  4PDZ A;  1K8U A;  2WCF A;  3DVJ A;  4PE0 A;  1DJH A;  4NDB A;  2JNF A;  1TRF A;  2ZNE A;  3EK8 A;  2COL B;  3SG5 A;  1REC A;  2KGR A;  2SCP A;  1GGZ A;  3KEV A;  2NLN A;  5JOL A;  4ORA B;  2JT3 A;  3LK0 A;  1OMV A;  1DJG A;  1QAS A;  2JNX A;  1WLM A;  1G33 A;  1B7T Z;  3SG2 A;  5I8N A;  1NYA A;  5J3X A;  4YGB B;  1CDP A;  3KHE A;  1WRZ A;  3D0Y A;  2QAC A;  1DGV A;  4AQI A;  1BLQ A;  2KQY A;  1SCV A;  1VRK A;  2BKH B;  2WOR A;  1FPW A;  1QVI Z;  2OTG B;  1R2U A;  1QS7 A;  2KAV A;  1CDL A;  4NDD A;  1KFU L;  2CNP A;  4YI9 A;  2LLS A;  4PE7 A;  1YVH A;  3C1V A;  1PVA A;  4YGC B;  1KQM B;  2HPS A;  1QV1 A;  4ORC B;  3TUY C;  2EHB A;  1XYD A;  1LIN A;  3PAL A;  2HF5 A;  2Y1N A;  2LLU A;  4GAO A;  1CLL A;  2L2E A;  1S5G Z;  3SIB A;  2A4J A;  4N5X A;  1K9U A;  2CXJ A;  3PN7 B;  1CTR A;  1DJX A;  4HRG A;  4MSP A;  2KNE A;  3CR5 X;  4MZK A;  1F70 A;  1FBV A;  2PRU A;  2K2A A;  2LNK A;  2M3W A;  1UP5 A;  2JUL A;  1KK8 C;  2LCP A;  5KU1 A;  2Y1M A;  2MBX A;  1JFJ A;  2DOQ A;  1SMG A;  1SPY A;  4GGF A;  1NCX A;  1ZMZ A;  2G9B A;  1B8C A;  4PAL A;  2O60 A;  2ZRS A;  1CFP A;  1CLM A;  1YRU B;  3VRQ A;  2LUC A;  4NQG A;  5F6T A;  1JSA A;  1TTX A;  2H61 C;  1NCZ A;  2BL0 B;  2E30 A;  2I7A A;  2QPT A;  4CFQ A;  3I5I C;  2FCE A;  2OPO A;  3VRO A;  1L2O B;  1J1D A;  3M0W A;  4JWQ A;  5CSJ A;  1DGU A;  1SL9 A;  2F8P A;  1Y1U A;  2AUC A;  2Y5I A;  1J7Q A;  2KI4 C;  2RGI A;  1M39 A;  3TS5 C;  2LVJ A;  1UUS A;  1NCY A;  4N1G A;  1JUO A;  2K2F A;  2AAO A;  1TNP A;  3BUM B;  1B9A A;  3SG3 A;  3FIA A;  1QX2 A;  1XO5 A;  1UHK A;  1KFX L;  4D1E A;  2JZI A;  1NPQ A;  2NXQ A;  2LHL A;  2M97 A;  3KPX A;  5HLO A;  1YR5 A;  4NDC A;  3E3R A;  1K9P A;  1CKK A;  1SCM B;  3PM8 A;  1L7Z A;  5AAN A;  4GNK B;  3GOF A;  2L51 A;  3DVK A;  1C07 A;  1QAT A;  2KYF A;  1CM4 A;  1UHJ A;  1CMG A;  2ZFD A;  5I2O A;  1CDN A;  1BR1 B;  1UHI A;  4GPL B;  3SG7 A;  1CFC A;  1HQV A;  3IF7 A;  1CMF A;  4CLN A;  1X02 A;  3BXK A;  2JT0 A;  3D10 A;  2OTG C;  1F55 A;  5DKN A;  4JPZ B;  1BR4 B;  2L0P A;  4QJ5 B;  1QV0 A;  1W7J B;  3AAK A;  5AFP A;  3DVM A;  1F8H A;  2HET A;  5FYX A;  1IRJ A;  2LAN A;  2BKI B;  4C0K A;  1K96 A;  1KQM C;  4GGF C;  2VRG A;  1RJV A;  3D0Y B;  3GK2 A;  2LVK A;  1MXL C;  2F3Z A;  1BF5 A;  1DJZ A;  1K93 D;  2JXL A;  1BG1 A;  1XFU O;  4YBH B;  1WDC B;  3QRX A;  1BT6 A;  2K0J A;  4MN0 A;  3A8R A;  3CWG A;  3PN7 C;  1S6C A;  5CSI A;  1ZUZ A;  2M49 B;  1XFV O;  1A4P A;  1M31 A;  3CGA A;  1XA5 A;  2MA2 A;  1BMO A;  3DVE A;  1ALW A;  1PSB A;  1R6P A;  3CS1 A;  1RK9 A;  1DVI A;  4FTG A;  1TIZ A;  4CPV A;  1S6J A;  2KHN A;  4GBA A;  2ZN9 A;  1B8R A;  1QX7 A;  1KWO B;  1EXR A;  1BJF A;  1EJ3 A;  1YX8 A;  3EVU A;  3NSO A;  2OS8 B;  1ZOT B;  1K2H A;  3PAT A;  1XFW O;  1MF8 B;  1PVB A;  3PLF B;  1QX5 B;  5AXI A;  4YRU A;  3LL8 B;  2BL0 C;  2KFG A;  2NCP A;  4YGA A;  1A03 A;  2ISD A;  1GQM A;  3LLE A;  2PSR A;  1K94 A;  1RTP 1;  2I2R E;  3NSI A;  2PAL A;  5D69 A;  1L2O C;  1KSM A;  4E68 A;  1JFK A;  1QLS A;  1SR6 B;  1QIW A;  1ODB A;  1XFY O;  2ZND A;  2IS9 A;  3KF9 A;  2KQ6 A;  2LLT A;  1S3P A;  1SL7 A;  2WOS A;  3DF0 A;  1DF0 A;  1J7P A;  4PHN A;  4YGE B;  3CR2 A;  1ZFS A;  5HLV A;  5I2L A;  1CFF A;  1IQ5 A;  2PAS A;  3BUX B;  2CCM A;  3EVR A;  1A75 B;  2KI6 D;  1N2D A;  5K89 A;  4DIR A;  1ALV A;  1YRT B;  2WC8 A;  4P5O E;  4OV2 A;  1PUL A;  5AEQ A;  2LV7 A;  2LP2 A;  1AVS A;  1SCM C;  4BY5 A;  5IBW A;  2Y9Z A;  1XFX O;  2JRF A;  5ER5 A;  1OZS A;  4M2P A;  1NP8 A;  3OX6 A;  1CM1 A;  3KO0 A;  3VRR A;  1A75 A;  1SKT A;  4R1E A;  3WHU B;  1B47 A;  1ZAC A;  1IGV A;  2JT8 A;  1PAL A;  5DKR A;  1M45 A;  3EKH A;  1AUI B;  1J7R A;  3CR4 X;  4MRY A;  4USL A;  2Y9Y A;  5KTY A;  5HKW A;  1IH0 A;  1QIV A;  4A4B A;  2JOJ A;  1SNL A;  2LM5 A;  3RM1 A;  1V1G A;  4MRX A;  1OFC X;  4Q04 A;  1A29 A;  1LXF C;  1PSR A;  2L4H A;  4PHK A;  4PHM A;  2HQ8 A;  2ZRT A;  4I5L B;  1SBJ A;  1OMD A;  3TDU A;  3BYA A;  1G8I A;  2WCB A;  2BCB A;  1DJW A;  1MUX A;  2LUX A;  1WDC C;  1S1E A;  3I5H B;  1EL4 A;  1NWD A;  2I18 A;  3WHT B;  1SRA A;  1DTL A;  1B8L A;  1IKU A;  1FF1 A;  1WY9 A;  4DCK A;  2GGM A;  2L98 A;  1BOD A;  1Y6W A;  4OVN F;  5ER4 X;  3SIA A;  3TDI A;  1M63 B;  4MZJ A;  4U8D A;  3ZNI A;  1DJI A;  5CPV A;  4WQ3 A;  3O2P A;  4PE4 A;  2NZ0 A;  1LKJ A;  1SK6 D;  4MZL A;  1EH2 A;  3LK1 A;  1DT7 B;  1NX3 A;  5GQQ C;  2Q91 A;  4FQO A;  4CID A;  1TN4 A;  4BY4 A;  1MQ1 A;  2ZKM X;  1KWO C;  4PE1 A;  1TNX A;  4C0J A;  1SL8 A;  4P2Y B;  2O5G A;  2BEC A;  2EC6 B;  2OS8 C;  1F71 A;  2K61 A;  1TOP A;  3GK1 A;  5HYD A;  1MXE A;  5AER A;  4ZCU A;  2MRD A;  1RRO A;  2JTT A;  1WLZ A;  2P6B B;  3NXA A;  5I2Q A;  1YVL A;  4ZCV A;  1E8A A;  3CTN A;  1OOJ A;  1HT9 A;  3OHM B;  1NX2 A;  4GUK A;  3AKA A;  1SY9 A;  1OQP A;  5TNC A;  1OSA A;  1V1F A;  4YGD B;  1UHH A;  3AKB A;  2M1U A;  1H4B A;  2WND A;  3OB2 B;  3F45 A;  1RFJ A;  1LVC D;  2K8M B;  3EK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...