4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Fibroblast growth factor 12
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
2JXLA 2Q4UA 1CMFA 2LVKA 2F2OA 4PE7A 4AOMA 1SL7A 4ORBB 3SG5A 1SCMC 3TDUA 1F55A 1XFXO 1QX5B 1B8RA 3D0YA 2LNKA 2MHHA 3VRRA 1AJ4A 2KAXA 5HKZA 3A8RA 4P5OE 2K7CA 2LC5A 2Y9ZA 1YTZC 1DMOA 1SRAA 4ETOA 1NIWA 1G8IA 1QVIY 2K0JA 5AXIA 1LINA 1DTLA 1IG5A 2KDHA 1XFZO 2ZRTA 1RECA 1TCFA 2H2KA 1FI5A 2OPOA 2JT0A 1JUOA 4MVFA 2FCDA 2KOTA 1Y1XA 1A29A 1K9PA 1WRKA 2K2FA 4I5JA 1EXRA 1UP5A 3TUYB 2JNFA 2BKHB 3WHTB 1IKUA 1F4QA 2F33A 1QTXA 1A75A 1YUTA 1FW4A 2WCBA 4NDDA 1M63B 1M39A 1AVSA 2H61C 1K9KA 2LV7A 2ZKMX 3EVVA 2E6WA 4E68A 5JJGA 1KQMC 1DF0B 2I94A 4OKHA 5D7FA 1E8AA 1YX8A 1MXLC 1CFPA 1WLMA 4OV2A 3IF7A 1UHHA 3BYAA 3GK4X 1BOCA 4ORAB 1C7VA 1B8CA 2BCXA 2PSRA 4YGCB 1S26D 1UWOA 1PALA 1CFDA 2GGZA 1ZFSA 1JF2A 1RWYA 1SL8A 3BXKA 1IGVA 2JRFA 2LM5A 2I18A 2BE4A 2BL0B 1CLMA 4PE0A 3C1VA 1U5IB 2KFGA 2SCPA 4NDCA 1SR6C 1UHKA 1RFJA 2JC2A 5J3XA 3CR4X 3I5FC 4DUQA 4OVNF 1UHNA 1TNQA 4YGBB 1VRKA 1MF8B 2EC6B 4GFTA 1NX0A 2ZNDA 2LE9B 5DKNA 4BY5A 1XVJA 2QPTA 1XK4C 1MQ1A 1YUUA 4GGNA 2FCEA 1ZOTB 2HQ8A 2LHLA 4N1GA 2P6BB 3PN7C 1AP4A 1CB1A 1DJHA 1KFXL 1CM4A 4OR9B 4TNCA 1J7PA 3HCMA 1WLZA 4GPLB 1FPWA 1XK4A 4MN0A 1D1OA 3WXAA 3I5GB 1KK7Y 3I5GC 3PALA 5BPJA 2NXQA 1EH2A 1QASA 3CLNA 1SBJA 4NQGA 1K2HA 2CCMA 2L0PA 3OHMB 2I7AA 4JQ0D 4JWQA 4C0LA 4PCWA 2E30A 1PVAA 1DJYA 4PHMA 5FYXA 1J1EA 2BCAA 3EK4A 1SW8A 1IJ5A 3PATA 4PHNA 1CM1A 1S1EA 4D1EA 1JF0A 1UHIA 4N1FA 2M1KB 1LA3A 1YX7A 2L2EA 1GGZA 3IQOA 1UHJA 1WRZA 2WC8A 3JVTC 4QJ5B 3AAKA 4YGEB 3RM1A 2LHIA 4YGDB 5I2OA 2EHBA 5AFPA 3FS7A 4GBAA 1WY9A 2F2PA 5TNCA 4YBHB 1LXFC 1NPQA 5IBWA 3KF9A 2LMVA 4MRXA 1S6CA 4CFQA 1NX2A 3KPXA 5KTYA 2JTTA 4ORCB 2LMUA 4DIRA 2F3ZA 2OS8C 2TN4A 4I5NB 3BUXB 2V53A 3BQ3A 1J1DA 1MHOA 1ALWA 1K90D 1B7TZ 1GGWA 2MBXA 2LMTA 2EC6C 2GGMA 1CTRA 1B9AA 2L4IA 2M9GA 1PVBA 2CT9A 3AKAA 4M2OA 1SKTA 1K94A 1JWDA 2MJWB 1YR5A 1C07A 2KFHA 2ZFDA 2IS9A 1CDPA 1KSOA 3CWGA 1KSMA 1UUSA 1F71A 1PRWA 1F4OA 2JPTA 2PALA 2H61A 5DKQA 2KBIA 3O6BA 3LK0A 2PRUA 2F8PA 3PSRA 1QIWA 1TTXA 1Y0VH 4PHJA 1SCVA 2MRDA 4OCIA 4MRYA 1CLBA 3EKJA 4PALA 1S6IA 4A4BA 1S5GY 2Q91A 3BOWB 1MR8A 2FJUB 3GK1A 4GNKB 2LP2A 2JOJA 4MEWA 3IQQA 1K95A 3TDIA 2M0RA 3VROA 3CR5X 1F70A 3I5FB 2ISDA 2COLB 2A4JA 2LLTA 1ZUZA 2KI4C 1RROA 3BUMB 1H4BA 2K7OA 4CFRA 1NSHA 2M1UA 3DF0B 1BJFA 1JC2A 3ZWHA 3I5IC 1UURA 3BUWB 1PK0D 4I5KA 1CNPA 3TUYC 4XJKB 1OZOA 3TS5C 2LUXA 3LCPC 3SG3A 1RTP1 3DD4A 4YGAA 4GAOA 5I2LA 3GOFA 5GQQC 1B7TY 2K7DA 4M2QA 3NXAA 1TN4A 3QRXA 1Y1AA 1BLQA 2MAZA 2Y1MA 2QACA 5CSFA 1JFKA 1KFUS 2JTZA 3DVMA 5AEQA 1R6PA 3DVEA 3EK7A 2JZIA 2D8NA 2KI6D 1OMRA 2G9BA 2KI4B 1OZSA 1QATA 1PSRA 3JTDC 2CXJA 2OTGB 3LLEA 4YI9A 1K8UA 1S36A 5HKWA 2LCPA 4YI8A 4ZCVA 5CPVA 2BKIB 1BMOA 4PHKA 1AK8A 1CDNA 1S3PA 5CSJA 1SR6B 5HYDA 1QS7A 2OS8B 3LL8B 2JULA 2NZ0A 3OP0A 2KGBC 2KHNA 1XO5A 1R2UA 2JNXA 1YRTB 1J7OA 2ZN9A 1PULA 1ALVA 2LP3A 4MLWA 1WDCB 2ZNEA 1HQVA 4WQ3A 2K2AA 3TZ1A 1K9UA 2CBLA 4GUKA 2WCFA 1BR1B 4MBEA 3KEVA 1KWOC 1SMGA 2KAYA 2M3WA 4FTGA 5AANA 1FI6A 1TRFA 3PN7B 2LANA 1WRLA 2CNPA 4UPGA 3OB1B 2PVBA 1OQPA 1N0YA 3D10A 1TCOB 5HLOA 3FWCA 2KFFA 1AUIB 1M46A 1SK6D 2Y4QA 5ER5A 4CLNA 1V1GA 1JFJA 1QLSA 3EVUA 2KNEA 1XFVO 1Y1UA 2ZRSA 1U5IA 4BY4A 4CIDA 1QJTA 2BCBA 3OB2B 1IRJA 5CSIA 2GV5A 2WOSA 3BUNB 1SPYA 4PE4A 1L2OB 1HT9A 4ICBA 1KK8B 1PSBA 4QJ3B 2JWWA 2LUCA 4A4CA 1KWOB 1A2XA 2I2RE 2LVVA 2K61A 1XFWO 2M7NA 4AQJA 5I8NA 1SY9A 3O4YA 2NCPA 3CZTX 3JVTB 3D0YB 2M97A 3CTNA 1V1FA 2HPSA 3OX6A 3KHEA 3CS1A 1BF5A 2JQ6A 3F45A 3MSEB 3WHUB 1W7IB 3I5HC 3E3RA 1S6JA 3JTDB 4MZKA 4NDBA 3WNXB 5KU1A 1JSAA 2Y1NA 1DVIA 4M2PA 2NCOA 2M49B 1QIVA 5PALA 3SG6A 3M0WA 1RJVA 2WCEA 3DVJA 2F3YA 4YRUA 1DJXA 4MSPA 1KFXS 2JU0A 1Q80A 1F8HA 4R1EA 1NX3A 5HLVA 1A75B 4C0JA 1M31A 1KCYA 5G08A 4AQIA 1WDCC 3FIAA 1BR4B 1TNPA 1CDLA 1DJWA 1DF0A 2BBNA 2Y5IA 3PLFB 4DS7A 1DT7B 3KO0A 5CSNA 2KGRA 2FOTA 5KSZA 2JT3A 2KYFA 1IH0A 1YRUB 1OSAA 1SNLA 1IWQA 4P2YB 1KK7Z 3A4UB 1J7RA 2MLEC 1TOPA 1NCYA 1ZACA 3NSLA 2K7BA 1EG4A 2L4HA 5F6TA 4CPVA 2M29A 1YURA 1MWNA 2M7LA 3AKBA 3VRPA 1TIZA 2BL0C 5ER4X 3PM8A 1BT6A 1NCXA 1NP8A 2LVJA 1MXEA 1Y6WA 1F54A 4USLA 3EKHA 1G4YR 4QJ4B 1W7JB 1SYMA 3ZNIA 2HF5A 1CMGA 1JBAA 3SG2A 3I5IB 1CFCA 1BU3A 1QXPA 1NUBA 3CGAA 4U8DA 1NX1A 1GQMA 2Y9YA 2NLNA 1A4PA 2BECA 2RGIA 3O2PA 1EJ3A 3I5HB 2EGDA 2G2BA 1EL4A 4WQ2A 4HRHA 2OTGC 1FBVA 1NWDA 1IQ3A 2KQ6A 4DCKA 2AAOA 2KQYA 1OFCX 1TNXA 3SIAA 1OE9B 1B8LA 4MZJA 2WORA 1XFUO 3DVKA 1X02A 2KSPA 5AERA 3H4SE 1RK9A 2WNDA 3K21A 2KBMA 2MLFC 5I2QA 4XYNA 1CDMA 1L2OC 1QX7A 2JT8A 3AAJA 4HSZA 1KQVA 1K93D 1YVHA 3TS5B 1IJ6A 3LK1A 4I5LB 3CR2A 4ZCUA 3DF0A 2MA2A 2PMYA 3NSOA 3FWBA 1KQMB 4XJKA 1B1GA 2LAPA 1A03A 1DJZA 2VRGA 2R2IA 3VGOA 5K89A 3NSIA 1C7WA 4HRGA 1QVIZ 2LLSA 1CLLA 2M8UA 1LVCD 1M45A 1DJGA 1CKKA 2HETA 1QV0A 5DKRA 3BUOB 3SIBA 4HREE 3TDZA 2O5GA 4WRIA 1OMVA 1LA0A 2BE6A 1ZMZA 2KI6C 1DJIA 3ICBA 4N5XA 3VRQA 3RLZA 1CFFA 1YUSA 2HQWA 2ZN8A 1OOJA 4PDZA 1EG3A 2K8MB 3SJSA 2L51A 5D69A 1QX2A 3EVRA 1H8BA 4DRWA 1J7QA 1XA5A 1AJ5A 1XYDA 2L5XB 2SASA 1KFUL 1DGVA 1B4CA 1SCMB 3PFVA 2BBMA 1J55A 1L7ZA 1N2DA 3GK2A 1SL9A 2AMIA 1K96A 1BG1A 1G33A 4L9MA 3VRNA 1FF1A 2DOQA 2CTNA 4FQOA 2LVIA 4IL1A 1BODA 1NYAA 1AHRA 1TNWA 3EK8A 5B8IB 5JOLA 2KAVA 4GGFA 3OX5A 1N65A 1LKJA 4MZLA 1MUXA 4F0ZB 3BOWA 4PE1A 2PASA 5HKYA 4GGFC 3SG4A 4Q04A 1S5GZ 3HX4A 1ODBA 1QV1A 1IQ5A 1B47A 1OMDA 2JXCA 1KK8C 2L98A 3NSKA 2B1UA 1NCZA 1QLKA 2L50A 4JPZB 1XFYO 1DGUA 2KYCA 2O60A 3O78A 1YVLA 1GJYA 3SG7A 4C0KA 2AUCA 2LLUA
chains in the Genus database with same CATH superfamily
4GKGA 2JP3A 2R5DA 1CMFA 4PE7A 1SL7A 1SCMC 3H1HD 2FYUK 1W9ZA 4L75A 1QX5B 3RL0D 1QL1A 5KLIB 3VRRA 2E5TA 3CWBE 1SFCB 1AVYA 2LC5A 2O01J 1YTZC 1OOIX 1DMOA 5AW4B 4OGQD 1NIWA 1G8IA 2ZYGA 1IG5A 2KDHA 4D6TD 2H2KA 2XU6A 3TDKA 1JUOA 3H1LD 4M3LA 5CCHC 1A29A 1EXRA 3TUYB 1L4AA 1PGOA 1H88A 3TGUG 2JWDA 5E79E 1IKUA 2J59M 2WCBA 5KLIC 1KQFB 2E6WA 1KQMC 5B66H 1MXLC 1DD4A 4OV2A 1ZRTE 1M8OB 4ORAB 4OGQB 2BCXA 2PSRA 1BDDA 4PJ0H 2ZVOB 1UWOA 3B88A 4L76A 4W7ZA 2ZXEB 1ZFSA 1GDTA 1IGVA 2ZJSE 2LM5A 2I18A 2BE4A 3LW5J 2E5YA 3GLMA 4TLFA 2LXCB 1HTLC 3V5BA 1VQLP 5J3XA 4A7PA 4OVNF 3AE1C 4OH8B 4RESB 4DOJA 1TNQA 3BFBA 1VRKA 4HJGH 4GFTA 2CK3H 1NTZK 2ZNDA 1EDJA 5E79H 3L75D 2QPTA 1L0NK 1XK4C 2FCEA 2C0XA 4N1GA 3PN7C 1GD2E 1KFXL 1J7PA 1PP9G 3N7NA 3L75G 2WSFH 1URQD 1D1OA 3WXAA 1NVOA 1GW3A 3G3ZA 2P1JA 2IZ1A 3S0GA 5AVSB 2Z5HA 1SQPE 1SBJA 2Q3EA 2CCMA 2V7QJ 3BVHA 1AQTA 3JSVC 2L5GB 2WVRA 3H6PA 3EK4A 1SW8A 1HH0A 4D1EA 1DC1A 2P58A 1UHIA 2M1KB 1KFNA 2YIUB 5APUA 3K5BA 1YX7A 1GGZA 2KPHA 1IJDB 3JVTC 2WC8A 4QJ5B 3IR9A 2LHIA 2H88C 1NU1D 1OW6A 3A5TA 3GHGC 2EHBA 3C9IA 5AVQB 1WY9A 3U1AA 2F2PA 2L5YA 5TNCA 3NMDA 3TGUJ 1A02J 2ZT9B 2BASA 1S6CA 3WMM0 3HE5B 2LMUA 2TN4A 2OS8C 3TNUA 2V53A 2OQQA 1IFPA 2EC6C 3P32A 1EDKA 4MN4C 3A0BH 1PVBA 1SKTA 1KYOI 3O6QB 3H1JJ 3HD7B 3KYQA 3OJAB 1OOFA 1KSOA 3CWGA 3L74J 5APYA 1F71A 2G8YA 1SSEB 2WZ7A 3M91A 3O6BA 3IAOA 3CX5E 3CYZA 3L70J 1Q2NA 2F8PA 1JMMA 4PHJA 1OOGA 4OCIA 4XA4A 4W80A 3R72A 3GF3A 3PJSK 2Q91A 3VMYA 2FJUB 1MFZA 4GNKB 4MEWA 3IQQA 2H7HA 3HD7C 3P8MC 3RGUA 3VROA 1F70A 4KT0J 2ISDA 3VMXA 1KQGB 3CWBJ 1RROA 1KN7A 1KMIZ 2NPSA 3VTPC 2A45G 3DF0B 1BJFA 1IFDA 1L0NJ 1VQ7P 1FS0E 1PK0D 4XJKB 4EDFA 3TS5C 3KQGA 1LJ2A 1ZR4A 2M0BA 4JKTA 3EFFK 3GOFA 5GQQC 4U3FD 1B7TY 1VPCA 3QRXA 1NTMG 1Y1AA 2MAZA 2ZT9C 2WQYC 2HPCB 5CSFA 3DVMA 2KNCA 2AEMA 3DVEA 2R32A 1LTJA 2AXTH 3G6EP 3A0HH 2KXPB 2G9BA 1OZSA 1M90Q 1PGJA 2I1JA 1N73C 3AE7C 1SQXK 3RK2B 1BGYJ 2SPZA 4LC1A 4Z1MH 5CPVA 1JB0J 1BMOA 1S72P 1XFRA 5HYDA 5L8RJ 3LL8B 2JULA 2KHNA 3Q1MA 1R2UA 2ZN9A 3BCCE 3FE8A 3IN6A 5AVVB 3D6YA 2ZNEA 3R2PA 3L47A 1NTMK 1GZLA 1GL2C 5H2FH 2WSEJ 2YO2A 1ZXGA 4UPGA 3OB1B 2PVBA 1KB9I 2QRXA 2YXQB 1MV8A 1JFJA 2KNEA 2OYIB 1OWAA 4WY4C 3QMEA 1U5IA 3U59A 1LP1A 4BY4A 4I6MC 2BCBA 2H8PD 3BUNB 2ZYDA 1NYHA 3D76A 4ICBA 2JWWA 2LUCA 1KWOB 2LVVA 1L4AC 3L72D 1GL2D 2N1TD 1SY9A 3D74A 3PRJA 3NFQA 5FI7A 1RHZB 2KIKA 3LIDA 1OVRA 4AUWA 5APWA 4D6TG 3CS1A 4FQTA 1QWVA 2B9BA 3MSEB 1IC2A 1S6JA 5KU1A 2FYNB 1HGZA 1WT6A 5PALA 3CCEP 1KV4A 4OWFA 3JCUE 1DJXA 3L4AA 1L4AB 3L71D 2JU0A 4IJ7A 4C0JA 1NX3A 5HLVA 1KCYA 1SLQA 1M31A 2QJYC 3F89A 4AQIA 1M1JA 3FIAA 3L70E 1OW8A 5CSNA 2FOTA 2JT3A 2KYFA 2PQLA 2FYUD 3H1ID 4ASVA 1IWQA 1NU1J 3A4UB 3N4XA 2KI7B 4IL6E 2WSEH 2L4HA 5F6TA 3L73E 3SWYA 1YURA 2QIWA 1PGQA 1NTME 2LVJA 1MXEA 3CX5H 1G4YR 1R8EA 4NPFX 3AE4C 1J1EC 1NAFA 1SYMA 3AEGC 2WPVB 3SG2A 1SQBK 1QXPA 1NTKD 1RH5B 2QEXP 2Y9YA 1ZP0C 2RGIA 5AVWB 1GK6A 1JMBA 3O2PA 1S5LX 2GUVA 2EGDA 3TGUD 4UB8H 1JCCA 3CX5I 1EXIA 3I55P 1DH3A 1TNXA 1AFOA 5B5EH 1L0ND 1FZFA 3H4SE 1WMKA 2HYNA 1DEEG 1NTKG 4ASWA 2H89C 1CDMA 3H1JD 4HSZA 1K93D 1JCDA 1IJ6A 1Z4HA 4ZCUA 4H0LB 3OGNA 3A3YB 2MA2A 2PMYA 3NSOA 3PHLA 2VRGA 2KS1A 1QVIZ 1CLLA 2IX7C 1QV0A 1KD1Q 5DKRA 4AYCA 1Y8AA 3MGNA 1SQQG 3HE5A 1PIXA 1LA0A 3PTZA 2KI6C 2FYUG 5BVZA 3Q5PA 1DX7A 1KILD 2FXPA 1K9MQ 1SQQD 1QX8A 2RMZA 1HJ0A 3B71A 3EVRA 1H8BA 3CWBD 3O6QA 3HD7A 1FDMA 3RZSA 2O01H 1AJ5A 2NPSD 2SASA 1DGVA 3CZ2A 1B4CA 1RE4C 1URQC 3R1VA 3FWNA 2KSJA 1J55A 5AW6B 2E43A 1SQXG 1OMIA 3TF5A 1BODA 3S4RA 1AHRA 3CC4P 2YO3A 1ZW0A 3OX5A 1N65A 1LKJA 4MZLA 4ZKPA 1K05A 4GGFC 2FJYA 4Q04A 3L70G 1ODBA 2WC6A 2O01N 3NSKA 1FZCC 1NCZA 2NPSB 4R4LA 4JPZB 1HBWA 3V4WA 5KLVE 2JXLA 2Q4UA 3CL3D 1HF9A 1AQ5A 4AOMA 1LNQA 3RK3D 2HPCA 4GDOA 1OZHA 1NKNA 1VQPP 4U3FG 4ZMDA 3CMAP 4P5OE 5APQA 2K7CA 2V7QH 2FY8A 3QWOC 5CCHD 2PAJA 1G1JA 5AXIA 1DTLA 1JTHB 2P7JA 1FU1A 3MIWA 4MVFA 2FCDA 1RF1C 2K2FA 5APTA 2B89A 2BKHB 1QTXA 1U7MA 1YUTA 1S9KD 4GODA 1SQVD 1M63B 1M39A 2H61C 1NH4A 3RK3C 4E68A 1QLED 1DF0B 4OKHA 2ZYAA 1P84D 1E8AA 1QVGO 3G4SP 3M0AA 1B8CA 4YGCB 5AVRB 1HJBA 1FOSF 2BCCE 1JF2A 3BXKA 1M1KQ 2JRFA 2A45H 2OYIA 2BL0B 1U5IB 1LP1B 1KILA 2SCPA 4NDCA 1SR6C 1UHKA 4PV1B 3NTNA 1H89A 2JC2A 1FDIA 2WPRA 3I5FC 4DUQA 1SQXD 1Y9BA 4YGBB 2GM4A 3C8VA 2EC6B 4BY5A 2B87B 2RKLA 1KORA 1YUUA 4TT3H 1N8RQ 4JD9A 3EWKA 3L72G 4OR9B 2HR3A 2LKMA 2C9LY 1OW7A 1KYOH 3GF7A 1FJKA 4MN0A 5KTBA 5TISE 1VQNP 1ORGA 3I5GB 3B5NB 2NXQA 1QASA 2YKOA 1K2HA 1KILC 4H44D 2L0PA 2NRGA 3L36A 2E30A 1DJYA 5FYXA 3AE9C 3H1HE 1J1EA 4EI2A 1M1JB 2IZ0A 1ZRTD 3IQOA 4PD4I 1WRZA 3AAKA 3AEAC 3RM1A 1GK4A 4YGDB 1ZLLA 4H13B 4Y99B 3L71E 2OYOA 1YJNP 4BRYB 3KZIE 2OARA 5IBWA 3B87A 3KF9A 2LMVA 1LTSC 4MRXA 4CFQA 3KPXA 1AA0A 3H1KE 2F3ZA 5KJ7C 5CCHA 3BQ3A 1J1DA 2FYZA 1DD3A 1BCCD 3DYEA 1B9AA 1FE6A 3AKAA 2CT9A 4M2OA 1SQQJ 3M9HA 2KZJA 1YR5A 2M5AB 1NTMD 2IS9A 3L73D 1QGKB 1CDPA 3S1KA 4F7FA 1KSMA 1UUSA 3U1CA 3Q3DA 1PRWA 3USSA 1SQPK 3DXLA 2ZXXA 3I5CA 3FX0A 2JEEA 5FI6A 2C9NY 1QIWA 1TTXA 1Y0VH 5APVA 2ZFCA 5KKZB 1OX3A 1CLBA 5AW8B 1TU3F 2JR8A 3RK2C 1S6IA 4A4BA 3BOWB 1Q7YQ 3GK1A 2R3SA 2JOJA 2L2CA 4B86A 1JOCA 1YJWP 3VB1A 2COLB 1ZUZA 2KI4C 1H4BA 4CFRA 2MKVA 3CZ0A 1Y47A 1JC2A 4I5KA 3LCPC 3SG3A 4CPGA 1RTP1 3DD4A 2NPSC 1HUCA 2G3AA 2KS1B 5I2LA 3CXHI 2QSIA 2E74B 2QVAA 2I8DA 1C3YA 1N2DC 1UIXA 5M1BA 2D8NA 4GOEA 2KI6D 1OMRA 1QATA 1FZCA 1PSRA 3JTDC 1GMJA 2CXJA 3SFDC 2OTGB 1XTCC 5KLVK 1K8UA 2JJLA 4I2LC 2LCPA 4U3FJ 1AK8A 1QEXA 2BKIB 1CDNA 1QS7A 4WVZA 4XFJA 1IFJA 4IFMA 2XNDH 4H44C 3W68A 5TJHA 1ALVA 1YQ4C 2YNYA 4MLWA 1ZOYC 2ZVNB 2GUSA 3TZ1A 1IFMA 3CCLP 3AEEC 4MBEA 3KEVA 1FI6A 1BGYD 3PN7B 5CCGC 1BGYE 1FOSE 1TCOB 3JC22 1SQXJ 5HLOA 2KFFA 1DELA 2O1KA 1S5LH 1AUIB 1SK6D 2YMYA 3L74G 2RH0A 1QLSA 3AEBC 5AW3B 3EVUA 2CPBA 2PP6A 3LW5H 1X0TA 3OB2B 1KB9E 5BU8B 3EQ2A 1GM0A 1L2OB 1HT9A 1PSBA 2OGUA 3G9RA 4IFDK 1XFWO 3JVTB 2RN0A 3BATA 3BRTB 4C46A 1LTBC 2B88A 2BEQD 1S9KE 2OYIC 2WWWA 1H8AA 4ZKUA 3WHUB 2KB7P 1W2BO 1N7SB 3DZTA 1JSAA 1JTHA 3Q2YA 2NCOA 3DY9A 3L72J 1RJVA 1HVVA 3RL0B 2M3BA 5B66E 2WCEA 1SFCD 2F3YA 4MSPA 1KFXS 1SS1A 3L71J 2AEFA 4R1EA 5KAIH 1TNPA 1BCCG 1CDLA 1DIPA 1DF0A 3E1RA 2BBNA 2Y5IA 1FZEA 1MZ9A 3GHGB 2A06E 1SP4A 1DQEA 1LTJC 2AXCA 1JNMA 3S0EA 1KK7Z 2K7BA 1KILB 2Q9IA 3L74D 4CPVA 2M29A 1P84E 2QA4P 1MWNA 3PM8A 1NCXA 5KAFH 3EKHA 1LT9B 3P7KA 2B87A 3H1IJ 1YIJP 3II6A 2HF5A 2QJYB 1CMGA 3S0BA 3CPWO 2KLUA 3Q5RA 3PLNA 1NX1A 4BWNA 2NLNA 2A45I 3FGAD 3KHUA 3B5NA 1EL4A 2KQ6A 2AAOA 5I94A 3FXEA 1XFUO 1BDCA 2KP8A 2WPQA 3A7OA 2KSPA 1LT9C 1M7LA 1YITP 2WNDA 1J1EB 3O8ZA 3FE9A 3K21A 1JM0A 2KUBA 2KBMA 3NHTA 4XYNA 1S4XA 2W90A 1L2OC 1SQBG 1EQ7A 1YVHA 2YKPA 4I5LB 2E42A 1JY2P 2J5UA 4K3AA 1DJZA 2Q1KA 3CMEP 3HE4B 2R2IA 3VGOA 5K89A 5B5EE 2JKVA 1AVOA 2LLSA 2M8UA 4BRYA 3CCSP 3L4LA 3BUOB 3SIBA 1GW4A 1QVFO 1OMVA 1FZAA 3BASA 1DJIA 3AE5C 3ICBA 4N5XA 1J1DB 3AE8C 4WY4A 5GTHE 1YUSA 1YQ3C 1QX2A 1SQBE 2ZT9D 1XA5A 3B7AA 4JYBA 2M5AA 4PD4E 2KK7A 3AEFC 2WCJA 2D2CC 1E79H 1FZGA 2BBMA 1IFNA 5AVZB 2KYVA 1SL9A 1K96A 4JF7A 1M1JC 1JUNA 4L9MA 3IVTA 2DOQA 2CTNA 2E76C 2LVIA 3IFMA 1OW4A 5JOLA 4C7RA 3WU2E 3RK2D 2KAVA 4GGFA 2V4HA 3CCQP 1K8AQ 1MUXA 5CBOA 3BOWA 3MD0A 4YPCA 3HX4A 4IOIH 2JXCA 1KK8C 4IL6H 1NTZD 1IIOA 4WWIA 2L50A 2O60A 2KYCA 1VQMP 3VN0A 1NTZE 1PFIA 1GJYA 3PJIA 1PL5A 4WB4A 2QJPC 4W7YA 3VP8A 3TDUA 3SG5A 5AW2B 1KC8Q 1F55A 3M0DC 3ZDMA 2Y0DA 3IF4A 3B4SA 1RE3C 1B8RA 1NU1E 3D0YA 2LNKA 2MHHA 4O9BA 3V2NA 1AJ4A 2WT7B 1W5CE 2KAXA 5HKZA 5KKZC 3H1LE 1FZCB 1SRAA 4ETOA 1LTAC 2K0JA 1G2CA 2BCCG 1L2PA 3JCUH 1RECA 1TCFA 1FI5A 4OGQC 2OPOA 2JT0A 1JY2O 4JYCA 1KTMA 5GTIE 1NKZB 3MZWB 1Y1XA 4I5JA 1YYCA 2JNFA 5K5GB 2K60A 1F4QA 2F33A 1A75A 4NDDA 1AVSA 2LV7A 1K9KA 3M06A 3EVVA 4I7ZC 5FI2A 5D7FA 4ZNCA 1CFPA 5AVUB 1WLMA 4OZDA 5APSA 1UHHA 3GK4X 1PPJE 3M9BA 1NGMB 1L4AD 2GGZA 3VYIA 1BCCJ 1C3ZA 1RWYA 1SL8A 2HODB 1FJPA 4JBZA 1J1DC 3C1VA 2KFGA 1RFJA 1AV1A 2ERBA 1DEKA 3L35A 1UHNA 1TUZA 1EZVG 1LS8A 2P2UA 1QL2A 1YTZI 1NX0A 1XVJA 3V2LA 1MQ1A 3CABA 1ZOTB 2HQ8A 2LHLA 1AP4A 2P6BB 5AW0B 1CM4A 3ITKA 1WLZA 3A0HE 3OW2O 5CBNA 1RE3A 4KHXA 4BXLA 3FXDA 1KK7Y 3L71G 3I5GC 1N7SA 1EH2A 3CLNA 1OXZA 4NQGA 5EL2A 2WPSA 3OHMB 3BCCJ 4JQ0D 1LTTC 4JWQA 4C0LA 4PCWA 2IYPA 5AVYB 2BCAA 1JY3P 4EYYQ 1JF0A 2M3EA 4N1FA 3L73G 3WU2H 1LA3A 2L2EA 3GHGA 1UHJA 2K3RA 2XZRA 4YGEB 3L4FA 2H8VA 2HFED 1J2JB 1VQ5P 3FS7A 4Y99C 1LXFC 1NPQA 3UIAA 3H1IG 3B5NC 1NX2A 5KTYA 3L70D 1EDLA 4I5NB 3BUXB 1SQPJ 2L91A 3AEDC 3MTUE 4UB6E 1EXJA 1ALWA 2FFDC 2YIUC 2ITAA 1GGWA 2LMTA 1LT9A 1G1IA 3D6ZA 3MUDC 1K94A 2MJWB 2D2CB 1LWUB 1C07A 1EZVD 1PP9E 5CJ0A 5KLVJ 3T97A 1F4OA 2JPTA 2H61A 2KBIA 3EFGA 2PRUA 5D3OA 1BE3E 4MRYA 2IFNA 2Q6QA 1X22A 4PALA 4N78E 1YJ9P 1MR8A 1K95A 3VOPA 2Y0CA 3TDIA 3CLQA 3CR5X 3I5FB 3L37A 2A4JA 1IK9A 1NSHA 2XNXA 2M1UA 3ZWHA 2N1TC 1VQ8P 1CNPA 1OZOA 2A06D 3P8CE 1NO4A 1PGPA 5AW7B 3HE4A 2QEBA 1KQLA 3OBVA 1W2EA 1JO5A 3NXAA 1TN4A 1BLQA 2E74C 2Q7CA 3CD6P 1X9VA 4IFFA 1E5WA 2K37A 5AEQA 1S2EA 1NTKJ 1IO4A 2JZIA 1N7SD 2GA1A 2KI4B 3RL0g 4WY4B 4C7NB 3CCMP 3LLEA 1CI6B 4YI9A 4QMAA 1P84H 4YI8A 1RF1B 4ZCVA 3OA7A 1S3PA 3L72E 3PP5A 2R44A 2KGBC 1FDOA 1XO5A 2O3JA 1J7OA 1YRTB 2QM8A 1PULA 2GTEA 3S0DA 1HQVA 4WQ3A 2K2AA 4GUKA 2WCFA 2M3WA 1SMGA 5AANA 1TRFA 4PJ0E 2LANA 2CNPA 5KAIE 3H1HG 4I7ZB 1N0YA 2OYHA 1K73Q 2LXBA 5DICA 2FYNC 1M46A 2JPOA 1T3JA 2WITA 3SWKA 4HKZH 3BJHA 1VL2A 1VF5C 1XFVO 1Y1UA 2ZRSA 3WUTA 3S9OA 5KJ7D 1GU4A 1FZBA 4CIDA 2P71A 5APXA 5CSIA 2GV5A 3RBZA 3CCUP 1URQB 4QJ3B 2K88A 3CDNA 2I2RE 1NTKK 3D78A 3E7KA 2HG5D 3H1IE 2K61A 1T8ZA 5I8NA 1BCCE 3D0YB 3FE6A 2WT7A 2M97A 1NAYA 2WCMA 2HPSA 2K9YA 3BFHA 3KHEA 2JQ6A 3F45A 2BCCD 2YMKA 3H1KJ 1G2CB 3E3RA 1RF0A 4MZKA 3WNXB 1DVIA 4M2PA 1NU1K 3SG6A 1QIVA 3HUSB 3R1OA 2BNXA 1NOHA 3CZ1A 4Y28J 3F5HA 4YRUA 1ZR2A 1A75B 1YTZT 1BR4B 5CMZA 3Q5SA 1DJWA 1KB9H 4DS7A 1RQVA 3KO0A 2IFMA 4I1LA 1IH0A 1YRUB 1UIIA 4P2YB 3VMZA 2P10A 4N6JA 2HODA 2I1KA 2MLEC 1X8YA 1KFMA 1TOPA 1NCYA 1ZACA 3NSLA 1EDIA 1EG4A 3B8EB 3VRPA 2WMMA 3SFEC 1BT6A 4IL6X 4RJTA 4USLA 4QJ4B 1VQOP 3ZNIA 1BE3J 3TK1A 2N9BA 5CHXA 2QE7H 1NUBA 3CGAA 1GQMA 1T3UA 3AECC 1L0NG 1KQSO 1LTIC 1SQXE 4WQ2A 2IYOA 3CXHH 2OTGC 1IQ3A 4DCKA 5AVXB 2KQYA 3V6IA 1L0LJ 3L73J 1OE9B 1B8LA 3H1JE 1S1CX 3DVKA 1ZN5A 4UB6H 1X02A 3UO9A 1RK9A 1NJIQ 1Z2CB 1A02F 5AVTB 4DJGA 3B5ND 1TUJA 3SS3A 3H32B 3H1KG 2FFDA 2JT8A 2N9YB 1Q81Q 2XDJA 3CCJP 3UNWA 1GTWA 1U57A 3CR2A 1VQKP 1BGYG 5BU5A 3FWBA 1KQMB 3SS4A 1SQVE 2LAPA 1A03A 2IBZG 1C7WA 3HD7D 1M45A 1DJGA 1CKKA 4YXDC 4HREE 2FXOA 2O5GA 2BE6A 2K1AA 1USEA 1ZMZA 3RLZA 2Q3IA 3MHVA 3L75E 1CFFA 2O1JA 2WCLA 2K8MB 3SJSA 3CCRP 2L51A 5D69A 3VMAA 3CC7P 1J7QA 1T14A 1SQVK 4N78D 1LWUA 3B6XA 1XYDA 3KZIH 3T97B 2KLDA 1SCMB 3PFVA 1L0LK 1L7ZA 1BG1A 2AMIA 1G33A 3VRNA 4IL1A 1NYAA 3EK8A 1HGVA 1ZMEC 2PASA 5HKYA 1JEKA 3CXHE 1YHQP 1S5GZ 1IFIA 1PZQA 2W6BA 3SWFA 1YBKA 3ABVC 3RL0C 2IBZI 1XFYO 1DGUA 3O78A 3V2QA 1YVLA 2AUCA 1KYOD 3PM2A 4NPDA 4D6TJ 3W67A 1KYOE 2LVKA 2F2OA 3HTKA 4ORBB 1R5LA 1XFXO 3D70A 3A8RA 2Y9ZA 1VQ4P 4C7NA 1QVIY 1CI6A 1LINA 2E74D 2ZRTA 1XFZO 1RF1A 5KJ7A 2KOTA 1WRKA 1K9PA 1UP5A 3L74E 3WHTB 1EZVE 1PP9D 2Z5IA 1CZQA 1FW4A 3VRQA 2ZKMX 4GIFA 5JJGA 2PRRA 3CXHD 5HL1A 2I94A 1N7LA 1YX8A 2QDIA 5KLVD 3IF7A 3BYAA 2OYHB 1BOCA 2KZIA 1C7VA 1GL2B 1S26D 1HWTC 1PALA 1CFDA 3R4YA 1VQ9P 4YTPC 2P70A 1FBMA 5C39A 1MUUA 1CLMA 4PE0A 1YI2P 3PH0A 1OIPA 1LWUC 1H0TB 3CR4X 3TGUE 2P67A 1RE4A 1URQA 2A06G 2K9JA 2QG4A 1MF8B 5DKNA 2LE9B 2POHA 2Z4EA 2QEHA 2E76D 4GGNA 1CB1A 3WUUA 2N1TA 1DJHA 4TNCA 3HCMA 4GPLB 1JY3N 1FPWA 1XK4A 4PD4H 4RO0A 2UWJE 2XV5A 3PALA 3CI9A 5BPJA 3G71P 1M57D 1JY3O 3EG5B 2OYHC 1USDA 3HUSA 3RBXA 2J58A 2I7AA 3B86A 3BCCD 4DZOA 1PVAA 4PHMA 3V2PA 3PATA 1IJ5A 4PHNA 1M56D 2KLVA 1CM1A 1S1EA 1L0LG 2LR2A 2VRSA 2E76B 1BE3D 2NZ2A 2OTJP 2W8ZA 1N86A 4EOTA 1SQQK 2Y0EA 3GW6A 3SSUA 3A2AA 2QJKB 2QEVA 3NXSA 4INWA 5I2OA 2FYUJ 5AFPA 4GBAA 4YBHB 3KXDA 2KLEA 3NHIA 2M8RA 4LGDE 2JTTA 4ORCB 4DIRA 1BE3G 4WY4D 3P8CD 3H1LJ 1LT1A 1MHOA 1K90D 1B7TZ 4D6TE 2MBXA 1N73B 1CTRA 2GGMA 2M9GA 2L4IA 4HH2A 2OTKE 1JWDA 2AEJA 2CPSA 2XKMA 2WCHA 3D75A 3K1EA 1OOHA 2KFHA 2ZFDA 2BAPA 2PALA 5DKQA 1RF0C 3BRVB 3LK0A 4KJMA 4H0LD 5KAFE 3PSRA 3GG2A 3KDPB 1SCVA 2MRDA 3EKJA 4L73A 4HYTB 1S5GY 2LP2A 2M0RA 1AJYA 3RK3B 2YKQA 1SQQE 3H32A 2FFDB 2FKWB 3V4QA 2LLTA 4GOFA 3BUMB 5CJ4A 3CCVP 2K7OA 3I5IC 1UURA 3BUWB 3TUYC 2Q5UA 2LUXA 1P84I 1LGHB 1S3JA 2W83C 4YGAA 4L74A 4GAOA 2W6AA 2R5BA 2OTLP 2K7DA 4M2QA 1SQBJ 2Y1MA 2PGDA 2QACA 1JFKA 1KFUS 2JTZA 1CSBA 1VDFA 1SFCA 1R6PA 1IK7A 2BEZF 5CCGA 3EK7A 3D73A 4UB8E 1SFCC 1NTZG 3Q8IA 4N3YB 3LIEA 1S36A 5HKWA 1WRGA 4PHKA 1FC2C 5CSJA 1SR6B 4PV1C 2OS8B 3SS5A 2NZ0A 1EC5A 3OP0A 3MUDA 1NU1G 4KYNA 4AQRD 2JNXA 2LP3A 1RY3A 3H1LG 1WDCB 1K9UA 2CBLA 4K35A 2DW3A 2WCKA 1D7MA 1BR1B 4PV1D 1KWOC 2KAYA 4FTGA 5EFWB 1Z56A 2JDIH 4LLHA 1WRLA 2QM7A 1ZV8A 4DT0A 1OQPA 3D10A 3FWCA 3HUSC 3QH9A 1DEBA 3V2RA 1VF5D 2Y4QA 1L0LE 5ER5A 4CLNA 1V1GA 4U3FE 1LTGC 3AE3C 2KSEA 1L0LD 2W6JH 5AW1B 1S5LE 3KPEA 1QJTA 1IRJA 2WOSA 1SPYA 4PE4A 4WBAA 2R3CA 3BCCG 1KK8B 3N7HA 3NGVA 1PP9J 2H43A 4A4CA 1A2XA 3HTKB 2M7NA 4AQJA 3O4YA 2NCPA 3CZTX 5AW9B 1T2KC 3CTNA 1V1FA 1PPJD 4PT1A 2WTYA 4U7JA 3OX6A 1XTGB 1BF5A 1VF5B 2WSFJ 2W27A 1BSHA 1W7IB 3I5HC 3JTDB 4NDBA 2Y1NA 2HLOA 2M49B 2PYQA 3M0WA 2IPPA 1MFTA 2IBZD 4H0LC 3DVJA 2JWAA 1U7JA 1X79B 3MP7B 1Q80A 3TSIA 3D77A 1F8HA 5AW5B 5G08A 1WDCC 2KOGA 3AE6C 3FWLA 1R5SA 3H1KD 1OVUA 2QJKC 1KB9D 3PLFB 1SQPD 1DT7B 5GTIH 3O4XA 1Q86Q 2KGRA 1EZVI 5KSZA 4NPEA 1GU5A 1P28A 1OSAA 1SNLA 2QEOA 2WC5A 1GL2A 2BCCJ 1JY2N 2ZAEB 5KLVG 4HB1A 1J7RA 5H2FE 3H1JG 1H0TA 4R4MA 3TNUB 1T2KD 2M7LA 3AKBA 3CC2P 1TIZA 1CW5A 2K9JB 2BL0C 5ER4X 3L75J 2YGUA 1NP8A 1KILE 3CX5D 3BFAA 1Y6WA 1F54A 3TYYA 4H44B 3M9QA 3M0DA 1W7JB 2IDBA 1JBAA 3I5IB 1CFCA 2N1TB 1BU3A 3HRNA 4U8DA 3VP9A 1A4PA 2BECA 4INXA 1SQVG 3E1IA 2WSSH 2IBZE 1EJ3A 3S0AA 3I5HB 2G2BA 4HRHA 1BSNA 1FBVA 1NWDA 5DJTB 2FBWC 1OFCX 1K04A 3SIAA 2AXTE 4H13D 4MZJA 2WORA 1IZNB 2WSCJ 1T6AA 1PV3A 5AERA 2C0WA 2D2CD 1NWQA 1NHLA 1OVVA 2E75B 4RKUJ 2MLFC 5I2QA 1QX7A 3AAJA 4H13C 1KQVA 3TS5B 3LK1A 1TWOA 3DF0A 3S0FA 3H25A 4XJKA 1B1GA 4GT1A 2JO1A 2QJPB 3NSIA 4HRGA 5GTHH 3AE2C 1LVCD 2HETA 3TDZA 4WRIA 2KNCB 3RK3E 1LTJB 3A0BE 4PD4D 1NTKE 2E75D 1NTMJ 3H1HJ 3OAKA 1N73A 2HQWA 3I56P 2ZN8A 1OOJA 4PDZA 1EG3A 1SVFA 4DRWA 1VQ6P 2YXRB 2FXMA 1SQPG 5TISH 2L5XB 1KFUL 2WSCH 3GMAA 1NTZJ 1L0NE 5DJUB 1N2DA 3GK2A 1MKMA 3C1LA 2MJZA 1SQBD 1FF1A 1N7SC 4FQOA 1Q90D 1TNWA 5B8IB 3R1PA 3CWBG 4XE5B 4EIJA 2FYUE 5CCGD 4F0ZB 4PE1A 1RQUA 1PPJG 3SG4A 2E75C 1KZUB 1SQVJ 3D71A 1QV1A 2PFXA 1IQ5A 1B47A 1OMDA 2L98A 2B1UA 1QLKA 3WUVA 1FAVA 4YXWH 1Q82Q 3SG7A 4C0KA 2LLUA
chains in the Genus database with same CATH topology
2JXLA 2Q4UA 1CMFA 2LVKA 2F2OA 4PE7A 4AOMA 1SL7A 4ORBB 3SG5A 1SCMC 3TDUA 1F55A 1XFXO 1QX5B 1B8RA 3D0YA 2LNKA 2MHHA 3VRRA 1AJ4A 2KAXA 5HKZA 3A8RA 4P5OE 2K7CA 2LC5A 2Y9ZA 1YTZC 1DMOA 1SRAA 4ETOA 1NIWA 1G8IA 1QVIY 2K0JA 5AXIA 1LINA 1DTLA 1IG5A 2KDHA 1XFZO 2ZRTA 1RECA 1TCFA 2H2KA 1FI5A 2OPOA 2JT0A 1JUOA 4MVFA 2FCDA 2KOTA 1Y1XA 1A29A 1K9PA 1WRKA 2K2FA 4I5JA 1EXRA 1UP5A 3TUYB 2JNFA 2BKHB 3WHTB 1IKUA 1F4QA 2F33A 1QTXA 1A75A 1YUTA 1FW4A 2WCBA 4NDDA 1M63B 1M39A 1AVSA 2H61C 1K9KA 2LV7A 2ZKMX 3EVVA 2E6WA 4E68A 5JJGA 1KQMC 1DF0B 2I94A 4OKHA 5D7FA 1E8AA 1YX8A 1MXLC 1CFPA 1WLMA 4OV2A 3IF7A 1UHHA 3BYAA 3GK4X 1BOCA 4ORAB 1C7VA 1B8CA 2BCXA 2PSRA 4YGCB 1S26D 1UWOA 1PALA 1CFDA 2GGZA 1ZFSA 1JF2A 1RWYA 1SL8A 3BXKA 1IGVA 2JRFA 2LM5A 2I18A 2BE4A 2BL0B 1CLMA 4PE0A 3C1VA 1U5IB 2KFGA 2SCPA 4NDCA 1SR6C 1UHKA 1RFJA 2JC2A 5J3XA 3CR4X 3I5FC 4DUQA 4OVNF 1UHNA 1TNQA 4YGBB 1VRKA 1MF8B 2EC6B 4GFTA 1NX0A 2ZNDA 2LE9B 5DKNA 4BY5A 1XVJA 2QPTA 1XK4C 1MQ1A 1YUUA 4GGNA 2FCEA 1ZOTB 2HQ8A 2LHLA 4N1GA 2P6BB 3PN7C 1AP4A 1CB1A 1DJHA 1KFXL 1CM4A 4OR9B 4TNCA 1J7PA 3HCMA 1WLZA 4GPLB 1FPWA 1XK4A 4MN0A 1D1OA 3WXAA 3I5GB 1KK7Y 3I5GC 3PALA 5BPJA 2NXQA 1EH2A 1QASA 3CLNA 1SBJA 4NQGA 1K2HA 2CCMA 2L0PA 3OHMB 2I7AA 4JQ0D 4JWQA 4C0LA 4PCWA 2E30A 1PVAA 1DJYA 4PHMA 5FYXA 1J1EA 2BCAA 3EK4A 1SW8A 1IJ5A 3PATA 4PHNA 1CM1A 1S1EA 4D1EA 1JF0A 1UHIA 4N1FA 2M1KB 1LA3A 1YX7A 2L2EA 1GGZA 3IQOA 1UHJA 1WRZA 2WC8A 3JVTC 4QJ5B 3AAKA 4YGEB 3RM1A 2LHIA 4YGDB 5I2OA 2EHBA 5AFPA 3FS7A 4GBAA 1WY9A 2F2PA 5TNCA 4YBHB 1LXFC 1NPQA 5IBWA 3KF9A 2LMVA 4MRXA 1S6CA 4CFQA 1NX2A 3KPXA 5KTYA 2JTTA 4ORCB 2LMUA 4DIRA 2F3ZA 2OS8C 2TN4A 4I5NB 3BUXB 2V53A 3BQ3A 1J1DA 1MHOA 1ALWA 1K90D 1B7TZ 1GGWA 2MBXA 2LMTA 2EC6C 2GGMA 1CTRA 1B9AA 2L4IA 2M9GA 1PVBA 2CT9A 3AKAA 4M2OA 1SKTA 1K94A 1JWDA 2MJWB 1YR5A 1C07A 2KFHA 2ZFDA 2IS9A 1CDPA 1KSOA 3CWGA 1KSMA 1UUSA 1F71A 1PRWA 1F4OA 2JPTA 2PALA 2H61A 5DKQA 2KBIA 3O6BA 3LK0A 2PRUA 2F8PA 3PSRA 1QIWA 1TTXA 1Y0VH 4PHJA 1SCVA 2MRDA 4OCIA 4MRYA 1CLBA 3EKJA 4PALA 1S6IA 4A4BA 1S5GY 2Q91A 3BOWB 1MR8A 2FJUB 3GK1A 4GNKB 2LP2A 2JOJA 4MEWA 3IQQA 1K95A 3TDIA 2M0RA 3VROA 3CR5X 1F70A 3I5FB 2ISDA 2COLB 2A4JA 2LLTA 1ZUZA 2KI4C 1RROA 3BUMB 1H4BA 2K7OA 4CFRA 1NSHA 2M1UA 3DF0B 1BJFA 1JC2A 3ZWHA 3I5IC 1UURA 3BUWB 1PK0D 4I5KA 1CNPA 3TUYC 4XJKB 1OZOA 3TS5C 2LUXA 3LCPC 3SG3A 1RTP1 3DD4A 4YGAA 4GAOA 5I2LA 3GOFA 5GQQC 1B7TY 2K7DA 4M2QA 3NXAA 1TN4A 3QRXA 1Y1AA 1BLQA 2MAZA 2Y1MA 2QACA 5CSFA 1JFKA 1KFUS 2JTZA 3DVMA 5AEQA 1R6PA 3DVEA 3EK7A 2JZIA 2D8NA 2KI6D 1OMRA 2G9BA 2KI4B 1OZSA 1QATA 1PSRA 3JTDC 2CXJA 2OTGB 3LLEA 4YI9A 1K8UA 1S36A 5HKWA 2LCPA 4YI8A 4ZCVA 5CPVA 2BKIB 1BMOA 4PHKA 1AK8A 1CDNA 1S3PA 5CSJA 1SR6B 5HYDA 1QS7A 2OS8B 3LL8B 2JULA 2NZ0A 3OP0A 2KGBC 2KHNA 1XO5A 1R2UA 2JNXA 1YRTB 1J7OA 2ZN9A 1PULA 1ALVA 2LP3A 4MLWA 1WDCB 2ZNEA 1HQVA 4WQ3A 2K2AA 3TZ1A 1K9UA 2CBLA 4GUKA 2WCFA 1BR1B 4MBEA 3KEVA 1KWOC 1SMGA 2KAYA 2M3WA 4FTGA 5AANA 1FI6A 1TRFA 3PN7B 2LANA 1WRLA 2CNPA 4UPGA 3OB1B 2PVBA 1OQPA 1N0YA 3D10A 1TCOB 5HLOA 3FWCA 2KFFA 1AUIB 1M46A 1SK6D 2Y4QA 5ER5A 4CLNA 1V1GA 1JFJA 1QLSA 3EVUA 2KNEA 1XFVO 1Y1UA 2ZRSA 1U5IA 4BY4A 4CIDA 1QJTA 2BCBA 3OB2B 1IRJA 5CSIA 2GV5A 2WOSA 3BUNB 1SPYA 4PE4A 1L2OB 1HT9A 4ICBA 1KK8B 1PSBA 4QJ3B 2JWWA 2LUCA 4A4CA 1KWOB 1A2XA 2I2RE 2LVVA 2K61A 1XFWO 2M7NA 4AQJA 5I8NA 1SY9A 3O4YA 2NCPA 3CZTX 3JVTB 3D0YB 2M97A 3CTNA 1V1FA 2HPSA 3OX6A 3KHEA 3CS1A 1BF5A 2JQ6A 3F45A 3MSEB 3WHUB 1W7IB 3I5HC 3E3RA 1S6JA 3JTDB 4MZKA 4NDBA 3WNXB 5KU1A 1JSAA 2Y1NA 1DVIA 4M2PA 2NCOA 2M49B 1QIVA 5PALA 3SG6A 3M0WA 1RJVA 2WCEA 3DVJA 2F3YA 4YRUA 1DJXA 4MSPA 1KFXS 2JU0A 1Q80A 1F8HA 4R1EA 1NX3A 5HLVA 1A75B 4C0JA 1M31A 1KCYA 5G08A 4AQIA 1WDCC 3FIAA 1BR4B 1TNPA 1CDLA 1DJWA 1DF0A 2BBNA 2Y5IA 3PLFB 4DS7A 1DT7B 3KO0A 5CSNA 2KGRA 2FOTA 5KSZA 2JT3A 2KYFA 1IH0A 1YRUB 1OSAA 1SNLA 1IWQA 4P2YB 1KK7Z 3A4UB 1J7RA 2MLEC 1TOPA 1NCYA 1ZACA 3NSLA 2K7BA 1EG4A 2L4HA 5F6TA 4CPVA 2M29A 1YURA 1MWNA 2M7LA 3AKBA 3VRPA 1TIZA 2BL0C 5ER4X 3PM8A 1BT6A 1NCXA 1NP8A 2LVJA 1MXEA 1Y6WA 1F54A 4USLA 3EKHA 1G4YR 4QJ4B 1W7JB 1SYMA 3ZNIA 2HF5A 1CMGA 1JBAA 3SG2A 3I5IB 1CFCA 1BU3A 1QXPA 1NUBA 3CGAA 4U8DA 1NX1A 1GQMA 2Y9YA 2NLNA 1A4PA 2BECA 2RGIA 3O2PA 1EJ3A 3I5HB 2EGDA 2G2BA 1EL4A 4WQ2A 4HRHA 2OTGC 1FBVA 1NWDA 1IQ3A 2KQ6A 4DCKA 2AAOA 2KQYA 1OFCX 1TNXA 3SIAA 1OE9B 1B8LA 4MZJA 2WORA 1XFUO 3DVKA 1X02A 2KSPA 5AERA 3H4SE 1RK9A 2WNDA 3K21A 2KBMA 2MLFC 5I2QA 4XYNA 1CDMA 1L2OC 1QX7A 2JT8A 3AAJA 4HSZA 1KQVA 1K93D 1YVHA 3TS5B 1IJ6A 3LK1A 4I5LB 3CR2A 4ZCUA 3DF0A 2MA2A 2PMYA 3NSOA 3FWBA 1KQMB 4XJKA 1B1GA 2LAPA 1A03A 1DJZA 2VRGA 2R2IA 3VGOA 5K89A 3NSIA 1C7WA 4HRGA 1QVIZ 2LLSA 1CLLA 2M8UA 1LVCD 1M45A 1DJGA 1CKKA 2HETA 1QV0A 5DKRA 3BUOB 3SIBA 4HREE 3TDZA 2O5GA 4WRIA 1OMVA 1LA0A 2BE6A 1ZMZA 2KI6C 1DJIA 3ICBA 4N5XA 3VRQA 3RLZA 1CFFA 1YUSA 2HQWA 2ZN8A 1OOJA 4PDZA 1EG3A 2K8MB 3SJSA 2L51A 5D69A 1QX2A 3EVRA 1H8BA 4DRWA 1J7QA 1XA5A 1AJ5A 1XYDA 2L5XB 2SASA 1KFUL 1DGVA 1B4CA 1SCMB 3PFVA 2BBMA 1J55A 1L7ZA 1N2DA 3GK2A 1SL9A 2AMIA 1K96A 1BG1A 1G33A 4L9MA 3VRNA 1FF1A 2DOQA 2CTNA 4FQOA 2LVIA 4IL1A 1BODA 1NYAA 1AHRA 1TNWA 3EK8A 5B8IB 5JOLA 2KAVA 4GGFA 3OX5A 1N65A 1LKJA 4MZLA 1MUXA 4F0ZB 3BOWA 4PE1A 2PASA 5HKYA 4GGFC 3SG4A 4Q04A 1S5GZ 3HX4A 1ODBA 1QV1A 1IQ5A 1B47A 1OMDA 2JXCA 1KK8C 2L98A 3NSKA 2B1UA 1NCZA 1QLKA 2L50A 4JPZB 1XFYO 1DGUA 2KYCA 2O60A 3O78A 1YVLA 1GJYA 3SG7A 4C0KA 2AUCA 2LLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXL A;  2Q4U A;  1CMF A;  2LVK A;  2F2O A;  4PE7 A;  4AOM A;  1SL7 A;  4ORB B;  3SG5 A;  1SCM C;  3TDU A;  1F55 A;  1XFX O;  1QX5 B;  1B8R A;  3D0Y A;  2LNK A;  2MHH A;  3VRR A;  1AJ4 A;  2KAX A;  5HKZ A;  3A8R A;  4P5O E;  2K7C A;  2LC5 A;  2Y9Z A;  1YTZ C;  1DMO A;  1SRA A;  4ETO A;  1NIW A;  1G8I A;  1QVI Y;  2K0J A;  5AXI A;  1LIN A;  1DTL A;  1IG5 A;  2KDH A;  1XFZ O;  2ZRT A;  1REC A;  1TCF A;  2H2K A;  1FI5 A;  2OPO A;  2JT0 A;  1JUO A;  4MVF A;  2FCD A;  2KOT A;  1Y1X A;  1A29 A;  1K9P A;  1WRK A;  2K2F A;  4I5J A;  1EXR A;  1UP5 A;  3TUY B;  2JNF A;  2BKH B;  3WHT B;  1IKU A;  1F4Q A;  2F33 A;  1QTX A;  1A75 A;  1YUT A;  1FW4 A;  2WCB A;  4NDD A;  1M63 B;  1M39 A;  1AVS A;  2H61 C;  1K9K A;  2LV7 A;  2ZKM X;  3EVV A;  2E6W A;  4E68 A;  5JJG A;  1KQM C;  1DF0 B;  2I94 A;  4OKH A;  5D7F A;  1E8A A;  1YX8 A;  1MXL C;  1CFP A;  1WLM A;  4OV2 A;  3IF7 A;  1UHH A;  3BYA A;  3GK4 X;  1BOC A;  4ORA B;  1C7V A;  1B8C A;  2BCX A;  2PSR A;  4YGC B;  1S26 D;  1UWO A;  1PAL A;  1CFD A;  2GGZ A;  1ZFS A;  1JF2 A;  1RWY A;  1SL8 A;  3BXK A;  1IGV A;  2JRF A;  2LM5 A;  2I18 A;  2BE4 A;  2BL0 B;  1CLM A;  4PE0 A;  3C1V A;  1U5I B;  2KFG A;  2SCP A;  4NDC A;  1SR6 C;  1UHK A;  1RFJ A;  2JC2 A;  5J3X A;  3CR4 X;  3I5F C;  4DUQ A;  4OVN F;  1UHN A;  1TNQ A;  4YGB B;  1VRK A;  1MF8 B;  2EC6 B;  4GFT A;  1NX0 A;  2ZND A;  2LE9 B;  5DKN A;  4BY5 A;  1XVJ A;  2QPT A;  1XK4 C;  1MQ1 A;  1YUU A;  4GGN A;  2FCE A;  1ZOT B;  2HQ8 A;  2LHL A;  4N1G A;  2P6B B;  3PN7 C;  1AP4 A;  1CB1 A;  1DJH A;  1KFX L;  1CM4 A;  4OR9 B;  4TNC A;  1J7P A;  3HCM A;  1WLZ A;  4GPL B;  1FPW A;  1XK4 A;  4MN0 A;  1D1O A;  3WXA A;  3I5G B;  1KK7 Y;  3I5G C;  3PAL A;  5BPJ A;  2NXQ A;  1EH2 A;  1QAS A;  3CLN A;  1SBJ A;  4NQG A;  1K2H A;  2CCM A;  2L0P A;  3OHM B;  2I7A A;  4JQ0 D;  4JWQ A;  4C0L A;  4PCW A;  2E30 A;  1PVA A;  1DJY A;  4PHM A;  5FYX A;  1J1E A;  2BCA A;  3EK4 A;  1SW8 A;  1IJ5 A;  3PAT A;  4PHN A;  1CM1 A;  1S1E A;  4D1E A;  1JF0 A;  1UHI A;  4N1F A;  2M1K B;  1LA3 A;  1YX7 A;  2L2E A;  1GGZ A;  3IQO A;  1UHJ A;  1WRZ A;  2WC8 A;  3JVT C;  4QJ5 B;  3AAK A;  4YGE B;  3RM1 A;  2LHI A;  4YGD B;  5I2O A;  2EHB A;  5AFP A;  3FS7 A;  4GBA A;  1WY9 A;  2F2P A;  5TNC A;  4YBH B;  1LXF C;  1NPQ A;  5IBW A;  3KF9 A;  2LMV A;  4MRX A;  1S6C A;  4CFQ A;  1NX2 A;  3KPX A;  5KTY A;  2JTT A;  4ORC B;  2LMU A;  4DIR A;  2F3Z A;  2OS8 C;  2TN4 A;  4I5N B;  3BUX B;  2V53 A;  3BQ3 A;  1J1D A;  1MHO A;  1ALW A;  1K90 D;  1B7T Z;  1GGW A;  2MBX A;  2LMT A;  2EC6 C;  2GGM A;  1CTR A;  1B9A A;  2L4I A;  2M9G A;  1PVB A;  2CT9 A;  3AKA A;  4M2O A;  1SKT A;  1K94 A;  1JWD A;  2MJW B;  1YR5 A;  1C07 A;  2KFH A;  2ZFD A;  2IS9 A;  1CDP A;  1KSO A;  3CWG A;  1KSM A;  1UUS A;  1F71 A;  1PRW A;  1F4O A;  2JPT A;  2PAL A;  2H61 A;  5DKQ A;  2KBI A;  3O6B A;  3LK0 A;  2PRU A;  2F8P A;  3PSR A;  1QIW A;  1TTX A;  1Y0V H;  4PHJ A;  1SCV A;  2MRD A;  4OCI A;  4MRY A;  1CLB A;  3EKJ A;  4PAL A;  1S6I A;  4A4B A;  1S5G Y;  2Q91 A;  3BOW B;  1MR8 A;  2FJU B;  3GK1 A;  4GNK B;  2LP2 A;  2JOJ A;  4MEW A;  3IQQ A;  1K95 A;  3TDI A;  2M0R A;  3VRO A;  3CR5 X;  1F70 A;  3I5F B;  2ISD A;  2COL B;  2A4J A;  2LLT A;  1ZUZ A;  2KI4 C;  1RRO A;  3BUM B;  1H4B A;  2K7O A;  4CFR A;  1NSH A;  2M1U A;  3DF0 B;  1BJF A;  1JC2 A;  3ZWH A;  3I5I C;  1UUR A;  3BUW B;  1PK0 D;  4I5K A;  1CNP A;  3TUY C;  4XJK B;  1OZO A;  3TS5 C;  2LUX A;  3LCP C;  3SG3 A;  1RTP 1;  3DD4 A;  4YGA A;  4GAO A;  5I2L A;  3GOF A;  5GQQ C;  1B7T Y;  2K7D A;  4M2Q A;  3NXA A;  1TN4 A;  3QRX A;  1Y1A A;  1BLQ A;  2MAZ A;  2Y1M A;  2QAC A;  5CSF A;  1JFK A;  1KFU S;  2JTZ A;  3DVM A;  5AEQ A;  1R6P A;  3DVE A;  3EK7 A;  2JZI A;  2D8N A;  2KI6 D;  1OMR A;  2G9B A;  2KI4 B;  1OZS A;  1QAT A;  1PSR A;  3JTD C;  2CXJ A;  2OTG B;  3LLE A;  4YI9 A;  1K8U A;  1S36 A;  5HKW A;  2LCP A;  4YI8 A;  4ZCV A;  5CPV A;  2BKI B;  1BMO A;  4PHK A;  1AK8 A;  1CDN A;  1S3P A;  5CSJ A;  1SR6 B;  5HYD A;  1QS7 A;  2OS8 B;  3LL8 B;  2JUL A;  2NZ0 A;  3OP0 A;  2KGB C;  2KHN A;  1XO5 A;  1R2U A;  2JNX A;  1YRT B;  1J7O A;  2ZN9 A;  1PUL A;  1ALV A;  2LP3 A;  4MLW A;  1WDC B;  2ZNE A;  1HQV A;  4WQ3 A;  2K2A A;  3TZ1 A;  1K9U A;  2CBL A;  4GUK A;  2WCF A;  1BR1 B;  4MBE A;  3KEV A;  1KWO C;  1SMG A;  2KAY A;  2M3W A;  4FTG A;  5AAN A;  1FI6 A;  1TRF A;  3PN7 B;  2LAN A;  1WRL A;  2CNP A;  4UPG A;  3OB1 B;  2PVB A;  1OQP A;  1N0Y A;  3D10 A;  1TCO B;  5HLO A;  3FWC A;  2KFF A;  1AUI B;  1M46 A;  1SK6 D;  2Y4Q A;  5ER5 A;  4CLN A;  1V1G A;  1JFJ A;  1QLS A;  3EVU A;  2KNE A;  1XFV O;  1Y1U A;  2ZRS A;  1U5I A;  4BY4 A;  4CID A;  1QJT A;  2BCB A;  3OB2 B;  1IRJ A;  5CSI A;  2GV5 A;  2WOS A;  3BUN B;  1SPY A;  4PE4 A;  1L2O B;  1HT9 A;  4ICB A;  1KK8 B;  1PSB A;  4QJ3 B;  2JWW A;  2LUC A;  4A4C A;  1KWO B;  1A2X A;  2I2R E;  2LVV A;  2K61 A;  1XFW O;  2M7N A;  4AQJ A;  5I8N A;  1SY9 A;  3O4Y A;  2NCP A;  3CZT X;  3JVT B;  3D0Y B;  2M97 A;  3CTN A;  1V1F A;  2HPS A;  3OX6 A;  3KHE A;  3CS1 A;  1BF5 A;  2JQ6 A;  3F45 A;  3MSE B;  3WHU B;  1W7I B;  3I5H C;  3E3R A;  1S6J A;  3JTD B;  4MZK A;  4NDB A;  3WNX B;  5KU1 A;  1JSA A;  2Y1N A;  1DVI A;  4M2P A;  2NCO A;  2M49 B;  1QIV A;  5PAL A;  3SG6 A;  3M0W A;  1RJV A;  2WCE A;  3DVJ A;  2F3Y A;  4YRU A;  1DJX A;  4MSP A;  1KFX S;  2JU0 A;  1Q80 A;  1F8H A;  4R1E A;  1NX3 A;  5HLV A;  1A75 B;  4C0J A;  1M31 A;  1KCY A;  5G08 A;  4AQI A;  1WDC C;  3FIA A;  1BR4 B;  1TNP A;  1CDL A;  1DJW A;  1DF0 A;  2BBN A;  2Y5I A;  3PLF B;  4DS7 A;  1DT7 B;  3KO0 A;  5CSN A;  2KGR A;  2FOT A;  5KSZ A;  2JT3 A;  2KYF A;  1IH0 A;  1YRU B;  1OSA A;  1SNL A;  1IWQ A;  4P2Y B;  1KK7 Z;  3A4U B;  1J7R A;  2MLE C;  1TOP A;  1NCY A;  1ZAC A;  3NSL A;  2K7B A;  1EG4 A;  2L4H A;  5F6T A;  4CPV A;  2M29 A;  1YUR A;  1MWN A;  2M7L A;  3AKB A;  3VRP A;  1TIZ A;  2BL0 C;  5ER4 X;  3PM8 A;  1BT6 A;  1NCX A;  1NP8 A;  2LVJ A;  1MXE A;  1Y6W A;  1F54 A;  4USL A;  3EKH A;  1G4Y R;  4QJ4 B;  1W7J B;  1SYM A;  3ZNI A;  2HF5 A;  1CMG A;  1JBA A;  3SG2 A;  3I5I B;  1CFC A;  1BU3 A;  1QXP A;  1NUB A;  3CGA A;  4U8D A;  1NX1 A;  1GQM A;  2Y9Y A;  2NLN A;  1A4P A;  2BEC A;  2RGI A;  3O2P A;  1EJ3 A;  3I5H B;  2EGD A;  2G2B A;  1EL4 A;  4WQ2 A;  4HRH A;  2OTG C;  1FBV A;  1NWD A;  1IQ3 A;  2KQ6 A;  4DCK A;  2AAO A;  2KQY A;  1OFC X;  1TNX A;  3SIA A;  1OE9 B;  1B8L A;  4MZJ A;  2WOR A;  1XFU O;  3DVK A;  1X02 A;  2KSP A;  5AER A;  3H4S E;  1RK9 A;  2WND A;  3K21 A;  2KBM A;  2MLF C;  5I2Q A;  4XYN A;  1CDM A;  1L2O C;  1QX7 A;  2JT8 A;  3AAJ A;  4HSZ A;  1KQV A;  1K93 D;  1YVH A;  3TS5 B;  1IJ6 A;  3LK1 A;  4I5L B;  3CR2 A;  4ZCU A;  3DF0 A;  2MA2 A;  2PMY A;  3NSO A;  3FWB A;  1KQM B;  4XJK A;  1B1G A;  2LAP A;  1A03 A;  1DJZ A;  2VRG A;  2R2I A;  3VGO A;  5K89 A;  3NSI A;  1C7W A;  4HRG A;  1QVI Z;  2LLS A;  1CLL A;  2M8U A;  1LVC D;  1M45 A;  1DJG A;  1CKK A;  2HET A;  1QV0 A;  5DKR A;  3BUO B;  3SIB A;  4HRE E;  3TDZ A;  2O5G A;  4WRI A;  1OMV A;  1LA0 A;  2BE6 A;  1ZMZ A;  2KI6 C;  1DJI A;  3ICB A;  4N5X A;  3VRQ A;  3RLZ A;  1CFF A;  1YUS A;  2HQW A;  2ZN8 A;  1OOJ A;  4PDZ A;  1EG3 A;  2K8M B;  3SJS A;  2L51 A;  5D69 A;  1QX2 A;  3EVR A;  1H8B A;  4DRW A;  1J7Q A;  1XA5 A;  1AJ5 A;  1XYD A;  2L5X B;  2SAS A;  1KFU L;  1DGV A;  1B4C A;  1SCM B;  3PFV A;  2BBM A;  1J55 A;  1L7Z A;  1N2D A;  3GK2 A;  1SL9 A;  2AMI A;  1K96 A;  1BG1 A;  1G33 A;  4L9M A;  3VRN A;  1FF1 A;  2DOQ A;  2CTN A;  4FQO A;  2LVI A;  4IL1 A;  1BOD A;  1NYA A;  1AHR A;  1TNW A;  3EK8 A;  5B8I B;  5JOL A;  2KAV A;  4GGF A;  3OX5 A;  1N65 A;  1LKJ A;  4MZL A;  1MUX A;  4F0Z B;  3BOW A;  4PE1 A;  2PAS A;  5HKY A;  4GGF C;  3SG4 A;  4Q04 A;  1S5G Z;  3HX4 A;  1ODB A;  1QV1 A;  1IQ5 A;  1B47 A;  1OMD A;  2JXC A;  1KK8 C;  2L98 A;  3NSK A;  2B1U A;  1NCZ A;  1QLK A;  2L50 A;  4JPZ B;  1XFY O;  1DGU A;  2KYC A;  2O60 A;  3O78 A;  1YVL A;  1GJY A;  3SG7 A;  4C0K A;  2AUC A;  2LLU A; 
#chains in the Genus database with same CATH topology
 4GKG A;  2JP3 A;  2R5D A;  1CMF A;  4PE7 A;  1SL7 A;  1SCM C;  3H1H D;  2FYU K;  1W9Z A;  4L75 A;  1QX5 B;  3RL0 D;  1QL1 A;  5KLI B;  3VRR A;  2E5T A;  3CWB E;  1SFC B;  1AVY A;  2LC5 A;  2O01 J;  1YTZ C;  1OOI X;  1DMO A;  5AW4 B;  4OGQ D;  1NIW A;  1G8I A;  2ZYG A;  1IG5 A;  2KDH A;  4D6T D;  2H2K A;  2XU6 A;  3TDK A;  1JUO A;  3H1L D;  4M3L A;  5CCH C;  1A29 A;  1EXR A;  3TUY B;  1L4A A;  1PGO A;  1H88 A;  3TGU G;  2JWD A;  5E79 E;  1IKU A;  2J59 M;  2WCB A;  5KLI C;  1KQF B;  2E6W A;  1KQM C;  5B66 H;  1MXL C;  1DD4 A;  4OV2 A;  1ZRT E;  1M8O B;  4ORA B;  4OGQ B;  2BCX A;  2PSR A;  1BDD A;  4PJ0 H;  2ZVO B;  1UWO A;  3B88 A;  4L76 A;  4W7Z A;  2ZXE B;  1ZFS A;  1GDT A;  1IGV A;  2ZJS E;  2LM5 A;  2I18 A;  2BE4 A;  3LW5 J;  2E5Y A;  3GLM A;  4TLF A;  2LXC B;  1HTL C;  3V5B A;  1VQL P;  5J3X A;  4A7P A;  4OVN F;  3AE1 C;  4OH8 B;  4RES B;  4DOJ A;  1TNQ A;  3BFB A;  1VRK A;  4HJG H;  4GFT A;  2CK3 H;  1NTZ K;  2ZND A;  1EDJ A;  5E79 H;  3L75 D;  2QPT A;  1L0N K;  1XK4 C;  2FCE A;  2C0X A;  4N1G A;  3PN7 C;  1GD2 E;  1KFX L;  1J7P A;  1PP9 G;  3N7N A;  3L75 G;  2WSF H;  1URQ D;  1D1O A;  3WXA A;  1NVO A;  1GW3 A;  3G3Z A;  2P1J A;  2IZ1 A;  3S0G A;  5AVS B;  2Z5H A;  1SQP E;  1SBJ A;  2Q3E A;  2CCM A;  2V7Q J;  3BVH A;  1AQT A;  3JSV C;  2L5G B;  2WVR A;  3H6P A;  3EK4 A;  1SW8 A;  1HH0 A;  4D1E A;  1DC1 A;  2P58 A;  1UHI A;  2M1K B;  1KFN A;  2YIU B;  5APU A;  3K5B A;  1YX7 A;  1GGZ A;  2KPH A;  1IJD B;  3JVT C;  2WC8 A;  4QJ5 B;  3IR9 A;  2LHI A;  2H88 C;  1NU1 D;  1OW6 A;  3A5T A;  3GHG C;  2EHB A;  3C9I A;  5AVQ B;  1WY9 A;  3U1A A;  2F2P A;  2L5Y A;  5TNC A;  3NMD A;  3TGU J;  1A02 J;  2ZT9 B;  2BAS A;  1S6C A;  3WMM 0;  3HE5 B;  2LMU A;  2TN4 A;  2OS8 C;  3TNU A;  2V53 A;  2OQQ A;  1IFP A;  2EC6 C;  3P32 A;  1EDK A;  4MN4 C;  3A0B H;  1PVB A;  1SKT A;  1KYO I;  3O6Q B;  3H1J J;  3HD7 B;  3KYQ A;  3OJA B;  1OOF A;  1KSO A;  3CWG A;  3L74 J;  5APY A;  1F71 A;  2G8Y A;  1SSE B;  2WZ7 A;  3M91 A;  3O6B A;  3IAO A;  3CX5 E;  3CYZ A;  3L70 J;  1Q2N A;  2F8P A;  1JMM A;  4PHJ A;  1OOG A;  4OCI A;  4XA4 A;  4W80 A;  3R72 A;  3GF3 A;  3PJS K;  2Q91 A;  3VMY A;  2FJU B;  1MFZ A;  4GNK B;  4MEW A;  3IQQ A;  2H7H A;  3HD7 C;  3P8M C;  3RGU A;  3VRO A;  1F70 A;  4KT0 J;  2ISD A;  3VMX A;  1KQG B;  3CWB J;  1RRO A;  1KN7 A;  1KMI Z;  2NPS A;  3VTP C;  2A45 G;  3DF0 B;  1BJF A;  1IFD A;  1L0N J;  1VQ7 P;  1FS0 E;  1PK0 D;  4XJK B;  4EDF A;  3TS5 C;  3KQG A;  1LJ2 A;  1ZR4 A;  2M0B A;  4JKT A;  3EFF K;  3GOF A;  5GQQ C;  4U3F D;  1B7T Y;  1VPC A;  3QRX A;  1NTM G;  1Y1A A;  2MAZ A;  2ZT9 C;  2WQY C;  2HPC B;  5CSF A;  3DVM A;  2KNC A;  2AEM A;  3DVE A;  2R32 A;  1LTJ A;  2AXT H;  3G6E P;  3A0H H;  2KXP B;  2G9B A;  1OZS A;  1M90 Q;  1PGJ A;  2I1J A;  1N73 C;  3AE7 C;  1SQX K;  3RK2 B;  1BGY J;  2SPZ A;  4LC1 A;  4Z1M H;  5CPV A;  1JB0 J;  1BMO A;  1S72 P;  1XFR A;  5HYD A;  5L8R J;  3LL8 B;  2JUL A;  2KHN A;  3Q1M A;  1R2U A;  2ZN9 A;  3BCC E;  3FE8 A;  3IN6 A;  5AVV B;  3D6Y A;  2ZNE A;  3R2P A;  3L47 A;  1NTM K;  1GZL A;  1GL2 C;  5H2F H;  2WSE J;  2YO2 A;  1ZXG A;  4UPG A;  3OB1 B;  2PVB A;  1KB9 I;  2QRX A;  2YXQ B;  1MV8 A;  1JFJ A;  2KNE A;  2OYI B;  1OWA A;  4WY4 C;  3QME A;  1U5I A;  3U59 A;  1LP1 A;  4BY4 A;  4I6M C;  2BCB A;  2H8P D;  3BUN B;  2ZYD A;  1NYH A;  3D76 A;  4ICB A;  2JWW A;  2LUC A;  1KWO B;  2LVV A;  1L4A C;  3L72 D;  1GL2 D;  2N1T D;  1SY9 A;  3D74 A;  3PRJ A;  3NFQ A;  5FI7 A;  1RHZ B;  2KIK A;  3LID A;  1OVR A;  4AUW A;  5APW A;  4D6T G;  3CS1 A;  4FQT A;  1QWV A;  2B9B A;  3MSE B;  1IC2 A;  1S6J A;  5KU1 A;  2FYN B;  1HGZ A;  1WT6 A;  5PAL A;  3CCE P;  1KV4 A;  4OWF A;  3JCU E;  1DJX A;  3L4A A;  1L4A B;  3L71 D;  2JU0 A;  4IJ7 A;  4C0J A;  1NX3 A;  5HLV A;  1KCY A;  1SLQ A;  1M31 A;  2QJY C;  3F89 A;  4AQI A;  1M1J A;  3FIA A;  3L70 E;  1OW8 A;  5CSN A;  2FOT A;  2JT3 A;  2KYF A;  2PQL A;  2FYU D;  3H1I D;  4ASV A;  1IWQ A;  1NU1 J;  3A4U B;  3N4X A;  2KI7 B;  4IL6 E;  2WSE H;  2L4H A;  5F6T A;  3L73 E;  3SWY A;  1YUR A;  2QIW A;  1PGQ A;  1NTM E;  2LVJ A;  1MXE A;  3CX5 H;  1G4Y R;  1R8E A;  4NPF X;  3AE4 C;  1J1E C;  1NAF A;  1SYM A;  3AEG C;  2WPV B;  3SG2 A;  1SQB K;  1QXP A;  1NTK D;  1RH5 B;  2QEX P;  2Y9Y A;  1ZP0 C;  2RGI A;  5AVW B;  1GK6 A;  1JMB A;  3O2P A;  1S5L X;  2GUV A;  2EGD A;  3TGU D;  4UB8 H;  1JCC A;  3CX5 I;  1EXI A;  3I55 P;  1DH3 A;  1TNX A;  1AFO A;  5B5E H;  1L0N D;  1FZF A;  3H4S E;  1WMK A;  2HYN A;  1DEE G;  1NTK G;  4ASW A;  2H89 C;  1CDM A;  3H1J D;  4HSZ A;  1K93 D;  1JCD A;  1IJ6 A;  1Z4H A;  4ZCU A;  4H0L B;  3OGN A;  3A3Y B;  2MA2 A;  2PMY A;  3NSO A;  3PHL A;  2VRG A;  2KS1 A;  1QVI Z;  1CLL A;  2IX7 C;  1QV0 A;  1KD1 Q;  5DKR A;  4AYC A;  1Y8A A;  3MGN A;  1SQQ G;  3HE5 A;  1PIX A;  1LA0 A;  3PTZ A;  2KI6 C;  2FYU G;  5BVZ A;  3Q5P A;  1DX7 A;  1KIL D;  2FXP A;  1K9M Q;  1SQQ D;  1QX8 A;  2RMZ A;  1HJ0 A;  3B71 A;  3EVR A;  1H8B A;  3CWB D;  3O6Q A;  3HD7 A;  1FDM A;  3RZS A;  2O01 H;  1AJ5 A;  2NPS D;  2SAS A;  1DGV A;  3CZ2 A;  1B4C A;  1RE4 C;  1URQ C;  3R1V A;  3FWN A;  2KSJ A;  1J55 A;  5AW6 B;  2E43 A;  1SQX G;  1OMI A;  3TF5 A;  1BOD A;  3S4R A;  1AHR A;  3CC4 P;  2YO3 A;  1ZW0 A;  3OX5 A;  1N65 A;  1LKJ A;  4MZL A;  4ZKP A;  1K05 A;  4GGF C;  2FJY A;  4Q04 A;  3L70 G;  1ODB A;  2WC6 A;  2O01 N;  3NSK A;  1FZC C;  1NCZ A;  2NPS B;  4R4L A;  4JPZ B;  1HBW A;  3V4W A;  5KLV E;  2JXL A;  2Q4U A;  3CL3 D;  1HF9 A;  1AQ5 A;  4AOM A;  1LNQ A;  3RK3 D;  2HPC A;  4GDO A;  1OZH A;  1NKN A;  1VQP P;  4U3F G;  4ZMD A;  3CMA P;  4P5O E;  5APQ A;  2K7C A;  2V7Q H;  2FY8 A;  3QWO C;  5CCH D;  2PAJ A;  1G1J A;  5AXI A;  1DTL A;  1JTH B;  2P7J A;  1FU1 A;  3MIW A;  4MVF A;  2FCD A;  1RF1 C;  2K2F A;  5APT A;  2B89 A;  2BKH B;  1QTX A;  1U7M A;  1YUT A;  1S9K D;  4GOD A;  1SQV D;  1M63 B;  1M39 A;  2H61 C;  1NH4 A;  3RK3 C;  4E68 A;  1QLE D;  1DF0 B;  4OKH A;  2ZYA A;  1P84 D;  1E8A A;  1QVG O;  3G4S P;  3M0A A;  1B8C A;  4YGC B;  5AVR B;  1HJB A;  1FOS F;  2BCC E;  1JF2 A;  3BXK A;  1M1K Q;  2JRF A;  2A45 H;  2OYI A;  2BL0 B;  1U5I B;  1LP1 B;  1KIL A;  2SCP A;  4NDC A;  1SR6 C;  1UHK A;  4PV1 B;  3NTN A;  1H89 A;  2JC2 A;  1FDI A;  2WPR A;  3I5F C;  4DUQ A;  1SQX D;  1Y9B A;  4YGB B;  2GM4 A;  3C8V A;  2EC6 B;  4BY5 A;  2B87 B;  2RKL A;  1KOR A;  1YUU A;  4TT3 H;  1N8R Q;  4JD9 A;  3EWK A;  3L72 G;  4OR9 B;  2HR3 A;  2LKM A;  2C9L Y;  1OW7 A;  1KYO H;  3GF7 A;  1FJK A;  4MN0 A;  5KTB A;  5TIS E;  1VQN P;  1ORG A;  3I5G B;  3B5N B;  2NXQ A;  1QAS A;  2YKO A;  1K2H A;  1KIL C;  4H44 D;  2L0P A;  2NRG A;  3L36 A;  2E30 A;  1DJY A;  5FYX A;  3AE9 C;  3H1H E;  1J1E A;  4EI2 A;  1M1J B;  2IZ0 A;  1ZRT D;  3IQO A;  4PD4 I;  1WRZ A;  3AAK A;  3AEA C;  3RM1 A;  1GK4 A;  4YGD B;  1ZLL A;  4H13 B;  4Y99 B;  3L71 E;  2OYO A;  1YJN P;  4BRY B;  3KZI E;  2OAR A;  5IBW A;  3B87 A;  3KF9 A;  2LMV A;  1LTS C;  4MRX A;  4CFQ A;  3KPX A;  1AA0 A;  3H1K E;  2F3Z A;  5KJ7 C;  5CCH A;  3BQ3 A;  1J1D A;  2FYZ A;  1DD3 A;  1BCC D;  3DYE A;  1B9A A;  1FE6 A;  3AKA A;  2CT9 A;  4M2O A;  1SQQ J;  3M9H A;  2KZJ A;  1YR5 A;  2M5A B;  1NTM D;  2IS9 A;  3L73 D;  1QGK B;  1CDP A;  3S1K A;  4F7F A;  1KSM A;  1UUS A;  3U1C A;  3Q3D A;  1PRW A;  3USS A;  1SQP K;  3DXL A;  2ZXX A;  3I5C A;  3FX0 A;  2JEE A;  5FI6 A;  2C9N Y;  1QIW A;  1TTX A;  1Y0V H;  5APV A;  2ZFC A;  5KKZ B;  1OX3 A;  1CLB A;  5AW8 B;  1TU3 F;  2JR8 A;  3RK2 C;  1S6I A;  4A4B A;  3BOW B;  1Q7Y Q;  3GK1 A;  2R3S A;  2JOJ A;  2L2C A;  4B86 A;  1JOC A;  1YJW P;  3VB1 A;  2COL B;  1ZUZ A;  2KI4 C;  1H4B A;  4CFR A;  2MKV A;  3CZ0 A;  1Y47 A;  1JC2 A;  4I5K A;  3LCP C;  3SG3 A;  4CPG A;  1RTP 1;  3DD4 A;  2NPS C;  1HUC A;  2G3A A;  2KS1 B;  5I2L A;  3CXH I;  2QSI A;  2E74 B;  2QVA A;  2I8D A;  1C3Y A;  1N2D C;  1UIX A;  5M1B A;  2D8N A;  4GOE A;  2KI6 D;  1OMR A;  1QAT A;  1FZC A;  1PSR A;  3JTD C;  1GMJ A;  2CXJ A;  3SFD C;  2OTG B;  1XTC C;  5KLV K;  1K8U A;  2JJL A;  4I2L C;  2LCP A;  4U3F J;  1AK8 A;  1QEX A;  2BKI B;  1CDN A;  1QS7 A;  4WVZ A;  4XFJ A;  1IFJ A;  4IFM A;  2XND H;  4H44 C;  3W68 A;  5TJH A;  1ALV A;  1YQ4 C;  2YNY A;  4MLW A;  1ZOY C;  2ZVN B;  2GUS A;  3TZ1 A;  1IFM A;  3CCL P;  3AEE C;  4MBE A;  3KEV A;  1FI6 A;  1BGY D;  3PN7 B;  5CCG C;  1BGY E;  1FOS E;  1TCO B;  3JC2 2;  1SQX J;  5HLO A;  2KFF A;  1DEL A;  2O1K A;  1S5L H;  1AUI B;  1SK6 D;  2YMY A;  3L74 G;  2RH0 A;  1QLS A;  3AEB C;  5AW3 B;  3EVU A;  2CPB A;  2PP6 A;  3LW5 H;  1X0T A;  3OB2 B;  1KB9 E;  5BU8 B;  3EQ2 A;  1GM0 A;  1L2O B;  1HT9 A;  1PSB A;  2OGU A;  3G9R A;  4IFD K;  1XFW O;  3JVT B;  2RN0 A;  3BAT A;  3BRT B;  4C46 A;  1LTB C;  2B88 A;  2BEQ D;  1S9K E;  2OYI C;  2WWW A;  1H8A A;  4ZKU A;  3WHU B;  2KB7 P;  1W2B O;  1N7S B;  3DZT A;  1JSA A;  1JTH A;  3Q2Y A;  2NCO A;  3DY9 A;  3L72 J;  1RJV A;  1HVV A;  3RL0 B;  2M3B A;  5B66 E;  2WCE A;  1SFC D;  2F3Y A;  4MSP A;  1KFX S;  1SS1 A;  3L71 J;  2AEF A;  4R1E A;  5KAI H;  1TNP A;  1BCC G;  1CDL A;  1DIP A;  1DF0 A;  3E1R A;  2BBN A;  2Y5I A;  1FZE A;  1MZ9 A;  3GHG B;  2A06 E;  1SP4 A;  1DQE A;  1LTJ C;  2AXC A;  1JNM A;  3S0E A;  1KK7 Z;  2K7B A;  1KIL B;  2Q9I A;  3L74 D;  4CPV A;  2M29 A;  1P84 E;  2QA4 P;  1MWN A;  3PM8 A;  1NCX A;  5KAF H;  3EKH A;  1LT9 B;  3P7K A;  2B87 A;  3H1I J;  1YIJ P;  3II6 A;  2HF5 A;  2QJY B;  1CMG A;  3S0B A;  3CPW O;  2KLU A;  3Q5R A;  3PLN A;  1NX1 A;  4BWN A;  2NLN A;  2A45 I;  3FGA D;  3KHU A;  3B5N A;  1EL4 A;  2KQ6 A;  2AAO A;  5I94 A;  3FXE A;  1XFU O;  1BDC A;  2KP8 A;  2WPQ A;  3A7O A;  2KSP A;  1LT9 C;  1M7L A;  1YIT P;  2WND A;  1J1E B;  3O8Z A;  3FE9 A;  3K21 A;  1JM0 A;  2KUB A;  2KBM A;  3NHT A;  4XYN A;  1S4X A;  2W90 A;  1L2O C;  1SQB G;  1EQ7 A;  1YVH A;  2YKP A;  4I5L B;  2E42 A;  1JY2 P;  2J5U A;  4K3A A;  1DJZ A;  2Q1K A;  3CME P;  3HE4 B;  2R2I A;  3VGO A;  5K89 A;  5B5E E;  2JKV A;  1AVO A;  2LLS A;  2M8U A;  4BRY A;  3CCS P;  3L4L A;  3BUO B;  3SIB A;  1GW4 A;  1QVF O;  1OMV A;  1FZA A;  3BAS A;  1DJI A;  3AE5 C;  3ICB A;  4N5X A;  1J1D B;  3AE8 C;  4WY4 A;  5GTH E;  1YUS A;  1YQ3 C;  1QX2 A;  1SQB E;  2ZT9 D;  1XA5 A;  3B7A A;  4JYB A;  2M5A A;  4PD4 E;  2KK7 A;  3AEF C;  2WCJ A;  2D2C C;  1E79 H;  1FZG A;  2BBM A;  1IFN A;  5AVZ B;  2KYV A;  1SL9 A;  1K96 A;  4JF7 A;  1M1J C;  1JUN A;  4L9M A;  3IVT A;  2DOQ A;  2CTN A;  2E76 C;  2LVI A;  3IFM A;  1OW4 A;  5JOL A;  4C7R A;  3WU2 E;  3RK2 D;  2KAV A;  4GGF A;  2V4H A;  3CCQ P;  1K8A Q;  1MUX A;  5CBO A;  3BOW A;  3MD0 A;  4YPC A;  3HX4 A;  4IOI H;  2JXC A;  1KK8 C;  4IL6 H;  1NTZ D;  1IIO A;  4WWI A;  2L50 A;  2O60 A;  2KYC A;  1VQM P;  3VN0 A;  1NTZ E;  1PFI A;  1GJY A;  3PJI A;  1PL5 A;  4WB4 A;  2QJP C;  4W7Y A;  3VP8 A;  3TDU A;  3SG5 A;  5AW2 B;  1KC8 Q;  1F55 A;  3M0D C;  3ZDM A;  2Y0D A;  3IF4 A;  3B4S A;  1RE3 C;  1B8R A;  1NU1 E;  3D0Y A;  2LNK A;  2MHH A;  4O9B A;  3V2N A;  1AJ4 A;  2WT7 B;  1W5C E;  2KAX A;  5HKZ A;  5KKZ C;  3H1L E;  1FZC B;  1SRA A;  4ETO A;  1LTA C;  2K0J A;  1G2C A;  2BCC G;  1L2P A;  3JCU H;  1REC A;  1TCF A;  1FI5 A;  4OGQ C;  2OPO A;  2JT0 A;  1JY2 O;  4JYC A;  1KTM A;  5GTI E;  1NKZ B;  3MZW B;  1Y1X A;  4I5J A;  1YYC A;  2JNF A;  5K5G B;  2K60 A;  1F4Q A;  2F33 A;  1A75 A;  4NDD A;  1AVS A;  2LV7 A;  1K9K A;  3M06 A;  3EVV A;  4I7Z C;  5FI2 A;  5D7F A;  4ZNC A;  1CFP A;  5AVU B;  1WLM A;  4OZD A;  5APS A;  1UHH A;  3GK4 X;  1PPJ E;  3M9B A;  1NGM B;  1L4A D;  2GGZ A;  3VYI A;  1BCC J;  1C3Z A;  1RWY A;  1SL8 A;  2HOD B;  1FJP A;  4JBZ A;  1J1D C;  3C1V A;  2KFG A;  1RFJ A;  1AV1 A;  2ERB A;  1DEK A;  3L35 A;  1UHN A;  1TUZ A;  1EZV G;  1LS8 A;  2P2U A;  1QL2 A;  1YTZ I;  1NX0 A;  1XVJ A;  3V2L A;  1MQ1 A;  3CAB A;  1ZOT B;  2HQ8 A;  2LHL A;  1AP4 A;  2P6B B;  5AW0 B;  1CM4 A;  3ITK A;  1WLZ A;  3A0H E;  3OW2 O;  5CBN A;  1RE3 A;  4KHX A;  4BXL A;  3FXD A;  1KK7 Y;  3L71 G;  3I5G C;  1N7S A;  1EH2 A;  3CLN A;  1OXZ A;  4NQG A;  5EL2 A;  2WPS A;  3OHM B;  3BCC J;  4JQ0 D;  1LTT C;  4JWQ A;  4C0L A;  4PCW A;  2IYP A;  5AVY B;  2BCA A;  1JY3 P;  4EYY Q;  1JF0 A;  2M3E A;  4N1F A;  3L73 G;  3WU2 H;  1LA3 A;  2L2E A;  3GHG A;  1UHJ A;  2K3R A;  2XZR A;  4YGE B;  3L4F A;  2H8V A;  2HFE D;  1J2J B;  1VQ5 P;  3FS7 A;  4Y99 C;  1LXF C;  1NPQ A;  3UIA A;  3H1I G;  3B5N C;  1NX2 A;  5KTY A;  3L70 D;  1EDL A;  4I5N B;  3BUX B;  1SQP J;  2L91 A;  3AED C;  3MTU E;  4UB6 E;  1EXJ A;  1ALW A;  2FFD C;  2YIU C;  2ITA A;  1GGW A;  2LMT A;  1LT9 A;  1G1I A;  3D6Z A;  3MUD C;  1K94 A;  2MJW B;  2D2C B;  1LWU B;  1C07 A;  1EZV D;  1PP9 E;  5CJ0 A;  5KLV J;  3T97 A;  1F4O A;  2JPT A;  2H61 A;  2KBI A;  3EFG A;  2PRU A;  5D3O A;  1BE3 E;  4MRY A;  2IFN A;  2Q6Q A;  1X22 A;  4PAL A;  4N78 E;  1YJ9 P;  1MR8 A;  1K95 A;  3VOP A;  2Y0C A;  3TDI A;  3CLQ A;  3CR5 X;  3I5F B;  3L37 A;  2A4J A;  1IK9 A;  1NSH A;  2XNX A;  2M1U A;  3ZWH A;  2N1T C;  1VQ8 P;  1CNP A;  1OZO A;  2A06 D;  3P8C E;  1NO4 A;  1PGP A;  5AW7 B;  3HE4 A;  2QEB A;  1KQL A;  3OBV A;  1W2E A;  1JO5 A;  3NXA A;  1TN4 A;  1BLQ A;  2E74 C;  2Q7C A;  3CD6 P;  1X9V A;  4IFF A;  1E5W A;  2K37 A;  5AEQ A;  1S2E A;  1NTK J;  1IO4 A;  2JZI A;  1N7S D;  2GA1 A;  2KI4 B;  3RL0 g;  4WY4 B;  4C7N B;  3CCM P;  3LLE A;  1CI6 B;  4YI9 A;  4QMA A;  1P84 H;  4YI8 A;  1RF1 B;  4ZCV A;  3OA7 A;  1S3P A;  3L72 E;  3PP5 A;  2R44 A;  2KGB C;  1FDO A;  1XO5 A;  2O3J A;  1J7O A;  1YRT B;  2QM8 A;  1PUL A;  2GTE A;  3S0D A;  1HQV A;  4WQ3 A;  2K2A A;  4GUK A;  2WCF A;  2M3W A;  1SMG A;  5AAN A;  1TRF A;  4PJ0 E;  2LAN A;  2CNP A;  5KAI E;  3H1H G;  4I7Z B;  1N0Y A;  2OYH A;  1K73 Q;  2LXB A;  5DIC A;  2FYN C;  1M46 A;  2JPO A;  1T3J A;  2WIT A;  3SWK A;  4HKZ H;  3BJH A;  1VL2 A;  1VF5 C;  1XFV O;  1Y1U A;  2ZRS A;  3WUT A;  3S9O A;  5KJ7 D;  1GU4 A;  1FZB A;  4CID A;  2P71 A;  5APX A;  5CSI A;  2GV5 A;  3RBZ A;  3CCU P;  1URQ B;  4QJ3 B;  2K88 A;  3CDN A;  2I2R E;  1NTK K;  3D78 A;  3E7K A;  2HG5 D;  3H1I E;  2K61 A;  1T8Z A;  5I8N A;  1BCC E;  3D0Y B;  3FE6 A;  2WT7 A;  2M97 A;  1NAY A;  2WCM A;  2HPS A;  2K9Y A;  3BFH A;  3KHE A;  2JQ6 A;  3F45 A;  2BCC D;  2YMK A;  3H1K J;  1G2C B;  3E3R A;  1RF0 A;  4MZK A;  3WNX B;  1DVI A;  4M2P A;  1NU1 K;  3SG6 A;  1QIV A;  3HUS B;  3R1O A;  2BNX A;  1NOH A;  3CZ1 A;  4Y28 J;  3F5H A;  4YRU A;  1ZR2 A;  1A75 B;  1YTZ T;  1BR4 B;  5CMZ A;  3Q5S A;  1DJW A;  1KB9 H;  4DS7 A;  1RQV A;  3KO0 A;  2IFM A;  4I1L A;  1IH0 A;  1YRU B;  1UII A;  4P2Y B;  3VMZ A;  2P10 A;  4N6J A;  2HOD A;  2I1K A;  2MLE C;  1X8Y A;  1KFM A;  1TOP A;  1NCY A;  1ZAC A;  3NSL A;  1EDI A;  1EG4 A;  3B8E B;  3VRP A;  2WMM A;  3SFE C;  1BT6 A;  4IL6 X;  4RJT A;  4USL A;  4QJ4 B;  1VQO P;  3ZNI A;  1BE3 J;  3TK1 A;  2N9B A;  5CHX A;  2QE7 H;  1NUB A;  3CGA A;  1GQM A;  1T3U A;  3AEC C;  1L0N G;  1KQS O;  1LTI C;  1SQX E;  4WQ2 A;  2IYO A;  3CXH H;  2OTG C;  1IQ3 A;  4DCK A;  5AVX B;  2KQY A;  3V6I A;  1L0L J;  3L73 J;  1OE9 B;  1B8L A;  3H1J E;  1S1C X;  3DVK A;  1ZN5 A;  4UB6 H;  1X02 A;  3UO9 A;  1RK9 A;  1NJI Q;  1Z2C B;  1A02 F;  5AVT B;  4DJG A;  3B5N D;  1TUJ A;  3SS3 A;  3H32 B;  3H1K G;  2FFD A;  2JT8 A;  2N9Y B;  1Q81 Q;  2XDJ A;  3CCJ P;  3UNW A;  1GTW A;  1U57 A;  3CR2 A;  1VQK P;  1BGY G;  5BU5 A;  3FWB A;  1KQM B;  3SS4 A;  1SQV E;  2LAP A;  1A03 A;  2IBZ G;  1C7W A;  3HD7 D;  1M45 A;  1DJG A;  1CKK A;  4YXD C;  4HRE E;  2FXO A;  2O5G A;  2BE6 A;  2K1A A;  1USE A;  1ZMZ A;  3RLZ A;  2Q3I A;  3MHV A;  3L75 E;  1CFF A;  2O1J A;  2WCL A;  2K8M B;  3SJS A;  3CCR P;  2L51 A;  5D69 A;  3VMA A;  3CC7 P;  1J7Q A;  1T14 A;  1SQV K;  4N78 D;  1LWU A;  3B6X A;  1XYD A;  3KZI H;  3T97 B;  2KLD A;  1SCM B;  3PFV A;  1L0L K;  1L7Z A;  1BG1 A;  2AMI A;  1G33 A;  3VRN A;  4IL1 A;  1NYA A;  3EK8 A;  1HGV A;  1ZME C;  2PAS A;  5HKY A;  1JEK A;  3CXH E;  1YHQ P;  1S5G Z;  1IFI A;  1PZQ A;  2W6B A;  3SWF A;  1YBK A;  3ABV C;  3RL0 C;  2IBZ I;  1XFY O;  1DGU A;  3O78 A;  3V2Q A;  1YVL A;  2AUC A;  1KYO D;  3PM2 A;  4NPD A;  4D6T J;  3W67 A;  1KYO E;  2LVK A;  2F2O A;  3HTK A;  4ORB B;  1R5L A;  1XFX O;  3D70 A;  3A8R A;  2Y9Z A;  1VQ4 P;  4C7N A;  1QVI Y;  1CI6 A;  1LIN A;  2E74 D;  2ZRT A;  1XFZ O;  1RF1 A;  5KJ7 A;  2KOT A;  1WRK A;  1K9P A;  1UP5 A;  3L74 E;  3WHT B;  1EZV E;  1PP9 D;  2Z5I A;  1CZQ A;  1FW4 A;  3VRQ A;  2ZKM X;  4GIF A;  5JJG A;  2PRR A;  3CXH D;  5HL1 A;  2I94 A;  1N7L A;  1YX8 A;  2QDI A;  5KLV D;  3IF7 A;  3BYA A;  2OYH B;  1BOC A;  2KZI A;  1C7V A;  1GL2 B;  1S26 D;  1HWT C;  1PAL A;  1CFD A;  3R4Y A;  1VQ9 P;  4YTP C;  2P70 A;  1FBM A;  5C39 A;  1MUU A;  1CLM A;  4PE0 A;  1YI2 P;  3PH0 A;  1OIP A;  1LWU C;  1H0T B;  3CR4 X;  3TGU E;  2P67 A;  1RE4 A;  1URQ A;  2A06 G;  2K9J A;  2QG4 A;  1MF8 B;  5DKN A;  2LE9 B;  2POH A;  2Z4E A;  2QEH A;  2E76 D;  4GGN A;  1CB1 A;  3WUU A;  2N1T A;  1DJH A;  4TNC A;  3HCM A;  4GPL B;  1JY3 N;  1FPW A;  1XK4 A;  4PD4 H;  4RO0 A;  2UWJ E;  2XV5 A;  3PAL A;  3CI9 A;  5BPJ A;  3G71 P;  1M57 D;  1JY3 O;  3EG5 B;  2OYH C;  1USD A;  3HUS A;  3RBX A;  2J58 A;  2I7A A;  3B86 A;  3BCC D;  4DZO A;  1PVA A;  4PHM A;  3V2P A;  3PAT A;  1IJ5 A;  4PHN A;  1M56 D;  2KLV A;  1CM1 A;  1S1E A;  1L0L G;  2LR2 A;  2VRS A;  2E76 B;  1BE3 D;  2NZ2 A;  2OTJ P;  2W8Z A;  1N86 A;  4EOT A;  1SQQ K;  2Y0E A;  3GW6 A;  3SSU A;  3A2A A;  2QJK B;  2QEV A;  3NXS A;  4INW A;  5I2O A;  2FYU J;  5AFP A;  4GBA A;  4YBH B;  3KXD A;  2KLE A;  3NHI A;  2M8R A;  4LGD E;  2JTT A;  4ORC B;  4DIR A;  1BE3 G;  4WY4 D;  3P8C D;  3H1L J;  1LT1 A;  1MHO A;  1K90 D;  1B7T Z;  4D6T E;  2MBX A;  1N73 B;  1CTR A;  2GGM A;  2M9G A;  2L4I A;  4HH2 A;  2OTK E;  1JWD A;  2AEJ A;  2CPS A;  2XKM A;  2WCH A;  3D75 A;  3K1E A;  1OOH A;  2KFH A;  2ZFD A;  2BAP A;  2PAL A;  5DKQ A;  1RF0 C;  3BRV B;  3LK0 A;  4KJM A;  4H0L D;  5KAF E;  3PSR A;  3GG2 A;  3KDP B;  1SCV A;  2MRD A;  3EKJ A;  4L73 A;  4HYT B;  1S5G Y;  2LP2 A;  2M0R A;  1AJY A;  3RK3 B;  2YKQ A;  1SQQ E;  3H32 A;  2FFD B;  2FKW B;  3V4Q A;  2LLT A;  4GOF A;  3BUM B;  5CJ4 A;  3CCV P;  2K7O A;  3I5I C;  1UUR A;  3BUW B;  3TUY C;  2Q5U A;  2LUX A;  1P84 I;  1LGH B;  1S3J A;  2W83 C;  4YGA A;  4L74 A;  4GAO A;  2W6A A;  2R5B A;  2OTL P;  2K7D A;  4M2Q A;  1SQB J;  2Y1M A;  2PGD A;  2QAC A;  1JFK A;  1KFU S;  2JTZ A;  1CSB A;  1VDF A;  1SFC A;  1R6P A;  1IK7 A;  2BEZ F;  5CCG A;  3EK7 A;  3D73 A;  4UB8 E;  1SFC C;  1NTZ G;  3Q8I A;  4N3Y B;  3LIE A;  1S36 A;  5HKW A;  1WRG A;  4PHK A;  1FC2 C;  5CSJ A;  1SR6 B;  4PV1 C;  2OS8 B;  3SS5 A;  2NZ0 A;  1EC5 A;  3OP0 A;  3MUD A;  1NU1 G;  4KYN A;  4AQR D;  2JNX A;  2LP3 A;  1RY3 A;  3H1L G;  1WDC B;  1K9U A;  2CBL A;  4K35 A;  2DW3 A;  2WCK A;  1D7M A;  1BR1 B;  4PV1 D;  1KWO C;  2KAY A;  4FTG A;  5EFW B;  1Z56 A;  2JDI H;  4LLH A;  1WRL A;  2QM7 A;  1ZV8 A;  4DT0 A;  1OQP A;  3D10 A;  3FWC A;  3HUS C;  3QH9 A;  1DEB A;  3V2R A;  1VF5 D;  2Y4Q A;  1L0L E;  5ER5 A;  4CLN A;  1V1G A;  4U3F E;  1LTG C;  3AE3 C;  2KSE A;  1L0L D;  2W6J H;  5AW1 B;  1S5L E;  3KPE A;  1QJT A;  1IRJ A;  2WOS A;  1SPY A;  4PE4 A;  4WBA A;  2R3C A;  3BCC G;  1KK8 B;  3N7H A;  3NGV A;  1PP9 J;  2H43 A;  4A4C A;  1A2X A;  3HTK B;  2M7N A;  4AQJ A;  3O4Y A;  2NCP A;  3CZT X;  5AW9 B;  1T2K C;  3CTN A;  1V1F A;  1PPJ D;  4PT1 A;  2WTY A;  4U7J A;  3OX6 A;  1XTG B;  1BF5 A;  1VF5 B;  2WSF J;  2W27 A;  1BSH A;  1W7I B;  3I5H C;  3JTD B;  4NDB A;  2Y1N A;  2HLO A;  2M49 B;  2PYQ A;  3M0W A;  2IPP A;  1MFT A;  2IBZ D;  4H0L C;  3DVJ A;  2JWA A;  1U7J A;  1X79 B;  3MP7 B;  1Q80 A;  3TSI A;  3D77 A;  1F8H A;  5AW5 B;  5G08 A;  1WDC C;  2KOG A;  3AE6 C;  3FWL A;  1R5S A;  3H1K D;  1OVU A;  2QJK C;  1KB9 D;  3PLF B;  1SQP D;  1DT7 B;  5GTI H;  3O4X A;  1Q86 Q;  2KGR A;  1EZV I;  5KSZ A;  4NPE A;  1GU5 A;  1P28 A;  1OSA A;  1SNL A;  2QEO A;  2WC5 A;  1GL2 A;  2BCC J;  1JY2 N;  2ZAE B;  5KLV G;  4HB1 A;  1J7R A;  5H2F E;  3H1J G;  1H0T A;  4R4M A;  3TNU B;  1T2K D;  2M7L A;  3AKB A;  3CC2 P;  1TIZ A;  1CW5 A;  2K9J B;  2BL0 C;  5ER4 X;  3L75 J;  2YGU A;  1NP8 A;  1KIL E;  3CX5 D;  3BFA A;  1Y6W A;  1F54 A;  3TYY A;  4H44 B;  3M9Q A;  3M0D A;  1W7J B;  2IDB A;  1JBA A;  3I5I B;  1CFC A;  2N1T B;  1BU3 A;  3HRN A;  4U8D A;  3VP9 A;  1A4P A;  2BEC A;  4INX A;  1SQV G;  3E1I A;  2WSS H;  2IBZ E;  1EJ3 A;  3S0A A;  3I5H B;  2G2B A;  4HRH A;  1BSN A;  1FBV A;  1NWD A;  5DJT B;  2FBW C;  1OFC X;  1K04 A;  3SIA A;  2AXT E;  4H13 D;  4MZJ A;  2WOR A;  1IZN B;  2WSC J;  1T6A A;  1PV3 A;  5AER A;  2C0W A;  2D2C D;  1NWQ A;  1NHL A;  1OVV A;  2E75 B;  4RKU J;  2MLF C;  5I2Q A;  1QX7 A;  3AAJ A;  4H13 C;  1KQV A;  3TS5 B;  3LK1 A;  1TWO A;  3DF0 A;  3S0F A;  3H25 A;  4XJK A;  1B1G A;  4GT1 A;  2JO1 A;  2QJP B;  3NSI A;  4HRG A;  5GTH H;  3AE2 C;  1LVC D;  2HET A;  3TDZ A;  4WRI A;  2KNC B;  3RK3 E;  1LTJ B;  3A0B E;  4PD4 D;  1NTK E;  2E75 D;  1NTM J;  3H1H J;  3OAK A;  1N73 A;  2HQW A;  3I56 P;  2ZN8 A;  1OOJ A;  4PDZ A;  1EG3 A;  1SVF A;  4DRW A;  1VQ6 P;  2YXR B;  2FXM A;  1SQP G;  5TIS H;  2L5X B;  1KFU L;  2WSC H;  3GMA A;  1NTZ J;  1L0N E;  5DJU B;  1N2D A;  3GK2 A;  1MKM A;  3C1L A;  2MJZ A;  1SQB D;  1FF1 A;  1N7S C;  4FQO A;  1Q90 D;  1TNW A;  5B8I B;  3R1P A;  3CWB G;  4XE5 B;  4EIJ A;  2FYU E;  5CCG D;  4F0Z B;  4PE1 A;  1RQU A;  1PPJ G;  3SG4 A;  2E75 C;  1KZU B;  1SQV J;  3D71 A;  1QV1 A;  2PFX A;  1IQ5 A;  1B47 A;  1OMD A;  2L98 A;  2B1U A;  1QLK A;  3WUV A;  1FAV A;  4YXW H;  1Q82 Q;  3SG7 A;  4C0K A;  2LLU A; 
#chains in the Genus database with same CATH homology
 2JXL A;  2Q4U A;  1CMF A;  2LVK A;  2F2O A;  4PE7 A;  4AOM A;  1SL7 A;  4ORB B;  3SG5 A;  1SCM C;  3TDU A;  1F55 A;  1XFX O;  1QX5 B;  1B8R A;  3D0Y A;  2LNK A;  2MHH A;  3VRR A;  1AJ4 A;  2KAX A;  5HKZ A;  3A8R A;  4P5O E;  2K7C A;  2LC5 A;  2Y9Z A;  1YTZ C;  1DMO A;  1SRA A;  4ETO A;  1NIW A;  1G8I A;  1QVI Y;  2K0J A;  5AXI A;  1LIN A;  1DTL A;  1IG5 A;  2KDH A;  1XFZ O;  2ZRT A;  1REC A;  1TCF A;  2H2K A;  1FI5 A;  2OPO A;  2JT0 A;  1JUO A;  4MVF A;  2FCD A;  2KOT A;  1Y1X A;  1A29 A;  1K9P A;  1WRK A;  2K2F A;  4I5J A;  1EXR A;  1UP5 A;  3TUY B;  2JNF A;  2BKH B;  3WHT B;  1IKU A;  1F4Q A;  2F33 A;  1QTX A;  1A75 A;  1YUT A;  1FW4 A;  2WCB A;  4NDD A;  1M63 B;  1M39 A;  1AVS A;  2H61 C;  1K9K A;  2LV7 A;  2ZKM X;  3EVV A;  2E6W A;  4E68 A;  5JJG A;  1KQM C;  1DF0 B;  2I94 A;  4OKH A;  5D7F A;  1E8A A;  1YX8 A;  1MXL C;  1CFP A;  1WLM A;  4OV2 A;  3IF7 A;  1UHH A;  3BYA A;  3GK4 X;  1BOC A;  4ORA B;  1C7V A;  1B8C A;  2BCX A;  2PSR A;  4YGC B;  1S26 D;  1UWO A;  1PAL A;  1CFD A;  2GGZ A;  1ZFS A;  1JF2 A;  1RWY A;  1SL8 A;  3BXK A;  1IGV A;  2JRF A;  2LM5 A;  2I18 A;  2BE4 A;  2BL0 B;  1CLM A;  4PE0 A;  3C1V A;  1U5I B;  2KFG A;  2SCP A;  4NDC A;  1SR6 C;  1UHK A;  1RFJ A;  2JC2 A;  5J3X A;  3CR4 X;  3I5F C;  4DUQ A;  4OVN F;  1UHN A;  1TNQ A;  4YGB B;  1VRK A;  1MF8 B;  2EC6 B;  4GFT A;  1NX0 A;  2ZND A;  2LE9 B;  5DKN A;  4BY5 A;  1XVJ A;  2QPT A;  1XK4 C;  1MQ1 A;  1YUU A;  4GGN A;  2FCE A;  1ZOT B;  2HQ8 A;  2LHL A;  4N1G A;  2P6B B;  3PN7 C;  1AP4 A;  1CB1 A;  1DJH A;  1KFX L;  1CM4 A;  4OR9 B;  4TNC A;  1J7P A;  3HCM A;  1WLZ A;  4GPL B;  1FPW A;  1XK4 A;  4MN0 A;  1D1O A;  3WXA A;  3I5G B;  1KK7 Y;  3I5G C;  3PAL A;  5BPJ A;  2NXQ A;  1EH2 A;  1QAS A;  3CLN A;  1SBJ A;  4NQG A;  1K2H A;  2CCM A;  2L0P A;  3OHM B;  2I7A A;  4JQ0 D;  4JWQ A;  4C0L A;  4PCW A;  2E30 A;  1PVA A;  1DJY A;  4PHM A;  5FYX A;  1J1E A;  2BCA A;  3EK4 A;  1SW8 A;  1IJ5 A;  3PAT A;  4PHN A;  1CM1 A;  1S1E A;  4D1E A;  1JF0 A;  1UHI A;  4N1F A;  2M1K B;  1LA3 A;  1YX7 A;  2L2E A;  1GGZ A;  3IQO A;  1UHJ A;  1WRZ A;  2WC8 A;  3JVT C;  4QJ5 B;  3AAK A;  4YGE B;  3RM1 A;  2LHI A;  4YGD B;  5I2O A;  2EHB A;  5AFP A;  3FS7 A;  4GBA A;  1WY9 A;  2F2P A;  5TNC A;  4YBH B;  1LXF C;  1NPQ A;  5IBW A;  3KF9 A;  2LMV A;  4MRX A;  1S6C A;  4CFQ A;  1NX2 A;  3KPX A;  5KTY A;  2JTT A;  4ORC B;  2LMU A;  4DIR A;  2F3Z A;  2OS8 C;  2TN4 A;  4I5N B;  3BUX B;  2V53 A;  3BQ3 A;  1J1D A;  1MHO A;  1ALW A;  1K90 D;  1B7T Z;  1GGW A;  2MBX A;  2LMT A;  2EC6 C;  2GGM A;  1CTR A;  1B9A A;  2L4I A;  2M9G A;  1PVB A;  2CT9 A;  3AKA A;  4M2O A;  1SKT A;  1K94 A;  1JWD A;  2MJW B;  1YR5 A;  1C07 A;  2KFH A;  2ZFD A;  2IS9 A;  1CDP A;  1KSO A;  3CWG A;  1KSM A;  1UUS A;  1F71 A;  1PRW A;  1F4O A;  2JPT A;  2PAL A;  2H61 A;  5DKQ A;  2KBI A;  3O6B A;  3LK0 A;  2PRU A;  2F8P A;  3PSR A;  1QIW A;  1TTX A;  1Y0V H;  4PHJ A;  1SCV A;  2MRD A;  4OCI A;  4MRY A;  1CLB A;  3EKJ A;  4PAL A;  1S6I A;  4A4B A;  1S5G Y;  2Q91 A;  3BOW B;  1MR8 A;  2FJU B;  3GK1 A;  4GNK B;  2LP2 A;  2JOJ A;  4MEW A;  3IQQ A;  1K95 A;  3TDI A;  2M0R A;  3VRO A;  3CR5 X;  1F70 A;  3I5F B;  2ISD A;  2COL B;  2A4J A;  2LLT A;  1ZUZ A;  2KI4 C;  1RRO A;  3BUM B;  1H4B A;  2K7O A;  4CFR A;  1NSH A;  2M1U A;  3DF0 B;  1BJF A;  1JC2 A;  3ZWH A;  3I5I C;  1UUR A;  3BUW B;  1PK0 D;  4I5K A;  1CNP A;  3TUY C;  4XJK B;  1OZO A;  3TS5 C;  2LUX A;  3LCP C;  3SG3 A;  1RTP 1;  3DD4 A;  4YGA A;  4GAO A;  5I2L A;  3GOF A;  5GQQ C;  1B7T Y;  2K7D A;  4M2Q A;  3NXA A;  1TN4 A;  3QRX A;  1Y1A A;  1BLQ A;  2MAZ A;  2Y1M A;  2QAC A;  5CSF A;  1JFK A;  1KFU S;  2JTZ A;  3DVM A;  5AEQ A;  1R6P A;  3DVE A;  3EK7 A;  2JZI A;  2D8N A;  2KI6 D;  1OMR A;  2G9B A;  2KI4 B;  1OZS A;  1QAT A;  1PSR A;  3JTD C;  2CXJ A;  2OTG B;  3LLE A;  4YI9 A;  1K8U A;  1S36 A;  5HKW A;  2LCP A;  4YI8 A;  4ZCV A;  5CPV A;  2BKI B;  1BMO A;  4PHK A;  1AK8 A;  1CDN A;  1S3P A;  5CSJ A;  1SR6 B;  5HYD A;  1QS7 A;  2OS8 B;  3LL8 B;  2JUL A;  2NZ0 A;  3OP0 A;  2KGB C;  2KHN A;  1XO5 A;  1R2U A;  2JNX A;  1YRT B;  1J7O A;  2ZN9 A;  1PUL A;  1ALV A;  2LP3 A;  4MLW A;  1WDC B;  2ZNE A;  1HQV A;  4WQ3 A;  2K2A A;  3TZ1 A;  1K9U A;  2CBL A;  4GUK A;  2WCF A;  1BR1 B;  4MBE A;  3KEV A;  1KWO C;  1SMG A;  2KAY A;  2M3W A;  4FTG A;  5AAN A;  1FI6 A;  1TRF A;  3PN7 B;  2LAN A;  1WRL A;  2CNP A;  4UPG A;  3OB1 B;  2PVB A;  1OQP A;  1N0Y A;  3D10 A;  1TCO B;  5HLO A;  3FWC A;  2KFF A;  1AUI B;  1M46 A;  1SK6 D;  2Y4Q A;  5ER5 A;  4CLN A;  1V1G A;  1JFJ A;  1QLS A;  3EVU A;  2KNE A;  1XFV O;  1Y1U A;  2ZRS A;  1U5I A;  4BY4 A;  4CID A;  1QJT A;  2BCB A;  3OB2 B;  1IRJ A;  5CSI A;  2GV5 A;  2WOS A;  3BUN B;  1SPY A;  4PE4 A;  1L2O B;  1HT9 A;  4ICB A;  1KK8 B;  1PSB A;  4QJ3 B;  2JWW A;  2LUC A;  4A4C A;  1KWO B;  1A2X A;  2I2R E;  2LVV A;  2K61 A;  1XFW O;  2M7N A;  4AQJ A;  5I8N A;  1SY9 A;  3O4Y A;  2NCP A;  3CZT X;  3JVT B;  3D0Y B;  2M97 A;  3CTN A;  1V1F A;  2HPS A;  3OX6 A;  3KHE A;  3CS1 A;  1BF5 A;  2JQ6 A;  3F45 A;  3MSE B;  3WHU B;  1W7I B;  3I5H C;  3E3R A;  1S6J A;  3JTD B;  4MZK A;  4NDB A;  3WNX B;  5KU1 A;  1JSA A;  2Y1N A;  1DVI A;  4M2P A;  2NCO A;  2M49 B;  1QIV A;  5PAL A;  3SG6 A;  3M0W A;  1RJV A;  2WCE A;  3DVJ A;  2F3Y A;  4YRU A;  1DJX A;  4MSP A;  1KFX S;  2JU0 A;  1Q80 A;  1F8H A;  4R1E A;  1NX3 A;  5HLV A;  1A75 B;  4C0J A;  1M31 A;  1KCY A;  5G08 A;  4AQI A;  1WDC C;  3FIA A;  1BR4 B;  1TNP A;  1CDL A;  1DJW A;  1DF0 A;  2BBN A;  2Y5I A;  3PLF B;  4DS7 A;  1DT7 B;  3KO0 A;  5CSN A;  2KGR A;  2FOT A;  5KSZ A;  2JT3 A;  2KYF A;  1IH0 A;  1YRU B;  1OSA A;  1SNL A;  1IWQ A;  4P2Y B;  1KK7 Z;  3A4U B;  1J7R A;  2MLE C;  1TOP A;  1NCY A;  1ZAC A;  3NSL A;  2K7B A;  1EG4 A;  2L4H A;  5F6T A;  4CPV A;  2M29 A;  1YUR A;  1MWN A;  2M7L A;  3AKB A;  3VRP A;  1TIZ A;  2BL0 C;  5ER4 X;  3PM8 A;  1BT6 A;  1NCX A;  1NP8 A;  2LVJ A;  1MXE A;  1Y6W A;  1F54 A;  4USL A;  3EKH A;  1G4Y R;  4QJ4 B;  1W7J B;  1SYM A;  3ZNI A;  2HF5 A;  1CMG A;  1JBA A;  3SG2 A;  3I5I B;  1CFC A;  1BU3 A;  1QXP A;  1NUB A;  3CGA A;  4U8D A;  1NX1 A;  1GQM A;  2Y9Y A;  2NLN A;  1A4P A;  2BEC A;  2RGI A;  3O2P A;  1EJ3 A;  3I5H B;  2EGD A;  2G2B A;  1EL4 A;  4WQ2 A;  4HRH A;  2OTG C;  1FBV A;  1NWD A;  1IQ3 A;  2KQ6 A;  4DCK A;  2AAO A;  2KQY A;  1OFC X;  1TNX A;  3SIA A;  1OE9 B;  1B8L A;  4MZJ A;  2WOR A;  1XFU O;  3DVK A;  1X02 A;  2KSP A;  5AER A;  3H4S E;  1RK9 A;  2WND A;  3K21 A;  2KBM A;  2MLF C;  5I2Q A;  4XYN A;  1CDM A;  1L2O C;  1QX7 A;  2JT8 A;  3AAJ A;  4HSZ A;  1KQV A;  1K93 D;  1YVH A;  3TS5 B;  1IJ6 A;  3LK1 A;  4I5L B;  3CR2 A;  4ZCU A;  3DF0 A;  2MA2 A;  2PMY A;  3NSO A;  3FWB A;  1KQM B;  4XJK A;  1B1G A;  2LAP A;  1A03 A;  1DJZ A;  2VRG A;  2R2I A;  3VGO A;  5K89 A;  3NSI A;  1C7W A;  4HRG A;  1QVI Z;  2LLS A;  1CLL A;  2M8U A;  1LVC D;  1M45 A;  1DJG A;  1CKK A;  2HET A;  1QV0 A;  5DKR A;  3BUO B;  3SIB A;  4HRE E;  3TDZ A;  2O5G A;  4WRI A;  1OMV A;  1LA0 A;  2BE6 A;  1ZMZ A;  2KI6 C;  1DJI A;  3ICB A;  4N5X A;  3VRQ A;  3RLZ A;  1CFF A;  1YUS A;  2HQW A;  2ZN8 A;  1OOJ A;  4PDZ A;  1EG3 A;  2K8M B;  3SJS A;  2L51 A;  5D69 A;  1QX2 A;  3EVR A;  1H8B A;  4DRW A;  1J7Q A;  1XA5 A;  1AJ5 A;  1XYD A;  2L5X B;  2SAS A;  1KFU L;  1DGV A;  1B4C A;  1SCM B;  3PFV A;  2BBM A;  1J55 A;  1L7Z A;  1N2D A;  3GK2 A;  1SL9 A;  2AMI A;  1K96 A;  1BG1 A;  1G33 A;  4L9M A;  3VRN A;  1FF1 A;  2DOQ A;  2CTN A;  4FQO A;  2LVI A;  4IL1 A;  1BOD A;  1NYA A;  1AHR A;  1TNW A;  3EK8 A;  5B8I B;  5JOL A;  2KAV A;  4GGF A;  3OX5 A;  1N65 A;  1LKJ A;  4MZL A;  1MUX A;  4F0Z B;  3BOW A;  4PE1 A;  2PAS A;  5HKY A;  4GGF C;  3SG4 A;  4Q04 A;  1S5G Z;  3HX4 A;  1ODB A;  1QV1 A;  1IQ5 A;  1B47 A;  1OMD A;  2JXC A;  1KK8 C;  2L98 A;  3NSK A;  2B1U A;  1NCZ A;  1QLK A;  2L50 A;  4JPZ B;  1XFY O;  1DGU A;  2KYC A;  2O60 A;  3O78 A;  1YVL A;  1GJY A;  3SG7 A;  4C0K A;  2AUC A;  2LLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...