4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
b'LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor 12
molecule tags Transport protein
source organism Homo sapiens
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
4GGFA 1F71A 1UHHA 1QLKA 2NZ0A 4HREE 4OCIA 5CPVA 1CFDA 2CXJA 3TDZA 1MHOA 5JOLA 2ZNDA 3C1VA 4CFQA 1GGWA 1OMRA 5TNCA 1S1EA 2P6BB 3JVTB 3I5HB 3TDIA 2KAXA 1Q80A 2AMIA 2LP3A 4PE0A 4M2QA 1PVAA 1B8RA 1K96A 2F2OA 3MSEB 4GFTA 4AQIA 2PASA 4C0JA 3BYAA 1WDCB 1IGVA 5D7FA 1A03A 3PATA 2Y4QA 2BCBA 1YRTB 4HRGA 1TIZA 1CLBA 1B47A 1QX2A 1W7JB 2QPTA 1K9UA 4DIRA 3K21A 1KFUS 1XFXO 4FQOA 2SASA 1JBAA 1FW4A 2H61A 2MA2A 3NSOA 1YVHA 3D10A 4N1FA 4YGAA 1AP4A 1TCFA 3E3RA 2LC5A 4TNCA 3DF0B 2FCEA 2K2AA 4YI9A 1QS7A 1PRWA 2CCMA 4PHNA 2KI4C 4PHJA 5DKQA 1XYDA 1PSBA 1QV0A 3O78A 1BMOA 3TDUA 2RGIA 1S6IA 3KEVA 2ISDA 3PM8A 1CDLA 1MF8B 3AKBA 2BECA 1UHIA 4GBAA 3LK0A 2SCPA 4UPGA 4YBHB 2WCBA 1CM1A 2HF5A 1F4QA 2I94A 3KO0A 1B8CA 1QJTA 3CLNA 2OPOA 3LL8B 4XYNA 1B8LA 1TCOB 1FI6A 2LLUA 2I18A 1LINA 2KI6D 1M39A 1WRZA 1RWYA 3GK2A 4DUQA 2O5GA 1XA5A 1UHKA 1MUXA 3FIAA 2KHNA 4YGCB 4P2YB 2K8MB 1ZMZA 1ALVA 1EG4A 3CR2A 3BOWB 4OR9B 4XJKB 1V1GA 2MBXA 1XO5A 2BE4A 4USLA 1L2OC 1RECA 4MEWA 5FYXA 2L4IA 1AUIB 4MN0A 2WNDA 5HKWA 3BOWA 1Y1XA 1TTXA 1XFYO 2M1KB 3NXAA 3IQQA 5I2QA 1KFUL 1F4OA 1RTP1 3GOFA 1CFCA 1K9KA 1KK7Y 4GGNA 4DCKA 1JFJA 4JQ0D 2NCOA 3F45A 1UHJA 1A29A 1OFCX 1CDPA 2H61C 3SG6A 1YVLA 1F54A 2OTGC 3DVMA 2H2KA 4WRIA 3AKAA 3AAJA 2ZNEA 1NX0A 1PK0D 2KAVA 2M7LA 2LV7A 1PVBA 2LVKA 2KQYA 1J1EA 2IS9A 1WY9A 4HSZA 2DOQA 4QJ5B 4MVFA 3SG4A 5HLVA 2Y1NA 4PHMA 1ZUZA 4I5KA 1S3PA 1SRAA 3DVJA 1H4BA 1BJFA 1YTZC 2E30A 5BPJA 1TNPA 5JJGA 1OMVA 1DT7B 3IQOA 2WCEA 4WQ3A 2JOJA 3PFVA 1NPQA 3TS5C 1QIWA 1XVJA 1CDNA 1QV1A 2ZRTA 4ORCB 3CWGA 1KWOB 2FJUB 3LK1A 1E8AA 2K7OA 1MXLC 3O4YA 4BY4A 4YRUA 1QLSA 2KDHA 1CDMA 5DKRA 1KFXL 1NX1A 1HT9A 1ODBA 2LMUA 1RROA 1S26D 4YGBB 3FWCA 1N2DA 2Y1MA 2HQWA 2F3ZA 2L51A 3GK4X 1WRLA 2R2IA 3KPXA 1VRKA 2JT8A 2KYCA 4GAOA 4GGFC 2JRFA 2LCPA 4BY5A 3WNXB 3AAKA 4DS7A 4HRHA 1KQVA 4ICBA 1TRFA 1EH2A 4OV2A 3SIAA 1ZOTB 1QTXA 2NXQA 5KU1A 4ZCVA 1TNXA 4XJKA 2F2PA 1JUOA 2L0PA 3VRQA 1F55A 2BBMA 2OTGB 1DGVA 2PVBA 1Y1UA 3CZTX 1LXFC 3NSIA 1JC2A 2KQ6A 2Y5IA 3EKHA 2JXCA 1TNQA 1B1GA 1UUSA 1M45A 1S5GY 4GPLB 1B7TZ 5DKNA 2FCDA 4GUKA 1V1FA 1WLZA 2KOTA 1FF1A 2KI6C 1K93D 2PALA 4M2OA 5KTYA 1FPWA 2MAZA 1BG1A 3KHEA 1FI5A 1DF0A 1NIWA 1LVCD 2LM5A 2MLEC 2ZKMX 3OX5A 1CFFA 1BOCA 3EK7A 1DJGA 2JXLA 4PDZA 2COLB 2KSPA 2L5XB 3DF0A 2MHHA 3I5IC 2LHLA 1DMOA 1A75B 4GNKB 4NDCA 1SY9A 1KK8B 1S36A 1SNLA 1U5IA 1XFUO 2JT3A 1NX3A 2B1UA 2JNXA 3OB2B 3OHMB 1BU3A 2Q4UA 1TOPA 1PSRA 2JULA 1GJYA 1DJYA 2CNPA 3WXAA 4MRYA 3WHTB 2KBMA 2M8UA 1IRJA 4PE7A 3CS1A 1BF5A 5HKYA 2GGMA 2M7NA 3SJSA 4L9MA 1YR5A 4N1GA 5CSIA 2BCXA 2NCPA 1C07A 1NWDA 1SCMC 2E6WA 1JF2A 1KK8C 4QJ4B 4MRXA 2D8NA 1UP5A 3EK4A 1CMFA 2M1UA 4C0LA 1A2XA 1L2OB 1H8BA 1KQMB 3LCPC 3I5FC 5ER4X 1DJIA 1YUTA 1M46A 1YUUA 1CFPA 2EGDA 2KGBC 4R1EA 2Q91A 1YX8A 1F70A 1RFJA 5G08A 1SL7A 3SG2A 2LANA 3O6BA 1K9PA 1MR8A 5CSNA 3PLFB 3JTDC 2HPSA 2KNEA 3OB1B 1CNPA 1DJZA 2EC6B 1UURA 1OOJA 2LVIA 2MJWB 4Q04A 2CT9A 5B8IB 1DJHA 4ORBB 4ZCUA 2K7DA 1DVIA 3OP0A 4NDBA 3D0YA 2M29A 2JNFA 2AUCA 2JTTA 5AXIA 1FBVA 3I5GC 4JPZB 2LE9B 5HLOA 1OQPA 2BKHB 1NCYA 2LNKA 2NLNA 1NUBA 2M3WA 2ZRSA 2KI4B 1BLQA 2PRUA 1LKJA 3A8RA 1L7ZA 1YUSA 5F6TA 3BUMB 2MRDA 3HX4A 4AQJA 1DTLA 1NX2A 2G9BA 1J7QA 2BL0B 2K7BA 1CLMA 4P5OE 4MSPA 3EVUA 1LA3A 2HQ8A 2I7AA 5CSFA 3I5IB 3VRRA 5AERA 4I5NB 5GQQC 3SG3A 4CIDA 2OS8B 3EKJA 1IQ3A 2CBLA 1X02A 1BR1B 2F8PA 5HKZA 1SCMB 1KQMC 3TUYC 3VROA 4FTGA 2K61A 4MZKA 3EVVA 2KFGA 3TS5B 2JT0A 2K7CA 1G4YR 5I8NA 4PCWA 3VRPA 2M0RA 1N0YA 2LUCA 4CFRA 1SPYA 1B9AA 4MZLA 1CKKA 4MBEA 1J1DA 1RK9A 1MQ1A 2KYFA 1G8IA 2KFHA 2V53A 2HETA 5D69A 2LLTA 2PSRA 3OX6A 1CMGA 1EXRA 3DVEA 3RLZA 3VGOA 2TN4A 2ZFDA 3BQ3A 3O2PA 3I5GB 3SIBA 1B4CA 1OZOA 4OKHA 1W7IB 3FS7A 5AEQA 2VRGA 2BL0C 4A4CA 4D1EA 1WLMA 2WCFA 1S6JA 2JPTA 5IBWA 2G2BA 1BT6A 1QXPA 2AAOA 2JU0A 3BUNB 1GQMA 1SL9A 3ZNIA 1B7TY 1SW8A 2BE6A 2LLSA 1SBJA 2Y9ZA 2GV5A 2MLFC 1CLLA 1A75A 1RJVA 1Y0VH 2LUXA 1DJWA 1MXEA 3LLEA 4NQGA 3GK1A 2K2FA 2GGZA 2I2RE 1TN4A 3DVKA 1NP8A 1YURA 4A4BA 1HQVA 1UHNA 2LMTA 3BUWB 1F8HA 1UWOA 3WHUB 1AVSA 2KGRA 2L4HA 1BODA 1CB1A 4F0ZB 3H4SE 5ER5A 2L2EA 1EG3A 1QX7A 1CTRA 4PALA 1M63B 1NCXA 5J3XA 3KF9A 1SL8A 1OZSA 2L98A 1C7VA 1IG5A 1NCZA 1JWDA 2Y9YA 1J7OA 1SYMA 3I5FB 4PE4A 4E68A 2O60A 1JFKA 2JWWA 2BBNA 1JF0A 2JTZA 4WQ2A 1JSAA 3EVRA 1WRKA 4CLNA 2WOSA 1D1OA 1EJ3A 3ICBA 1YX7A 4YI8A 1KFXS 4QJ3B 1XFVO 3BUXB 1C7WA 1S5GZ 3D0YB 3NSLA 5AANA 2LMVA 3SG7A 1U5IB 2LHIA 1IWQA 1AJ4A 1OMDA 3EK8A 2OS8C 3DD4A 1QX5B 1BR4B 1A4PA 3CR4X 4ORAB 3FWBA 1KWOC 1IJ6A 1QASA 3CR5X 1WDCC 1XFWO 5KSZA 1KSMA 1AHRA 1N65A 1DF0B 1K95A 4OVNF 5HYDA 3VRNA 1SCVA 2JQ6A 3SG5A 2JC2A 4MZJA 1ZFSA 2M9GA 4I5JA 2FOTA 4IL1A 5I2LA 3I5HC 1CM4A 1IH0A 4PHKA 2BCAA 4YGDB 3CTNA 4C0KA 1MWNA 1K2HA 3A4UB 1QVIY 1G33A 1GGZA 2K0JA 1NYAA 1LA0A 3JVTC 3QRXA 1KK7Z 3CGAA 4CPVA 2LAPA 1KCYA 1IKUA 1SR6B 1KSOA 2A4JA 2KAYA 3M0WA 2EC6C 3PN7B 3PSRA 2ZN8A 1Y1AA 2F3YA 5K89A 1ZACA 2KFFA 4MLWA 3TZ1A 1XK4C 2KBIA 1YRUB 1AK8A 1J55A 2LP2A 1IQ5A 2L50A 2PMYA 5PALA 2BKIB 4M2PA 4PE1A 1J7PA 3NSKA 1J7RA 1TNWA 1Y6WA 2JZIA 1DGUA 2LVJA 3RM1A 3PN7C 1S6CA 1K94A 1R2UA 1OSAA 4AOMA 5AFPA 3JTDB 2M97A 2QACA 1PULA 1K8UA 1QIVA 3BUOB 2EHBA 1PALA 3PALA 4YGEB 1SKTA 1SK6D 2F33A 3IF7A 1NSHA 4U8DA 3HCMA 3BXKA 5CSJA 2M49B 4NDDA 1SMGA 4JWQA 5I2OA 1OE9B 1EL4A 1AJ5A 1QVIZ 1QATA 2CTNA 2ZN9A 3TUYB 3ZWHA 1XFZO 2WC8A 1DJXA 2LVVA 2WORA 1R6PA 4I5LB 1ALWA 1SR6C 1IJ5A 4DRWA 4ETOA 1XK4A 1K90D 1M31A 4N5XA
chains in the Genus database with same CATH superfamily
1UHHA 1QLKA 4OCIA 1LTJC 5CPVA 1M90Q 1MHOA 4CFQA 1OMRA 3I5HB 1PP9J 3Q1MA 2A06E 1QGKB 2FFDB 2AMIA 1AVOA 1N7SD 3A0HH 1B8RA 1ZMEC 1NYHA 1Q86Q 2OYIC 1WDCB 5D7FA 1A03A 4L76A 2IFMA 4N78E 2BCBA 2E74D 1JTHA 3LIDA 1QX2A 1W7JB 3AE8C 2L5YA 1DEBA 1XFXO 2SASA 1DC1A 1FW4A 2K60A 4O9BA 1ZRTE 3EG5B 1ORGA 1OW7A 4YGAA 2LC5A 2FCEA 1JY2O 3HTKB 2OARA 4PHNA 1NVOA 5DKQA 3KZIH 2JWAA 1S6IA 2C0XA 3HD7B 1KN7A 3A5TA 2ISDA 3PM8A 3AKBA 1QL2A 2SCPA 1N2DC 4YBHB 1CSBA 2HF5A 2I94A 5KJ7C 1QJTA 3CLNA 2WCLA 2LLUA 1LINA 1LTBC 3KZIE 1Q81Q 3GK2A 1LT9B 2XZRA 2OYHA 4P2YB 1ZMZA 4OR9B 1FDMA 5I2QA 1Y1XA 1L0NE 5KLVD 4H0LB 3S1KA 1KK7Y 4JQ0D 1KB9I 3H1HD 1OFCX 1LWUC 5BVZA 4TT3H 1YVLA 2AEFA 1SQBD 1NTMD 4BWNA 2Z5IA 1L4AD 1BDCA 3CZ1A 2WPVB 3AKAA 3AAJA 1PK0D 1PGQA 2O01J 3M0AA 2LV7A 3TNUB 1SQPK 2LVKA 2KQYA 3BFHA 3I55P 3IR9A 3T97A 2A45G 5HLVA 2Y1NA 4AQRD 1PFIA 5AW4B 1SRAA 1BGYD 1NU1E 1H4BA 3S0DA 5JJGA 1DT7B 1QIWA 1P84I 1QV1A 1XFRA 3LK1A 4BY4A 3GHGB 4RESB 1JTHB 2KDHA 5AVRB 2I1KA 1KFXL 2W27A 1GL2B 1N2DA 2Y1MA 2LXBA 4HH2A 1M1JB 3USSA 4GAOA 4GGFC 5APYA 3V4WA 2FFDA 3R72A 3NFQA 3L70J 3RGUA 3SIAA 2ZYGA 3VRQA 4XJKA 1F55A 1JUOA 3SFEC 1DGVA 5TISH 2PVBA 2YXQB 3NSIA 2IBZD 1BGYJ 1M56D 2V7QH 2QJYB 3EKHA 1R5LA 1QWVA 5B5EH 3CX5H 3L75G 1IFNA 3RK3D 5KTYA 1CW5A 1S72P 2OTJP 2W83C 5B66E 2OYOA 3WU2E 1M7LA 2LM5A 2ZKMX 2IYOA 1FZGA 1BOCA 3EK7A 1DJGA 4C7NB 1IFDA 1NTMJ 4PDZA 2COLB 2L5XB 1GK6A 2MHHA 3NHTA 4B86A 3S0AA 2LHLA 1OVVA 1KK8B 2KUBA 5KLVJ 1XFUO 2B1UA 2JNXA 3OB2B 1RF1C 2ZYAA 2V4HA 2Q4UA 1TOPA 3H1LJ 3H1JG 1DJYA 1NTZD 2E75B 3CCQP 4Z1MH 4MRYA 3H32A 4U7JA 2KBMA 3H6PA 2M8UA 5APSA 4PE7A 1QLED 2GGMA 2M7NA 1GZLA 5CMZA 2KK7A 3B5ND 4L9MA 1YR5A 1GW4A 2BCXA 1C07A 1BE3G 4I1LA 2FKWB 1LT9A 2BCCG 3D71A 5KLVE 1CMFA 4C0LA 1XTGB 1A2XA 4L74A 3AEAC 1DJIA 3S0FA 1RQVA 2EGDA 2KGBC 2ZFCA 3TNUA 2O01H 1IFPA 1L4AC 2J5UA 2KNEA 2FYNC 2WSEH 1X8YA 3ITKA 1PP9G 1S5LE 2WPRA 5CCHA 2K7DA 1DVIA 3OP0A 2K37A 4NDBA 4WWIA 3L4FA 1YTZT 2DW3A 1FC2C 2AUCA 3KHUA 2FYNB 1NTMK 2AXTE 5HLOA 4OH8B 2BKHB 1TWOA 3H32B 1SQQE 3P8CD 4ASVA 2NLNA 5AW5B 3R1OA 1YHQP 2M3WA 1FOSF 1BLQA 2PRUA 3RK2C 2HYNA 1YUSA 5APTA 3CCMP 5KAFE 3V4QA 1VPCA 1DTLA 3B6XA 1URQA 3CMAP 4MSPA 2GM4A 4TLFA 5GQQC 3WMM0 5CJ0A 1Y9BA 2XKMA 1SCMB 3AEFC 3TUYC 2H43A 2KFGA 3EWKA 2RMZA 3IFMA 3P8MC 2N1TB 1N7SB 5E79H 2M0RA 4CFRA 1SPYA 4MZLA 1SFCC 2QM8A 4RO0A 4MBEA 1X9VA 3KQGA 1MQ1A 4IFMA 2HETA 1OOGA 1CMGA 4KJMA 3VGOA 2TN4A 2ZFDA 4OKHA 2N9YB 1KFNA 1WLMA 1D7MA 5AVZB 1NAFA 2G2BA 1FS0E 2AAOA 3BUNB 1GL2A 1L0NK 1B7TY 3JC22 3A0BE 1URQC 2LLSA 2MLFC 1BE3E 1CLLA 1RF0C 1LS8A 1ZRTD 1Y0VH 1DJWA 4NQGA 1YBKA 2FYZA 1TN4A 4DJGA 2WPSA 3M91A 1UHNA 2HPCA 3S0GA 1BODA 1M1KQ 3T97B 4PALA 1T6AA 1OZSA 2M3EA 3TYYA 1IG5A 2BEZF 4NPDA 1J7OA 1NU1K 4E68A 3L74J 1MFTA 4WQ2A 1JSAA 3VMAA 4CLNA 2QVAA 4PD4E 1KFXS 4NPEA 1S9KE 3WU2H 3L73D 1S5GZ 3NSLA 1VQ6P 3H1LG 5AANA 4UB8E 1IFJA 2QJKC 2LMVA 3L72D 1LGHB 1HUCA 4WY4B 1RY3A 1EZVI 2R32A 2KIKA 4GDOA 3CR4X 3Q8IA 4ORAB 1IJ6A 1XFWO 5KSZA 1UIXA 1N65A 1K95A 1RE3A 1U7MA 5HYDA 3VRNA 2BCCJ 3S0EA 1ZXGA 3SG5A 4MZJA 4IL1A 5I2LA 1N86A 2K3RA 5AW0B 3Q5RA 4ZMDA 3IVTA 1K2HA 4IL6X 3IF4A 1KILB 1L0NJ 1G33A 1OWAA 3RK2D 2M5AB 2V7QJ 3QRXA 4PD4I 3CGAA 4ZNCA 1FJPA 1HGZA 2WSCJ 2QEBA 2F3YA 2O01N 1ZACA 3TZ1A 1IQ5A 3F5HA 1SQBG 3W68A 2BKIB 3B5NC 3N4XA 5D3OA 3NSKA 3R1VA 2K9JB 2KZIA 2ZYDA 1OOHA 3A3YB 5AVQB 5FI6A 1MZ9A 4DT0A 1NJIQ 1A02J 1ZR2A 5APQA 1VL2A 1VQ8P 1OSAA 4FQTA 2QACA 1OX3A 4EIJA 3BUOB 2M5AA 3RK3B 2HLOA 1SKTA 3L37A 1SK6D 3VOPA 3BXKA 5CSJA 1DX7A 1SMGA 5I2OA 1AJ5A 2ZN9A 4I5LB 2WC8A 2LVVA 2WORA 1R6PA 1AFOA 4DRWA 2KXPB 1J1EB 3MD0A 4IFFA 4N5XA 2WTYA 4GGFA 1RF1B 1YQ4C 2ZNDA 1PPJG 5KLIC 1FZAA 4AYCA 1S1EA 4WY4C 1Q80A 1N73A 2WVRA 4M2QA 5CBNA 4GFTA 1NAYA 3DYEA 3E1IA 1SQQG 4I7ZB 1YRTB 1TIZA 2HG5D 1SQXJ 1LTJB 2WCMA 1VQNP 1JBAA 3N7HA 4PJ0H 2H61A 2MA2A 3NSOA 4YXWH 4HKZH 1YVHA 4OZDA 3D10A 3W67A 1OOIX 1TCFA 1ZOYC 3DF0B 3NTNA 2Z4EA 4YI9A 5AW7B 2C9NY 1XYDA 1QV0A 1VF5C 1BMOA 2NPSD 3U1AA 3KEVA 1MF8B 1Q2NA 2J58A 1JY2P 3LK0A 4UPGA 2WCBA 2OPOA 1TCOB 1M1JC 2I18A 3RK3C 3CX5D 1M39A 1WRGA 1FZCA 2FY8A 1MUXA 4UB6E 3CZ2A 2XNXA 2MBXA 3CR2A 3BOWB 1V1GA 2GUVA 1XO5A 2OTKE 3GG2A 1L2OC 1RECA 2MKVA 3WUTA 5FYXA 3R4YA 1AUIB 4MN0A 5KAIE 1QVGO 1KYOH 1XFYO 1CFCA 1K9KA 3F45A 2H61C 3SG6A 1DIPA 1LP1A 2OTGC 3DVMA 3MUDA 4WRIA 4IL6H 1EZVE 1JY3P 3V2PA 1NX0A 1J2JB 2KSEA 1U57A 3TGUG 3AEBC 2R3SA 1J1EA 2QEVA 2JP3A 4BXLA 3SG4A 2O1JA 1ZUZA 1WMKA 3DVJA 3P7KA 2E30A 1Z2CB 1OMVA 1AQ5A 3CXHE 2JOJA 3TS5C 1NPQA 2RKLA 1LTGC 2WQYC 2ZRTA 2J59M 2IBZE 2FJUB 3BJHA 3G9RA 1OVUA 3NHIA 3O4YA 4KYNA 4Y99B 4I2LC 1JCCA 2LMUA 1RROA 3CZ0A 3FWCA 1NWQA 3KPXA 2WMMA 4D6TE 1NU1G 2JRFA 4C7RA 2E75C 4ASWA 1EDLA 3WNXB 3AAKA 4HRHA 1HGVA 2D2CB 2R5DA 2WSFH 5AW1B 1W5CE 2PAJA 4OV2A 4YTPC 2YIUB 1NGMB 2I8DA 1P28A 2FXOA 3HD7C 1Y1UA 1IFMA 2AXCA 3HE5B 4Y99C 1J1DB 3VP9A 1KILA 2W8ZA 5CJ4A 2KI7B 4GPLB 2WZ7A 4PT1A 1B7TZ 3VB1A 2L91A 4GUKA 1W2BO 1FU1A 1V1FA 2K1AA 1FF1A 2AXTH 5GTHE 4M2OA 1FPWA 4EI2A 3KHEA 2HODA 1LVCD 2MLEC 3A0HE 1J1DC 1M57D 2GUSA 2PFXA 3UO9A 1FZEA 5APVA 5CCGD 1T3JA 2QIWA 2WCHA 2OYIB 1DMOA 1A75B 3L71E 4L75A 4WY4A 1USDA 4INWA 3OHMB 1GJYA 2N1TC 2CNPA 3FE8A 4JKTA 3G71P 2Y0EA 4PD4D 5KTBA 3MP7B 2FFDC 1IRJA 1BF5A 5HKYA 3RL0D 1DELA 5DJUB 3LW5H 4N1GA 4UB8H 2NCPA 4C7NA 1SCMC 2E6WA 3TF5A 3B7AA 3SS4A 4MRXA 4OGQD 1JEKA 2D8NA 1L0LE 1UP5A 2M1UA 3RK2B 3I5FC 1N7LA 3B8EB 3D78A 3D75A 1RF0A 1YUUA 3OBVA 1H89A 4R1EA 4D6TG 1YX8A 2HFED 3JCUE 3O6BA 1LNQA 1K9PA 3PLFB 1CNPA 2NPSB 1UURA 1OOJA 3QMEA 3V2QA 3CPWO 1DJHA 2IBZG 1BGYG 1YTZI 1BCCG 2L2CA 1WT6A 2YMKA 1ZLLA 1FDOA 3CXHD 2JTTA 5AVVB 3V6IA 1FBVA 3UIAA 1OVRA 1OQPA 1SQQJ 1DD4A 4MN4C 4H44C 2LNKA 3M0DC 5K5GB 2ZRSA 1NTMG 3HRNA 1IIOA 3A8RA 1KC8Q 5F6TA 1OZHA 3BUMB 2MRDA 4IFDK 4AQJA 2E76B 3TGUD 1CLMA 2WITA 4JBZA 1GU5A 3EVUA 3AE3C 1PZQA 2I7AA 1T2KD 3SG3A 3D6ZA 1JMMA 1RE4A 2OS8B 2YO3A 1IQ3A 2F8PA 1X02A 2FYUK 1YIJP 3EVVA 4RKUJ 1LTTC 1HVVA 3PRJA 1N0YA 1S5LH 1JOCA 2PP6A 4YXDC 1JCDA 4K35A 3L70D 2WT7B 2KPHA 2PSRA 3NGVA 3OX6A 1T3UA 3SIBA 1SQVD 1B4CA 2YXRB 2QDIA 2D2CC 2WPQA 1SQVJ 3VP8A 2K88A 4C46A 2OYHB 4A4CA 1HWTC 5IBWA 1GMJA 1SL9A 3ZNIA 1SW8A 2BCCE 3TGUE 2BE6A 2K9YA 3CX5I 1A75A 3LLEA 2IZ0A 1MXEA 2K2FA 2GGZA 2N1TD 1FZFA 3N7NA 2ITAA 2JPOA 4INXA 1SQVE 1UWOA 2KGRA 3GW6A 2KOGA 3AE9C 1C3YA 2L2EA 2FXMA 1QX7A 1CTRA 4XFJA 2SPZA 2Y0CA 1C7VA 2Y9YA 1TUJA 2XV5A 2KNCA 1JF0A 3EVRA 1BGYE 3TSIA 2Q3EA 1YX7A 1RHZB 3AE1C 5B66H 4QJ3B 3HE4B 3D0YB 3M0DA 3PLNA 1FDIA 2HR3A 1KQLA 2LHIA 5B5EE 3EK8A 4IOIH 2W6AA 1BR4B 2WT7A 1NTME 1GDTA 1KSMA 2B87B 3BRVB 2IZ1A 2LXCB 2ZAEB 2JQ6A 3GMAA 4UB6H 2M9GA 1OXZA 1CM4A 4IL6E 3A4UB 2P2UA 1GGZA 1A02F 3RL0C 4PV1D 3JVTC 2FXPA 2MJZA 1JY2N 4CPVA 4ZKUA 4H0LC 1VQ7P 3PSRA 3M0WA 3PN7B 2YGUA 2ZN8A 1Y1AA 5K89A 2KFFA 1AK8A 2LP2A 2PMYA 2C9LY 2FJYA 3BCCE 3BFAA 3CXHI 1URQD 3V2LA 2Q6QA 4PE1A 1J7PA 1J7RA 1TNWA 1LWUA 1BE3D 2JZIA 2YKQA 2LVJA 1EXJA 1K94A 1G2CB 3L4AA 5AFPA 2AEJA 3H1KG 1K8UA 1EC5A 1HTLC 1P84D 3B88A 1H88A 1ZN5A 3CX5E 2F33A 3IF7A 1JM0A 1SQXD 2L5GB 5KLIB 4JWQA 1Y47A 1OE9B 1EL4A 1VQMP 5APXA 1QATA 3B5NA 1JB0J 5TISE 1DJXA 1H0TA 2BNXA 1IJ5A 1GW3A 1U7JA 1M31A 1P84H 3L72G 2NZ0A 1CFDA 2PGDA 3H1IG 1S9KD 1K9MQ 5TNCA 1JUNA 2IPPA 3TDIA 4HJGH 1BSNA 2LP3A 1PVAA 4GT1A 3VYIA 1K96A 4AQIA 3II6A 4QMAA 4C0JA 1LTJA 4GKGA 1IGVA 3PATA 1SQXE 4HRGA 1CLBA 1B47A 1MV8A 3GHGC 4OGQB 2M8RA 2QPTA 1KFUS 4FQOA 3S0BA 3V2NA 1PGPA 2Q9IA 1USEA 4U3FE 3L74G 4U3FG 4N1FA 3L71J 5CBOA 3CCEP 2GA1A 3D74A 3L75E 3HD7A 4TNCA 2K2AA 1L4AB 2XNDH 1QS7A 1PRWA 2CCMA 3KYQA 4PHJA 1PSBA 3O78A 3TDUA 2H89C 2RGIA 4D6TD 1CDLA 4N6JA 1OMIA 1UHIA 1T14A 3MIWA 1IO4A 1X0TA 1CM1A 3KO0A 5KJ7A 1B8CA 3LL8B 2FYUG 1QX8A 1B8LA 2YKOA 2KI6D 3OA7A 4LLHA 3H1KE 1WRZA 1RWYA 4DUQA 3H1HE 2P58A 3C9IA 3FIAA 1ALVA 1EG4A 3BCCJ 2BE4A 4USLA 4MEWA 2L4IA 5BU5A 3IQQA 3MGNA 1RTP1 5I94A 1OW4A 4GGNA 1T8ZA 1JFJA 3CI9A 2K9JA 1LT9C 4EOTA 1HJBA 3AEDC 1KYOD 1NTKE 1DEEG 3EQ2A 1SFCD 3CCSP 1Z4HA 2IS9A 3CWBG 3MZWB 5DJTB 1WY9A 2DOQA 1X22A 1L4AA 3L73J 1S3PA 3PJIA 5CHXA 1YTZC 3QWOC 1TNPA 1FAVA 1SQXG 3IQOA 3PFVA 1XVJA 1P84E 4ORCB 2KLUA 2ZJSE 3CWGA 1E8AA 1PP9D 1MXLC 4YRUA 2E42A 1CDMA 5DKRA 1ODBA 1C3ZA 4PV1B 1S26D 4YGBB 2W6JH 2H7HA 2HQWA 2F3ZA 2L51A 2NZ2A 1CI6B 2R2IA 1W2EA 2JT8A 2KYCA 4JF7A 3K1EA 2LCPA 4BY5A 4DS7A 4ICBA 2KS1B 3H1IE 1EH2A 1CI6A 3O6QB 2CPBA 4LC1A 1BDDA 3S4RA 2NXQA 1NOHA 5EL2A 4ZCVA 1TNXA 3B71A 2L0PA 1Q7YQ 3MTUE 1IFIA 1XTCC 3CCUP 2FYUE 3KXDA 1SQQK 1YJNP 2Y5IA 1B1GA 1TNQA 2JKVA 1NTZJ 5DKNA 3PTZA 3B5NB 2KOTA 3H1LE 1DEKA 1K93D 3A0BH 4RJTA 1FI5A 1DF0A 1YQ3C 4L73A 1KB9D 2P7JA 3OX5A 1CFFA 3ABVC 1SFCA 5H2FH 1YJ9P 3DF0A 1FBMA 3CL3D 2FBWC 3CABA 3O6QA 4NDCA 1SY9A 1S36A 1U5IA 1SNLA 3AEGC 5TJHA 3TGUJ 1PGOA 3IAOA 1NH4A 2JULA 2KYVA 4EDFA 1TU3F 2O1KA 3CWBE 3G6EP 1MUUA 4A7PA 3WXAA 5KAFH 3HUSA 5AW3B 3SWFA 1GM0A 2KZJA 2KP8A 4XE5B 3RK3E 3SS5A 2POHA 5CSIA 3DZTA 2QRXA 3CYZA 3WUVA 1SQVK 2W6BA 1DH3A 4U3FJ 3EK4A 3M9BA 1L2OB 1KV4A 2RH0A 1G1IA 2P10A 5KKZB 3L72E 1M46A 1NU1J 1CFPA 1F70A 1RFJA 5G08A 2R5BA 1SL7A 2E74C 2KLDA 1MR8A 5CSNA 5CCGA 1YI2P 3JTDC 1DJZA 2EC6B 2IFNA 1NTZK 4Q04A 1URQB 2MJWB 2E75D 1PPJE 5B8IB 1HJ0A 4ZCUA 1IK7A 1EQ7A 2A45H 1LTAC 1GK4A 3D0YA 2M29A 2WSFJ 2JNFA 3FWLA 3HUSB 1KFMA 5M1BA 4JPZB 2LE9B 1Q90D 4GOFA 3PH0A 1NCYA 2P67A 3G3ZA 1NUBA 2KI4B 3VMZA 1LKJA 2RN0A 5KKZC 4R4LA 1J7QA 2G9BA 2R3CA 2IDBA 1AJYA 3SS3A 3D77A 5CSFA 4I5NB 4CIDA 2R44A 1ZV8A 1SFCB 4OWFA 1BR1B 5HKZA 1FE6A 1KQMC 2YMYA 3LW5J 1UIIA 2K61A 5AW6B 3TS5B 2JT0A 3H25A 5I8NA 1MFZA 2M0BA 4PCWA 3VRPA 2QG4A 1FOSE 1NTKG 5APWA 3AE2C 1GTWA 1RK9A 1BE3J 1G8IA 2KFHA 4BRYA 2V53A 5D69A 3JCUH 1TUZA 2QJPC 2LLTA 2WCKA 3BQ3A 4I6MC 2P1JA 1OZOA 4WBAA 1VQPP 1W7IB 3FS7A 5AVTB 5AEQA 2VRGA 2ZT9C 4ZKPA 1KTMA 4D1EA 2WCFA 2QJKB 5KLVK 5H2FE 5C39A 1BT6A 1QXPA 1VQ5P 2E76C 3BASA 3H1IJ 2Y9ZA 3D70A 4WY4D 5L8RJ 1RJVA 1PP9E 2KB7P 3GK1A 2E5YA 1H0TB 2I2RE 2QA4P 3L75D 3DVKA 1YURA 2LMTA 2JWDA 3L74D 2OYHC 1SQPE 1AVSA 4U3FD 4N78D 1CB1A 4F0ZB 5AVWB 1L0LK 2O3JA 1EG3A 1VDFA 5J3XA 2A45I 3KF9A 1SL8A 2L98A 2B87A 3OW2O 1NCZA 1AA0A 5AW2B 1G2CA 3I5FB 4PE4A 1HF9A 1JFKA 2JWWA 1AQTA 2KLEA 1SQXK 2BBNA 2B9BA 5GTIH 1WRKA 1EJ3A 4YI8A 2OGUA 1JY3O 1XFVO 3BUXB 1C7WA 1VF5B 2P71A 5CCHC 2I1JA 3PM2A 3O8ZA 2WSCH 3HE4A 3SSUA 1PGJA 2G8YA 1OMDA 2OS8C 3DD4A 2GTEA 4H13B 3NMDA 3FWBA 1KWOC 3LIEA 1BSHA 1FZBA 3CR5X 3GHGA 1BCCJ 3GF7A 4OVNF 3H1HJ 3CCVP 2N1TA 2LR2A 1ZFSA 4I5JA 2FOTA 1SQPD 3SFDC 3I5HC 1RQUA 1KILE 3L47A 3AEEC 3CC7P 4PHKA 3L70E 2BCAA 4YGDB 1MWNA 1DQEA 2QEHA 3A7OA 3CWBD 1FZCC 2E5TA 2IBZI 1KD1Q 4IJ7A 4GIFA 1JMBA 2LAPA 1KCYA 1IKUA 1VQOP 3K5BA 1KSOA 1L2PA 2EC6C 5GTHH 5AVYB 3KPEA 4MLWA 3CXHH 5PALA 3F89A 3VTPC 1L0LJ 1IC2A 1DGUA 3UNWA 3AE5C 4R4MA 1FJKA 1EZVG 3JTDB 2M97A 1MKMA 1PULA 1PALA 2E74B 3PALA 1NSHA 4U8DA 3SWYA 3HCMA 3D76A 2M49B 2VRSA 2QM7A 2CTNA 3TUYB 3ZWHA 4ETOA 2ZT9D 1NO4A 1ALWA 1EXIA 3S9OA 1KILC 1K90D 3AE7C 2M3BA 3FGAD 1F71A 4OGQC 4HREE 3TDZA 2CXJA 5JOLA 2B89A 1VQ9P 3C1VA 2ZVOB 1GGWA 3B4SA 3U1CA 2P6BB 3JVTB 4KHXA 3HD7D 2KAXA 1N73C 3PP5A 3OGNA 4PE0A 1LJ2A 1VQKP 3U59A 1K04A 2F2OA 2BAPA 3MSEB 1NTZG 2PASA 2IX7C 3BYAA 1SQPG 1NU1D 1H8AA 2Y4QA 3KDPB 1LWUB 2QJPB 1K9UA 4DIRA 3K21A 3GLMA 4HB1A 3CC4P 1JO5A 3RBXA 1OOFA 2PQLA 1BCCE 1S3JA 1OIPA 1YJWP 3L71G 2E43A 1AP4A 3E3RA 3G4SP 2W90A 3H1ID 1K05A 3IN6A 2KI4C 1L0ND 2BECA 3L70G 4GBAA 2WSSH 4WVZA 2CPSA 5GTIE 3H1JD 4NPFX 1F4QA 1T2KC 4XYNA 3CD6P 1FI6A 1QL1A 2Z5HA 2O5GA 1XA5A 1UHKA 2KHNA 3DXLA 4YGCB 2K8MB 4XJKB 1NTKK 2WNDA 3Q5SA 5HKWA 3BOWA 2M1KB 1TTXA 1EDKA 3RBZA 3NXAA 1KFUL 1F4OA 3GOFA 4PJ0E 1QEXA 4W7ZA 3ZDMA 4BRYB 4DCKA 2WSEJ 2NCOA 2JO1A 2Q1KA 1UHJA 1GL2D 1M1JA 3L72J 4N3YB 1A29A 1K73Q 3FXDA 1CDPA 1F54A 2H88C 2H2KA 1PPJD 4DOJA 2OQQA 3TK1A 2AEMA 1HH0A 3D6YA 2ZNEA 2KNCB 1EDIA 2QSIA 1S5LX 1E79H 2KAVA 2D2CD 2M7LA 1PVBA 3M06A 3CCJP 5DICA 2NRGA 4HSZA 4QJ5B 4MVFA 3L73G 4PHMA 4I5KA 3L75J 2HODB 1PV3A 3EFGA 1KQFB 5BU8B 3M9HA 1NKZB 1BJFA 5BPJA 1N7SC 4LGDE 4H44D 2KLVA 2WCEA 4WQ3A 1CDNA 1W9ZA 2ZXXA 1KWOB 2WC6A 3JSVC 2K7OA 1QLSA 1NX1A 1HT9A 1CZQA 2QE7H 3L4LA 1EZVD 5AVSB 3R2PA 1K8AQ 2YKPA 3GK4X 3FWNA 1WRLA 1VRKA 3D73A 2QJYC 1KQVA 1S2EA 1TRFA 3C8VA 3AE4C 1ZOTB 1QTXA 2OYIA 5KU1A 1VQLP 2F2PA 2BBMA 3WUUA 2OTGB 3CZTX 3BVHA 1LXFC 1JC2A 2KQ6A 4HYTB 3L35A 2JXCA 1UUSA 1M45A 1S5GY 3CMEP 1S4XA 2UWJE 2FCDA 1NKNA 1AV1A 1WLZA 1IK9A 3FE6A 2KI6C 1ZP0C 2PALA 1S1CX 2MAZA 1BG1A 1DD3A 3H1LD 1NIWA 2WC5A 3L36A 3RL0g 3BCCD 3HE5A 4JD9A 2JXLA 3HTKA 1E5WA 2KSPA 1YYCA 3CC2P 3I5IC 3RZSA 1GD2E 2ZT9B 4GNKB 1SLQA 1SQBE 2JT3A 1NX3A 3AECC 3V2RA 2QEXP 1BU3A 3CWBJ 1PSRA 3H1JJ 2H8VA 4H13D 1VQ4P 3B87A 2WCJA 3WHTB 2PYQA 1SQPJ 3CS1A 2H8PD 4PV1C 3SJSA 5AW9B 2ZVNB 1SS1A 5AVXB 4JYCA 2BASA 1QVFO 4AUWA 1RE3C 1NWDA 2JJLA 3GF3A 1JF2A 1KK8C 4QJ4B 2NPSA 1R8EA 2XDJA 3BCCG 3Q5PA 1Q82Q 1H8BA 1KQMB 3LCPC 1SQVG 2BEQD 5ER4X 2E76D 1YUTA 1NTZE 2Q91A 3O4XA 1Y8AA 3SG2A 1KZUB 2IYPA 2LANA 1IJDB 3OB1B 2HPSA 3SWKA 1EDJA 1LP1B 2LVIA 1SP4A 2CT9A 4ORBB 4PD4H 3PHLA 1PL5A 2CK3H 3RL0B 3L73E 3CDNA 3A2AA 1LTSC 3MUDC 5AXIA 3TDKA 3I5GC 3R1PA 4YPCA 1YITP 1FZCB 1KQGB 2FYUD 1L7ZA 2WWWA 3BFBA 2A06D 3HX4A 4H0LD 1NX2A 4WB4A 5CCHD 2BL0B 2K7BA 1N73B 2Q5UA 4P5OE 1LA3A 2HQ8A 5AERA 3C1LA 3I5IB 3VRRA 1RE4C 3EKJA 3OAKA 2CBLA 4XA4A 1OW8A 3VROA 4FTGA 2Q7CA 4MZKA 5E79E 3EFFK 1KQSO 4F7FA 1SQBK 2K7CA 1G4YR 1HBWA 1L0LD 4CPGA 3CCLP 3BRTB 2LUCA 1B9AA 3V5BA 1CKKA 3Q2YA 1IZNB 3OJAB 1J1DA 4EYYQ 2Y0DA 2YO2A 2KYFA 1PIXA 1M8OB 3DY9A 1EXRA 3DVEA 3RLZA 5FI7A 3O2PA 3I5GB 5AW8B 5KJ7D 4DZOA 3CCRP 3I56P 3P32A 2N9BA 2OTLP 2BL0C 1L0NG 1RH5B 1S6JA 2JPTA 4D6TJ 1N8RQ 1Z56A 5EFWB 4K3AA 2JU0A 2Q3IA 1GQMA 3CLQA 2JR8A 1N7SA 1SVFA 3AE6C 5KLVG 1SBJA 1RF1A 3VN0A 2GV5A 3L71D 2JEEA 3QH9A 1BCCD 2YIUC 2LUXA 3FE9A 3PJSK 1NP8A 4A4BA 1HQVA 2XU6A 3M9QA 3BUWB 1F8HA 3WHUB 4I7ZC 2L4HA 3H4SE 3BATA 5ER5A 3H1KJ 1GU4A 1M63B 1NCXA 1KMIZ 3H1KD 3FX0A 3FXEA 1JWDA 1SQQD 1SYMA 3P8CE 3Q3DA 2O60A 1KILD 2B88A 3L74E 2JTZA 2WOSA 2ERBA 1D1OA 3ICBA 1SQBJ 4GOEA 2PRRA 1J1EC 1LTIC 3SG7A 1U5IB 1IWQA 1AJ4A 1NHLA 1KYOI 5CCGC 5HL1A 1QX5B 3E1RA 1A4PA 1SSEB 2P70A 2A06G 1KYOE 1NTKD 1QASA 5KAIH 1WDCC 1AHRA 1DF0B 3H1HG 1SCVA 4H44B 3E7KA 4W80A 2JC2A 2QEOA 2C0WA 1IH0A 5APUA 3VMXA 3CTNA 4C0KA 1QVIY 2K0JA 1JY3N 1NYAA 1R5SA 1LA0A 3B86A 1KK7Z 4H13C 1SR6B 2A4JA 2KAYA 3HUSC 1VF5D 2NPSC 2BCCD 2KS1A 2KSJA 3MHVA 1ZR4A 1XK4C 2KBIA 1YRUB 1J55A 2LKMA 1JNMA 5FI2A 2L50A 4W7YA 1L0LG 2ZXEB 1X79B 4M2PA 1Y6WA 2JDIH 4M3LA 4Y28J 3RM1A 1ZW0A 3VMYA 3PN7C 1S6CA 1R2UA 3NXSA 2FYUJ 4AOMA 2YNYA 1QIVA 1KB9H 1NTKJ 4GODA 4JYBA 2EHBA 2G3AA 1KB9E 4YGEB 1OW6A 2HPCB 1AVYA 1G1JA 1LT1A 3H1JE 1GL2C 5AVUB 4NDDA 1QVIZ 1XFZO 1KORA 3I5CA 1SR6C 4KT0J 1XK4A
chains in the Genus database with same CATH topology
4GGFA 1F71A 1UHHA 1QLKA 2NZ0A 4HREE 4OCIA 5CPVA 1CFDA 2CXJA 3TDZA 1MHOA 5JOLA 2ZNDA 3C1VA 4CFQA 1GGWA 1OMRA 5TNCA 1S1EA 2P6BB 3JVTB 3I5HB 3TDIA 2KAXA 1Q80A 2AMIA 2LP3A 4PE0A 4M2QA 1PVAA 1B8RA 1K96A 2F2OA 3MSEB 4GFTA 4AQIA 2PASA 4C0JA 3BYAA 1WDCB 1IGVA 5D7FA 1A03A 3PATA 2Y4QA 2BCBA 1YRTB 4HRGA 1TIZA 1CLBA 1B47A 1QX2A 1W7JB 2QPTA 1K9UA 4DIRA 3K21A 1KFUS 1XFXO 4FQOA 2SASA 1JBAA 1FW4A 2H61A 2MA2A 3NSOA 1YVHA 3D10A 4N1FA 4YGAA 1AP4A 1TCFA 3E3RA 2LC5A 4TNCA 3DF0B 2FCEA 2K2AA 4YI9A 1QS7A 1PRWA 2CCMA 4PHNA 2KI4C 4PHJA 5DKQA 1XYDA 1PSBA 1QV0A 3O78A 1BMOA 3TDUA 2RGIA 1S6IA 3KEVA 2ISDA 3PM8A 1CDLA 1MF8B 3AKBA 2BECA 1UHIA 4GBAA 3LK0A 2SCPA 4UPGA 4YBHB 2WCBA 1CM1A 2HF5A 1F4QA 2I94A 3KO0A 1B8CA 1QJTA 3CLNA 2OPOA 3LL8B 4XYNA 1B8LA 1TCOB 1FI6A 2LLUA 2I18A 1LINA 2KI6D 1M39A 1WRZA 1RWYA 3GK2A 4DUQA 2O5GA 1XA5A 1UHKA 1MUXA 3FIAA 2KHNA 4YGCB 4P2YB 2K8MB 1ZMZA 1ALVA 1EG4A 3CR2A 3BOWB 4OR9B 4XJKB 1V1GA 2MBXA 1XO5A 2BE4A 4USLA 1L2OC 1RECA 4MEWA 5FYXA 2L4IA 1AUIB 4MN0A 2WNDA 5HKWA 3BOWA 1Y1XA 1TTXA 1XFYO 2M1KB 3NXAA 3IQQA 5I2QA 1KFUL 1F4OA 1RTP1 3GOFA 1CFCA 1K9KA 1KK7Y 4GGNA 4DCKA 1JFJA 4JQ0D 2NCOA 3F45A 1UHJA 1A29A 1OFCX 1CDPA 2H61C 3SG6A 1YVLA 1F54A 2OTGC 3DVMA 2H2KA 4WRIA 3AKAA 3AAJA 2ZNEA 1NX0A 1PK0D 2KAVA 2M7LA 2LV7A 1PVBA 2LVKA 2KQYA 1J1EA 2IS9A 1WY9A 4HSZA 2DOQA 4QJ5B 4MVFA 3SG4A 5HLVA 2Y1NA 4PHMA 1ZUZA 4I5KA 1S3PA 1SRAA 3DVJA 1H4BA 1BJFA 1YTZC 2E30A 5BPJA 1TNPA 5JJGA 1OMVA 1DT7B 3IQOA 2WCEA 4WQ3A 2JOJA 3PFVA 1NPQA 3TS5C 1QIWA 1XVJA 1CDNA 1QV1A 2ZRTA 4ORCB 3CWGA 1KWOB 2FJUB 3LK1A 1E8AA 2K7OA 1MXLC 3O4YA 4BY4A 4YRUA 1QLSA 2KDHA 1CDMA 5DKRA 1KFXL 1NX1A 1HT9A 1ODBA 2LMUA 1RROA 1S26D 4YGBB 3FWCA 1N2DA 2Y1MA 2HQWA 2F3ZA 2L51A 3GK4X 1WRLA 2R2IA 3KPXA 1VRKA 2JT8A 2KYCA 4GAOA 4GGFC 2JRFA 2LCPA 4BY5A 3WNXB 3AAKA 4DS7A 4HRHA 1KQVA 4ICBA 1TRFA 1EH2A 4OV2A 3SIAA 1ZOTB 1QTXA 2NXQA 5KU1A 4ZCVA 1TNXA 4XJKA 2F2PA 1JUOA 2L0PA 3VRQA 1F55A 2BBMA 2OTGB 1DGVA 2PVBA 1Y1UA 3CZTX 1LXFC 3NSIA 1JC2A 2KQ6A 2Y5IA 3EKHA 2JXCA 1TNQA 1B1GA 1UUSA 1M45A 1S5GY 4GPLB 1B7TZ 5DKNA 2FCDA 4GUKA 1V1FA 1WLZA 2KOTA 1FF1A 2KI6C 1K93D 2PALA 4M2OA 5KTYA 1FPWA 2MAZA 1BG1A 3KHEA 1FI5A 1DF0A 1NIWA 1LVCD 2LM5A 2MLEC 2ZKMX 3OX5A 1CFFA 1BOCA 3EK7A 1DJGA 2JXLA 4PDZA 2COLB 2KSPA 2L5XB 3DF0A 2MHHA 3I5IC 2LHLA 1DMOA 1A75B 4GNKB 4NDCA 1SY9A 1KK8B 1S36A 1SNLA 1U5IA 1XFUO 2JT3A 1NX3A 2B1UA 2JNXA 3OB2B 3OHMB 1BU3A 2Q4UA 1TOPA 1PSRA 2JULA 1GJYA 1DJYA 2CNPA 3WXAA 4MRYA 3WHTB 2KBMA 2M8UA 1IRJA 4PE7A 3CS1A 1BF5A 5HKYA 2GGMA 2M7NA 3SJSA 4L9MA 1YR5A 4N1GA 5CSIA 2BCXA 2NCPA 1C07A 1NWDA 1SCMC 2E6WA 1JF2A 1KK8C 4QJ4B 4MRXA 2D8NA 1UP5A 3EK4A 1CMFA 2M1UA 4C0LA 1A2XA 1L2OB 1H8BA 1KQMB 3LCPC 3I5FC 5ER4X 1DJIA 1YUTA 1M46A 1YUUA 1CFPA 2EGDA 2KGBC 4R1EA 2Q91A 1YX8A 1F70A 1RFJA 5G08A 1SL7A 3SG2A 2LANA 3O6BA 1K9PA 1MR8A 5CSNA 3PLFB 3JTDC 2HPSA 2KNEA 3OB1B 1CNPA 1DJZA 2EC6B 1UURA 1OOJA 2LVIA 2MJWB 4Q04A 2CT9A 5B8IB 1DJHA 4ORBB 4ZCUA 2K7DA 1DVIA 3OP0A 4NDBA 3D0YA 2M29A 2JNFA 2AUCA 2JTTA 5AXIA 1FBVA 3I5GC 4JPZB 2LE9B 5HLOA 1OQPA 2BKHB 1NCYA 2LNKA 2NLNA 1NUBA 2M3WA 2ZRSA 2KI4B 1BLQA 2PRUA 1LKJA 3A8RA 1L7ZA 1YUSA 5F6TA 3BUMB 2MRDA 3HX4A 4AQJA 1DTLA 1NX2A 2G9BA 1J7QA 2BL0B 2K7BA 1CLMA 4P5OE 4MSPA 3EVUA 1LA3A 2HQ8A 2I7AA 5CSFA 3I5IB 3VRRA 5AERA 4I5NB 5GQQC 3SG3A 4CIDA 2OS8B 3EKJA 1IQ3A 2CBLA 1X02A 1BR1B 2F8PA 5HKZA 1SCMB 1KQMC 3TUYC 3VROA 4FTGA 2K61A 4MZKA 3EVVA 2KFGA 3TS5B 2JT0A 2K7CA 1G4YR 5I8NA 4PCWA 3VRPA 2M0RA 1N0YA 2LUCA 4CFRA 1SPYA 1B9AA 4MZLA 1CKKA 4MBEA 1J1DA 1RK9A 1MQ1A 2KYFA 1G8IA 2KFHA 2V53A 2HETA 5D69A 2LLTA 2PSRA 3OX6A 1CMGA 1EXRA 3DVEA 3RLZA 3VGOA 2TN4A 2ZFDA 3BQ3A 3O2PA 3I5GB 3SIBA 1B4CA 1OZOA 4OKHA 1W7IB 3FS7A 5AEQA 2VRGA 2BL0C 4A4CA 4D1EA 1WLMA 2WCFA 1S6JA 2JPTA 5IBWA 2G2BA 1BT6A 1QXPA 2AAOA 2JU0A 3BUNB 1GQMA 1SL9A 3ZNIA 1B7TY 1SW8A 2BE6A 2LLSA 1SBJA 2Y9ZA 2GV5A 2MLFC 1CLLA 1A75A 1RJVA 1Y0VH 2LUXA 1DJWA 1MXEA 3LLEA 4NQGA 3GK1A 2K2FA 2GGZA 2I2RE 1TN4A 3DVKA 1NP8A 1YURA 4A4BA 1HQVA 1UHNA 2LMTA 3BUWB 1F8HA 1UWOA 3WHUB 1AVSA 2KGRA 2L4HA 1BODA 1CB1A 4F0ZB 3H4SE 5ER5A 2L2EA 1EG3A 1QX7A 1CTRA 4PALA 1M63B 1NCXA 5J3XA 3KF9A 1SL8A 1OZSA 2L98A 1C7VA 1IG5A 1NCZA 1JWDA 2Y9YA 1J7OA 1SYMA 3I5FB 4PE4A 4E68A 2O60A 1JFKA 2JWWA 2BBNA 1JF0A 2JTZA 4WQ2A 1JSAA 3EVRA 1WRKA 4CLNA 2WOSA 1D1OA 1EJ3A 3ICBA 1YX7A 4YI8A 1KFXS 4QJ3B 1XFVO 3BUXB 1C7WA 1S5GZ 3D0YB 3NSLA 5AANA 2LMVA 3SG7A 1U5IB 2LHIA 1IWQA 1AJ4A 1OMDA 3EK8A 2OS8C 3DD4A 1QX5B 1BR4B 1A4PA 3CR4X 4ORAB 3FWBA 1KWOC 1IJ6A 1QASA 3CR5X 1WDCC 1XFWO 5KSZA 1KSMA 1AHRA 1N65A 1DF0B 1K95A 4OVNF 5HYDA 3VRNA 1SCVA 2JQ6A 3SG5A 2JC2A 4MZJA 1ZFSA 2M9GA 4I5JA 2FOTA 4IL1A 5I2LA 3I5HC 1CM4A 1IH0A 4PHKA 2BCAA 4YGDB 3CTNA 4C0KA 1MWNA 1K2HA 3A4UB 1QVIY 1G33A 1GGZA 2K0JA 1NYAA 1LA0A 3JVTC 3QRXA 1KK7Z 3CGAA 4CPVA 2LAPA 1KCYA 1IKUA 1SR6B 1KSOA 2A4JA 2KAYA 3M0WA 2EC6C 3PN7B 3PSRA 2ZN8A 1Y1AA 2F3YA 5K89A 1ZACA 2KFFA 4MLWA 3TZ1A 1XK4C 2KBIA 1YRUB 1AK8A 1J55A 2LP2A 1IQ5A 2L50A 2PMYA 5PALA 2BKIB 4M2PA 4PE1A 1J7PA 3NSKA 1J7RA 1TNWA 1Y6WA 2JZIA 1DGUA 2LVJA 3RM1A 3PN7C 1S6CA 1K94A 1R2UA 1OSAA 4AOMA 5AFPA 3JTDB 2M97A 2QACA 1PULA 1K8UA 1QIVA 3BUOB 2EHBA 1PALA 3PALA 4YGEB 1SKTA 1SK6D 2F33A 3IF7A 1NSHA 4U8DA 3HCMA 3BXKA 5CSJA 2M49B 4NDDA 1SMGA 4JWQA 5I2OA 1OE9B 1EL4A 1AJ5A 1QVIZ 1QATA 2CTNA 2ZN9A 3TUYB 3ZWHA 1XFZO 2WC8A 1DJXA 2LVVA 2WORA 1R6PA 4I5LB 1ALWA 1SR6C 1IJ5A 4DRWA 4ETOA 1XK4A 1K90D 1M31A 4N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGF A;  1F71 A;  1UHH A;  1QLK A;  2NZ0 A;  4HRE E;  4OCI A;  5CPV A;  1CFD A;  2CXJ A;  3TDZ A;  1MHO A;  5JOL A;  2ZND A;  3C1V A;  4CFQ A;  1GGW A;  1OMR A;  5TNC A;  1S1E A;  2P6B B;  3JVT B;  3I5H B;  3TDI A;  2KAX A;  1Q80 A;  2AMI A;  2LP3 A;  4PE0 A;  4M2Q A;  1PVA A;  1B8R A;  1K96 A;  2F2O A;  3MSE B;  4GFT A;  4AQI A;  2PAS A;  4C0J A;  3BYA A;  1WDC B;  1IGV A;  5D7F A;  1A03 A;  3PAT A;  2Y4Q A;  2BCB A;  1YRT B;  4HRG A;  1TIZ A;  1CLB A;  1B47 A;  1QX2 A;  1W7J B;  2QPT A;  1K9U A;  4DIR A;  3K21 A;  1KFU S;  1XFX O;  4FQO A;  2SAS A;  1JBA A;  1FW4 A;  2H61 A;  2MA2 A;  3NSO A;  1YVH A;  3D10 A;  4N1F A;  4YGA A;  1AP4 A;  1TCF A;  3E3R A;  2LC5 A;  4TNC A;  3DF0 B;  2FCE A;  2K2A A;  4YI9 A;  1QS7 A;  1PRW A;  2CCM A;  4PHN A;  2KI4 C;  4PHJ A;  5DKQ A;  1XYD A;  1PSB A;  1QV0 A;  3O78 A;  1BMO A;  3TDU A;  2RGI A;  1S6I A;  3KEV A;  2ISD A;  3PM8 A;  1CDL A;  1MF8 B;  3AKB A;  2BEC A;  1UHI A;  4GBA A;  3LK0 A;  2SCP A;  4UPG A;  4YBH B;  2WCB A;  1CM1 A;  2HF5 A;  1F4Q A;  2I94 A;  3KO0 A;  1B8C A;  1QJT A;  3CLN A;  2OPO A;  3LL8 B;  4XYN A;  1B8L A;  1TCO B;  1FI6 A;  2LLU A;  2I18 A;  1LIN A;  2KI6 D;  1M39 A;  1WRZ A;  1RWY A;  3GK2 A;  4DUQ A;  2O5G A;  1XA5 A;  1UHK A;  1MUX A;  3FIA A;  2KHN A;  4YGC B;  4P2Y B;  2K8M B;  1ZMZ A;  1ALV A;  1EG4 A;  3CR2 A;  3BOW B;  4OR9 B;  4XJK B;  1V1G A;  2MBX A;  1XO5 A;  2BE4 A;  4USL A;  1L2O C;  1REC A;  4MEW A;  5FYX A;  2L4I A;  1AUI B;  4MN0 A;  2WND A;  5HKW A;  3BOW A;  1Y1X A;  1TTX A;  1XFY O;  2M1K B;  3NXA A;  3IQQ A;  5I2Q A;  1KFU L;  1F4O A;  1RTP 1;  3GOF A;  1CFC A;  1K9K A;  1KK7 Y;  4GGN A;  4DCK A;  1JFJ A;  4JQ0 D;  2NCO A;  3F45 A;  1UHJ A;  1A29 A;  1OFC X;  1CDP A;  2H61 C;  3SG6 A;  1YVL A;  1F54 A;  2OTG C;  3DVM A;  2H2K A;  4WRI A;  3AKA A;  3AAJ A;  2ZNE A;  1NX0 A;  1PK0 D;  2KAV A;  2M7L A;  2LV7 A;  1PVB A;  2LVK A;  2KQY A;  1J1E A;  2IS9 A;  1WY9 A;  4HSZ A;  2DOQ A;  4QJ5 B;  4MVF A;  3SG4 A;  5HLV A;  2Y1N A;  4PHM A;  1ZUZ A;  4I5K A;  1S3P A;  1SRA A;  3DVJ A;  1H4B A;  1BJF A;  1YTZ C;  2E30 A;  5BPJ A;  1TNP A;  5JJG A;  1OMV A;  1DT7 B;  3IQO A;  2WCE A;  4WQ3 A;  2JOJ A;  3PFV A;  1NPQ A;  3TS5 C;  1QIW A;  1XVJ A;  1CDN A;  1QV1 A;  2ZRT A;  4ORC B;  3CWG A;  1KWO B;  2FJU B;  3LK1 A;  1E8A A;  2K7O A;  1MXL C;  3O4Y A;  4BY4 A;  4YRU A;  1QLS A;  2KDH A;  1CDM A;  5DKR A;  1KFX L;  1NX1 A;  1HT9 A;  1ODB A;  2LMU A;  1RRO A;  1S26 D;  4YGB B;  3FWC A;  1N2D A;  2Y1M A;  2HQW A;  2F3Z A;  2L51 A;  3GK4 X;  1WRL A;  2R2I A;  3KPX A;  1VRK A;  2JT8 A;  2KYC A;  4GAO A;  4GGF C;  2JRF A;  2LCP A;  4BY5 A;  3WNX B;  3AAK A;  4DS7 A;  4HRH A;  1KQV A;  4ICB A;  1TRF A;  1EH2 A;  4OV2 A;  3SIA A;  1ZOT B;  1QTX A;  2NXQ A;  5KU1 A;  4ZCV A;  1TNX A;  4XJK A;  2F2P A;  1JUO A;  2L0P A;  3VRQ A;  1F55 A;  2BBM A;  2OTG B;  1DGV A;  2PVB A;  1Y1U A;  3CZT X;  1LXF C;  3NSI A;  1JC2 A;  2KQ6 A;  2Y5I A;  3EKH A;  2JXC A;  1TNQ A;  1B1G A;  1UUS A;  1M45 A;  1S5G Y;  4GPL B;  1B7T Z;  5DKN A;  2FCD A;  4GUK A;  1V1F A;  1WLZ A;  2KOT A;  1FF1 A;  2KI6 C;  1K93 D;  2PAL A;  4M2O A;  5KTY A;  1FPW A;  2MAZ A;  1BG1 A;  3KHE A;  1FI5 A;  1DF0 A;  1NIW A;  1LVC D;  2LM5 A;  2MLE C;  2ZKM X;  3OX5 A;  1CFF A;  1BOC A;  3EK7 A;  1DJG A;  2JXL A;  4PDZ A;  2COL B;  2KSP A;  2L5X B;  3DF0 A;  2MHH A;  3I5I C;  2LHL A;  1DMO A;  1A75 B;  4GNK B;  4NDC A;  1SY9 A;  1KK8 B;  1S36 A;  1SNL A;  1U5I A;  1XFU O;  2JT3 A;  1NX3 A;  2B1U A;  2JNX A;  3OB2 B;  3OHM B;  1BU3 A;  2Q4U A;  1TOP A;  1PSR A;  2JUL A;  1GJY A;  1DJY A;  2CNP A;  3WXA A;  4MRY A;  3WHT B;  2KBM A;  2M8U A;  1IRJ A;  4PE7 A;  3CS1 A;  1BF5 A;  5HKY A;  2GGM A;  2M7N A;  3SJS A;  4L9M A;  1YR5 A;  4N1G A;  5CSI A;  2BCX A;  2NCP A;  1C07 A;  1NWD A;  1SCM C;  2E6W A;  1JF2 A;  1KK8 C;  4QJ4 B;  4MRX A;  2D8N A;  1UP5 A;  3EK4 A;  1CMF A;  2M1U A;  4C0L A;  1A2X A;  1L2O B;  1H8B A;  1KQM B;  3LCP C;  3I5F C;  5ER4 X;  1DJI A;  1YUT A;  1M46 A;  1YUU A;  1CFP A;  2EGD A;  2KGB C;  4R1E A;  2Q91 A;  1YX8 A;  1F70 A;  1RFJ A;  5G08 A;  1SL7 A;  3SG2 A;  2LAN A;  3O6B A;  1K9P A;  1MR8 A;  5CSN A;  3PLF B;  3JTD C;  2HPS A;  2KNE A;  3OB1 B;  1CNP A;  1DJZ A;  2EC6 B;  1UUR A;  1OOJ A;  2LVI A;  2MJW B;  4Q04 A;  2CT9 A;  5B8I B;  1DJH A;  4ORB B;  4ZCU A;  2K7D A;  1DVI A;  3OP0 A;  4NDB A;  3D0Y A;  2M29 A;  2JNF A;  2AUC A;  2JTT A;  5AXI A;  1FBV A;  3I5G C;  4JPZ B;  2LE9 B;  5HLO A;  1OQP A;  2BKH B;  1NCY A;  2LNK A;  2NLN A;  1NUB A;  2M3W A;  2ZRS A;  2KI4 B;  1BLQ A;  2PRU A;  1LKJ A;  3A8R A;  1L7Z A;  1YUS A;  5F6T A;  3BUM B;  2MRD A;  3HX4 A;  4AQJ A;  1DTL A;  1NX2 A;  2G9B A;  1J7Q A;  2BL0 B;  2K7B A;  1CLM A;  4P5O E;  4MSP A;  3EVU A;  1LA3 A;  2HQ8 A;  2I7A A;  5CSF A;  3I5I B;  3VRR A;  5AER A;  4I5N B;  5GQQ C;  3SG3 A;  4CID A;  2OS8 B;  3EKJ A;  1IQ3 A;  2CBL A;  1X02 A;  1BR1 B;  2F8P A;  5HKZ A;  1SCM B;  1KQM C;  3TUY C;  3VRO A;  4FTG A;  2K61 A;  4MZK A;  3EVV A;  2KFG A;  3TS5 B;  2JT0 A;  2K7C A;  1G4Y R;  5I8N A;  4PCW A;  3VRP A;  2M0R A;  1N0Y A;  2LUC A;  4CFR A;  1SPY A;  1B9A A;  4MZL A;  1CKK A;  4MBE A;  1J1D A;  1RK9 A;  1MQ1 A;  2KYF A;  1G8I A;  2KFH A;  2V53 A;  2HET A;  5D69 A;  2LLT A;  2PSR A;  3OX6 A;  1CMG A;  1EXR A;  3DVE A;  3RLZ A;  3VGO A;  2TN4 A;  2ZFD A;  3BQ3 A;  3O2P A;  3I5G B;  3SIB A;  1B4C A;  1OZO A;  4OKH A;  1W7I B;  3FS7 A;  5AEQ A;  2VRG A;  2BL0 C;  4A4C A;  4D1E A;  1WLM A;  2WCF A;  1S6J A;  2JPT A;  5IBW A;  2G2B A;  1BT6 A;  1QXP A;  2AAO A;  2JU0 A;  3BUN B;  1GQM A;  1SL9 A;  3ZNI A;  1B7T Y;  1SW8 A;  2BE6 A;  2LLS A;  1SBJ A;  2Y9Z A;  2GV5 A;  2MLF C;  1CLL A;  1A75 A;  1RJV A;  1Y0V H;  2LUX A;  1DJW A;  1MXE A;  3LLE A;  4NQG A;  3GK1 A;  2K2F A;  2GGZ A;  2I2R E;  1TN4 A;  3DVK A;  1NP8 A;  1YUR A;  4A4B A;  1HQV A;  1UHN A;  2LMT A;  3BUW B;  1F8H A;  1UWO A;  3WHU B;  1AVS A;  2KGR A;  2L4H A;  1BOD A;  1CB1 A;  4F0Z B;  3H4S E;  5ER5 A;  2L2E A;  1EG3 A;  1QX7 A;  1CTR A;  4PAL A;  1M63 B;  1NCX A;  5J3X A;  3KF9 A;  1SL8 A;  1OZS A;  2L98 A;  1C7V A;  1IG5 A;  1NCZ A;  1JWD A;  2Y9Y A;  1J7O A;  1SYM A;  3I5F B;  4PE4 A;  4E68 A;  2O60 A;  1JFK A;  2JWW A;  2BBN A;  1JF0 A;  2JTZ A;  4WQ2 A;  1JSA A;  3EVR A;  1WRK A;  4CLN A;  2WOS A;  1D1O A;  1EJ3 A;  3ICB A;  1YX7 A;  4YI8 A;  1KFX S;  4QJ3 B;  1XFV O;  3BUX B;  1C7W A;  1S5G Z;  3D0Y B;  3NSL A;  5AAN A;  2LMV A;  3SG7 A;  1U5I B;  2LHI A;  1IWQ A;  1AJ4 A;  1OMD A;  3EK8 A;  2OS8 C;  3DD4 A;  1QX5 B;  1BR4 B;  1A4P A;  3CR4 X;  4ORA B;  3FWB A;  1KWO C;  1IJ6 A;  1QAS A;  3CR5 X;  1WDC C;  1XFW O;  5KSZ A;  1KSM A;  1AHR A;  1N65 A;  1DF0 B;  1K95 A;  4OVN F;  5HYD A;  3VRN A;  1SCV A;  2JQ6 A;  3SG5 A;  2JC2 A;  4MZJ A;  1ZFS A;  2M9G A;  4I5J A;  2FOT A;  4IL1 A;  5I2L A;  3I5H C;  1CM4 A;  1IH0 A;  4PHK A;  2BCA A;  4YGD B;  3CTN A;  4C0K A;  1MWN A;  1K2H A;  3A4U B;  1QVI Y;  1G33 A;  1GGZ A;  2K0J A;  1NYA A;  1LA0 A;  3JVT C;  3QRX A;  1KK7 Z;  3CGA A;  4CPV A;  2LAP A;  1KCY A;  1IKU A;  1SR6 B;  1KSO A;  2A4J A;  2KAY A;  3M0W A;  2EC6 C;  3PN7 B;  3PSR A;  2ZN8 A;  1Y1A A;  2F3Y A;  5K89 A;  1ZAC A;  2KFF A;  4MLW A;  3TZ1 A;  1XK4 C;  2KBI A;  1YRU B;  1AK8 A;  1J55 A;  2LP2 A;  1IQ5 A;  2L50 A;  2PMY A;  5PAL A;  2BKI B;  4M2P A;  4PE1 A;  1J7P A;  3NSK A;  1J7R A;  1TNW A;  1Y6W A;  2JZI A;  1DGU A;  2LVJ A;  3RM1 A;  3PN7 C;  1S6C A;  1K94 A;  1R2U A;  1OSA A;  4AOM A;  5AFP A;  3JTD B;  2M97 A;  2QAC A;  1PUL A;  1K8U A;  1QIV A;  3BUO B;  2EHB A;  1PAL A;  3PAL A;  4YGE B;  1SKT A;  1SK6 D;  2F33 A;  3IF7 A;  1NSH A;  4U8D A;  3HCM A;  3BXK A;  5CSJ A;  2M49 B;  4NDD A;  1SMG A;  4JWQ A;  5I2O A;  1OE9 B;  1EL4 A;  1AJ5 A;  1QVI Z;  1QAT A;  2CTN A;  2ZN9 A;  3TUY B;  3ZWH A;  1XFZ O;  2WC8 A;  1DJX A;  2LVV A;  2WOR A;  1R6P A;  4I5L B;  1ALW A;  1SR6 C;  1IJ5 A;  4DRW A;  4ETO A;  1XK4 A;  1K90 D;  1M31 A;  4N5X A; 
#chains in the Genus database with same CATH topology
 1UHH A;  1QLK A;  4OCI A;  1LTJ C;  5CPV A;  1M90 Q;  1MHO A;  4CFQ A;  1OMR A;  3I5H B;  1PP9 J;  3Q1M A;  2A06 E;  1QGK B;  2FFD B;  2AMI A;  1AVO A;  1N7S D;  3A0H H;  1B8R A;  1ZME C;  1NYH A;  1Q86 Q;  2OYI C;  1WDC B;  5D7F A;  1A03 A;  4L76 A;  2IFM A;  4N78 E;  2BCB A;  2E74 D;  1JTH A;  3LID A;  1QX2 A;  1W7J B;  3AE8 C;  2L5Y A;  1DEB A;  1XFX O;  2SAS A;  1DC1 A;  1FW4 A;  2K60 A;  4O9B A;  1ZRT E;  3EG5 B;  1ORG A;  1OW7 A;  4YGA A;  2LC5 A;  2FCE A;  1JY2 O;  3HTK B;  2OAR A;  4PHN A;  1NVO A;  5DKQ A;  3KZI H;  2JWA A;  1S6I A;  2C0X A;  3HD7 B;  1KN7 A;  3A5T A;  2ISD A;  3PM8 A;  3AKB A;  1QL2 A;  2SCP A;  1N2D C;  4YBH B;  1CSB A;  2HF5 A;  2I94 A;  5KJ7 C;  1QJT A;  3CLN A;  2WCL A;  2LLU A;  1LIN A;  1LTB C;  3KZI E;  1Q81 Q;  3GK2 A;  1LT9 B;  2XZR A;  2OYH A;  4P2Y B;  1ZMZ A;  4OR9 B;  1FDM A;  5I2Q A;  1Y1X A;  1L0N E;  5KLV D;  4H0L B;  3S1K A;  1KK7 Y;  4JQ0 D;  1KB9 I;  3H1H D;  1OFC X;  1LWU C;  5BVZ A;  4TT3 H;  1YVL A;  2AEF A;  1SQB D;  1NTM D;  4BWN A;  2Z5I A;  1L4A D;  1BDC A;  3CZ1 A;  2WPV B;  3AKA A;  3AAJ A;  1PK0 D;  1PGQ A;  2O01 J;  3M0A A;  2LV7 A;  3TNU B;  1SQP K;  2LVK A;  2KQY A;  3BFH A;  3I55 P;  3IR9 A;  3T97 A;  2A45 G;  5HLV A;  2Y1N A;  4AQR D;  1PFI A;  5AW4 B;  1SRA A;  1BGY D;  1NU1 E;  1H4B A;  3S0D A;  5JJG A;  1DT7 B;  1QIW A;  1P84 I;  1QV1 A;  1XFR A;  3LK1 A;  4BY4 A;  3GHG B;  4RES B;  1JTH B;  2KDH A;  5AVR B;  2I1K A;  1KFX L;  2W27 A;  1GL2 B;  1N2D A;  2Y1M A;  2LXB A;  4HH2 A;  1M1J B;  3USS A;  4GAO A;  4GGF C;  5APY A;  3V4W A;  2FFD A;  3R72 A;  3NFQ A;  3L70 J;  3RGU A;  3SIA A;  2ZYG A;  3VRQ A;  4XJK A;  1F55 A;  1JUO A;  3SFE C;  1DGV A;  5TIS H;  2PVB A;  2YXQ B;  3NSI A;  2IBZ D;  1BGY J;  1M56 D;  2V7Q H;  2QJY B;  3EKH A;  1R5L A;  1QWV A;  5B5E H;  3CX5 H;  3L75 G;  1IFN A;  3RK3 D;  5KTY A;  1CW5 A;  1S72 P;  2OTJ P;  2W83 C;  5B66 E;  2OYO A;  3WU2 E;  1M7L A;  2LM5 A;  2ZKM X;  2IYO A;  1FZG A;  1BOC A;  3EK7 A;  1DJG A;  4C7N B;  1IFD A;  1NTM J;  4PDZ A;  2COL B;  2L5X B;  1GK6 A;  2MHH A;  3NHT A;  4B86 A;  3S0A A;  2LHL A;  1OVV A;  1KK8 B;  2KUB A;  5KLV J;  1XFU O;  2B1U A;  2JNX A;  3OB2 B;  1RF1 C;  2ZYA A;  2V4H A;  2Q4U A;  1TOP A;  3H1L J;  3H1J G;  1DJY A;  1NTZ D;  2E75 B;  3CCQ P;  4Z1M H;  4MRY A;  3H32 A;  4U7J A;  2KBM A;  3H6P A;  2M8U A;  5APS A;  4PE7 A;  1QLE D;  2GGM A;  2M7N A;  1GZL A;  5CMZ A;  2KK7 A;  3B5N D;  4L9M A;  1YR5 A;  1GW4 A;  2BCX A;  1C07 A;  1BE3 G;  4I1L A;  2FKW B;  1LT9 A;  2BCC G;  3D71 A;  5KLV E;  1CMF A;  4C0L A;  1XTG B;  1A2X A;  4L74 A;  3AEA C;  1DJI A;  3S0F A;  1RQV A;  2EGD A;  2KGB C;  2ZFC A;  3TNU A;  2O01 H;  1IFP A;  1L4A C;  2J5U A;  2KNE A;  2FYN C;  2WSE H;  1X8Y A;  3ITK A;  1PP9 G;  1S5L E;  2WPR A;  5CCH A;  2K7D A;  1DVI A;  3OP0 A;  2K37 A;  4NDB A;  4WWI A;  3L4F A;  1YTZ T;  2DW3 A;  1FC2 C;  2AUC A;  3KHU A;  2FYN B;  1NTM K;  2AXT E;  5HLO A;  4OH8 B;  2BKH B;  1TWO A;  3H32 B;  1SQQ E;  3P8C D;  4ASV A;  2NLN A;  5AW5 B;  3R1O A;  1YHQ P;  2M3W A;  1FOS F;  1BLQ A;  2PRU A;  3RK2 C;  2HYN A;  1YUS A;  5APT A;  3CCM P;  5KAF E;  3V4Q A;  1VPC A;  1DTL A;  3B6X A;  1URQ A;  3CMA P;  4MSP A;  2GM4 A;  4TLF A;  5GQQ C;  3WMM 0;  5CJ0 A;  1Y9B A;  2XKM A;  1SCM B;  3AEF C;  3TUY C;  2H43 A;  2KFG A;  3EWK A;  2RMZ A;  3IFM A;  3P8M C;  2N1T B;  1N7S B;  5E79 H;  2M0R A;  4CFR A;  1SPY A;  4MZL A;  1SFC C;  2QM8 A;  4RO0 A;  4MBE A;  1X9V A;  3KQG A;  1MQ1 A;  4IFM A;  2HET A;  1OOG A;  1CMG A;  4KJM A;  3VGO A;  2TN4 A;  2ZFD A;  4OKH A;  2N9Y B;  1KFN A;  1WLM A;  1D7M A;  5AVZ B;  1NAF A;  2G2B A;  1FS0 E;  2AAO A;  3BUN B;  1GL2 A;  1L0N K;  1B7T Y;  3JC2 2;  3A0B E;  1URQ C;  2LLS A;  2MLF C;  1BE3 E;  1CLL A;  1RF0 C;  1LS8 A;  1ZRT D;  1Y0V H;  1DJW A;  4NQG A;  1YBK A;  2FYZ A;  1TN4 A;  4DJG A;  2WPS A;  3M91 A;  1UHN A;  2HPC A;  3S0G A;  1BOD A;  1M1K Q;  3T97 B;  4PAL A;  1T6A A;  1OZS A;  2M3E A;  3TYY A;  1IG5 A;  2BEZ F;  4NPD A;  1J7O A;  1NU1 K;  4E68 A;  3L74 J;  1MFT A;  4WQ2 A;  1JSA A;  3VMA A;  4CLN A;  2QVA A;  4PD4 E;  1KFX S;  4NPE A;  1S9K E;  3WU2 H;  3L73 D;  1S5G Z;  3NSL A;  1VQ6 P;  3H1L G;  5AAN A;  4UB8 E;  1IFJ A;  2QJK C;  2LMV A;  3L72 D;  1LGH B;  1HUC A;  4WY4 B;  1RY3 A;  1EZV I;  2R32 A;  2KIK A;  4GDO A;  3CR4 X;  3Q8I A;  4ORA B;  1IJ6 A;  1XFW O;  5KSZ A;  1UIX A;  1N65 A;  1K95 A;  1RE3 A;  1U7M A;  5HYD A;  3VRN A;  2BCC J;  3S0E A;  1ZXG A;  3SG5 A;  4MZJ A;  4IL1 A;  5I2L A;  1N86 A;  2K3R A;  5AW0 B;  3Q5R A;  4ZMD A;  3IVT A;  1K2H A;  4IL6 X;  3IF4 A;  1KIL B;  1L0N J;  1G33 A;  1OWA A;  3RK2 D;  2M5A B;  2V7Q J;  3QRX A;  4PD4 I;  3CGA A;  4ZNC A;  1FJP A;  1HGZ A;  2WSC J;  2QEB A;  2F3Y A;  2O01 N;  1ZAC A;  3TZ1 A;  1IQ5 A;  3F5H A;  1SQB G;  3W68 A;  2BKI B;  3B5N C;  3N4X A;  5D3O A;  3NSK A;  3R1V A;  2K9J B;  2KZI A;  2ZYD A;  1OOH A;  3A3Y B;  5AVQ B;  5FI6 A;  1MZ9 A;  4DT0 A;  1NJI Q;  1A02 J;  1ZR2 A;  5APQ A;  1VL2 A;  1VQ8 P;  1OSA A;  4FQT A;  2QAC A;  1OX3 A;  4EIJ A;  3BUO B;  2M5A A;  3RK3 B;  2HLO A;  1SKT A;  3L37 A;  1SK6 D;  3VOP A;  3BXK A;  5CSJ A;  1DX7 A;  1SMG A;  5I2O A;  1AJ5 A;  2ZN9 A;  4I5L B;  2WC8 A;  2LVV A;  2WOR A;  1R6P A;  1AFO A;  4DRW A;  2KXP B;  1J1E B;  3MD0 A;  4IFF A;  4N5X A;  2WTY A;  4GGF A;  1RF1 B;  1YQ4 C;  2ZND A;  1PPJ G;  5KLI C;  1FZA A;  4AYC A;  1S1E A;  4WY4 C;  1Q80 A;  1N73 A;  2WVR A;  4M2Q A;  5CBN A;  4GFT A;  1NAY A;  3DYE A;  3E1I A;  1SQQ G;  4I7Z B;  1YRT B;  1TIZ A;  2HG5 D;  1SQX J;  1LTJ B;  2WCM A;  1VQN P;  1JBA A;  3N7H A;  4PJ0 H;  2H61 A;  2MA2 A;  3NSO A;  4YXW H;  4HKZ H;  1YVH A;  4OZD A;  3D10 A;  3W67 A;  1OOI X;  1TCF A;  1ZOY C;  3DF0 B;  3NTN A;  2Z4E A;  4YI9 A;  5AW7 B;  2C9N Y;  1XYD A;  1QV0 A;  1VF5 C;  1BMO A;  2NPS D;  3U1A A;  3KEV A;  1MF8 B;  1Q2N A;  2J58 A;  1JY2 P;  3LK0 A;  4UPG A;  2WCB A;  2OPO A;  1TCO B;  1M1J C;  2I18 A;  3RK3 C;  3CX5 D;  1M39 A;  1WRG A;  1FZC A;  2FY8 A;  1MUX A;  4UB6 E;  3CZ2 A;  2XNX A;  2MBX A;  3CR2 A;  3BOW B;  1V1G A;  2GUV A;  1XO5 A;  2OTK E;  3GG2 A;  1L2O C;  1REC A;  2MKV A;  3WUT A;  5FYX A;  3R4Y A;  1AUI B;  4MN0 A;  5KAI E;  1QVG O;  1KYO H;  1XFY O;  1CFC A;  1K9K A;  3F45 A;  2H61 C;  3SG6 A;  1DIP A;  1LP1 A;  2OTG C;  3DVM A;  3MUD A;  4WRI A;  4IL6 H;  1EZV E;  1JY3 P;  3V2P A;  1NX0 A;  1J2J B;  2KSE A;  1U57 A;  3TGU G;  3AEB C;  2R3S A;  1J1E A;  2QEV A;  2JP3 A;  4BXL A;  3SG4 A;  2O1J A;  1ZUZ A;  1WMK A;  3DVJ A;  3P7K A;  2E30 A;  1Z2C B;  1OMV A;  1AQ5 A;  3CXH E;  2JOJ A;  3TS5 C;  1NPQ A;  2RKL A;  1LTG C;  2WQY C;  2ZRT A;  2J59 M;  2IBZ E;  2FJU B;  3BJH A;  3G9R A;  1OVU A;  3NHI A;  3O4Y A;  4KYN A;  4Y99 B;  4I2L C;  1JCC A;  2LMU A;  1RRO A;  3CZ0 A;  3FWC A;  1NWQ A;  3KPX A;  2WMM A;  4D6T E;  1NU1 G;  2JRF A;  4C7R A;  2E75 C;  4ASW A;  1EDL A;  3WNX B;  3AAK A;  4HRH A;  1HGV A;  2D2C B;  2R5D A;  2WSF H;  5AW1 B;  1W5C E;  2PAJ A;  4OV2 A;  4YTP C;  2YIU B;  1NGM B;  2I8D A;  1P28 A;  2FXO A;  3HD7 C;  1Y1U A;  1IFM A;  2AXC A;  3HE5 B;  4Y99 C;  1J1D B;  3VP9 A;  1KIL A;  2W8Z A;  5CJ4 A;  2KI7 B;  4GPL B;  2WZ7 A;  4PT1 A;  1B7T Z;  3VB1 A;  2L91 A;  4GUK A;  1W2B O;  1FU1 A;  1V1F A;  2K1A A;  1FF1 A;  2AXT H;  5GTH E;  4M2O A;  1FPW A;  4EI2 A;  3KHE A;  2HOD A;  1LVC D;  2MLE C;  3A0H E;  1J1D C;  1M57 D;  2GUS A;  2PFX A;  3UO9 A;  1FZE A;  5APV A;  5CCG D;  1T3J A;  2QIW A;  2WCH A;  2OYI B;  1DMO A;  1A75 B;  3L71 E;  4L75 A;  4WY4 A;  1USD A;  4INW A;  3OHM B;  1GJY A;  2N1T C;  2CNP A;  3FE8 A;  4JKT A;  3G71 P;  2Y0E A;  4PD4 D;  5KTB A;  3MP7 B;  2FFD C;  1IRJ A;  1BF5 A;  5HKY A;  3RL0 D;  1DEL A;  5DJU B;  3LW5 H;  4N1G A;  4UB8 H;  2NCP A;  4C7N A;  1SCM C;  2E6W A;  3TF5 A;  3B7A A;  3SS4 A;  4MRX A;  4OGQ D;  1JEK A;  2D8N A;  1L0L E;  1UP5 A;  2M1U A;  3RK2 B;  3I5F C;  1N7L A;  3B8E B;  3D78 A;  3D75 A;  1RF0 A;  1YUU A;  3OBV A;  1H89 A;  4R1E A;  4D6T G;  1YX8 A;  2HFE D;  3JCU E;  3O6B A;  1LNQ A;  1K9P A;  3PLF B;  1CNP A;  2NPS B;  1UUR A;  1OOJ A;  3QME A;  3V2Q A;  3CPW O;  1DJH A;  2IBZ G;  1BGY G;  1YTZ I;  1BCC G;  2L2C A;  1WT6 A;  2YMK A;  1ZLL A;  1FDO A;  3CXH D;  2JTT A;  5AVV B;  3V6I A;  1FBV A;  3UIA A;  1OVR A;  1OQP A;  1SQQ J;  1DD4 A;  4MN4 C;  4H44 C;  2LNK A;  3M0D C;  5K5G B;  2ZRS A;  1NTM G;  3HRN A;  1IIO A;  3A8R A;  1KC8 Q;  5F6T A;  1OZH A;  3BUM B;  2MRD A;  4IFD K;  4AQJ A;  2E76 B;  3TGU D;  1CLM A;  2WIT A;  4JBZ A;  1GU5 A;  3EVU A;  3AE3 C;  1PZQ A;  2I7A A;  1T2K D;  3SG3 A;  3D6Z A;  1JMM A;  1RE4 A;  2OS8 B;  2YO3 A;  1IQ3 A;  2F8P A;  1X02 A;  2FYU K;  1YIJ P;  3EVV A;  4RKU J;  1LTT C;  1HVV A;  3PRJ A;  1N0Y A;  1S5L H;  1JOC A;  2PP6 A;  4YXD C;  1JCD A;  4K35 A;  3L70 D;  2WT7 B;  2KPH A;  2PSR A;  3NGV A;  3OX6 A;  1T3U A;  3SIB A;  1SQV D;  1B4C A;  2YXR B;  2QDI A;  2D2C C;  2WPQ A;  1SQV J;  3VP8 A;  2K88 A;  4C46 A;  2OYH B;  4A4C A;  1HWT C;  5IBW A;  1GMJ A;  1SL9 A;  3ZNI A;  1SW8 A;  2BCC E;  3TGU E;  2BE6 A;  2K9Y A;  3CX5 I;  1A75 A;  3LLE A;  2IZ0 A;  1MXE A;  2K2F A;  2GGZ A;  2N1T D;  1FZF A;  3N7N A;  2ITA A;  2JPO A;  4INX A;  1SQV E;  1UWO A;  2KGR A;  3GW6 A;  2KOG A;  3AE9 C;  1C3Y A;  2L2E A;  2FXM A;  1QX7 A;  1CTR A;  4XFJ A;  2SPZ A;  2Y0C A;  1C7V A;  2Y9Y A;  1TUJ A;  2XV5 A;  2KNC A;  1JF0 A;  3EVR A;  1BGY E;  3TSI A;  2Q3E A;  1YX7 A;  1RHZ B;  3AE1 C;  5B66 H;  4QJ3 B;  3HE4 B;  3D0Y B;  3M0D A;  3PLN A;  1FDI A;  2HR3 A;  1KQL A;  2LHI A;  5B5E E;  3EK8 A;  4IOI H;  2W6A A;  1BR4 B;  2WT7 A;  1NTM E;  1GDT A;  1KSM A;  2B87 B;  3BRV B;  2IZ1 A;  2LXC B;  2ZAE B;  2JQ6 A;  3GMA A;  4UB6 H;  2M9G A;  1OXZ A;  1CM4 A;  4IL6 E;  3A4U B;  2P2U A;  1GGZ A;  1A02 F;  3RL0 C;  4PV1 D;  3JVT C;  2FXP A;  2MJZ A;  1JY2 N;  4CPV A;  4ZKU A;  4H0L C;  1VQ7 P;  3PSR A;  3M0W A;  3PN7 B;  2YGU A;  2ZN8 A;  1Y1A A;  5K89 A;  2KFF A;  1AK8 A;  2LP2 A;  2PMY A;  2C9L Y;  2FJY A;  3BCC E;  3BFA A;  3CXH I;  1URQ D;  3V2L A;  2Q6Q A;  4PE1 A;  1J7P A;  1J7R A;  1TNW A;  1LWU A;  1BE3 D;  2JZI A;  2YKQ A;  2LVJ A;  1EXJ A;  1K94 A;  1G2C B;  3L4A A;  5AFP A;  2AEJ A;  3H1K G;  1K8U A;  1EC5 A;  1HTL C;  1P84 D;  3B88 A;  1H88 A;  1ZN5 A;  3CX5 E;  2F33 A;  3IF7 A;  1JM0 A;  1SQX D;  2L5G B;  5KLI B;  4JWQ A;  1Y47 A;  1OE9 B;  1EL4 A;  1VQM P;  5APX A;  1QAT A;  3B5N A;  1JB0 J;  5TIS E;  1DJX A;  1H0T A;  2BNX A;  1IJ5 A;  1GW3 A;  1U7J A;  1M31 A;  1P84 H;  3L72 G;  2NZ0 A;  1CFD A;  2PGD A;  3H1I G;  1S9K D;  1K9M Q;  5TNC A;  1JUN A;  2IPP A;  3TDI A;  4HJG H;  1BSN A;  2LP3 A;  1PVA A;  4GT1 A;  3VYI A;  1K96 A;  4AQI A;  3II6 A;  4QMA A;  4C0J A;  1LTJ A;  4GKG A;  1IGV A;  3PAT A;  1SQX E;  4HRG A;  1CLB A;  1B47 A;  1MV8 A;  3GHG C;  4OGQ B;  2M8R A;  2QPT A;  1KFU S;  4FQO A;  3S0B A;  3V2N A;  1PGP A;  2Q9I A;  1USE A;  4U3F E;  3L74 G;  4U3F G;  4N1F A;  3L71 J;  5CBO A;  3CCE P;  2GA1 A;  3D74 A;  3L75 E;  3HD7 A;  4TNC A;  2K2A A;  1L4A B;  2XND H;  1QS7 A;  1PRW A;  2CCM A;  3KYQ A;  4PHJ A;  1PSB A;  3O78 A;  3TDU A;  2H89 C;  2RGI A;  4D6T D;  1CDL A;  4N6J A;  1OMI A;  1UHI A;  1T14 A;  3MIW A;  1IO4 A;  1X0T A;  1CM1 A;  3KO0 A;  5KJ7 A;  1B8C A;  3LL8 B;  2FYU G;  1QX8 A;  1B8L A;  2YKO A;  2KI6 D;  3OA7 A;  4LLH A;  3H1K E;  1WRZ A;  1RWY A;  4DUQ A;  3H1H E;  2P58 A;  3C9I A;  3FIA A;  1ALV A;  1EG4 A;  3BCC J;  2BE4 A;  4USL A;  4MEW A;  2L4I A;  5BU5 A;  3IQQ A;  3MGN A;  1RTP 1;  5I94 A;  1OW4 A;  4GGN A;  1T8Z A;  1JFJ A;  3CI9 A;  2K9J A;  1LT9 C;  4EOT A;  1HJB A;  3AED C;  1KYO D;  1NTK E;  1DEE G;  3EQ2 A;  1SFC D;  3CCS P;  1Z4H A;  2IS9 A;  3CWB G;  3MZW B;  5DJT B;  1WY9 A;  2DOQ A;  1X22 A;  1L4A A;  3L73 J;  1S3P A;  3PJI A;  5CHX A;  1YTZ C;  3QWO C;  1TNP A;  1FAV A;  1SQX G;  3IQO A;  3PFV A;  1XVJ A;  1P84 E;  4ORC B;  2KLU A;  2ZJS E;  3CWG A;  1E8A A;  1PP9 D;  1MXL C;  4YRU A;  2E42 A;  1CDM A;  5DKR A;  1ODB A;  1C3Z A;  4PV1 B;  1S26 D;  4YGB B;  2W6J H;  2H7H A;  2HQW A;  2F3Z A;  2L51 A;  2NZ2 A;  1CI6 B;  2R2I A;  1W2E A;  2JT8 A;  2KYC A;  4JF7 A;  3K1E A;  2LCP A;  4BY5 A;  4DS7 A;  4ICB A;  2KS1 B;  3H1I E;  1EH2 A;  1CI6 A;  3O6Q B;  2CPB A;  4LC1 A;  1BDD A;  3S4R A;  2NXQ A;  1NOH A;  5EL2 A;  4ZCV A;  1TNX A;  3B71 A;  2L0P A;  1Q7Y Q;  3MTU E;  1IFI A;  1XTC C;  3CCU P;  2FYU E;  3KXD A;  1SQQ K;  1YJN P;  2Y5I A;  1B1G A;  1TNQ A;  2JKV A;  1NTZ J;  5DKN A;  3PTZ A;  3B5N B;  2KOT A;  3H1L E;  1DEK A;  1K93 D;  3A0B H;  4RJT A;  1FI5 A;  1DF0 A;  1YQ3 C;  4L73 A;  1KB9 D;  2P7J A;  3OX5 A;  1CFF A;  3ABV C;  1SFC A;  5H2F H;  1YJ9 P;  3DF0 A;  1FBM A;  3CL3 D;  2FBW C;  3CAB A;  3O6Q A;  4NDC A;  1SY9 A;  1S36 A;  1U5I A;  1SNL A;  3AEG C;  5TJH A;  3TGU J;  1PGO A;  3IAO A;  1NH4 A;  2JUL A;  2KYV A;  4EDF A;  1TU3 F;  2O1K A;  3CWB E;  3G6E P;  1MUU A;  4A7P A;  3WXA A;  5KAF H;  3HUS A;  5AW3 B;  3SWF A;  1GM0 A;  2KZJ A;  2KP8 A;  4XE5 B;  3RK3 E;  3SS5 A;  2POH A;  5CSI A;  3DZT A;  2QRX A;  3CYZ A;  3WUV A;  1SQV K;  2W6B A;  1DH3 A;  4U3F J;  3EK4 A;  3M9B A;  1L2O B;  1KV4 A;  2RH0 A;  1G1I A;  2P10 A;  5KKZ B;  3L72 E;  1M46 A;  1NU1 J;  1CFP A;  1F70 A;  1RFJ A;  5G08 A;  2R5B A;  1SL7 A;  2E74 C;  2KLD A;  1MR8 A;  5CSN A;  5CCG A;  1YI2 P;  3JTD C;  1DJZ A;  2EC6 B;  2IFN A;  1NTZ K;  4Q04 A;  1URQ B;  2MJW B;  2E75 D;  1PPJ E;  5B8I B;  1HJ0 A;  4ZCU A;  1IK7 A;  1EQ7 A;  2A45 H;  1LTA C;  1GK4 A;  3D0Y A;  2M29 A;  2WSF J;  2JNF A;  3FWL A;  3HUS B;  1KFM A;  5M1B A;  4JPZ B;  2LE9 B;  1Q90 D;  4GOF A;  3PH0 A;  1NCY A;  2P67 A;  3G3Z A;  1NUB A;  2KI4 B;  3VMZ A;  1LKJ A;  2RN0 A;  5KKZ C;  4R4L A;  1J7Q A;  2G9B A;  2R3C A;  2IDB A;  1AJY A;  3SS3 A;  3D77 A;  5CSF A;  4I5N B;  4CID A;  2R44 A;  1ZV8 A;  1SFC B;  4OWF A;  1BR1 B;  5HKZ A;  1FE6 A;  1KQM C;  2YMY A;  3LW5 J;  1UII A;  2K61 A;  5AW6 B;  3TS5 B;  2JT0 A;  3H25 A;  5I8N A;  1MFZ A;  2M0B A;  4PCW A;  3VRP A;  2QG4 A;  1FOS E;  1NTK G;  5APW A;  3AE2 C;  1GTW A;  1RK9 A;  1BE3 J;  1G8I A;  2KFH A;  4BRY A;  2V53 A;  5D69 A;  3JCU H;  1TUZ A;  2QJP C;  2LLT A;  2WCK A;  3BQ3 A;  4I6M C;  2P1J A;  1OZO A;  4WBA A;  1VQP P;  1W7I B;  3FS7 A;  5AVT B;  5AEQ A;  2VRG A;  2ZT9 C;  4ZKP A;  1KTM A;  4D1E A;  2WCF A;  2QJK B;  5KLV K;  5H2F E;  5C39 A;  1BT6 A;  1QXP A;  1VQ5 P;  2E76 C;  3BAS A;  3H1I J;  2Y9Z A;  3D70 A;  4WY4 D;  5L8R J;  1RJV A;  1PP9 E;  2KB7 P;  3GK1 A;  2E5Y A;  1H0T B;  2I2R E;  2QA4 P;  3L75 D;  3DVK A;  1YUR A;  2LMT A;  2JWD A;  3L74 D;  2OYH C;  1SQP E;  1AVS A;  4U3F D;  4N78 D;  1CB1 A;  4F0Z B;  5AVW B;  1L0L K;  2O3J A;  1EG3 A;  1VDF A;  5J3X A;  2A45 I;  3KF9 A;  1SL8 A;  2L98 A;  2B87 A;  3OW2 O;  1NCZ A;  1AA0 A;  5AW2 B;  1G2C A;  3I5F B;  4PE4 A;  1HF9 A;  1JFK A;  2JWW A;  1AQT A;  2KLE A;  1SQX K;  2BBN A;  2B9B A;  5GTI H;  1WRK A;  1EJ3 A;  4YI8 A;  2OGU A;  1JY3 O;  1XFV O;  3BUX B;  1C7W A;  1VF5 B;  2P71 A;  5CCH C;  2I1J A;  3PM2 A;  3O8Z A;  2WSC H;  3HE4 A;  3SSU A;  1PGJ A;  2G8Y A;  1OMD A;  2OS8 C;  3DD4 A;  2GTE A;  4H13 B;  3NMD A;  3FWB A;  1KWO C;  3LIE A;  1BSH A;  1FZB A;  3CR5 X;  3GHG A;  1BCC J;  3GF7 A;  4OVN F;  3H1H J;  3CCV P;  2N1T A;  2LR2 A;  1ZFS A;  4I5J A;  2FOT A;  1SQP D;  3SFD C;  3I5H C;  1RQU A;  1KIL E;  3L47 A;  3AEE C;  3CC7 P;  4PHK A;  3L70 E;  2BCA A;  4YGD B;  1MWN A;  1DQE A;  2QEH A;  3A7O A;  3CWB D;  1FZC C;  2E5T A;  2IBZ I;  1KD1 Q;  4IJ7 A;  4GIF A;  1JMB A;  2LAP A;  1KCY A;  1IKU A;  1VQO P;  3K5B A;  1KSO A;  1L2P A;  2EC6 C;  5GTH H;  5AVY B;  3KPE A;  4MLW A;  3CXH H;  5PAL A;  3F89 A;  3VTP C;  1L0L J;  1IC2 A;  1DGU A;  3UNW A;  3AE5 C;  4R4M A;  1FJK A;  1EZV G;  3JTD B;  2M97 A;  1MKM A;  1PUL A;  1PAL A;  2E74 B;  3PAL A;  1NSH A;  4U8D A;  3SWY A;  3HCM A;  3D76 A;  2M49 B;  2VRS A;  2QM7 A;  2CTN A;  3TUY B;  3ZWH A;  4ETO A;  2ZT9 D;  1NO4 A;  1ALW A;  1EXI A;  3S9O A;  1KIL C;  1K90 D;  3AE7 C;  2M3B A;  3FGA D;  1F71 A;  4OGQ C;  4HRE E;  3TDZ A;  2CXJ A;  5JOL A;  2B89 A;  1VQ9 P;  3C1V A;  2ZVO B;  1GGW A;  3B4S A;  3U1C A;  2P6B B;  3JVT B;  4KHX A;  3HD7 D;  2KAX A;  1N73 C;  3PP5 A;  3OGN A;  4PE0 A;  1LJ2 A;  1VQK P;  3U59 A;  1K04 A;  2F2O A;  2BAP A;  3MSE B;  1NTZ G;  2PAS A;  2IX7 C;  3BYA A;  1SQP G;  1NU1 D;  1H8A A;  2Y4Q A;  3KDP B;  1LWU B;  2QJP B;  1K9U A;  4DIR A;  3K21 A;  3GLM A;  4HB1 A;  3CC4 P;  1JO5 A;  3RBX A;  1OOF A;  2PQL A;  1BCC E;  1S3J A;  1OIP A;  1YJW P;  3L71 G;  2E43 A;  1AP4 A;  3E3R A;  3G4S P;  2W90 A;  3H1I D;  1K05 A;  3IN6 A;  2KI4 C;  1L0N D;  2BEC A;  3L70 G;  4GBA A;  2WSS H;  4WVZ A;  2CPS A;  5GTI E;  3H1J D;  4NPF X;  1F4Q A;  1T2K C;  4XYN A;  3CD6 P;  1FI6 A;  1QL1 A;  2Z5H A;  2O5G A;  1XA5 A;  1UHK A;  2KHN A;  3DXL A;  4YGC B;  2K8M B;  4XJK B;  1NTK K;  2WND A;  3Q5S A;  5HKW A;  3BOW A;  2M1K B;  1TTX A;  1EDK A;  3RBZ A;  3NXA A;  1KFU L;  1F4O A;  3GOF A;  4PJ0 E;  1QEX A;  4W7Z A;  3ZDM A;  4BRY B;  4DCK A;  2WSE J;  2NCO A;  2JO1 A;  2Q1K A;  1UHJ A;  1GL2 D;  1M1J A;  3L72 J;  4N3Y B;  1A29 A;  1K73 Q;  3FXD A;  1CDP A;  1F54 A;  2H88 C;  2H2K A;  1PPJ D;  4DOJ A;  2OQQ A;  3TK1 A;  2AEM A;  1HH0 A;  3D6Y A;  2ZNE A;  2KNC B;  1EDI A;  2QSI A;  1S5L X;  1E79 H;  2KAV A;  2D2C D;  2M7L A;  1PVB A;  3M06 A;  3CCJ P;  5DIC A;  2NRG A;  4HSZ A;  4QJ5 B;  4MVF A;  3L73 G;  4PHM A;  4I5K A;  3L75 J;  2HOD B;  1PV3 A;  3EFG A;  1KQF B;  5BU8 B;  3M9H A;  1NKZ B;  1BJF A;  5BPJ A;  1N7S C;  4LGD E;  4H44 D;  2KLV A;  2WCE A;  4WQ3 A;  1CDN A;  1W9Z A;  2ZXX A;  1KWO B;  2WC6 A;  3JSV C;  2K7O A;  1QLS A;  1NX1 A;  1HT9 A;  1CZQ A;  2QE7 H;  3L4L A;  1EZV D;  5AVS B;  3R2P A;  1K8A Q;  2YKP A;  3GK4 X;  3FWN A;  1WRL A;  1VRK A;  3D73 A;  2QJY C;  1KQV A;  1S2E A;  1TRF A;  3C8V A;  3AE4 C;  1ZOT B;  1QTX A;  2OYI A;  5KU1 A;  1VQL P;  2F2P A;  2BBM A;  3WUU A;  2OTG B;  3CZT X;  3BVH A;  1LXF C;  1JC2 A;  2KQ6 A;  4HYT B;  3L35 A;  2JXC A;  1UUS A;  1M45 A;  1S5G Y;  3CME P;  1S4X A;  2UWJ E;  2FCD A;  1NKN A;  1AV1 A;  1WLZ A;  1IK9 A;  3FE6 A;  2KI6 C;  1ZP0 C;  2PAL A;  1S1C X;  2MAZ A;  1BG1 A;  1DD3 A;  3H1L D;  1NIW A;  2WC5 A;  3L36 A;  3RL0 g;  3BCC D;  3HE5 A;  4JD9 A;  2JXL A;  3HTK A;  1E5W A;  2KSP A;  1YYC A;  3CC2 P;  3I5I C;  3RZS A;  1GD2 E;  2ZT9 B;  4GNK B;  1SLQ A;  1SQB E;  2JT3 A;  1NX3 A;  3AEC C;  3V2R A;  2QEX P;  1BU3 A;  3CWB J;  1PSR A;  3H1J J;  2H8V A;  4H13 D;  1VQ4 P;  3B87 A;  2WCJ A;  3WHT B;  2PYQ A;  1SQP J;  3CS1 A;  2H8P D;  4PV1 C;  3SJS A;  5AW9 B;  2ZVN B;  1SS1 A;  5AVX B;  4JYC A;  2BAS A;  1QVF O;  4AUW A;  1RE3 C;  1NWD A;  2JJL A;  3GF3 A;  1JF2 A;  1KK8 C;  4QJ4 B;  2NPS A;  1R8E A;  2XDJ A;  3BCC G;  3Q5P A;  1Q82 Q;  1H8B A;  1KQM B;  3LCP C;  1SQV G;  2BEQ D;  5ER4 X;  2E76 D;  1YUT A;  1NTZ E;  2Q91 A;  3O4X A;  1Y8A A;  3SG2 A;  1KZU B;  2IYP A;  2LAN A;  1IJD B;  3OB1 B;  2HPS A;  3SWK A;  1EDJ A;  1LP1 B;  2LVI A;  1SP4 A;  2CT9 A;  4ORB B;  4PD4 H;  3PHL A;  1PL5 A;  2CK3 H;  3RL0 B;  3L73 E;  3CDN A;  3A2A A;  1LTS C;  3MUD C;  5AXI A;  3TDK A;  3I5G C;  3R1P A;  4YPC A;  1YIT P;  1FZC B;  1KQG B;  2FYU D;  1L7Z A;  2WWW A;  3BFB A;  2A06 D;  3HX4 A;  4H0L D;  1NX2 A;  4WB4 A;  5CCH D;  2BL0 B;  2K7B A;  1N73 B;  2Q5U A;  4P5O E;  1LA3 A;  2HQ8 A;  5AER A;  3C1L A;  3I5I B;  3VRR A;  1RE4 C;  3EKJ A;  3OAK A;  2CBL A;  4XA4 A;  1OW8 A;  3VRO A;  4FTG A;  2Q7C A;  4MZK A;  5E79 E;  3EFF K;  1KQS O;  4F7F A;  1SQB K;  2K7C A;  1G4Y R;  1HBW A;  1L0L D;  4CPG A;  3CCL P;  3BRT B;  2LUC A;  1B9A A;  3V5B A;  1CKK A;  3Q2Y A;  1IZN B;  3OJA B;  1J1D A;  4EYY Q;  2Y0D A;  2YO2 A;  2KYF A;  1PIX A;  1M8O B;  3DY9 A;  1EXR A;  3DVE A;  3RLZ A;  5FI7 A;  3O2P A;  3I5G B;  5AW8 B;  5KJ7 D;  4DZO A;  3CCR P;  3I56 P;  3P32 A;  2N9B A;  2OTL P;  2BL0 C;  1L0N G;  1RH5 B;  1S6J A;  2JPT A;  4D6T J;  1N8R Q;  1Z56 A;  5EFW B;  4K3A A;  2JU0 A;  2Q3I A;  1GQM A;  3CLQ A;  2JR8 A;  1N7S A;  1SVF A;  3AE6 C;  5KLV G;  1SBJ A;  1RF1 A;  3VN0 A;  2GV5 A;  3L71 D;  2JEE A;  3QH9 A;  1BCC D;  2YIU C;  2LUX A;  3FE9 A;  3PJS K;  1NP8 A;  4A4B A;  1HQV A;  2XU6 A;  3M9Q A;  3BUW B;  1F8H A;  3WHU B;  4I7Z C;  2L4H A;  3H4S E;  3BAT A;  5ER5 A;  3H1K J;  1GU4 A;  1M63 B;  1NCX A;  1KMI Z;  3H1K D;  3FX0 A;  3FXE A;  1JWD A;  1SQQ D;  1SYM A;  3P8C E;  3Q3D A;  2O60 A;  1KIL D;  2B88 A;  3L74 E;  2JTZ A;  2WOS A;  2ERB A;  1D1O A;  3ICB A;  1SQB J;  4GOE A;  2PRR A;  1J1E C;  1LTI C;  3SG7 A;  1U5I B;  1IWQ A;  1AJ4 A;  1NHL A;  1KYO I;  5CCG C;  5HL1 A;  1QX5 B;  3E1R A;  1A4P A;  1SSE B;  2P70 A;  2A06 G;  1KYO E;  1NTK D;  1QAS A;  5KAI H;  1WDC C;  1AHR A;  1DF0 B;  3H1H G;  1SCV A;  4H44 B;  3E7K A;  4W80 A;  2JC2 A;  2QEO A;  2C0W A;  1IH0 A;  5APU A;  3VMX A;  3CTN A;  4C0K A;  1QVI Y;  2K0J A;  1JY3 N;  1NYA A;  1R5S A;  1LA0 A;  3B86 A;  1KK7 Z;  4H13 C;  1SR6 B;  2A4J A;  2KAY A;  3HUS C;  1VF5 D;  2NPS C;  2BCC D;  2KS1 A;  2KSJ A;  3MHV A;  1ZR4 A;  1XK4 C;  2KBI A;  1YRU B;  1J55 A;  2LKM A;  1JNM A;  5FI2 A;  2L50 A;  4W7Y A;  1L0L G;  2ZXE B;  1X79 B;  4M2P A;  1Y6W A;  2JDI H;  4M3L A;  4Y28 J;  3RM1 A;  1ZW0 A;  3VMY A;  3PN7 C;  1S6C A;  1R2U A;  3NXS A;  2FYU J;  4AOM A;  2YNY A;  1QIV A;  1KB9 H;  1NTK J;  4GOD A;  4JYB A;  2EHB A;  2G3A A;  1KB9 E;  4YGE B;  1OW6 A;  2HPC B;  1AVY A;  1G1J A;  1LT1 A;  3H1J E;  1GL2 C;  5AVU B;  4NDD A;  1QVI Z;  1XFZ O;  1KOR A;  3I5C A;  1SR6 C;  4KT0 J;  1XK4 A; 
#chains in the Genus database with same CATH homology
 4GGF A;  1F71 A;  1UHH A;  1QLK A;  2NZ0 A;  4HRE E;  4OCI A;  5CPV A;  1CFD A;  2CXJ A;  3TDZ A;  1MHO A;  5JOL A;  2ZND A;  3C1V A;  4CFQ A;  1GGW A;  1OMR A;  5TNC A;  1S1E A;  2P6B B;  3JVT B;  3I5H B;  3TDI A;  2KAX A;  1Q80 A;  2AMI A;  2LP3 A;  4PE0 A;  4M2Q A;  1PVA A;  1B8R A;  1K96 A;  2F2O A;  3MSE B;  4GFT A;  4AQI A;  2PAS A;  4C0J A;  3BYA A;  1WDC B;  1IGV A;  5D7F A;  1A03 A;  3PAT A;  2Y4Q A;  2BCB A;  1YRT B;  4HRG A;  1TIZ A;  1CLB A;  1B47 A;  1QX2 A;  1W7J B;  2QPT A;  1K9U A;  4DIR A;  3K21 A;  1KFU S;  1XFX O;  4FQO A;  2SAS A;  1JBA A;  1FW4 A;  2H61 A;  2MA2 A;  3NSO A;  1YVH A;  3D10 A;  4N1F A;  4YGA A;  1AP4 A;  1TCF A;  3E3R A;  2LC5 A;  4TNC A;  3DF0 B;  2FCE A;  2K2A A;  4YI9 A;  1QS7 A;  1PRW A;  2CCM A;  4PHN A;  2KI4 C;  4PHJ A;  5DKQ A;  1XYD A;  1PSB A;  1QV0 A;  3O78 A;  1BMO A;  3TDU A;  2RGI A;  1S6I A;  3KEV A;  2ISD A;  3PM8 A;  1CDL A;  1MF8 B;  3AKB A;  2BEC A;  1UHI A;  4GBA A;  3LK0 A;  2SCP A;  4UPG A;  4YBH B;  2WCB A;  1CM1 A;  2HF5 A;  1F4Q A;  2I94 A;  3KO0 A;  1B8C A;  1QJT A;  3CLN A;  2OPO A;  3LL8 B;  4XYN A;  1B8L A;  1TCO B;  1FI6 A;  2LLU A;  2I18 A;  1LIN A;  2KI6 D;  1M39 A;  1WRZ A;  1RWY A;  3GK2 A;  4DUQ A;  2O5G A;  1XA5 A;  1UHK A;  1MUX A;  3FIA A;  2KHN A;  4YGC B;  4P2Y B;  2K8M B;  1ZMZ A;  1ALV A;  1EG4 A;  3CR2 A;  3BOW B;  4OR9 B;  4XJK B;  1V1G A;  2MBX A;  1XO5 A;  2BE4 A;  4USL A;  1L2O C;  1REC A;  4MEW A;  5FYX A;  2L4I A;  1AUI B;  4MN0 A;  2WND A;  5HKW A;  3BOW A;  1Y1X A;  1TTX A;  1XFY O;  2M1K B;  3NXA A;  3IQQ A;  5I2Q A;  1KFU L;  1F4O A;  1RTP 1;  3GOF A;  1CFC A;  1K9K A;  1KK7 Y;  4GGN A;  4DCK A;  1JFJ A;  4JQ0 D;  2NCO A;  3F45 A;  1UHJ A;  1A29 A;  1OFC X;  1CDP A;  2H61 C;  3SG6 A;  1YVL A;  1F54 A;  2OTG C;  3DVM A;  2H2K A;  4WRI A;  3AKA A;  3AAJ A;  2ZNE A;  1NX0 A;  1PK0 D;  2KAV A;  2M7L A;  2LV7 A;  1PVB A;  2LVK A;  2KQY A;  1J1E A;  2IS9 A;  1WY9 A;  4HSZ A;  2DOQ A;  4QJ5 B;  4MVF A;  3SG4 A;  5HLV A;  2Y1N A;  4PHM A;  1ZUZ A;  4I5K A;  1S3P A;  1SRA A;  3DVJ A;  1H4B A;  1BJF A;  1YTZ C;  2E30 A;  5BPJ A;  1TNP A;  5JJG A;  1OMV A;  1DT7 B;  3IQO A;  2WCE A;  4WQ3 A;  2JOJ A;  3PFV A;  1NPQ A;  3TS5 C;  1QIW A;  1XVJ A;  1CDN A;  1QV1 A;  2ZRT A;  4ORC B;  3CWG A;  1KWO B;  2FJU B;  3LK1 A;  1E8A A;  2K7O A;  1MXL C;  3O4Y A;  4BY4 A;  4YRU A;  1QLS A;  2KDH A;  1CDM A;  5DKR A;  1KFX L;  1NX1 A;  1HT9 A;  1ODB A;  2LMU A;  1RRO A;  1S26 D;  4YGB B;  3FWC A;  1N2D A;  2Y1M A;  2HQW A;  2F3Z A;  2L51 A;  3GK4 X;  1WRL A;  2R2I A;  3KPX A;  1VRK A;  2JT8 A;  2KYC A;  4GAO A;  4GGF C;  2JRF A;  2LCP A;  4BY5 A;  3WNX B;  3AAK A;  4DS7 A;  4HRH A;  1KQV A;  4ICB A;  1TRF A;  1EH2 A;  4OV2 A;  3SIA A;  1ZOT B;  1QTX A;  2NXQ A;  5KU1 A;  4ZCV A;  1TNX A;  4XJK A;  2F2P A;  1JUO A;  2L0P A;  3VRQ A;  1F55 A;  2BBM A;  2OTG B;  1DGV A;  2PVB A;  1Y1U A;  3CZT X;  1LXF C;  3NSI A;  1JC2 A;  2KQ6 A;  2Y5I A;  3EKH A;  2JXC A;  1TNQ A;  1B1G A;  1UUS A;  1M45 A;  1S5G Y;  4GPL B;  1B7T Z;  5DKN A;  2FCD A;  4GUK A;  1V1F A;  1WLZ A;  2KOT A;  1FF1 A;  2KI6 C;  1K93 D;  2PAL A;  4M2O A;  5KTY A;  1FPW A;  2MAZ A;  1BG1 A;  3KHE A;  1FI5 A;  1DF0 A;  1NIW A;  1LVC D;  2LM5 A;  2MLE C;  2ZKM X;  3OX5 A;  1CFF A;  1BOC A;  3EK7 A;  1DJG A;  2JXL A;  4PDZ A;  2COL B;  2KSP A;  2L5X B;  3DF0 A;  2MHH A;  3I5I C;  2LHL A;  1DMO A;  1A75 B;  4GNK B;  4NDC A;  1SY9 A;  1KK8 B;  1S36 A;  1SNL A;  1U5I A;  1XFU O;  2JT3 A;  1NX3 A;  2B1U A;  2JNX A;  3OB2 B;  3OHM B;  1BU3 A;  2Q4U A;  1TOP A;  1PSR A;  2JUL A;  1GJY A;  1DJY A;  2CNP A;  3WXA A;  4MRY A;  3WHT B;  2KBM A;  2M8U A;  1IRJ A;  4PE7 A;  3CS1 A;  1BF5 A;  5HKY A;  2GGM A;  2M7N A;  3SJS A;  4L9M A;  1YR5 A;  4N1G A;  5CSI A;  2BCX A;  2NCP A;  1C07 A;  1NWD A;  1SCM C;  2E6W A;  1JF2 A;  1KK8 C;  4QJ4 B;  4MRX A;  2D8N A;  1UP5 A;  3EK4 A;  1CMF A;  2M1U A;  4C0L A;  1A2X A;  1L2O B;  1H8B A;  1KQM B;  3LCP C;  3I5F C;  5ER4 X;  1DJI A;  1YUT A;  1M46 A;  1YUU A;  1CFP A;  2EGD A;  2KGB C;  4R1E A;  2Q91 A;  1YX8 A;  1F70 A;  1RFJ A;  5G08 A;  1SL7 A;  3SG2 A;  2LAN A;  3O6B A;  1K9P A;  1MR8 A;  5CSN A;  3PLF B;  3JTD C;  2HPS A;  2KNE A;  3OB1 B;  1CNP A;  1DJZ A;  2EC6 B;  1UUR A;  1OOJ A;  2LVI A;  2MJW B;  4Q04 A;  2CT9 A;  5B8I B;  1DJH A;  4ORB B;  4ZCU A;  2K7D A;  1DVI A;  3OP0 A;  4NDB A;  3D0Y A;  2M29 A;  2JNF A;  2AUC A;  2JTT A;  5AXI A;  1FBV A;  3I5G C;  4JPZ B;  2LE9 B;  5HLO A;  1OQP A;  2BKH B;  1NCY A;  2LNK A;  2NLN A;  1NUB A;  2M3W A;  2ZRS A;  2KI4 B;  1BLQ A;  2PRU A;  1LKJ A;  3A8R A;  1L7Z A;  1YUS A;  5F6T A;  3BUM B;  2MRD A;  3HX4 A;  4AQJ A;  1DTL A;  1NX2 A;  2G9B A;  1J7Q A;  2BL0 B;  2K7B A;  1CLM A;  4P5O E;  4MSP A;  3EVU A;  1LA3 A;  2HQ8 A;  2I7A A;  5CSF A;  3I5I B;  3VRR A;  5AER A;  4I5N B;  5GQQ C;  3SG3 A;  4CID A;  2OS8 B;  3EKJ A;  1IQ3 A;  2CBL A;  1X02 A;  1BR1 B;  2F8P A;  5HKZ A;  1SCM B;  1KQM C;  3TUY C;  3VRO A;  4FTG A;  2K61 A;  4MZK A;  3EVV A;  2KFG A;  3TS5 B;  2JT0 A;  2K7C A;  1G4Y R;  5I8N A;  4PCW A;  3VRP A;  2M0R A;  1N0Y A;  2LUC A;  4CFR A;  1SPY A;  1B9A A;  4MZL A;  1CKK A;  4MBE A;  1J1D A;  1RK9 A;  1MQ1 A;  2KYF A;  1G8I A;  2KFH A;  2V53 A;  2HET A;  5D69 A;  2LLT A;  2PSR A;  3OX6 A;  1CMG A;  1EXR A;  3DVE A;  3RLZ A;  3VGO A;  2TN4 A;  2ZFD A;  3BQ3 A;  3O2P A;  3I5G B;  3SIB A;  1B4C A;  1OZO A;  4OKH A;  1W7I B;  3FS7 A;  5AEQ A;  2VRG A;  2BL0 C;  4A4C A;  4D1E A;  1WLM A;  2WCF A;  1S6J A;  2JPT A;  5IBW A;  2G2B A;  1BT6 A;  1QXP A;  2AAO A;  2JU0 A;  3BUN B;  1GQM A;  1SL9 A;  3ZNI A;  1B7T Y;  1SW8 A;  2BE6 A;  2LLS A;  1SBJ A;  2Y9Z A;  2GV5 A;  2MLF C;  1CLL A;  1A75 A;  1RJV A;  1Y0V H;  2LUX A;  1DJW A;  1MXE A;  3LLE A;  4NQG A;  3GK1 A;  2K2F A;  2GGZ A;  2I2R E;  1TN4 A;  3DVK A;  1NP8 A;  1YUR A;  4A4B A;  1HQV A;  1UHN A;  2LMT A;  3BUW B;  1F8H A;  1UWO A;  3WHU B;  1AVS A;  2KGR A;  2L4H A;  1BOD A;  1CB1 A;  4F0Z B;  3H4S E;  5ER5 A;  2L2E A;  1EG3 A;  1QX7 A;  1CTR A;  4PAL A;  1M63 B;  1NCX A;  5J3X A;  3KF9 A;  1SL8 A;  1OZS A;  2L98 A;  1C7V A;  1IG5 A;  1NCZ A;  1JWD A;  2Y9Y A;  1J7O A;  1SYM A;  3I5F B;  4PE4 A;  4E68 A;  2O60 A;  1JFK A;  2JWW A;  2BBN A;  1JF0 A;  2JTZ A;  4WQ2 A;  1JSA A;  3EVR A;  1WRK A;  4CLN A;  2WOS A;  1D1O A;  1EJ3 A;  3ICB A;  1YX7 A;  4YI8 A;  1KFX S;  4QJ3 B;  1XFV O;  3BUX B;  1C7W A;  1S5G Z;  3D0Y B;  3NSL A;  5AAN A;  2LMV A;  3SG7 A;  1U5I B;  2LHI A;  1IWQ A;  1AJ4 A;  1OMD A;  3EK8 A;  2OS8 C;  3DD4 A;  1QX5 B;  1BR4 B;  1A4P A;  3CR4 X;  4ORA B;  3FWB A;  1KWO C;  1IJ6 A;  1QAS A;  3CR5 X;  1WDC C;  1XFW O;  5KSZ A;  1KSM A;  1AHR A;  1N65 A;  1DF0 B;  1K95 A;  4OVN F;  5HYD A;  3VRN A;  1SCV A;  2JQ6 A;  3SG5 A;  2JC2 A;  4MZJ A;  1ZFS A;  2M9G A;  4I5J A;  2FOT A;  4IL1 A;  5I2L A;  3I5H C;  1CM4 A;  1IH0 A;  4PHK A;  2BCA A;  4YGD B;  3CTN A;  4C0K A;  1MWN A;  1K2H A;  3A4U B;  1QVI Y;  1G33 A;  1GGZ A;  2K0J A;  1NYA A;  1LA0 A;  3JVT C;  3QRX A;  1KK7 Z;  3CGA A;  4CPV A;  2LAP A;  1KCY A;  1IKU A;  1SR6 B;  1KSO A;  2A4J A;  2KAY A;  3M0W A;  2EC6 C;  3PN7 B;  3PSR A;  2ZN8 A;  1Y1A A;  2F3Y A;  5K89 A;  1ZAC A;  2KFF A;  4MLW A;  3TZ1 A;  1XK4 C;  2KBI A;  1YRU B;  1AK8 A;  1J55 A;  2LP2 A;  1IQ5 A;  2L50 A;  2PMY A;  5PAL A;  2BKI B;  4M2P A;  4PE1 A;  1J7P A;  3NSK A;  1J7R A;  1TNW A;  1Y6W A;  2JZI A;  1DGU A;  2LVJ A;  3RM1 A;  3PN7 C;  1S6C A;  1K94 A;  1R2U A;  1OSA A;  4AOM A;  5AFP A;  3JTD B;  2M97 A;  2QAC A;  1PUL A;  1K8U A;  1QIV A;  3BUO B;  2EHB A;  1PAL A;  3PAL A;  4YGE B;  1SKT A;  1SK6 D;  2F33 A;  3IF7 A;  1NSH A;  4U8D A;  3HCM A;  3BXK A;  5CSJ A;  2M49 B;  4NDD A;  1SMG A;  4JWQ A;  5I2O A;  1OE9 B;  1EL4 A;  1AJ5 A;  1QVI Z;  1QAT A;  2CTN A;  2ZN9 A;  3TUY B;  3ZWH A;  1XFZ O;  2WC8 A;  1DJX A;  2LVV A;  2WOR A;  1R6P A;  4I5L B;  1ALW A;  1SR6 C;  1IJ5 A;  4DRW A;  4ETO A;  1XK4 A;  1K90 D;  1M31 A;  4N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...