4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
b'LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor 12
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
1DJZA 1QV0A 4GPLB 1PSRA 2A4JA 4M2QA 2OS8B 4TNCA 1ZACA 1DT7B 1UHIA 2KI4B 2NCOA 4HRGA 2K7BA 1S36A 4DIRA 2JXLA 4ZCUA 1OE9B 1DF0A 1K95A 2WCEA 1A75A 2LCPA 2JTTA 4C0LA 2BBMA 1C07A 4WRIA 3NSIA 2LVKA 1H4BA 4M2OA 2KNEA 2RGIA 4D1EA 3K21A 2FCEA 3TDIA 1JWDA 3PN7B 1B7TY 1K9UA 4PHNA 1EG4A 1J7RA 1GGZA 2FJUB 1AK8A 4IL1A 4JWQA 1AVSA 1J1DA 2PRUA 3OHMB 4ORAB 2LMUA 2O60A 3SG3A 1XFVO 1YUSA 1U5IA 2M3WA 3GK2A 1XFXO 2VRGA 4NDBA 2HF5A 5GQQC 1NIWA 3AAKA 3EKJA 2LLTA 2MJWB 3VRNA 1M31A 1NYAA 1FBVA 1DGUA 1DTLA 1S5GY 1SCVA 2JNFA 3M0WA 5B8IB 1QASA 1CM4A 3SG4A 4GGNA 4PHMA 1KK7Z 2L4HA 2DOQA 1MXEA 1BLQA 2ZNEA 3VROA 1XFYO 3BUOB 2M1KB 2Y5IA 4A4BA 3DF0A 3KPXA 1CMGA 2NCPA 2PVBA 5FYXA 2KYFA 4DUQA 2KAVA 5HKZA 1FPWA 1S26D 2SASA 3SG5A 1RECA 1JFJA 1OMDA 3JVTC 3DVKA 1F70A 1JSAA 1PALA 1YURA 5HKYA 3CS1A 1DJWA 5I2OA 1JF0A 2LP2A 3CWGA 1NSHA 1JBAA 5CSFA 1QJTA 1TNQA 4C0KA 3I5FC 1UHNA 3VRRA 1CDNA 1F8HA 2JPTA 2KQYA 3D0YB 4I5NB 1DJXA 3AKAA 2JWWA 1B8CA 5DKNA 3BXKA 4BY5A 1SL8A 1XO5A 4P2YB 1YX7A 3A4UB 2K8MB 4R1EA 3KEVA 4OCIA 2LHIA 1JF2A 2ZRTA 4QJ5B 1M63B 3VRPA 1LINA 2GGZA 3CLNA 2JC2A 4AQIA 1QATA 2Q4UA 1J1EA 2LVIA 4MRXA 2K61A 4CFRA 1FW4A 2WORA 4PDZA 1NX0A 1EH2A 3GK4X 1B4CA 2F2PA 2L0PA 3I5IC 3ZNIA 4DS7A 1DJIA 4YGCB 1PRWA 3DD4A 1HQVA 1IQ3A 1NX3A 1SPYA 4Q04A 3WNXB 1A29A 4AQJA 1JUOA 1CFDA 1EL4A 3JVTB 2PALA 1RFJA 1N65A 1S1EA 2M97A 2ZNDA 1DF0B 1IH0A 3NSLA 4C0JA 1IGVA 2HETA 1OZSA 1A75B 1WRZA 1SYMA 1BU3A 1QIWA 3JTDC 3I5FB 2ISDA 1TCFA 1KFXS 2NZ0A 1CLMA 1CDLA 2FCDA 2KI6D 1LA0A 3WHTB 3SG6A 1F54A 4JPZB 1AJ5A 3CZTX 1ZOTB 3IQOA 1DJGA 4GAOA 2JQ6A 2KGBC 1DJHA 2MLEC 2Y1MA 1BT6A 2CT9A 1TTXA 1XFWO 1C7WA 1QX2A 1B1GA 3SIBA 3TUYC 1U5IB 1B8RA 2LVVA 1SRAA 1CFCA 1DMOA 1B9AA 2I2RE 1S3PA 2F2OA 2M0RA 3TS5C 1HT9A 2LC5A 1XFUO 3PSRA 5DKQA 1QXPA 1SCMC 2F33A 4P5OE 1M45A 2BCBA 4AOMA 1BR4B 5CPVA 2JU0A 1G8IA 4OKHA 2HPSA 3LL8B 4FQOA 3I5IB 1K8UA 2COLB 3GOFA 2LE9B 1CNPA 1QV1A 1F4OA 4USLA 1EXRA 1IJ5A 2LAPA 3DF0B 1L7ZA 1TN4A 2LMVA 1NCYA 3GK1A 1GGWA 1WRLA 2ZN9A 1OOJA 3RM1A 1H8BA 1QVIZ 1ALWA 2LMTA 5KTYA 1SK6D 1UHKA 1CLLA 1IQ5A 3RLZA 3BUWB 3EK7A 1RK9A 4UPGA 1TIZA 2KFHA 3NSKA 1D1OA 3CGAA 2M8UA 1SMGA 2R2IA 1CDPA 4CFQA 1AJ4A 1K93D 2EC6C 2WCBA 1R6PA 1JFKA 2KYCA 3CR2A 4NDCA 1F55A 1OFCX 3I5HC 1W7JB 2LUCA 3JTDB 1CB1A 1OMRA 1YVLA 3O78A 4MBEA 1MF8B 2LLSA 2MAZA 4MVFA 3EKHA 5IBWA 1BODA 2KAYA 2V53A 3EK4A 3HX4A 1MXLC 4OV2A 4HRHA 1NX2A 1LA3A 1S6CA 2SCPA 1NP8A 3CR5X 1R2UA 2F3YA 4YGEB 2LHLA 1QX7A 1IWQA 5AXIA 2BECA 1RJVA 1X02A 3PLFB 2WC8A 2L51A 5CSJA 4I5JA 3TUYB 1NWDA 1WLMA 4ORBB 2F8PA 4MZKA 2Y1NA 4QJ4B 2G9BA 3TS5B 2CBLA 1UURA 3BUMB 1QX5B 3LCPC 1SCMB 5BPJA 2JZIA 1V1GA 3IQQA 1FI6A 1MQ1A 1ALVA 4HREE 3FWCA 1XA5A 2TN4A 3PALA 5KSZA 3LLEA 1LKJA 1OQPA 2MLFC 1SL9A 2B1UA 3SJSA 1UHHA 4M2PA 1YRTB 1XK4A 2NXQA 4MZJA 3FS7A 1B7TZ 1YRUB 2M1UA 2HQ8A 4PE1A 1EJ3A 3C1VA 2JTZA 1AHRA 1NUBA 2FOTA 1BOCA 4XYNA 1TOPA 1Y1AA 3DVJA 2JOJA 1CKKA 2KFFA 1K9PA 1KWOC 2LVJA 1CTRA 2OTGC 3NSOA 2EC6B 1S5GZ 2LP3A 1NCZA 3I5HB 2L98A 2WNDA 1Y1XA 2ZN8A 3NXAA 2WOSA 1K2HA 3EVRA 2PSRA 2GV5A 5ER5A 4YI8A 2I18A 1KQMC 1SW8A 2K2AA 3HCMA 1KCYA 1BMOA 4HSZA 2BL0C 1Y0VH 1E8AA 1NCXA 1KQVA 4I5LB 2M7LA 1GQMA 1DJYA 5AANA 1LXFC 4U8DA 1J7PA 1CLBA 4MRYA 1XYDA 1TRFA 1KK8C 1DVIA 1SR6C 1YUUA 3BQ3A 3PATA 3EK8A 1MHOA 1BG1A 5TNCA 1M39A 1K9KA 1UHJA 2H61A 2JXCA 2K7OA 2NLNA 1QLKA 3FWBA 3H4SE 4MN0A 4PALA 2LM5A 1MWNA 1A03A 2M7NA 1XK4C 2KGRA 1YR5A 1YUTA 3F45A 3EVUA 4GNKB 5JOLA 2L2EA 2M29A 2MRDA 3ZWHA 1FF1A 1JC2A 3FIAA 2Y4QA 1B47A 2E30A 4PHKA 1CFFA 3BOWA 1PULA 1F4QA 3ICBA 4ORCB 2AUCA 2M49B 2Y9YA 2P6BB 1A4PA 2I94A 5DKRA 1KWOB 2M9GA 1XVJA 1C7VA 2OTGB 4PE0A 4YGDB 1OZOA 4OVNF 1FI5A 3DVMA 1B8LA 2ZRSA 1PK0D 1G33A 3WHUB 1Q80A 3DVEA 1BF5A 5G08A 1G4YR 4CPVA 2BE6A 2H2KA 4MLWA 4GFTA 1KQMB 2QACA 4N1FA 5CSIA 4OR9B 4GBAA 1PSBA 1KFUS 2BBNA 2KAXA 2BL0B 1ZFSA 3WXAA 2LUXA 4L9MA 2KSPA 1KFXL 2AAOA 1SBJA 2BKHB 4CIDA 5KU1A 2E6WA 4WQ3A 2MBXA 1IRJA 4WQ2A 1BR1B 1ODBA 3CR4X 2K7CA 4PE4A 3VGOA 2ZKMX 1KK8B 1ZUZA 5HKWA 1SR6B 2LV7A 4YRUA 5ER4X 2IS9A 4YGAA 4NDDA 1XFZO 3TDZA 2JRFA 5HYDA 3KHEA 4XJKB 2QPTA 2H61C 2L4IA 2BE4A 3BUNB 4N5XA 5I2QA 4E68A 2KBMA 3O2PA 3I5GC 2EGDA 2ZFDA 1UP5A 2F3ZA 2KOTA 3CTNA 3TZ1A 1GJYA 2CCMA 1QLSA 3PFVA 4JQ0D 4FTGA 3OP0A 4QJ3B 3EVVA 1UWOA 5PALA 2L5XB 1SNLA 4DCKA 1TNXA 3O4YA 4XJKA 1WY9A 3SIAA 5AFPA 3KF9A 1IKUA 2JULA 1NX1A 1S6IA 2MHHA 4MEWA 1IG5A 1WDCC 1L2OC 5HLVA 4CLNA 3SG7A 2JT3A 4PHJA 1SKTA 5D7FA 2WCFA 3LK1A 3QRXA 5AEQA 2BCXA 4ZCVA 1J55A 1KFUL 1OSAA 2O5GA 3IF7A 1YTZC 1TNWA 4ETOA 4GGFA 1PVAA 1M46A 1MR8A 2BCAA 1AP4A 2GGMA 1K90D 2CXJA 3TDUA 1K94A 4A4CA 3PM8A 1F71A 2OPOA 1TCOB 1S6JA 5I8NA 2LNKA 1UUSA 4YI9A 2BKIB 4DRWA 2OS8C 1LVCD 2KQ6A 1VRKA 4PCWA 1J7QA 5F6TA 4BY4A 2KI4C 3OX6A 1CFPA 5JJGA 2JT8A 2AMIA 1KSMA 2K7DA 1YX8A 2KDHA 1RWYA 2L50A 1QIVA 4N1GA 5AERA 1BJFA 1ZMZA 1RTP1 1WLZA 5HLOA 2I7AA 1QTXA 1CM1A 2G2BA 3O6BA 4YGBB 1CMFA 5CSNA 1K96A 2CTNA 2JNXA 3D0YA 1YVHA 1TNPA 1OMVA 2K2FA 2Q91A 3E3RA 1PVBA 4I5KA 3OX5A 2D8NA 5J3XA 2JT0A 2MA2A 3PN7C 3I5GB 5I2LA 4MZLA 2K0JA 1CDMA 5D69A 4NQGA 4PE7A 1Y1UA 3BYAA 1QVIY 1DGVA 3AAJA 3D10A 3AKBA 1V1FA 4GUKA 2HQWA 1SL7A 1W7IB 2LANA 1J7OA 1AUIB 1KK7Y 3BUXB 3MSEB 1NPQA 4F0ZB 2KFGA 4YBHB 1IJ6A 2PMYA 3BOWB 2CNPA 1SY9A 1WDCB 1L2OB 2LLUA 3KO0A 4MSPA 2KHNA 1RROA 3OB2B 5K89A 2KI6C 3VRQA 1A2XA 1KSOA 1MUXA 2KBIA 1QS7A 2EHBA 1N2DA 3OB1B 2PASA 3SG2A 3A8RA 1EG3A 1N0YA 4GGFC 3LK0A 1Y6WA 4ICBA 2Y9ZA 1WRKA
chains in the Genus database with same CATH superfamily
1DJZA 1QV0A 2V7QJ 1YQ4C 2OS8B 2HR3A 2JDIH 3SSUA 1DT7B 2Q9IA 1VDFA 2KNCA 2L5GB 1DF0A 3FGAD 2WCEA 3IR9A 1RQUA 1A75A 2KLVA 1T14A 1YHQP 4IFFA 2BBMA 1S5LE 1NTKD 1JOCA 3NSIA 2LVKA 1H4BA 1FDIA 3LIEA 1HH0A 1AFOA 1LP1B 3V2PA 2R3SA 4PHNA 2OYIA 1AK8A 1JTHA 4PD4I 3D73A 4PT1A 1VQ9P 1SQVD 1N73C 4ORAB 2ZXEB 1VQ6P 3SG3A 1VL2A 3HE5A 3AAKA 1NYAA 1FBVA 1P84I 1CM4A 2N1TD 4GGNA 1N8RQ 1GTWA 2JPOA 5FI6A 3D78A 3VROA 4I1LA 1CMGA 2Y5IA 1G1JA 2K60A 3R1VA 5FYXA 3KPEA 2KYFA 2KAVA 5HKZA 5B66E 2SASA 3CWBG 1RECA 1NU1G 4ZKPA 2PRRA 1VQNP 2BASA 3V2LA 2OQQA 4QMAA 1JY2O 2B9BA 1F70A 1JSAA 1X22A 5M1BA 3B71A 2FYUJ 3CS1A 3CWGA 3PJSK 3T97A 3CZ1A 3I5FC 5AW8B 3VRRA 1QL1A 2KQYA 2XU6A 2B87B 1BDCA 3AKAA 2JWWA 1B8CA 5DKNA 1NTKK 2K88A 2JR8A 5CCGD 1GW4A 1KB9I 1J1DC 2WCJA 2ZRTA 1JF2A 3CABA 1GD2E 3GF7A 1BCCG 3L75D 1LINA 2Q1KA 1SQPG 1SQQG 2E43A 3H1IG 1QATA 4UB6E 2K1AA 1FS0E 2K61A 3CC7P 1OZHA 2WVRA 3EFGA 1GL2C 1EH2A 3L72D 3R1OA 1KILB 2F2PA 4GOFA 4H44C 1SQVE 3CMEP 1RQVA 2QJPC 3U1AA 3E1RA 1SFCA 1NX3A 1SPYA 4Q04A 4AQJA 1JUOA 1CFDA 3JVTB 1Q2NA 3KZIH 1VPCA 2M97A 1IGVA 2HYNA 5B5EE 2OYOA 3HUSB 5GTIE 1KFXS 2NZ0A 1CLMA 3PLNA 2KIKA 2KI6D 5AVUB 1LA0A 4IJ7A 3B6XA 3SG6A 1NKZB 4JPZB 1AJ5A 3CZTX 2OGUA 1DJHA 2UWJE 2CT9A 3K1EA 1XFWO 1B1GA 2QSIA 2LVVA 1SRAA 1CFCA 1DMOA 2M0RA 2I1KA 5CCHC 1RE4A 1J1EC 1FZBA 1SCMC 3HTKB 5CPVA 2OTJP 1G8IA 2HPSA 3LL8B 3I5IB 1BDDA 3BFBA 1CNPA 1QV1A 1RH5B 4PJ0H 3M0DC 3GK1A 1WRLA 3L75E 1H8BA 4Y99C 3RK2C 1S9KD 5KTYA 1IQ5A 1X79B 1FC2C 2B89A 2FYUD 3L72E 1TIZA 2KFHA 3VB1A 1JY2P 3CGAA 1SMGA 2K37A 4CFQA 1AJ4A 1R8EA 1R6PA 1S3JA 1KQFB 3H1JG 1XFRA 2I8DA 3I5HC 1W7JB 3JTDB 1CB1A 3O78A 1HJBA 3RK3C 4MVFA 2POHA 1BODA 2JO1A 3Q3DA 3HX4A 1MXLC 2J5UA 2M5AA 4OV2A 3CWBJ 3AEDC 3SWYA 1Y9BA 1NU1J 3DXLA 3CXHE 5APXA 4PD4H 3S0DA 4YGEB 3V4WA 2LHLA 1NTMG 3PLFB 3TUYB 1NWDA 1WLMA 1E79H 3A0BH 3TS5B 1P84H 1V1GA 1XA5A 3PALA 5KSZA 3LLEA 1LKJA 1LT9A 5KKZC 1L0NK 4ZMDA 3FE6A 4PV1C 3FS7A 1YRUB 2KZIA 5AVTB 1EJ3A 3C1VA 1BCCJ 2YXRB 3HE4B 2H7HA 1NUBA 1SQPJ 1ZP0C 3P8MC 1SQQJ 3FXDA 2ZFCA 2A06G 2C9LY 1Y1AA 1LTJB 3A5TA 2LVJA 2W83C 1NYHA 2E76C 1NCZA 3I55P 1Y1XA 3JC22 2IYOA 3EVRA 5CHXA 1OX3A 1KORA 5KJ7C 1JMMA 5APVA 1KQMC 1SW8A 2K2AA 2AEMA 1S9KE 3CCSP 2PFXA 2BL0C 1Y0VH 1KB9H 1RF0A 2FYUE 2WSSH 1L4AC 4N6JA 1IFJA 1M1JC 3TDKA 1CLBA 4MRYA 1ZMEC 1KK8C 1JY3N 2WPRA 3BQ3A 3PATA 1MHOA 5TNCA 3JCUE 1K9KA 3NHTA 2E75C 3D6YA 2NLNA 5FI7A 1QLKA 1A03A 3GHGB 3IF4A 1XK4C 2IDBA 1W2BO 3CPWO 5JOLA 2L2EA 2YGUA 1FF1A 2BCCG 1JC2A 1YTZT 1BE3G 1B47A 3K5BA 3HD7C 3MUDA 4BXLA 2M49B 2WZ7A 2P6BB 5DKRA 1C7VA 1KWOB 2M9GA 2OTGB 2CPBA 5AW7B 2FXOA 5CCHD 1LWUC 2ZRSA 3CWBD 4YXDC 1NU1D 4CPVA 1YBKA 2QACA 1Z4HA 1PSBA 1KFUS 2OYHC 2KS1B 3NGVA 1LTJC 1OW6A 4WQ3A 3RK2D 3AEEC 5FI2A 1USDA 2R3CA 3VGOA 5HKWA 3L4AA 5ER4X 1QVGO 1NTZJ 2H61C 5I2QA 1LP1A 1FZCC 1IK9A 1QL2A 3O2PA 1EZVG 1BCCD 1UP5A 2KOTA 1URQC 2JWDA 1KQSO 1GJYA 3PFVA 3RK3D 1PL5A 1SQPD 1SQQD 3EVVA 2L91A 3BCCJ 2NPSB 1WY9A 3KF9A 2JULA 1VQ5P 1HWTC 4CPGA 2RH0A 1KD1Q 1X0TA 3SS4A 2JT3A 4PHJA 3GLMA 3LK1A 1M90Q 2E42A 2O5GA 3R1PA 1IO4A 4GGFA 3H1LG 2XZRA 4IL6E 1M46A 3G6EP 4EDFA 1K90D 2CXJA 1IFIA 4A4CA 3PM8A 1F71A 4PV1D 2LNKA 1EDIA 1OVUA 2QEVA 1J7QA 3V6IA 3NHIA 1EC5A 4I7ZB 1CFPA 1DEKA 1IFPA 2AMIA 2N1TB 3NMDA 2K7DA 1YX8A 1RWYA 1FOSF 1Q86Q 5AERA 3CWBE 1NU1E 1RTP1 2I7AA 3O6BA 5CSNA 1LTTC 2P7JA 1H88A 2CTNA 2JNXA 1OMVA 3S9OA 2E76D 3L70G 2B87A 3CCUP 4I5KA 3H6PA 3ITKA 3MGNA 3H32B 1CDMA 5KJ7D 3AKBA 3D77A 1V1FA 4GUKA 2B88A 4XA4A 1CZQA 2LANA 1J7OA 1AUIB 4OGQC 3MSEB 2KFGA 4YBHB 1SQBG 2PMYA 3ZDMA 3PHLA 1S2EA 1SY9A 3Q5RA 4H13D 3B5NC 1KILA 1MZ9A 2IYPA 2KOGA 1A2XA 2KBIA 1BCCE 1Y47A 4WB4A 1SQPE 4GT1A 1SQQE 3H1IE 3LK0A 1NO4A 2Y9ZA 2PYQA 3LW5H 2WSFH 3L74G 4M2QA 3N7HA 1BE3J 1ZACA 2FXPA 1JB0J 1VF5C 1HF9A 2KI4B 2NCOA 2K7BA 2I1JA 2JXLA 3C9IA 1K95A 1NTZD 3FWLA 2LCPA 1SQXK 3HD7D 4IFMA 3HUSA 3O6QA 2QM8A 2YIUC 1PGPA 4WRIA 1QLED 1S5LH 2RGIA 2IFMA 4D1EA 1VQ8P 3K21A 3SS3A 4WBAA 2FCEA 3TDIA 1B7TY 1K9UA 2FJUB 3BCCD 2WC5A 4IL1A 1R5SA 2ZJSE 4AUWA 2LMUA 3CXHI 2QM7A 1XFVO 3QMEA 1L0LK 3HTKA 3L4FA 2JNFA 5B8IB 1QASA 2WCKA 3L35A 2L4HA 2KK7A 3PTZA 1EDLA 2DOQA 4HB1A 1MXEA 2ZNEA 1N2DC 4B86A 3W67A 2R44A 1AQ5A 1PGJA 3G71P 1IJDB 2A06D 3F5HA 3MHVA 1IK7A 1JFJA 5B66H 4INWA 5EFWB 1J2JB 1DEBA 1YURA 3CCLP 3V2RA 2LR2A 1A02F 5CCGC 5HKYA 3BRVB 1DJWA 1CI6B 1JF0A 3TGUG 1AV1A 5CSFA 3H1LJ 3OA7A 1QJTA 2CPSA 3D0YB 1YITP 1K05A 4I5NB 1OW7A 2KXPB 2W27A 3V5BA 3BXKA 4P2YB 1YX7A 3A4UB 3H1JE 4MN4C 4OCIA 1N73B 3DY9A 3VYIA 2LHIA 1SLQA 4QJ5B 2IBZG 1LJ2A 3VRPA 1OMIA 4GIFA 2PQLA 2LXCB 3AE7C 1X8YA 4MRXA 4HKZH 2AXCA 1FW4A 2WORA 1NX0A 1SP4A 1NTME 4UB6H 3GK4X 3TSIA 1B4CA 1H89A 3BCCE 1M8OB 4L75A 2H8VA 1PRWA 1BE3D 5AVXB 1IQ3A 2IBZI 3HE4A 1SQBJ 2Q6QA 4OZDA 1OZSA 2ZVOB 1WRZA 1VQKP 3SFEC 3I5FB 2ISDA 1TCFA 3GG2A 3MD0A 2A06E 3B5ND 5B5EH 2YXQB 5GTIH 2J58A 2Y0EA 3L74J 4XE5B 2Q5UA 2WITA 3WHTB 3IQOA 1J1DB 2JQ6A 2Z5HA 1KTMA 2MLEC 4EI2A 1TTXA 1ZN5A 1C7WA 1QX2A 1DIPA 3OGNA 1B8RA 1B9AA 1VF5D 5GTHE 3NTNA 2LXBA 3CMAP 1EDJA 1XFUO 2ZT9C 2F33A 4AOMA 1M45A 1GL2B 4GOEA 4HJGH 4H44B 2DW3A 3R2PA 4USLA 1F4OA 2ITAA 1U7JA 2QJPB 3DF0B 1QVFO 2OARA 4H0LC 2ZN9A 1QVIZ 1ALWA 1SK6D 4R4MA 1GMJA 5AVVB 3RLZA 4I6MC 1RK9A 4UPGA 1PP9G 2L5YA 2AEJA 1RF0C 3H1LD 1FOSE 2M8UA 1SFCD 1CDPA 3A2AA 1K93D 3BFHA 2IFNA 3CC2P 2BCCE 2IZ0A 3U1CA 2LUCA 4WVZA 1BE3E 1YVLA 2JEEA 2GUVA 2V7QH 2MAZA 5IBWA 2Y0CA 4HRHA 2K9JB 2KS1A 2XDJA 2L2CA 1OW8A 3CXHH 2FXMA 1IWQA 5AXIA 2BECA 1X02A 4FQTA 2WC8A 1OIPA 3TGUJ 3TF5A 2KPHA 1UURA 1J1EB 1QX5B 1W9ZA 1SCMB 5BPJA 3N4XA 1FI6A 1MQ1A 1LGHB 1ALVA 3FWCA 2TN4A 2MLFC 1HTLC 2WWWA 2M1UA 1SQVK 1SQBD 5DICA 2HQ8A 4PE1A 2MKVA 4Y99B 5KLVG 2O01J 2A45G 2NPSA 3KYQA 3RK2B 3CCEP 1AHRA 1NAFA 1BOCA 4WY4C 4XFJA 1EZVE 2H88C 1K9PA 1HVVA 2WSCJ 3B8EB 3TNUB 3I5HB 3H1HG 3CCQP 2WNDA 2KUBA 3L74D 2WOSA 4RO0A 3RK3B 3CCRP 2FKWB 4W7ZA 3CXHD 4BRYB 1LT1A 2JWAA 4Y28J 4ZKUA 1NCXA 1S72P 4I5LB 1CW5A 3S1KA 3H1LE 2M7LA 1NJIQ 3VMZA 5AANA 2CK3H 1Z2CB 1XYDA 3OAKA 2XKMA 2W6BA 1SR6C 1JY2N 1BG1A 1OWAA 1BGYG 2IPPA 1UHJA 2JXCA 2K7OA 4LGDE 3AEBC 3KXDA 3JCUH 1TU3F 5KKZB 1KMIZ 4PALA 1FZAA 3H32A 4PV1B 5DJUB 1VQ7P 2LM5A 2M7NA 1YR5A 1YUTA 3F45A 3AE9C 2MRDA 2E30A 1IIOA 3Q8IA 1GK6A 1MFZA 2E76B 1OZOA 4OVNF 3NXSA 1B8LA 3BJHA 2GUSA 2ZT9D 1PK0D 1G33A 1JEKA 4C7NB 1MKMA 1SQBE 5AVWB 1BF5A 2KSJA 2QEOA 2BE6A 4OWFA 1NKNA 1KQMB 5CSIA 3BFAA 2BL0B 1HJ0A 4L9MA 2KSPA 1W5CE 1Y8AA 1PP9J 5AVZB 3TGUD 5KU1A 2E6WA 1DEEG 1L4AB 2ZVNB 4H0LD 3B86A 1M1JB 1BR1B 1ODBA 3CR4X 2K7CA 1KK8B 3L74E 1T6AA 4YGAA 3M91A 1XFZO 2R5DA 3PP5A 3TDZA 3F89A 5HYDA 3QH9A 1T3JA 2QPTA 2E75B 5BVZA 2L4IA 4N5XA 2KBMA 2MJZA 2IBZD 1S4XA 4F7FA 2N9BA 3II6A 3I56P 3AEFC 1QLSA 4JQ0D 1LTGC 2WC6A 2L5XB 1SNLA 2E74C 3OBVA 1IFNA 1RE3A 3EFFK 4XJKA 3SIAA 3HD7B 1RF1C 1NX1A 1S6IA 2QIWA 3M9QA 1WDCC 2FFDC 5AEQA 4ZCVA 4JBZA 1KFUL 3JSVC 1LWUB 1VQMP 1OVVA 1XTCC 1PVAA 2BCAA 5KLVJ 3S0EA 1K94A 4IOIH 3CZ0A 4KYNA 3H1IJ 3L71G 2OPOA 1TCOB 3A0HE 4IL6H 3W68A 2OYHB 4YI9A 4DRWA 3NFQA 2W90A 5KAFE 1NAYA 1VQ4P 2KB7P 3OX6A 1SVFA 2FYUK 3H1KG 3Q5SA 2JT8A 4WY4D 3D71A 1TWOA 2L50A 1N7SA 1CI6A 4RKUJ 2AXTE 1WLZA 5HLOA 2KZJA 4W80A 3D0YA 4DZOA 1YVHA 2K2FA 2Q91A 1VQPP 3OX5A 3AE2C 1FZCB 2JT0A 2MA2A 3PN7C 4Z1MH 4MZLA 1URQB 2K0JA 3TGUE 5D69A 1N73A 4PE7A 4JD9A 3BYAA 5APWA 1DGVA 1G1IA 4H13C 1TUJA 2HQWA 1LTSC 3UNWA 3DZTA 1YJ9P 3CI9A 3BVHA 3BASA 5APYA 3BOWB 2CNPA 4YPCA 1BGYJ 2LLUA 4MSPA 1KC8Q 5TISE 2IBZE 1MUXA 4JYBA 2EHBA 3OB1B 2KLUA 3A8RA 2RN0A 4W7YA 1PP9D 4GPLB 2IX7C 4I2LC 1AVOA 2A4JA 1K73Q 1UHIA 2QDIA 1M56D 3CD6P 2FJYA 5CJ4A 4HRGA 1S36A 1FZEA 4HYTB 2JTTA 4C0LA 3KQGA 3L4LA 4OH8B 4R4LA 4M2OA 2KNEA 2WSEJ 2KP8A 1J7RA 1AVSA 1AJYA 1J1DA 5BU5A 2PRUA 2WTYA 3H1JJ 3AE8C 4BWNA 1YUSA 4OGQB 3S0AA 5GQQC 4INXA 2LLTA 3VRNA 1N86A 1DGUA 1DTLA 1S5GY 1SCVA 1GL2A 1RHZB 2ZXXA 3SG4A 3B5NB 4PHMA 3DYEA 3FE9A 2P2UA 5AW4B 1YJWP 5KLVD 1NTMJ 3H1ID 1XFYO 3DF0A 2NCPA 2PVBA 3T97B 4DUQA 1FPWA 1S26D 3SG5A 1YIJP 1KILD 1PGQA 1WMKA 1VF5B 3H1HD 1NTKG 3DVKA 1U57A 2E74D 1PALA 1EZVI 1NGMB 5AVRB 2FBWC 3PRJA 1NSHA 1DELA 4C0KA 2YO2A 2WPVB 2YIUB 1PP9E 1F8HA 1NU1K 2WPQA 3G4SP 1QEXA 1Q90D 1SL8A 1XO5A 2OYIC 4R1EA 1GM0A 3IFMA 2QG4A 3H1KJ 1IFMA 1BGYD 4U7JA 4U3FG 3CLNA 4AQIA 2Q4UA 5CCHA 2NZ2A 1J1EA 4DT0A 1QWVA 1PV3A 1XTGB 1WRGA 3OJAB 3RL0C 1OOIX 3O8ZA 1AVYA 2QJYC 5KLIC 3DD4A 1HQVA 1SQPK 1SQQK 3VMYA 1M57D 3WNXB 3A7OA 1A29A 4KT0J 1KFNA 2JJLA 3VP9A 5AVQB 2WCLA 2PALA 1RFJA 1N65A 1S1EA 4C0JA 5KLVE 2W6AA 3MIWA 3TNUA 4N78D 4D6TG 1SYMA 1QIWA 1AQTA 2BEZF 5AVSB 2BCCJ 1CDLA 2FCDA 1KILE 3L75G 4BRYA 3H1JD 3RBZA 1F54A 1ZOTB 3H1HE 3AE5C 4GAOA 1BT6A 1DH3A 2LKMA 1YQ3C 1YJNP 1U5IB 4C7RA 2I2RE 2FY8A 2F2OA 2SPZA 4C46A 2LC5A 1QXPA 4P5OE 1NTMD 2BCBA 5GTHH 5CJ0A 2HG5D 1BR4B 1ZR2A 2JU0A 1MFTA 2OTLP 5KTBA 1K8UA 2COLB 2K9YA 2D2CD 5L8RJ 3SFDC 1IJ5A 2LAPA 1JM0A 1TN4A 3U59A 2WPSA 1SFCC 1BGYE 5AW3B 5C39A 3RM1A 2ZAEB 2LMTA 1CLLA 3BUWB 3EK7A 3MP7B 2W8ZA 3CX5E 5APUA 2KYVA 1FJPA 3NSKA 1D1OA 2EC6C 3CR2A 3P8CD 1L2PA 1T3UA 1OFCX 4C7NA 1OMRA 5KJ7A 1MF8B 1H0TB 2LLSA 5K5GB 1C3YA 2V53A 1S1CX 4ZNCA 3H1KD 1NX2A 1NP8A 2QJKC 5TJHA 4RJTA 1L4AA 1L0NG 1M1JA 2L51A 5CSJA 2QEBA 4I5JA 1DD3A 4N78E 2W6JH 1NTZK 2Y1NA 4QJ4B 2CBLA 1OVRA 2ZT9B 3BUMB 1RE4C 1H8AA 1JCDA 3IQQA 1OOGA 1BSHA 4HREE 5KAIE 4AQRD 2P70A 1NWQA 2WCHA 1OQPA 1NTMK 2B1UA 3SJSA 1UHHA 4M2PA 1XK4A 4MZJA 1B7TZ 4H0LB 3Q2YA 1KYOD 4U3FJ 2BAPA 4NPDA 3HD7A 3EWKA 1TOPA 3L70J 3DVJA 2ZYAA 2JOJA 2Z5IA 4YTPC 1CTRA 2BCCD 5CBOA 3P32A 1LWUA 1A02J 2ZN8A 2PSRA 4YI8A 3WMM0 1FU1A 3HCMA 1KCYA 1BMOA 3RL0D 2OYHA 4HSZA 1LTIC 1OOFA 1LTJA 2N9YB 1KQVA 3Q5PA 2QEHA 1EXJA 2M8RA 3L73G 1M7LA 1DJYA 1LXFC 3P8CE 1J7PA 2NRGA 4D6TJ 3L71E 2H43A 1TRFA 4A7PA 1YUUA 3LIDA 3B4SA 1M39A 2H61A 1NOHA 5AW1B 3V2QA 3H1KE 1FZCA 1LT9C 3H4SE 2KLEA 4MN0A 1BSNA 1URQA 3A3YB 1DX7A 1LS8A 1CSBA 2YMYA 4GNKB 1YTZI 3M06A 2QVAA 3L36A 2G8YA 4WY4B 1EZVD 2Y4QA 4PHKA 3BOWA 2FYZA 3ICBA 4ORCB 2Y9YA 1A4PA 2I94A 1XVJA 4PE0A 1FBMA 3GW6A 4YGDB 3GHGA 3BRTB 2NPSD 3DVMA 1MUUA 1K04A 3UIAA 1Q80A 1N7SC 3CCVP 4MLWA 1HGVA 1PGOA 1KYOE 3I5CA 4OR9B 3SWKA 4EOTA 3N7NA 2BBNA 2KAXA 3L37A 1ZFSA 3WXAA 2LUXA 3EQ2A 3M9HA 1KFXL 3AE1C 1SBJA 1Q7YQ 2WT7B 2FYNC 2YO3A 1IRJA 1R5LA 3M0AA 1WT6A 1SR6B 2LV7A 4NDDA 5AW9B 2KI7B 2JRFA 3BUNB 4E68A 2HPCB 3I5GC 2EGDA 2F3ZA 3CTNA 4U3FD 1JNMA 3OP0A 1L0NJ 4NPEA 4KHXA 2H8PD 5PALA 3L70D 4DCKA 1PZQA 2IZ1A 3WU2H 1TNXA 3O4YA 1Z56A 4TT3H 3MUDC 1IG5A 2E5YA 3B5NA 1L2OC 4CLNA 5DJTB 1SKTA 3QRXA 4KJMA 1OSAA 3IF7A 1YTZC 4ETOA 1MR8A 2Q7CA 2GGMA 1GU5A 5AVYB 2P58A 1C3ZA 2OS8C 3AE4C 3A0HH 3UO9A 4D6TD 5KAFH 5JJGA 2KDHA 2RMZA 1W2EA 1BJFA 1QTXA 1CM1A 2G2BA 4YGBB 1G2CB 1CMFA 2A45I 1K96A 3PM2A 2AXTH 1NTKE 1FDMA 1PVBA 2D8NA 1S5LX 4WWIA 3S0GA 4UB8E 2N1TA 3AAJA 3D10A 3L73J 2QE7H 1FDOA 1W7IB 3O4XA 5H2FE 2E74B 2ERBA 1T2KC 1KK7Y 3BUXB 1NPQA 1RF1B 3C8VA 2H89C 1JMBA 2C0XA 1WDCB 3KO0A 2KHNA 1RROA 2FFDB 3OB2B 3V4QA 3KDPB 5TISH 1KQLA 1N2DA 4U3FE 2PASA 5EL2A 1N0YA 3FE8A 4GGFC 1OW4A 2O01H 5AFPA 4ICBA 1SQXG 1X9VA 3L70E 1SQBK 1EDKA 3O6QB 1PSRA 1ZV8A 2YMKA 4TNCA 1NVOA 2M3EA 1JCCA 1FE6A 2O1JA 4DIRA 2WSCH 4LC1A 4ZCUA 1OE9B 3QWOC 5CCGA 3CX5I 2YKPA 3HRNA 2OTKE 1C07A 5I94A 1EXIA 1L0LG 1L0ND 2KSEA 1JWDA 1D7MA 3PN7B 1EG4A 1GGZA 2R5BA 1N7SD 4JWQA 4D6TE 2Y0DA 3OHMB 1GDTA 4H13B 2O60A 1KN7A 1QGKB 1U5IA 2M3WA 3GK2A 1XFXO 2VRGA 4NDBA 2HF5A 3RBXA 3CCMP 1NIWA 2AEFA 3S0BA 1DC1A 3EKJA 2MJWB 1M31A 3C1LA 3GF3A 3M0WA 2WQYC 1KK7Z 1DQEA 1KILC 1BLQA 3M9BA 3BUOB 2M1KB 4A4BA 3WU2E 3KPXA 5AW0B 2PGDA 3D70A 4ASVA 1NTZG 1PPJG 1OMDA 3JVTC 1JY3O 2VRSA 1JUNA 3VMXA 1SS1A 2HODB 5I2OA 3BCCG 2LP2A 1JBAA 3HUSC 1TNQA 2D2CB 1H0TA 3CL3D 3G9RA 1UHNA 1CDNA 1KFMA 2JPTA 2E5TA 1DJXA 3L73D 2GM4A 4BY5A 3IN6A 2K8MB 4NPFX 3KEVA 1HBWA 2QA4P 3VN0A 1M63B 3H1HJ 2GGZA 2JC2A 1LNQA 2XNXA 2LVIA 2BEQD 4CFRA 4PDZA 2PP6A 3VTPC 5APSA 4IFDK 3VP8A 1L0NE 1GW3A 2XV5A 2L0PA 2O01N 3I5IC 3ZNIA 1PIXA 3R72A 4DS7A 1DJIA 4YGCB 1FAVA 1GL2D 4PD4D 3KHUA 2C0WA 3MZWB 3KZIE 4H44D 1EL4A 4EIJA 2KNCB 2ZNDA 1IH0A 1DF0B 1T2KD 3NSLA 2J59M 2HETA 1A75B 1NHLA 1P84D 1BU3A 3JTDC 4DOJA 2A45H 1SQXJ 2P67A 4RESB 2OYIB 1JTHB 1KYOI 1DJGA 2KGBC 2Y1MA 4N3YB 2BNXA 2M0BA 3SIBA 1FJKA 3TUYC 3HE5B 3OW2O 2D2CC 4ASWA 1S3PA 3V2NA 3TS5C 1HT9A 1KV4A 3PSRA 5DKQA 4EYYQ 5CMZA 3L73E 1L0LJ 4OKHA 4FQOA 3GOFA 4PJ0E 2LE9B 3RL0B 2ZYDA 2QJYB 3BATA 5KLIB 1EXRA 1L7ZA 1T8ZA 4O9BA 2LMVA 1NCYA 1GGWA 1N7LA 3VOPA 3AEAC 1OOJA 3PH0A 5HL1A 1KB9D 4WY4A 1UHKA 1U7MA 3B7AA 1JY3P 1ZW0A 3FX0A 2R2IA 1LTAC 3CX5H 2WCBA 1JFKA 2KYCA 4NDCA 1F55A 3IVTA 3WUUA 4MBEA 1YI2P 3AECC 2O3JA 3EKHA 2KAYA 4PD4E 3EK4A 3TK1A 1OXZA 1GZLA 1LA3A 2P10A 1S6CA 2SCPA 3MTUE 3CR5X 1R2UA 1IZNB 2F3YA 4JYCA 1OOHA 1QX7A 1RJVA 1UIXA 2WT7A 5E79H 3A0BE 2QRXA 1P84E 3PJIA 1SQVG 4ORBB 2F8PA 1M1KQ 4MZKA 2G9BA 5CBNA 3LCPC 3L71J 2JZIA 2WSEH 4LLHA 2K9JA 2RKLA 2YNYA 2HPCA 1SL9A 5KAIH 1YRTB 4TLFA 2NXQA 2P1JA 1KZUB 3GHGC 3E1IA 1SFCB 2HFED 2JTZA 4GKGA 2FOTA 2XNDH 3LW5J 4XYNA 1HUCA 1USEA 2WSFJ 5D3OA 3CX5D 3CCJP 4L74A 2KLDA 1CKKA 2KFFA 1KWOC 4YXWH 2OTGC 1SQXD 3NSOA 2EC6B 1FZGA 1S5GZ 3RL0g 2LP3A 3M0DA 1Q82Q 1IC2A 1RY3A 3R4YA 3EG5B 2L98A 3NXAA 5KLVK 1K2HA 2GV5A 5ER5A 3B88A 2WMMA 2I18A 5APTA 1HGZA 1IFDA 3CDNA 1KB9E 1GK4A 3H25A 1E8AA 2QJKB 3CYZA 4GDOA 4K3AA 1GQMA 4U8DA 3RZSA 1K9MQ 1KQGB 2P71A 1L0LD 3AE3C 1DVIA 3FXEA 3EK8A 1ZOYC 1G2CA 4JF7A 1L4AD 2QEXP 1VQLP 3FWBA 2Q3IA 1MWNA 3L72G 2KGRA 3RK3E 3EVUA 4GODA 2E75D 2Z4EA 2M29A 3ZWHA 2NPSC 1UIIA 3USSA 3FIAA 2YKQA 1RF1A 2GTEA 1CFFA 1PULA 2HLOA 1F4QA 1FZFA 2AUCA 5APQA 3CZ2A 2FFDA 3D6ZA 1SSEB 1FI5A 1PFIA 1ZRTD 3WHUB 3DVEA 1DD4A 1PPJD 5G08A 2Q3EA 3CLQA 3TYYA 1G4YR 2H2KA 2GA1A 4GFTA 4N1FA 2R32A 4GBAA 2M5AB 1K8AQ 3Q1MA 1KYOH 4IL6X 2AAOA 2BKHB 4CIDA 3D75A 4I7ZC 3RGUA 2MBXA 3WUTA 1SQXE 1ZR4A 4WQ2A 2N1TC 3GMAA 3L71D 3VMAA 4PE4A 2ZKMX 1ZUZA 1QX8A 4YRUA 2IS9A 3S0FA 4L73A 3KHEA 4XJKB 2BE4A 4K35A 1AA0A 2JP3A 1LT9B 5E79E 2M3BA 1NTKJ 2ZFDA 3TZ1A 2CCMA 3L47A 3AE6C 4FTGA 4QJ3B 3G3ZA 1UWOA 2V4HA 2O1KA 2YKOA 3D74A 1L0LE 1SQVJ 2PAJA 1URQD 1IKUA 1GU4A 2MHHA 4MEWA 4HH2A 3SWFA 5HLVA 3SG7A 5D7FA 3IAOA 2C9NY 2WCFA 2BCXA 3S4RA 1J55A 2FYUG 3SS5A 1ZLLA 1TNWA 2ZYGA 1N7SB 4AYCA 3P7KA 1AP4A 3TDUA 3B87A 1VQOP 1TUZA 1S6JA 5I8NA 1NH4A 1UUSA 2BKIB 1LVCD 2KQ6A 1VRKA 4PCWA 1LTBC 5F6TA 4BY4A 5AW2B 2KI4C 2FYNB 1KSMA 2G3AA 1QIVA 4N1GA 2HODA 1ZRTE 1NTZE 1ZMZA 4M3LA 3E7KA 1PPJE 5AW6B 3AEGC 4L76A 1TNPA 1JO5A 3E3RA 3CC4P 1E5WA 2WCMA 5J3XA 1YYCA 3I5GB 5I2LA 4DJGA 4NQGA 1Y1UA 1QVIY 1ZXGA 3ABVC 4UB8H 1SL7A 1P28A 4F0ZB 2JKVA 1RE3C 5H2FH 5BU8B 1IJ6A 2K3RA 1Q81Q 3L75J 1L2OB 5AW5B 3D76A 3FWNA 5K89A 2KI6C 3VRQA 1KSOA 4JKTA 4OGQD 1ORGA 1MV8A 1QS7A 3WUVA 3L72J 3SG2A 1EG3A 1Y6WA 1EQ7A 1WRKA
chains in the Genus database with same CATH topology
1DJZA 1QV0A 4GPLB 1PSRA 2A4JA 4M2QA 2OS8B 4TNCA 1ZACA 1DT7B 1UHIA 2KI4B 2NCOA 4HRGA 2K7BA 1S36A 4DIRA 2JXLA 4ZCUA 1OE9B 1DF0A 1K95A 2WCEA 1A75A 2LCPA 2JTTA 4C0LA 2BBMA 1C07A 4WRIA 3NSIA 2LVKA 1H4BA 4M2OA 2KNEA 2RGIA 4D1EA 3K21A 2FCEA 3TDIA 1JWDA 3PN7B 1B7TY 1K9UA 4PHNA 1EG4A 1J7RA 1GGZA 2FJUB 1AK8A 4IL1A 4JWQA 1AVSA 1J1DA 2PRUA 3OHMB 4ORAB 2LMUA 2O60A 3SG3A 1XFVO 1YUSA 1U5IA 2M3WA 3GK2A 1XFXO 2VRGA 4NDBA 2HF5A 5GQQC 1NIWA 3AAKA 3EKJA 2LLTA 2MJWB 3VRNA 1M31A 1NYAA 1FBVA 1DGUA 1DTLA 1S5GY 1SCVA 2JNFA 3M0WA 5B8IB 1QASA 1CM4A 3SG4A 4GGNA 4PHMA 1KK7Z 2L4HA 2DOQA 1MXEA 1BLQA 2ZNEA 3VROA 1XFYO 3BUOB 2M1KB 2Y5IA 4A4BA 3DF0A 3KPXA 1CMGA 2NCPA 2PVBA 5FYXA 2KYFA 4DUQA 2KAVA 5HKZA 1FPWA 1S26D 2SASA 3SG5A 1RECA 1JFJA 1OMDA 3JVTC 3DVKA 1F70A 1JSAA 1PALA 1YURA 5HKYA 3CS1A 1DJWA 5I2OA 1JF0A 2LP2A 3CWGA 1NSHA 1JBAA 5CSFA 1QJTA 1TNQA 4C0KA 3I5FC 1UHNA 3VRRA 1CDNA 1F8HA 2JPTA 2KQYA 3D0YB 4I5NB 1DJXA 3AKAA 2JWWA 1B8CA 5DKNA 3BXKA 4BY5A 1SL8A 1XO5A 4P2YB 1YX7A 3A4UB 2K8MB 4R1EA 3KEVA 4OCIA 2LHIA 1JF2A 2ZRTA 4QJ5B 1M63B 3VRPA 1LINA 2GGZA 3CLNA 2JC2A 4AQIA 1QATA 2Q4UA 1J1EA 2LVIA 4MRXA 2K61A 4CFRA 1FW4A 2WORA 4PDZA 1NX0A 1EH2A 3GK4X 1B4CA 2F2PA 2L0PA 3I5IC 3ZNIA 4DS7A 1DJIA 4YGCB 1PRWA 3DD4A 1HQVA 1IQ3A 1NX3A 1SPYA 4Q04A 3WNXB 1A29A 4AQJA 1JUOA 1CFDA 1EL4A 3JVTB 2PALA 1RFJA 1N65A 1S1EA 2M97A 2ZNDA 1DF0B 1IH0A 3NSLA 4C0JA 1IGVA 2HETA 1OZSA 1A75B 1WRZA 1SYMA 1BU3A 1QIWA 3JTDC 3I5FB 2ISDA 1TCFA 1KFXS 2NZ0A 1CLMA 1CDLA 2FCDA 2KI6D 1LA0A 3WHTB 3SG6A 1F54A 4JPZB 1AJ5A 3CZTX 1ZOTB 3IQOA 1DJGA 4GAOA 2JQ6A 2KGBC 1DJHA 2MLEC 2Y1MA 1BT6A 2CT9A 1TTXA 1XFWO 1C7WA 1QX2A 1B1GA 3SIBA 3TUYC 1U5IB 1B8RA 2LVVA 1SRAA 1CFCA 1DMOA 1B9AA 2I2RE 1S3PA 2F2OA 2M0RA 3TS5C 1HT9A 2LC5A 1XFUO 3PSRA 5DKQA 1QXPA 1SCMC 2F33A 4P5OE 1M45A 2BCBA 4AOMA 1BR4B 5CPVA 2JU0A 1G8IA 4OKHA 2HPSA 3LL8B 4FQOA 3I5IB 1K8UA 2COLB 3GOFA 2LE9B 1CNPA 1QV1A 1F4OA 4USLA 1EXRA 1IJ5A 2LAPA 3DF0B 1L7ZA 1TN4A 2LMVA 1NCYA 3GK1A 1GGWA 1WRLA 2ZN9A 1OOJA 3RM1A 1H8BA 1QVIZ 1ALWA 2LMTA 5KTYA 1SK6D 1UHKA 1CLLA 1IQ5A 3RLZA 3BUWB 3EK7A 1RK9A 4UPGA 1TIZA 2KFHA 3NSKA 1D1OA 3CGAA 2M8UA 1SMGA 2R2IA 1CDPA 4CFQA 1AJ4A 1K93D 2EC6C 2WCBA 1R6PA 1JFKA 2KYCA 3CR2A 4NDCA 1F55A 1OFCX 3I5HC 1W7JB 2LUCA 3JTDB 1CB1A 1OMRA 1YVLA 3O78A 4MBEA 1MF8B 2LLSA 2MAZA 4MVFA 3EKHA 5IBWA 1BODA 2KAYA 2V53A 3EK4A 3HX4A 1MXLC 4OV2A 4HRHA 1NX2A 1LA3A 1S6CA 2SCPA 1NP8A 3CR5X 1R2UA 2F3YA 4YGEB 2LHLA 1QX7A 1IWQA 5AXIA 2BECA 1RJVA 1X02A 3PLFB 2WC8A 2L51A 5CSJA 4I5JA 3TUYB 1NWDA 1WLMA 4ORBB 2F8PA 4MZKA 2Y1NA 4QJ4B 2G9BA 3TS5B 2CBLA 1UURA 3BUMB 1QX5B 3LCPC 1SCMB 5BPJA 2JZIA 1V1GA 3IQQA 1FI6A 1MQ1A 1ALVA 4HREE 3FWCA 1XA5A 2TN4A 3PALA 5KSZA 3LLEA 1LKJA 1OQPA 2MLFC 1SL9A 2B1UA 3SJSA 1UHHA 4M2PA 1YRTB 1XK4A 2NXQA 4MZJA 3FS7A 1B7TZ 1YRUB 2M1UA 2HQ8A 4PE1A 1EJ3A 3C1VA 2JTZA 1AHRA 1NUBA 2FOTA 1BOCA 4XYNA 1TOPA 1Y1AA 3DVJA 2JOJA 1CKKA 2KFFA 1K9PA 1KWOC 2LVJA 1CTRA 2OTGC 3NSOA 2EC6B 1S5GZ 2LP3A 1NCZA 3I5HB 2L98A 2WNDA 1Y1XA 2ZN8A 3NXAA 2WOSA 1K2HA 3EVRA 2PSRA 2GV5A 5ER5A 4YI8A 2I18A 1KQMC 1SW8A 2K2AA 3HCMA 1KCYA 1BMOA 4HSZA 2BL0C 1Y0VH 1E8AA 1NCXA 1KQVA 4I5LB 2M7LA 1GQMA 1DJYA 5AANA 1LXFC 4U8DA 1J7PA 1CLBA 4MRYA 1XYDA 1TRFA 1KK8C 1DVIA 1SR6C 1YUUA 3BQ3A 3PATA 3EK8A 1MHOA 1BG1A 5TNCA 1M39A 1K9KA 1UHJA 2H61A 2JXCA 2K7OA 2NLNA 1QLKA 3FWBA 3H4SE 4MN0A 4PALA 2LM5A 1MWNA 1A03A 2M7NA 1XK4C 2KGRA 1YR5A 1YUTA 3F45A 3EVUA 4GNKB 5JOLA 2L2EA 2M29A 2MRDA 3ZWHA 1FF1A 1JC2A 3FIAA 2Y4QA 1B47A 2E30A 4PHKA 1CFFA 3BOWA 1PULA 1F4QA 3ICBA 4ORCB 2AUCA 2M49B 2Y9YA 2P6BB 1A4PA 2I94A 5DKRA 1KWOB 2M9GA 1XVJA 1C7VA 2OTGB 4PE0A 4YGDB 1OZOA 4OVNF 1FI5A 3DVMA 1B8LA 2ZRSA 1PK0D 1G33A 3WHUB 1Q80A 3DVEA 1BF5A 5G08A 1G4YR 4CPVA 2BE6A 2H2KA 4MLWA 4GFTA 1KQMB 2QACA 4N1FA 5CSIA 4OR9B 4GBAA 1PSBA 1KFUS 2BBNA 2KAXA 2BL0B 1ZFSA 3WXAA 2LUXA 4L9MA 2KSPA 1KFXL 2AAOA 1SBJA 2BKHB 4CIDA 5KU1A 2E6WA 4WQ3A 2MBXA 1IRJA 4WQ2A 1BR1B 1ODBA 3CR4X 2K7CA 4PE4A 3VGOA 2ZKMX 1KK8B 1ZUZA 5HKWA 1SR6B 2LV7A 4YRUA 5ER4X 2IS9A 4YGAA 4NDDA 1XFZO 3TDZA 2JRFA 5HYDA 3KHEA 4XJKB 2QPTA 2H61C 2L4IA 2BE4A 3BUNB 4N5XA 5I2QA 4E68A 2KBMA 3O2PA 3I5GC 2EGDA 2ZFDA 1UP5A 2F3ZA 2KOTA 3CTNA 3TZ1A 1GJYA 2CCMA 1QLSA 3PFVA 4JQ0D 4FTGA 3OP0A 4QJ3B 3EVVA 1UWOA 5PALA 2L5XB 1SNLA 4DCKA 1TNXA 3O4YA 4XJKA 1WY9A 3SIAA 5AFPA 3KF9A 1IKUA 2JULA 1NX1A 1S6IA 2MHHA 4MEWA 1IG5A 1WDCC 1L2OC 5HLVA 4CLNA 3SG7A 2JT3A 4PHJA 1SKTA 5D7FA 2WCFA 3LK1A 3QRXA 5AEQA 2BCXA 4ZCVA 1J55A 1KFUL 1OSAA 2O5GA 3IF7A 1YTZC 1TNWA 4ETOA 4GGFA 1PVAA 1M46A 1MR8A 2BCAA 1AP4A 2GGMA 1K90D 2CXJA 3TDUA 1K94A 4A4CA 3PM8A 1F71A 2OPOA 1TCOB 1S6JA 5I8NA 2LNKA 1UUSA 4YI9A 2BKIB 4DRWA 2OS8C 1LVCD 2KQ6A 1VRKA 4PCWA 1J7QA 5F6TA 4BY4A 2KI4C 3OX6A 1CFPA 5JJGA 2JT8A 2AMIA 1KSMA 2K7DA 1YX8A 2KDHA 1RWYA 2L50A 1QIVA 4N1GA 5AERA 1BJFA 1ZMZA 1RTP1 1WLZA 5HLOA 2I7AA 1QTXA 1CM1A 2G2BA 3O6BA 4YGBB 1CMFA 5CSNA 1K96A 2CTNA 2JNXA 3D0YA 1YVHA 1TNPA 1OMVA 2K2FA 2Q91A 3E3RA 1PVBA 4I5KA 3OX5A 2D8NA 5J3XA 2JT0A 2MA2A 3PN7C 3I5GB 5I2LA 4MZLA 2K0JA 1CDMA 5D69A 4NQGA 4PE7A 1Y1UA 3BYAA 1QVIY 1DGVA 3AAJA 3D10A 3AKBA 1V1FA 4GUKA 2HQWA 1SL7A 1W7IB 2LANA 1J7OA 1AUIB 1KK7Y 3BUXB 3MSEB 1NPQA 4F0ZB 2KFGA 4YBHB 1IJ6A 2PMYA 3BOWB 2CNPA 1SY9A 1WDCB 1L2OB 2LLUA 3KO0A 4MSPA 2KHNA 1RROA 3OB2B 5K89A 2KI6C 3VRQA 1A2XA 1KSOA 1MUXA 2KBIA 1QS7A 2EHBA 1N2DA 3OB1B 2PASA 3SG2A 3A8RA 1EG3A 1N0YA 4GGFC 3LK0A 1Y6WA 4ICBA 2Y9ZA 1WRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJZ A;  1QV0 A;  4GPL B;  1PSR A;  2A4J A;  4M2Q A;  2OS8 B;  4TNC A;  1ZAC A;  1DT7 B;  1UHI A;  2KI4 B;  2NCO A;  4HRG A;  2K7B A;  1S36 A;  4DIR A;  2JXL A;  4ZCU A;  1OE9 B;  1DF0 A;  1K95 A;  2WCE A;  1A75 A;  2LCP A;  2JTT A;  4C0L A;  2BBM A;  1C07 A;  4WRI A;  3NSI A;  2LVK A;  1H4B A;  4M2O A;  2KNE A;  2RGI A;  4D1E A;  3K21 A;  2FCE A;  3TDI A;  1JWD A;  3PN7 B;  1B7T Y;  1K9U A;  4PHN A;  1EG4 A;  1J7R A;  1GGZ A;  2FJU B;  1AK8 A;  4IL1 A;  4JWQ A;  1AVS A;  1J1D A;  2PRU A;  3OHM B;  4ORA B;  2LMU A;  2O60 A;  3SG3 A;  1XFV O;  1YUS A;  1U5I A;  2M3W A;  3GK2 A;  1XFX O;  2VRG A;  4NDB A;  2HF5 A;  5GQQ C;  1NIW A;  3AAK A;  3EKJ A;  2LLT A;  2MJW B;  3VRN A;  1M31 A;  1NYA A;  1FBV A;  1DGU A;  1DTL A;  1S5G Y;  1SCV A;  2JNF A;  3M0W A;  5B8I B;  1QAS A;  1CM4 A;  3SG4 A;  4GGN A;  4PHM A;  1KK7 Z;  2L4H A;  2DOQ A;  1MXE A;  1BLQ A;  2ZNE A;  3VRO A;  1XFY O;  3BUO B;  2M1K B;  2Y5I A;  4A4B A;  3DF0 A;  3KPX A;  1CMG A;  2NCP A;  2PVB A;  5FYX A;  2KYF A;  4DUQ A;  2KAV A;  5HKZ A;  1FPW A;  1S26 D;  2SAS A;  3SG5 A;  1REC A;  1JFJ A;  1OMD A;  3JVT C;  3DVK A;  1F70 A;  1JSA A;  1PAL A;  1YUR A;  5HKY A;  3CS1 A;  1DJW A;  5I2O A;  1JF0 A;  2LP2 A;  3CWG A;  1NSH A;  1JBA A;  5CSF A;  1QJT A;  1TNQ A;  4C0K A;  3I5F C;  1UHN A;  3VRR A;  1CDN A;  1F8H A;  2JPT A;  2KQY A;  3D0Y B;  4I5N B;  1DJX A;  3AKA A;  2JWW A;  1B8C A;  5DKN A;  3BXK A;  4BY5 A;  1SL8 A;  1XO5 A;  4P2Y B;  1YX7 A;  3A4U B;  2K8M B;  4R1E A;  3KEV A;  4OCI A;  2LHI A;  1JF2 A;  2ZRT A;  4QJ5 B;  1M63 B;  3VRP A;  1LIN A;  2GGZ A;  3CLN A;  2JC2 A;  4AQI A;  1QAT A;  2Q4U A;  1J1E A;  2LVI A;  4MRX A;  2K61 A;  4CFR A;  1FW4 A;  2WOR A;  4PDZ A;  1NX0 A;  1EH2 A;  3GK4 X;  1B4C A;  2F2P A;  2L0P A;  3I5I C;  3ZNI A;  4DS7 A;  1DJI A;  4YGC B;  1PRW A;  3DD4 A;  1HQV A;  1IQ3 A;  1NX3 A;  1SPY A;  4Q04 A;  3WNX B;  1A29 A;  4AQJ A;  1JUO A;  1CFD A;  1EL4 A;  3JVT B;  2PAL A;  1RFJ A;  1N65 A;  1S1E A;  2M97 A;  2ZND A;  1DF0 B;  1IH0 A;  3NSL A;  4C0J A;  1IGV A;  2HET A;  1OZS A;  1A75 B;  1WRZ A;  1SYM A;  1BU3 A;  1QIW A;  3JTD C;  3I5F B;  2ISD A;  1TCF A;  1KFX S;  2NZ0 A;  1CLM A;  1CDL A;  2FCD A;  2KI6 D;  1LA0 A;  3WHT B;  3SG6 A;  1F54 A;  4JPZ B;  1AJ5 A;  3CZT X;  1ZOT B;  3IQO A;  1DJG A;  4GAO A;  2JQ6 A;  2KGB C;  1DJH A;  2MLE C;  2Y1M A;  1BT6 A;  2CT9 A;  1TTX A;  1XFW O;  1C7W A;  1QX2 A;  1B1G A;  3SIB A;  3TUY C;  1U5I B;  1B8R A;  2LVV A;  1SRA A;  1CFC A;  1DMO A;  1B9A A;  2I2R E;  1S3P A;  2F2O A;  2M0R A;  3TS5 C;  1HT9 A;  2LC5 A;  1XFU O;  3PSR A;  5DKQ A;  1QXP A;  1SCM C;  2F33 A;  4P5O E;  1M45 A;  2BCB A;  4AOM A;  1BR4 B;  5CPV A;  2JU0 A;  1G8I A;  4OKH A;  2HPS A;  3LL8 B;  4FQO A;  3I5I B;  1K8U A;  2COL B;  3GOF A;  2LE9 B;  1CNP A;  1QV1 A;  1F4O A;  4USL A;  1EXR A;  1IJ5 A;  2LAP A;  3DF0 B;  1L7Z A;  1TN4 A;  2LMV A;  1NCY A;  3GK1 A;  1GGW A;  1WRL A;  2ZN9 A;  1OOJ A;  3RM1 A;  1H8B A;  1QVI Z;  1ALW A;  2LMT A;  5KTY A;  1SK6 D;  1UHK A;  1CLL A;  1IQ5 A;  3RLZ A;  3BUW B;  3EK7 A;  1RK9 A;  4UPG A;  1TIZ A;  2KFH A;  3NSK A;  1D1O A;  3CGA A;  2M8U A;  1SMG A;  2R2I A;  1CDP A;  4CFQ A;  1AJ4 A;  1K93 D;  2EC6 C;  2WCB A;  1R6P A;  1JFK A;  2KYC A;  3CR2 A;  4NDC A;  1F55 A;  1OFC X;  3I5H C;  1W7J B;  2LUC A;  3JTD B;  1CB1 A;  1OMR A;  1YVL A;  3O78 A;  4MBE A;  1MF8 B;  2LLS A;  2MAZ A;  4MVF A;  3EKH A;  5IBW A;  1BOD A;  2KAY A;  2V53 A;  3EK4 A;  3HX4 A;  1MXL C;  4OV2 A;  4HRH A;  1NX2 A;  1LA3 A;  1S6C A;  2SCP A;  1NP8 A;  3CR5 X;  1R2U A;  2F3Y A;  4YGE B;  2LHL A;  1QX7 A;  1IWQ A;  5AXI A;  2BEC A;  1RJV A;  1X02 A;  3PLF B;  2WC8 A;  2L51 A;  5CSJ A;  4I5J A;  3TUY B;  1NWD A;  1WLM A;  4ORB B;  2F8P A;  4MZK A;  2Y1N A;  4QJ4 B;  2G9B A;  3TS5 B;  2CBL A;  1UUR A;  3BUM B;  1QX5 B;  3LCP C;  1SCM B;  5BPJ A;  2JZI A;  1V1G A;  3IQQ A;  1FI6 A;  1MQ1 A;  1ALV A;  4HRE E;  3FWC A;  1XA5 A;  2TN4 A;  3PAL A;  5KSZ A;  3LLE A;  1LKJ A;  1OQP A;  2MLF C;  1SL9 A;  2B1U A;  3SJS A;  1UHH A;  4M2P A;  1YRT B;  1XK4 A;  2NXQ A;  4MZJ A;  3FS7 A;  1B7T Z;  1YRU B;  2M1U A;  2HQ8 A;  4PE1 A;  1EJ3 A;  3C1V A;  2JTZ A;  1AHR A;  1NUB A;  2FOT A;  1BOC A;  4XYN A;  1TOP A;  1Y1A A;  3DVJ A;  2JOJ A;  1CKK A;  2KFF A;  1K9P A;  1KWO C;  2LVJ A;  1CTR A;  2OTG C;  3NSO A;  2EC6 B;  1S5G Z;  2LP3 A;  1NCZ A;  3I5H B;  2L98 A;  2WND A;  1Y1X A;  2ZN8 A;  3NXA A;  2WOS A;  1K2H A;  3EVR A;  2PSR A;  2GV5 A;  5ER5 A;  4YI8 A;  2I18 A;  1KQM C;  1SW8 A;  2K2A A;  3HCM A;  1KCY A;  1BMO A;  4HSZ A;  2BL0 C;  1Y0V H;  1E8A A;  1NCX A;  1KQV A;  4I5L B;  2M7L A;  1GQM A;  1DJY A;  5AAN A;  1LXF C;  4U8D A;  1J7P A;  1CLB A;  4MRY A;  1XYD A;  1TRF A;  1KK8 C;  1DVI A;  1SR6 C;  1YUU A;  3BQ3 A;  3PAT A;  3EK8 A;  1MHO A;  1BG1 A;  5TNC A;  1M39 A;  1K9K A;  1UHJ A;  2H61 A;  2JXC A;  2K7O A;  2NLN A;  1QLK A;  3FWB A;  3H4S E;  4MN0 A;  4PAL A;  2LM5 A;  1MWN A;  1A03 A;  2M7N A;  1XK4 C;  2KGR A;  1YR5 A;  1YUT A;  3F45 A;  3EVU A;  4GNK B;  5JOL A;  2L2E A;  2M29 A;  2MRD A;  3ZWH A;  1FF1 A;  1JC2 A;  3FIA A;  2Y4Q A;  1B47 A;  2E30 A;  4PHK A;  1CFF A;  3BOW A;  1PUL A;  1F4Q A;  3ICB A;  4ORC B;  2AUC A;  2M49 B;  2Y9Y A;  2P6B B;  1A4P A;  2I94 A;  5DKR A;  1KWO B;  2M9G A;  1XVJ A;  1C7V A;  2OTG B;  4PE0 A;  4YGD B;  1OZO A;  4OVN F;  1FI5 A;  3DVM A;  1B8L A;  2ZRS A;  1PK0 D;  1G33 A;  3WHU B;  1Q80 A;  3DVE A;  1BF5 A;  5G08 A;  1G4Y R;  4CPV A;  2BE6 A;  2H2K A;  4MLW A;  4GFT A;  1KQM B;  2QAC A;  4N1F A;  5CSI A;  4OR9 B;  4GBA A;  1PSB A;  1KFU S;  2BBN A;  2KAX A;  2BL0 B;  1ZFS A;  3WXA A;  2LUX A;  4L9M A;  2KSP A;  1KFX L;  2AAO A;  1SBJ A;  2BKH B;  4CID A;  5KU1 A;  2E6W A;  4WQ3 A;  2MBX A;  1IRJ A;  4WQ2 A;  1BR1 B;  1ODB A;  3CR4 X;  2K7C A;  4PE4 A;  3VGO A;  2ZKM X;  1KK8 B;  1ZUZ A;  5HKW A;  1SR6 B;  2LV7 A;  4YRU A;  5ER4 X;  2IS9 A;  4YGA A;  4NDD A;  1XFZ O;  3TDZ A;  2JRF A;  5HYD A;  3KHE A;  4XJK B;  2QPT A;  2H61 C;  2L4I A;  2BE4 A;  3BUN B;  4N5X A;  5I2Q A;  4E68 A;  2KBM A;  3O2P A;  3I5G C;  2EGD A;  2ZFD A;  1UP5 A;  2F3Z A;  2KOT A;  3CTN A;  3TZ1 A;  1GJY A;  2CCM A;  1QLS A;  3PFV A;  4JQ0 D;  4FTG A;  3OP0 A;  4QJ3 B;  3EVV A;  1UWO A;  5PAL A;  2L5X B;  1SNL A;  4DCK A;  1TNX A;  3O4Y A;  4XJK A;  1WY9 A;  3SIA A;  5AFP A;  3KF9 A;  1IKU A;  2JUL A;  1NX1 A;  1S6I A;  2MHH A;  4MEW A;  1IG5 A;  1WDC C;  1L2O C;  5HLV A;  4CLN A;  3SG7 A;  2JT3 A;  4PHJ A;  1SKT A;  5D7F A;  2WCF A;  3LK1 A;  3QRX A;  5AEQ A;  2BCX A;  4ZCV A;  1J55 A;  1KFU L;  1OSA A;  2O5G A;  3IF7 A;  1YTZ C;  1TNW A;  4ETO A;  4GGF A;  1PVA A;  1M46 A;  1MR8 A;  2BCA A;  1AP4 A;  2GGM A;  1K90 D;  2CXJ A;  3TDU A;  1K94 A;  4A4C A;  3PM8 A;  1F71 A;  2OPO A;  1TCO B;  1S6J A;  5I8N A;  2LNK A;  1UUS A;  4YI9 A;  2BKI B;  4DRW A;  2OS8 C;  1LVC D;  2KQ6 A;  1VRK A;  4PCW A;  1J7Q A;  5F6T A;  4BY4 A;  2KI4 C;  3OX6 A;  1CFP A;  5JJG A;  2JT8 A;  2AMI A;  1KSM A;  2K7D A;  1YX8 A;  2KDH A;  1RWY A;  2L50 A;  1QIV A;  4N1G A;  5AER A;  1BJF A;  1ZMZ A;  1RTP 1;  1WLZ A;  5HLO A;  2I7A A;  1QTX A;  1CM1 A;  2G2B A;  3O6B A;  4YGB B;  1CMF A;  5CSN A;  1K96 A;  2CTN A;  2JNX A;  3D0Y A;  1YVH A;  1TNP A;  1OMV A;  2K2F A;  2Q91 A;  3E3R A;  1PVB A;  4I5K A;  3OX5 A;  2D8N A;  5J3X A;  2JT0 A;  2MA2 A;  3PN7 C;  3I5G B;  5I2L A;  4MZL A;  2K0J A;  1CDM A;  5D69 A;  4NQG A;  4PE7 A;  1Y1U A;  3BYA A;  1QVI Y;  1DGV A;  3AAJ A;  3D10 A;  3AKB A;  1V1F A;  4GUK A;  2HQW A;  1SL7 A;  1W7I B;  2LAN A;  1J7O A;  1AUI B;  1KK7 Y;  3BUX B;  3MSE B;  1NPQ A;  4F0Z B;  2KFG A;  4YBH B;  1IJ6 A;  2PMY A;  3BOW B;  2CNP A;  1SY9 A;  1WDC B;  1L2O B;  2LLU A;  3KO0 A;  4MSP A;  2KHN A;  1RRO A;  3OB2 B;  5K89 A;  2KI6 C;  3VRQ A;  1A2X A;  1KSO A;  1MUX A;  2KBI A;  1QS7 A;  2EHB A;  1N2D A;  3OB1 B;  2PAS A;  3SG2 A;  3A8R A;  1EG3 A;  1N0Y A;  4GGF C;  3LK0 A;  1Y6W A;  4ICB A;  2Y9Z A;  1WRK A; 
#chains in the Genus database with same CATH topology
 1DJZ A;  1QV0 A;  2V7Q J;  1YQ4 C;  2OS8 B;  2HR3 A;  2JDI H;  3SSU A;  1DT7 B;  2Q9I A;  1VDF A;  2KNC A;  2L5G B;  1DF0 A;  3FGA D;  2WCE A;  3IR9 A;  1RQU A;  1A75 A;  2KLV A;  1T14 A;  1YHQ P;  4IFF A;  2BBM A;  1S5L E;  1NTK D;  1JOC A;  3NSI A;  2LVK A;  1H4B A;  1FDI A;  3LIE A;  1HH0 A;  1AFO A;  1LP1 B;  3V2P A;  2R3S A;  4PHN A;  2OYI A;  1AK8 A;  1JTH A;  4PD4 I;  3D73 A;  4PT1 A;  1VQ9 P;  1SQV D;  1N73 C;  4ORA B;  2ZXE B;  1VQ6 P;  3SG3 A;  1VL2 A;  3HE5 A;  3AAK A;  1NYA A;  1FBV A;  1P84 I;  1CM4 A;  2N1T D;  4GGN A;  1N8R Q;  1GTW A;  2JPO A;  5FI6 A;  3D78 A;  3VRO A;  4I1L A;  1CMG A;  2Y5I A;  1G1J A;  2K60 A;  3R1V A;  5FYX A;  3KPE A;  2KYF A;  2KAV A;  5HKZ A;  5B66 E;  2SAS A;  3CWB G;  1REC A;  1NU1 G;  4ZKP A;  2PRR A;  1VQN P;  2BAS A;  3V2L A;  2OQQ A;  4QMA A;  1JY2 O;  2B9B A;  1F70 A;  1JSA A;  1X22 A;  5M1B A;  3B71 A;  2FYU J;  3CS1 A;  3CWG A;  3PJS K;  3T97 A;  3CZ1 A;  3I5F C;  5AW8 B;  3VRR A;  1QL1 A;  2KQY A;  2XU6 A;  2B87 B;  1BDC A;  3AKA A;  2JWW A;  1B8C A;  5DKN A;  1NTK K;  2K88 A;  2JR8 A;  5CCG D;  1GW4 A;  1KB9 I;  1J1D C;  2WCJ A;  2ZRT A;  1JF2 A;  3CAB A;  1GD2 E;  3GF7 A;  1BCC G;  3L75 D;  1LIN A;  2Q1K A;  1SQP G;  1SQQ G;  2E43 A;  3H1I G;  1QAT A;  4UB6 E;  2K1A A;  1FS0 E;  2K61 A;  3CC7 P;  1OZH A;  2WVR A;  3EFG A;  1GL2 C;  1EH2 A;  3L72 D;  3R1O A;  1KIL B;  2F2P A;  4GOF A;  4H44 C;  1SQV E;  3CME P;  1RQV A;  2QJP C;  3U1A A;  3E1R A;  1SFC A;  1NX3 A;  1SPY A;  4Q04 A;  4AQJ A;  1JUO A;  1CFD A;  3JVT B;  1Q2N A;  3KZI H;  1VPC A;  2M97 A;  1IGV A;  2HYN A;  5B5E E;  2OYO A;  3HUS B;  5GTI E;  1KFX S;  2NZ0 A;  1CLM A;  3PLN A;  2KIK A;  2KI6 D;  5AVU B;  1LA0 A;  4IJ7 A;  3B6X A;  3SG6 A;  1NKZ B;  4JPZ B;  1AJ5 A;  3CZT X;  2OGU A;  1DJH A;  2UWJ E;  2CT9 A;  3K1E A;  1XFW O;  1B1G A;  2QSI A;  2LVV A;  1SRA A;  1CFC A;  1DMO A;  2M0R A;  2I1K A;  5CCH C;  1RE4 A;  1J1E C;  1FZB A;  1SCM C;  3HTK B;  5CPV A;  2OTJ P;  1G8I A;  2HPS A;  3LL8 B;  3I5I B;  1BDD A;  3BFB A;  1CNP A;  1QV1 A;  1RH5 B;  4PJ0 H;  3M0D C;  3GK1 A;  1WRL A;  3L75 E;  1H8B A;  4Y99 C;  3RK2 C;  1S9K D;  5KTY A;  1IQ5 A;  1X79 B;  1FC2 C;  2B89 A;  2FYU D;  3L72 E;  1TIZ A;  2KFH A;  3VB1 A;  1JY2 P;  3CGA A;  1SMG A;  2K37 A;  4CFQ A;  1AJ4 A;  1R8E A;  1R6P A;  1S3J A;  1KQF B;  3H1J G;  1XFR A;  2I8D A;  3I5H C;  1W7J B;  3JTD B;  1CB1 A;  3O78 A;  1HJB A;  3RK3 C;  4MVF A;  2POH A;  1BOD A;  2JO1 A;  3Q3D A;  3HX4 A;  1MXL C;  2J5U A;  2M5A A;  4OV2 A;  3CWB J;  3AED C;  3SWY A;  1Y9B A;  1NU1 J;  3DXL A;  3CXH E;  5APX A;  4PD4 H;  3S0D A;  4YGE B;  3V4W A;  2LHL A;  1NTM G;  3PLF B;  3TUY B;  1NWD A;  1WLM A;  1E79 H;  3A0B H;  3TS5 B;  1P84 H;  1V1G A;  1XA5 A;  3PAL A;  5KSZ A;  3LLE A;  1LKJ A;  1LT9 A;  5KKZ C;  1L0N K;  4ZMD A;  3FE6 A;  4PV1 C;  3FS7 A;  1YRU B;  2KZI A;  5AVT B;  1EJ3 A;  3C1V A;  1BCC J;  2YXR B;  3HE4 B;  2H7H A;  1NUB A;  1SQP J;  1ZP0 C;  3P8M C;  1SQQ J;  3FXD A;  2ZFC A;  2A06 G;  2C9L Y;  1Y1A A;  1LTJ B;  3A5T A;  2LVJ A;  2W83 C;  1NYH A;  2E76 C;  1NCZ A;  3I55 P;  1Y1X A;  3JC2 2;  2IYO A;  3EVR A;  5CHX A;  1OX3 A;  1KOR A;  5KJ7 C;  1JMM A;  5APV A;  1KQM C;  1SW8 A;  2K2A A;  2AEM A;  1S9K E;  3CCS P;  2PFX A;  2BL0 C;  1Y0V H;  1KB9 H;  1RF0 A;  2FYU E;  2WSS H;  1L4A C;  4N6J A;  1IFJ A;  1M1J C;  3TDK A;  1CLB A;  4MRY A;  1ZME C;  1KK8 C;  1JY3 N;  2WPR A;  3BQ3 A;  3PAT A;  1MHO A;  5TNC A;  3JCU E;  1K9K A;  3NHT A;  2E75 C;  3D6Y A;  2NLN A;  5FI7 A;  1QLK A;  1A03 A;  3GHG B;  3IF4 A;  1XK4 C;  2IDB A;  1W2B O;  3CPW O;  5JOL A;  2L2E A;  2YGU A;  1FF1 A;  2BCC G;  1JC2 A;  1YTZ T;  1BE3 G;  1B47 A;  3K5B A;  3HD7 C;  3MUD A;  4BXL A;  2M49 B;  2WZ7 A;  2P6B B;  5DKR A;  1C7V A;  1KWO B;  2M9G A;  2OTG B;  2CPB A;  5AW7 B;  2FXO A;  5CCH D;  1LWU C;  2ZRS A;  3CWB D;  4YXD C;  1NU1 D;  4CPV A;  1YBK A;  2QAC A;  1Z4H A;  1PSB A;  1KFU S;  2OYH C;  2KS1 B;  3NGV A;  1LTJ C;  1OW6 A;  4WQ3 A;  3RK2 D;  3AEE C;  5FI2 A;  1USD A;  2R3C A;  3VGO A;  5HKW A;  3L4A A;  5ER4 X;  1QVG O;  1NTZ J;  2H61 C;  5I2Q A;  1LP1 A;  1FZC C;  1IK9 A;  1QL2 A;  3O2P A;  1EZV G;  1BCC D;  1UP5 A;  2KOT A;  1URQ C;  2JWD A;  1KQS O;  1GJY A;  3PFV A;  3RK3 D;  1PL5 A;  1SQP D;  1SQQ D;  3EVV A;  2L91 A;  3BCC J;  2NPS B;  1WY9 A;  3KF9 A;  2JUL A;  1VQ5 P;  1HWT C;  4CPG A;  2RH0 A;  1KD1 Q;  1X0T A;  3SS4 A;  2JT3 A;  4PHJ A;  3GLM A;  3LK1 A;  1M90 Q;  2E42 A;  2O5G A;  3R1P A;  1IO4 A;  4GGF A;  3H1L G;  2XZR A;  4IL6 E;  1M46 A;  3G6E P;  4EDF A;  1K90 D;  2CXJ A;  1IFI A;  4A4C A;  3PM8 A;  1F71 A;  4PV1 D;  2LNK A;  1EDI A;  1OVU A;  2QEV A;  1J7Q A;  3V6I A;  3NHI A;  1EC5 A;  4I7Z B;  1CFP A;  1DEK A;  1IFP A;  2AMI A;  2N1T B;  3NMD A;  2K7D A;  1YX8 A;  1RWY A;  1FOS F;  1Q86 Q;  5AER A;  3CWB E;  1NU1 E;  1RTP 1;  2I7A A;  3O6B A;  5CSN A;  1LTT C;  2P7J A;  1H88 A;  2CTN A;  2JNX A;  1OMV A;  3S9O A;  2E76 D;  3L70 G;  2B87 A;  3CCU P;  4I5K A;  3H6P A;  3ITK A;  3MGN A;  3H32 B;  1CDM A;  5KJ7 D;  3AKB A;  3D77 A;  1V1F A;  4GUK A;  2B88 A;  4XA4 A;  1CZQ A;  2LAN A;  1J7O A;  1AUI B;  4OGQ C;  3MSE B;  2KFG A;  4YBH B;  1SQB G;  2PMY A;  3ZDM A;  3PHL A;  1S2E A;  1SY9 A;  3Q5R A;  4H13 D;  3B5N C;  1KIL A;  1MZ9 A;  2IYP A;  2KOG A;  1A2X A;  2KBI A;  1BCC E;  1Y47 A;  4WB4 A;  1SQP E;  4GT1 A;  1SQQ E;  3H1I E;  3LK0 A;  1NO4 A;  2Y9Z A;  2PYQ A;  3LW5 H;  2WSF H;  3L74 G;  4M2Q A;  3N7H A;  1BE3 J;  1ZAC A;  2FXP A;  1JB0 J;  1VF5 C;  1HF9 A;  2KI4 B;  2NCO A;  2K7B A;  2I1J A;  2JXL A;  3C9I A;  1K95 A;  1NTZ D;  3FWL A;  2LCP A;  1SQX K;  3HD7 D;  4IFM A;  3HUS A;  3O6Q A;  2QM8 A;  2YIU C;  1PGP A;  4WRI A;  1QLE D;  1S5L H;  2RGI A;  2IFM A;  4D1E A;  1VQ8 P;  3K21 A;  3SS3 A;  4WBA A;  2FCE A;  3TDI A;  1B7T Y;  1K9U A;  2FJU B;  3BCC D;  2WC5 A;  4IL1 A;  1R5S A;  2ZJS E;  4AUW A;  2LMU A;  3CXH I;  2QM7 A;  1XFV O;  3QME A;  1L0L K;  3HTK A;  3L4F A;  2JNF A;  5B8I B;  1QAS A;  2WCK A;  3L35 A;  2L4H A;  2KK7 A;  3PTZ A;  1EDL A;  2DOQ A;  4HB1 A;  1MXE A;  2ZNE A;  1N2D C;  4B86 A;  3W67 A;  2R44 A;  1AQ5 A;  1PGJ A;  3G71 P;  1IJD B;  2A06 D;  3F5H A;  3MHV A;  1IK7 A;  1JFJ A;  5B66 H;  4INW A;  5EFW B;  1J2J B;  1DEB A;  1YUR A;  3CCL P;  3V2R A;  2LR2 A;  1A02 F;  5CCG C;  5HKY A;  3BRV B;  1DJW A;  1CI6 B;  1JF0 A;  3TGU G;  1AV1 A;  5CSF A;  3H1L J;  3OA7 A;  1QJT A;  2CPS A;  3D0Y B;  1YIT P;  1K05 A;  4I5N B;  1OW7 A;  2KXP B;  2W27 A;  3V5B A;  3BXK A;  4P2Y B;  1YX7 A;  3A4U B;  3H1J E;  4MN4 C;  4OCI A;  1N73 B;  3DY9 A;  3VYI A;  2LHI A;  1SLQ A;  4QJ5 B;  2IBZ G;  1LJ2 A;  3VRP A;  1OMI A;  4GIF A;  2PQL A;  2LXC B;  3AE7 C;  1X8Y A;  4MRX A;  4HKZ H;  2AXC A;  1FW4 A;  2WOR A;  1NX0 A;  1SP4 A;  1NTM E;  4UB6 H;  3GK4 X;  3TSI A;  1B4C A;  1H89 A;  3BCC E;  1M8O B;  4L75 A;  2H8V A;  1PRW A;  1BE3 D;  5AVX B;  1IQ3 A;  2IBZ I;  3HE4 A;  1SQB J;  2Q6Q A;  4OZD A;  1OZS A;  2ZVO B;  1WRZ A;  1VQK P;  3SFE C;  3I5F B;  2ISD A;  1TCF A;  3GG2 A;  3MD0 A;  2A06 E;  3B5N D;  5B5E H;  2YXQ B;  5GTI H;  2J58 A;  2Y0E A;  3L74 J;  4XE5 B;  2Q5U A;  2WIT A;  3WHT B;  3IQO A;  1J1D B;  2JQ6 A;  2Z5H A;  1KTM A;  2MLE C;  4EI2 A;  1TTX A;  1ZN5 A;  1C7W A;  1QX2 A;  1DIP A;  3OGN A;  1B8R A;  1B9A A;  1VF5 D;  5GTH E;  3NTN A;  2LXB A;  3CMA P;  1EDJ A;  1XFU O;  2ZT9 C;  2F33 A;  4AOM A;  1M45 A;  1GL2 B;  4GOE A;  4HJG H;  4H44 B;  2DW3 A;  3R2P A;  4USL A;  1F4O A;  2ITA A;  1U7J A;  2QJP B;  3DF0 B;  1QVF O;  2OAR A;  4H0L C;  2ZN9 A;  1QVI Z;  1ALW A;  1SK6 D;  4R4M A;  1GMJ A;  5AVV B;  3RLZ A;  4I6M C;  1RK9 A;  4UPG A;  1PP9 G;  2L5Y A;  2AEJ A;  1RF0 C;  3H1L D;  1FOS E;  2M8U A;  1SFC D;  1CDP A;  3A2A A;  1K93 D;  3BFH A;  2IFN A;  3CC2 P;  2BCC E;  2IZ0 A;  3U1C A;  2LUC A;  4WVZ A;  1BE3 E;  1YVL A;  2JEE A;  2GUV A;  2V7Q H;  2MAZ A;  5IBW A;  2Y0C A;  4HRH A;  2K9J B;  2KS1 A;  2XDJ A;  2L2C A;  1OW8 A;  3CXH H;  2FXM A;  1IWQ A;  5AXI A;  2BEC A;  1X02 A;  4FQT A;  2WC8 A;  1OIP A;  3TGU J;  3TF5 A;  2KPH A;  1UUR A;  1J1E B;  1QX5 B;  1W9Z A;  1SCM B;  5BPJ A;  3N4X A;  1FI6 A;  1MQ1 A;  1LGH B;  1ALV A;  3FWC A;  2TN4 A;  2MLF C;  1HTL C;  2WWW A;  2M1U A;  1SQV K;  1SQB D;  5DIC A;  2HQ8 A;  4PE1 A;  2MKV A;  4Y99 B;  5KLV G;  2O01 J;  2A45 G;  2NPS A;  3KYQ A;  3RK2 B;  3CCE P;  1AHR A;  1NAF A;  1BOC A;  4WY4 C;  4XFJ A;  1EZV E;  2H88 C;  1K9P A;  1HVV A;  2WSC J;  3B8E B;  3TNU B;  3I5H B;  3H1H G;  3CCQ P;  2WND A;  2KUB A;  3L74 D;  2WOS A;  4RO0 A;  3RK3 B;  3CCR P;  2FKW B;  4W7Z A;  3CXH D;  4BRY B;  1LT1 A;  2JWA A;  4Y28 J;  4ZKU A;  1NCX A;  1S72 P;  4I5L B;  1CW5 A;  3S1K A;  3H1L E;  2M7L A;  1NJI Q;  3VMZ A;  5AAN A;  2CK3 H;  1Z2C B;  1XYD A;  3OAK A;  2XKM A;  2W6B A;  1SR6 C;  1JY2 N;  1BG1 A;  1OWA A;  1BGY G;  2IPP A;  1UHJ A;  2JXC A;  2K7O A;  4LGD E;  3AEB C;  3KXD A;  3JCU H;  1TU3 F;  5KKZ B;  1KMI Z;  4PAL A;  1FZA A;  3H32 A;  4PV1 B;  5DJU B;  1VQ7 P;  2LM5 A;  2M7N A;  1YR5 A;  1YUT A;  3F45 A;  3AE9 C;  2MRD A;  2E30 A;  1IIO A;  3Q8I A;  1GK6 A;  1MFZ A;  2E76 B;  1OZO A;  4OVN F;  3NXS A;  1B8L A;  3BJH A;  2GUS A;  2ZT9 D;  1PK0 D;  1G33 A;  1JEK A;  4C7N B;  1MKM A;  1SQB E;  5AVW B;  1BF5 A;  2KSJ A;  2QEO A;  2BE6 A;  4OWF A;  1NKN A;  1KQM B;  5CSI A;  3BFA A;  2BL0 B;  1HJ0 A;  4L9M A;  2KSP A;  1W5C E;  1Y8A A;  1PP9 J;  5AVZ B;  3TGU D;  5KU1 A;  2E6W A;  1DEE G;  1L4A B;  2ZVN B;  4H0L D;  3B86 A;  1M1J B;  1BR1 B;  1ODB A;  3CR4 X;  2K7C A;  1KK8 B;  3L74 E;  1T6A A;  4YGA A;  3M91 A;  1XFZ O;  2R5D A;  3PP5 A;  3TDZ A;  3F89 A;  5HYD A;  3QH9 A;  1T3J A;  2QPT A;  2E75 B;  5BVZ A;  2L4I A;  4N5X A;  2KBM A;  2MJZ A;  2IBZ D;  1S4X A;  4F7F A;  2N9B A;  3II6 A;  3I56 P;  3AEF C;  1QLS A;  4JQ0 D;  1LTG C;  2WC6 A;  2L5X B;  1SNL A;  2E74 C;  3OBV A;  1IFN A;  1RE3 A;  3EFF K;  4XJK A;  3SIA A;  3HD7 B;  1RF1 C;  1NX1 A;  1S6I A;  2QIW A;  3M9Q A;  1WDC C;  2FFD C;  5AEQ A;  4ZCV A;  4JBZ A;  1KFU L;  3JSV C;  1LWU B;  1VQM P;  1OVV A;  1XTC C;  1PVA A;  2BCA A;  5KLV J;  3S0E A;  1K94 A;  4IOI H;  3CZ0 A;  4KYN A;  3H1I J;  3L71 G;  2OPO A;  1TCO B;  3A0H E;  4IL6 H;  3W68 A;  2OYH B;  4YI9 A;  4DRW A;  3NFQ A;  2W90 A;  5KAF E;  1NAY A;  1VQ4 P;  2KB7 P;  3OX6 A;  1SVF A;  2FYU K;  3H1K G;  3Q5S A;  2JT8 A;  4WY4 D;  3D71 A;  1TWO A;  2L50 A;  1N7S A;  1CI6 A;  4RKU J;  2AXT E;  1WLZ A;  5HLO A;  2KZJ A;  4W80 A;  3D0Y A;  4DZO A;  1YVH A;  2K2F A;  2Q91 A;  1VQP P;  3OX5 A;  3AE2 C;  1FZC B;  2JT0 A;  2MA2 A;  3PN7 C;  4Z1M H;  4MZL A;  1URQ B;  2K0J A;  3TGU E;  5D69 A;  1N73 A;  4PE7 A;  4JD9 A;  3BYA A;  5APW A;  1DGV A;  1G1I A;  4H13 C;  1TUJ A;  2HQW A;  1LTS C;  3UNW A;  3DZT A;  1YJ9 P;  3CI9 A;  3BVH A;  3BAS A;  5APY A;  3BOW B;  2CNP A;  4YPC A;  1BGY J;  2LLU A;  4MSP A;  1KC8 Q;  5TIS E;  2IBZ E;  1MUX A;  4JYB A;  2EHB A;  3OB1 B;  2KLU A;  3A8R A;  2RN0 A;  4W7Y A;  1PP9 D;  4GPL B;  2IX7 C;  4I2L C;  1AVO A;  2A4J A;  1K73 Q;  1UHI A;  2QDI A;  1M56 D;  3CD6 P;  2FJY A;  5CJ4 A;  4HRG A;  1S36 A;  1FZE A;  4HYT B;  2JTT A;  4C0L A;  3KQG A;  3L4L A;  4OH8 B;  4R4L A;  4M2O A;  2KNE A;  2WSE J;  2KP8 A;  1J7R A;  1AVS A;  1AJY A;  1J1D A;  5BU5 A;  2PRU A;  2WTY A;  3H1J J;  3AE8 C;  4BWN A;  1YUS A;  4OGQ B;  3S0A A;  5GQQ C;  4INX A;  2LLT A;  3VRN A;  1N86 A;  1DGU A;  1DTL A;  1S5G Y;  1SCV A;  1GL2 A;  1RHZ B;  2ZXX A;  3SG4 A;  3B5N B;  4PHM A;  3DYE A;  3FE9 A;  2P2U A;  5AW4 B;  1YJW P;  5KLV D;  1NTM J;  3H1I D;  1XFY O;  3DF0 A;  2NCP A;  2PVB A;  3T97 B;  4DUQ A;  1FPW A;  1S26 D;  3SG5 A;  1YIJ P;  1KIL D;  1PGQ A;  1WMK A;  1VF5 B;  3H1H D;  1NTK G;  3DVK A;  1U57 A;  2E74 D;  1PAL A;  1EZV I;  1NGM B;  5AVR B;  2FBW C;  3PRJ A;  1NSH A;  1DEL A;  4C0K A;  2YO2 A;  2WPV B;  2YIU B;  1PP9 E;  1F8H A;  1NU1 K;  2WPQ A;  3G4S P;  1QEX A;  1Q90 D;  1SL8 A;  1XO5 A;  2OYI C;  4R1E A;  1GM0 A;  3IFM A;  2QG4 A;  3H1K J;  1IFM A;  1BGY D;  4U7J A;  4U3F G;  3CLN A;  4AQI A;  2Q4U A;  5CCH A;  2NZ2 A;  1J1E A;  4DT0 A;  1QWV A;  1PV3 A;  1XTG B;  1WRG A;  3OJA B;  3RL0 C;  1OOI X;  3O8Z A;  1AVY A;  2QJY C;  5KLI C;  3DD4 A;  1HQV A;  1SQP K;  1SQQ K;  3VMY A;  1M57 D;  3WNX B;  3A7O A;  1A29 A;  4KT0 J;  1KFN A;  2JJL A;  3VP9 A;  5AVQ B;  2WCL A;  2PAL A;  1RFJ A;  1N65 A;  1S1E A;  4C0J A;  5KLV E;  2W6A A;  3MIW A;  3TNU A;  4N78 D;  4D6T G;  1SYM A;  1QIW A;  1AQT A;  2BEZ F;  5AVS B;  2BCC J;  1CDL A;  2FCD A;  1KIL E;  3L75 G;  4BRY A;  3H1J D;  3RBZ A;  1F54 A;  1ZOT B;  3H1H E;  3AE5 C;  4GAO A;  1BT6 A;  1DH3 A;  2LKM A;  1YQ3 C;  1YJN P;  1U5I B;  4C7R A;  2I2R E;  2FY8 A;  2F2O A;  2SPZ A;  4C46 A;  2LC5 A;  1QXP A;  4P5O E;  1NTM D;  2BCB A;  5GTH H;  5CJ0 A;  2HG5 D;  1BR4 B;  1ZR2 A;  2JU0 A;  1MFT A;  2OTL P;  5KTB A;  1K8U A;  2COL B;  2K9Y A;  2D2C D;  5L8R J;  3SFD C;  1IJ5 A;  2LAP A;  1JM0 A;  1TN4 A;  3U59 A;  2WPS A;  1SFC C;  1BGY E;  5AW3 B;  5C39 A;  3RM1 A;  2ZAE B;  2LMT A;  1CLL A;  3BUW B;  3EK7 A;  3MP7 B;  2W8Z A;  3CX5 E;  5APU A;  2KYV A;  1FJP A;  3NSK A;  1D1O A;  2EC6 C;  3CR2 A;  3P8C D;  1L2P A;  1T3U A;  1OFC X;  4C7N A;  1OMR A;  5KJ7 A;  1MF8 B;  1H0T B;  2LLS A;  5K5G B;  1C3Y A;  2V53 A;  1S1C X;  4ZNC A;  3H1K D;  1NX2 A;  1NP8 A;  2QJK C;  5TJH A;  4RJT A;  1L4A A;  1L0N G;  1M1J A;  2L51 A;  5CSJ A;  2QEB A;  4I5J A;  1DD3 A;  4N78 E;  2W6J H;  1NTZ K;  2Y1N A;  4QJ4 B;  2CBL A;  1OVR A;  2ZT9 B;  3BUM B;  1RE4 C;  1H8A A;  1JCD A;  3IQQ A;  1OOG A;  1BSH A;  4HRE E;  5KAI E;  4AQR D;  2P70 A;  1NWQ A;  2WCH A;  1OQP A;  1NTM K;  2B1U A;  3SJS A;  1UHH A;  4M2P A;  1XK4 A;  4MZJ A;  1B7T Z;  4H0L B;  3Q2Y A;  1KYO D;  4U3F J;  2BAP A;  4NPD A;  3HD7 A;  3EWK A;  1TOP A;  3L70 J;  3DVJ A;  2ZYA A;  2JOJ A;  2Z5I A;  4YTP C;  1CTR A;  2BCC D;  5CBO A;  3P32 A;  1LWU A;  1A02 J;  2ZN8 A;  2PSR A;  4YI8 A;  3WMM 0;  1FU1 A;  3HCM A;  1KCY A;  1BMO A;  3RL0 D;  2OYH A;  4HSZ A;  1LTI C;  1OOF A;  1LTJ A;  2N9Y B;  1KQV A;  3Q5P A;  2QEH A;  1EXJ A;  2M8R A;  3L73 G;  1M7L A;  1DJY A;  1LXF C;  3P8C E;  1J7P A;  2NRG A;  4D6T J;  3L71 E;  2H43 A;  1TRF A;  4A7P A;  1YUU A;  3LID A;  3B4S A;  1M39 A;  2H61 A;  1NOH A;  5AW1 B;  3V2Q A;  3H1K E;  1FZC A;  1LT9 C;  3H4S E;  2KLE A;  4MN0 A;  1BSN A;  1URQ A;  3A3Y B;  1DX7 A;  1LS8 A;  1CSB A;  2YMY A;  4GNK B;  1YTZ I;  3M06 A;  2QVA A;  3L36 A;  2G8Y A;  4WY4 B;  1EZV D;  2Y4Q A;  4PHK A;  3BOW A;  2FYZ A;  3ICB A;  4ORC B;  2Y9Y A;  1A4P A;  2I94 A;  1XVJ A;  4PE0 A;  1FBM A;  3GW6 A;  4YGD B;  3GHG A;  3BRT B;  2NPS D;  3DVM A;  1MUU A;  1K04 A;  3UIA A;  1Q80 A;  1N7S C;  3CCV P;  4MLW A;  1HGV A;  1PGO A;  1KYO E;  3I5C A;  4OR9 B;  3SWK A;  4EOT A;  3N7N A;  2BBN A;  2KAX A;  3L37 A;  1ZFS A;  3WXA A;  2LUX A;  3EQ2 A;  3M9H A;  1KFX L;  3AE1 C;  1SBJ A;  1Q7Y Q;  2WT7 B;  2FYN C;  2YO3 A;  1IRJ A;  1R5L A;  3M0A A;  1WT6 A;  1SR6 B;  2LV7 A;  4NDD A;  5AW9 B;  2KI7 B;  2JRF A;  3BUN B;  4E68 A;  2HPC B;  3I5G C;  2EGD A;  2F3Z A;  3CTN A;  4U3F D;  1JNM A;  3OP0 A;  1L0N J;  4NPE A;  4KHX A;  2H8P D;  5PAL A;  3L70 D;  4DCK A;  1PZQ A;  2IZ1 A;  3WU2 H;  1TNX A;  3O4Y A;  1Z56 A;  4TT3 H;  3MUD C;  1IG5 A;  2E5Y A;  3B5N A;  1L2O C;  4CLN A;  5DJT B;  1SKT A;  3QRX A;  4KJM A;  1OSA A;  3IF7 A;  1YTZ C;  4ETO A;  1MR8 A;  2Q7C A;  2GGM A;  1GU5 A;  5AVY B;  2P58 A;  1C3Z A;  2OS8 C;  3AE4 C;  3A0H H;  3UO9 A;  4D6T D;  5KAF H;  5JJG A;  2KDH A;  2RMZ A;  1W2E A;  1BJF A;  1QTX A;  1CM1 A;  2G2B A;  4YGB B;  1G2C B;  1CMF A;  2A45 I;  1K96 A;  3PM2 A;  2AXT H;  1NTK E;  1FDM A;  1PVB A;  2D8N A;  1S5L X;  4WWI A;  3S0G A;  4UB8 E;  2N1T A;  3AAJ A;  3D10 A;  3L73 J;  2QE7 H;  1FDO A;  1W7I B;  3O4X A;  5H2F E;  2E74 B;  2ERB A;  1T2K C;  1KK7 Y;  3BUX B;  1NPQ A;  1RF1 B;  3C8V A;  2H89 C;  1JMB A;  2C0X A;  1WDC B;  3KO0 A;  2KHN A;  1RRO A;  2FFD B;  3OB2 B;  3V4Q A;  3KDP B;  5TIS H;  1KQL A;  1N2D A;  4U3F E;  2PAS A;  5EL2 A;  1N0Y A;  3FE8 A;  4GGF C;  1OW4 A;  2O01 H;  5AFP A;  4ICB A;  1SQX G;  1X9V A;  3L70 E;  1SQB K;  1EDK A;  3O6Q B;  1PSR A;  1ZV8 A;  2YMK A;  4TNC A;  1NVO A;  2M3E A;  1JCC A;  1FE6 A;  2O1J A;  4DIR A;  2WSC H;  4LC1 A;  4ZCU A;  1OE9 B;  3QWO C;  5CCG A;  3CX5 I;  2YKP A;  3HRN A;  2OTK E;  1C07 A;  5I94 A;  1EXI A;  1L0L G;  1L0N D;  2KSE A;  1JWD A;  1D7M A;  3PN7 B;  1EG4 A;  1GGZ A;  2R5B A;  1N7S D;  4JWQ A;  4D6T E;  2Y0D A;  3OHM B;  1GDT A;  4H13 B;  2O60 A;  1KN7 A;  1QGK B;  1U5I A;  2M3W A;  3GK2 A;  1XFX O;  2VRG A;  4NDB A;  2HF5 A;  3RBX A;  3CCM P;  1NIW A;  2AEF A;  3S0B A;  1DC1 A;  3EKJ A;  2MJW B;  1M31 A;  3C1L A;  3GF3 A;  3M0W A;  2WQY C;  1KK7 Z;  1DQE A;  1KIL C;  1BLQ A;  3M9B A;  3BUO B;  2M1K B;  4A4B A;  3WU2 E;  3KPX A;  5AW0 B;  2PGD A;  3D70 A;  4ASV A;  1NTZ G;  1PPJ G;  1OMD A;  3JVT C;  1JY3 O;  2VRS A;  1JUN A;  3VMX A;  1SS1 A;  2HOD B;  5I2O A;  3BCC G;  2LP2 A;  1JBA A;  3HUS C;  1TNQ A;  2D2C B;  1H0T A;  3CL3 D;  3G9R A;  1UHN A;  1CDN A;  1KFM A;  2JPT A;  2E5T A;  1DJX A;  3L73 D;  2GM4 A;  4BY5 A;  3IN6 A;  2K8M B;  4NPF X;  3KEV A;  1HBW A;  2QA4 P;  3VN0 A;  1M63 B;  3H1H J;  2GGZ A;  2JC2 A;  1LNQ A;  2XNX A;  2LVI A;  2BEQ D;  4CFR A;  4PDZ A;  2PP6 A;  3VTP C;  5APS A;  4IFD K;  3VP8 A;  1L0N E;  1GW3 A;  2XV5 A;  2L0P A;  2O01 N;  3I5I C;  3ZNI A;  1PIX A;  3R72 A;  4DS7 A;  1DJI A;  4YGC B;  1FAV A;  1GL2 D;  4PD4 D;  3KHU A;  2C0W A;  3MZW B;  3KZI E;  4H44 D;  1EL4 A;  4EIJ A;  2KNC B;  2ZND A;  1IH0 A;  1DF0 B;  1T2K D;  3NSL A;  2J59 M;  2HET A;  1A75 B;  1NHL A;  1P84 D;  1BU3 A;  3JTD C;  4DOJ A;  2A45 H;  1SQX J;  2P67 A;  4RES B;  2OYI B;  1JTH B;  1KYO I;  1DJG A;  2KGB C;  2Y1M A;  4N3Y B;  2BNX A;  2M0B A;  3SIB A;  1FJK A;  3TUY C;  3HE5 B;  3OW2 O;  2D2C C;  4ASW A;  1S3P A;  3V2N A;  3TS5 C;  1HT9 A;  1KV4 A;  3PSR A;  5DKQ A;  4EYY Q;  5CMZ A;  3L73 E;  1L0L J;  4OKH A;  4FQO A;  3GOF A;  4PJ0 E;  2LE9 B;  3RL0 B;  2ZYD A;  2QJY B;  3BAT A;  5KLI B;  1EXR A;  1L7Z A;  1T8Z A;  4O9B A;  2LMV A;  1NCY A;  1GGW A;  1N7L A;  3VOP A;  3AEA C;  1OOJ A;  3PH0 A;  5HL1 A;  1KB9 D;  4WY4 A;  1UHK A;  1U7M A;  3B7A A;  1JY3 P;  1ZW0 A;  3FX0 A;  2R2I A;  1LTA C;  3CX5 H;  2WCB A;  1JFK A;  2KYC A;  4NDC A;  1F55 A;  3IVT A;  3WUU A;  4MBE A;  1YI2 P;  3AEC C;  2O3J A;  3EKH A;  2KAY A;  4PD4 E;  3EK4 A;  3TK1 A;  1OXZ A;  1GZL A;  1LA3 A;  2P10 A;  1S6C A;  2SCP A;  3MTU E;  3CR5 X;  1R2U A;  1IZN B;  2F3Y A;  4JYC A;  1OOH A;  1QX7 A;  1RJV A;  1UIX A;  2WT7 A;  5E79 H;  3A0B E;  2QRX A;  1P84 E;  3PJI A;  1SQV G;  4ORB B;  2F8P A;  1M1K Q;  4MZK A;  2G9B A;  5CBN A;  3LCP C;  3L71 J;  2JZI A;  2WSE H;  4LLH A;  2K9J A;  2RKL A;  2YNY A;  2HPC A;  1SL9 A;  5KAI H;  1YRT B;  4TLF A;  2NXQ A;  2P1J A;  1KZU B;  3GHG C;  3E1I A;  1SFC B;  2HFE D;  2JTZ A;  4GKG A;  2FOT A;  2XND H;  3LW5 J;  4XYN A;  1HUC A;  1USE A;  2WSF J;  5D3O A;  3CX5 D;  3CCJ P;  4L74 A;  2KLD A;  1CKK A;  2KFF A;  1KWO C;  4YXW H;  2OTG C;  1SQX D;  3NSO A;  2EC6 B;  1FZG A;  1S5G Z;  3RL0 g;  2LP3 A;  3M0D A;  1Q82 Q;  1IC2 A;  1RY3 A;  3R4Y A;  3EG5 B;  2L98 A;  3NXA A;  5KLV K;  1K2H A;  2GV5 A;  5ER5 A;  3B88 A;  2WMM A;  2I18 A;  5APT A;  1HGZ A;  1IFD A;  3CDN A;  1KB9 E;  1GK4 A;  3H25 A;  1E8A A;  2QJK B;  3CYZ A;  4GDO A;  4K3A A;  1GQM A;  4U8D A;  3RZS A;  1K9M Q;  1KQG B;  2P71 A;  1L0L D;  3AE3 C;  1DVI A;  3FXE A;  3EK8 A;  1ZOY C;  1G2C A;  4JF7 A;  1L4A D;  2QEX P;  1VQL P;  3FWB A;  2Q3I A;  1MWN A;  3L72 G;  2KGR A;  3RK3 E;  3EVU A;  4GOD A;  2E75 D;  2Z4E A;  2M29 A;  3ZWH A;  2NPS C;  1UII A;  3USS A;  3FIA A;  2YKQ A;  1RF1 A;  2GTE A;  1CFF A;  1PUL A;  2HLO A;  1F4Q A;  1FZF A;  2AUC A;  5APQ A;  3CZ2 A;  2FFD A;  3D6Z A;  1SSE B;  1FI5 A;  1PFI A;  1ZRT D;  3WHU B;  3DVE A;  1DD4 A;  1PPJ D;  5G08 A;  2Q3E A;  3CLQ A;  3TYY A;  1G4Y R;  2H2K A;  2GA1 A;  4GFT A;  4N1F A;  2R32 A;  4GBA A;  2M5A B;  1K8A Q;  3Q1M A;  1KYO H;  4IL6 X;  2AAO A;  2BKH B;  4CID A;  3D75 A;  4I7Z C;  3RGU A;  2MBX A;  3WUT A;  1SQX E;  1ZR4 A;  4WQ2 A;  2N1T C;  3GMA A;  3L71 D;  3VMA A;  4PE4 A;  2ZKM X;  1ZUZ A;  1QX8 A;  4YRU A;  2IS9 A;  3S0F A;  4L73 A;  3KHE A;  4XJK B;  2BE4 A;  4K35 A;  1AA0 A;  2JP3 A;  1LT9 B;  5E79 E;  2M3B A;  1NTK J;  2ZFD A;  3TZ1 A;  2CCM A;  3L47 A;  3AE6 C;  4FTG A;  4QJ3 B;  3G3Z A;  1UWO A;  2V4H A;  2O1K A;  2YKO A;  3D74 A;  1L0L E;  1SQV J;  2PAJ A;  1URQ D;  1IKU A;  1GU4 A;  2MHH A;  4MEW A;  4HH2 A;  3SWF A;  5HLV A;  3SG7 A;  5D7F A;  3IAO A;  2C9N Y;  2WCF A;  2BCX A;  3S4R A;  1J55 A;  2FYU G;  3SS5 A;  1ZLL A;  1TNW A;  2ZYG A;  1N7S B;  4AYC A;  3P7K A;  1AP4 A;  3TDU A;  3B87 A;  1VQO P;  1TUZ A;  1S6J A;  5I8N A;  1NH4 A;  1UUS A;  2BKI B;  1LVC D;  2KQ6 A;  1VRK A;  4PCW A;  1LTB C;  5F6T A;  4BY4 A;  5AW2 B;  2KI4 C;  2FYN B;  1KSM A;  2G3A A;  1QIV A;  4N1G A;  2HOD A;  1ZRT E;  1NTZ E;  1ZMZ A;  4M3L A;  3E7K A;  1PPJ E;  5AW6 B;  3AEG C;  4L76 A;  1TNP A;  1JO5 A;  3E3R A;  3CC4 P;  1E5W A;  2WCM A;  5J3X A;  1YYC A;  3I5G B;  5I2L A;  4DJG A;  4NQG A;  1Y1U A;  1QVI Y;  1ZXG A;  3ABV C;  4UB8 H;  1SL7 A;  1P28 A;  4F0Z B;  2JKV A;  1RE3 C;  5H2F H;  5BU8 B;  1IJ6 A;  2K3R A;  1Q81 Q;  3L75 J;  1L2O B;  5AW5 B;  3D76 A;  3FWN A;  5K89 A;  2KI6 C;  3VRQ A;  1KSO A;  4JKT A;  4OGQ D;  1ORG A;  1MV8 A;  1QS7 A;  3WUV A;  3L72 J;  3SG2 A;  1EG3 A;  1Y6W A;  1EQ7 A;  1WRK A; 
#chains in the Genus database with same CATH homology
 1DJZ A;  1QV0 A;  4GPL B;  1PSR A;  2A4J A;  4M2Q A;  2OS8 B;  4TNC A;  1ZAC A;  1DT7 B;  1UHI A;  2KI4 B;  2NCO A;  4HRG A;  2K7B A;  1S36 A;  4DIR A;  2JXL A;  4ZCU A;  1OE9 B;  1DF0 A;  1K95 A;  2WCE A;  1A75 A;  2LCP A;  2JTT A;  4C0L A;  2BBM A;  1C07 A;  4WRI A;  3NSI A;  2LVK A;  1H4B A;  4M2O A;  2KNE A;  2RGI A;  4D1E A;  3K21 A;  2FCE A;  3TDI A;  1JWD A;  3PN7 B;  1B7T Y;  1K9U A;  4PHN A;  1EG4 A;  1J7R A;  1GGZ A;  2FJU B;  1AK8 A;  4IL1 A;  4JWQ A;  1AVS A;  1J1D A;  2PRU A;  3OHM B;  4ORA B;  2LMU A;  2O60 A;  3SG3 A;  1XFV O;  1YUS A;  1U5I A;  2M3W A;  3GK2 A;  1XFX O;  2VRG A;  4NDB A;  2HF5 A;  5GQQ C;  1NIW A;  3AAK A;  3EKJ A;  2LLT A;  2MJW B;  3VRN A;  1M31 A;  1NYA A;  1FBV A;  1DGU A;  1DTL A;  1S5G Y;  1SCV A;  2JNF A;  3M0W A;  5B8I B;  1QAS A;  1CM4 A;  3SG4 A;  4GGN A;  4PHM A;  1KK7 Z;  2L4H A;  2DOQ A;  1MXE A;  1BLQ A;  2ZNE A;  3VRO A;  1XFY O;  3BUO B;  2M1K B;  2Y5I A;  4A4B A;  3DF0 A;  3KPX A;  1CMG A;  2NCP A;  2PVB A;  5FYX A;  2KYF A;  4DUQ A;  2KAV A;  5HKZ A;  1FPW A;  1S26 D;  2SAS A;  3SG5 A;  1REC A;  1JFJ A;  1OMD A;  3JVT C;  3DVK A;  1F70 A;  1JSA A;  1PAL A;  1YUR A;  5HKY A;  3CS1 A;  1DJW A;  5I2O A;  1JF0 A;  2LP2 A;  3CWG A;  1NSH A;  1JBA A;  5CSF A;  1QJT A;  1TNQ A;  4C0K A;  3I5F C;  1UHN A;  3VRR A;  1CDN A;  1F8H A;  2JPT A;  2KQY A;  3D0Y B;  4I5N B;  1DJX A;  3AKA A;  2JWW A;  1B8C A;  5DKN A;  3BXK A;  4BY5 A;  1SL8 A;  1XO5 A;  4P2Y B;  1YX7 A;  3A4U B;  2K8M B;  4R1E A;  3KEV A;  4OCI A;  2LHI A;  1JF2 A;  2ZRT A;  4QJ5 B;  1M63 B;  3VRP A;  1LIN A;  2GGZ A;  3CLN A;  2JC2 A;  4AQI A;  1QAT A;  2Q4U A;  1J1E A;  2LVI A;  4MRX A;  2K61 A;  4CFR A;  1FW4 A;  2WOR A;  4PDZ A;  1NX0 A;  1EH2 A;  3GK4 X;  1B4C A;  2F2P A;  2L0P A;  3I5I C;  3ZNI A;  4DS7 A;  1DJI A;  4YGC B;  1PRW A;  3DD4 A;  1HQV A;  1IQ3 A;  1NX3 A;  1SPY A;  4Q04 A;  3WNX B;  1A29 A;  4AQJ A;  1JUO A;  1CFD A;  1EL4 A;  3JVT B;  2PAL A;  1RFJ A;  1N65 A;  1S1E A;  2M97 A;  2ZND A;  1DF0 B;  1IH0 A;  3NSL A;  4C0J A;  1IGV A;  2HET A;  1OZS A;  1A75 B;  1WRZ A;  1SYM A;  1BU3 A;  1QIW A;  3JTD C;  3I5F B;  2ISD A;  1TCF A;  1KFX S;  2NZ0 A;  1CLM A;  1CDL A;  2FCD A;  2KI6 D;  1LA0 A;  3WHT B;  3SG6 A;  1F54 A;  4JPZ B;  1AJ5 A;  3CZT X;  1ZOT B;  3IQO A;  1DJG A;  4GAO A;  2JQ6 A;  2KGB C;  1DJH A;  2MLE C;  2Y1M A;  1BT6 A;  2CT9 A;  1TTX A;  1XFW O;  1C7W A;  1QX2 A;  1B1G A;  3SIB A;  3TUY C;  1U5I B;  1B8R A;  2LVV A;  1SRA A;  1CFC A;  1DMO A;  1B9A A;  2I2R E;  1S3P A;  2F2O A;  2M0R A;  3TS5 C;  1HT9 A;  2LC5 A;  1XFU O;  3PSR A;  5DKQ A;  1QXP A;  1SCM C;  2F33 A;  4P5O E;  1M45 A;  2BCB A;  4AOM A;  1BR4 B;  5CPV A;  2JU0 A;  1G8I A;  4OKH A;  2HPS A;  3LL8 B;  4FQO A;  3I5I B;  1K8U A;  2COL B;  3GOF A;  2LE9 B;  1CNP A;  1QV1 A;  1F4O A;  4USL A;  1EXR A;  1IJ5 A;  2LAP A;  3DF0 B;  1L7Z A;  1TN4 A;  2LMV A;  1NCY A;  3GK1 A;  1GGW A;  1WRL A;  2ZN9 A;  1OOJ A;  3RM1 A;  1H8B A;  1QVI Z;  1ALW A;  2LMT A;  5KTY A;  1SK6 D;  1UHK A;  1CLL A;  1IQ5 A;  3RLZ A;  3BUW B;  3EK7 A;  1RK9 A;  4UPG A;  1TIZ A;  2KFH A;  3NSK A;  1D1O A;  3CGA A;  2M8U A;  1SMG A;  2R2I A;  1CDP A;  4CFQ A;  1AJ4 A;  1K93 D;  2EC6 C;  2WCB A;  1R6P A;  1JFK A;  2KYC A;  3CR2 A;  4NDC A;  1F55 A;  1OFC X;  3I5H C;  1W7J B;  2LUC A;  3JTD B;  1CB1 A;  1OMR A;  1YVL A;  3O78 A;  4MBE A;  1MF8 B;  2LLS A;  2MAZ A;  4MVF A;  3EKH A;  5IBW A;  1BOD A;  2KAY A;  2V53 A;  3EK4 A;  3HX4 A;  1MXL C;  4OV2 A;  4HRH A;  1NX2 A;  1LA3 A;  1S6C A;  2SCP A;  1NP8 A;  3CR5 X;  1R2U A;  2F3Y A;  4YGE B;  2LHL A;  1QX7 A;  1IWQ A;  5AXI A;  2BEC A;  1RJV A;  1X02 A;  3PLF B;  2WC8 A;  2L51 A;  5CSJ A;  4I5J A;  3TUY B;  1NWD A;  1WLM A;  4ORB B;  2F8P A;  4MZK A;  2Y1N A;  4QJ4 B;  2G9B A;  3TS5 B;  2CBL A;  1UUR A;  3BUM B;  1QX5 B;  3LCP C;  1SCM B;  5BPJ A;  2JZI A;  1V1G A;  3IQQ A;  1FI6 A;  1MQ1 A;  1ALV A;  4HRE E;  3FWC A;  1XA5 A;  2TN4 A;  3PAL A;  5KSZ A;  3LLE A;  1LKJ A;  1OQP A;  2MLF C;  1SL9 A;  2B1U A;  3SJS A;  1UHH A;  4M2P A;  1YRT B;  1XK4 A;  2NXQ A;  4MZJ A;  3FS7 A;  1B7T Z;  1YRU B;  2M1U A;  2HQ8 A;  4PE1 A;  1EJ3 A;  3C1V A;  2JTZ A;  1AHR A;  1NUB A;  2FOT A;  1BOC A;  4XYN A;  1TOP A;  1Y1A A;  3DVJ A;  2JOJ A;  1CKK A;  2KFF A;  1K9P A;  1KWO C;  2LVJ A;  1CTR A;  2OTG C;  3NSO A;  2EC6 B;  1S5G Z;  2LP3 A;  1NCZ A;  3I5H B;  2L98 A;  2WND A;  1Y1X A;  2ZN8 A;  3NXA A;  2WOS A;  1K2H A;  3EVR A;  2PSR A;  2GV5 A;  5ER5 A;  4YI8 A;  2I18 A;  1KQM C;  1SW8 A;  2K2A A;  3HCM A;  1KCY A;  1BMO A;  4HSZ A;  2BL0 C;  1Y0V H;  1E8A A;  1NCX A;  1KQV A;  4I5L B;  2M7L A;  1GQM A;  1DJY A;  5AAN A;  1LXF C;  4U8D A;  1J7P A;  1CLB A;  4MRY A;  1XYD A;  1TRF A;  1KK8 C;  1DVI A;  1SR6 C;  1YUU A;  3BQ3 A;  3PAT A;  3EK8 A;  1MHO A;  1BG1 A;  5TNC A;  1M39 A;  1K9K A;  1UHJ A;  2H61 A;  2JXC A;  2K7O A;  2NLN A;  1QLK A;  3FWB A;  3H4S E;  4MN0 A;  4PAL A;  2LM5 A;  1MWN A;  1A03 A;  2M7N A;  1XK4 C;  2KGR A;  1YR5 A;  1YUT A;  3F45 A;  3EVU A;  4GNK B;  5JOL A;  2L2E A;  2M29 A;  2MRD A;  3ZWH A;  1FF1 A;  1JC2 A;  3FIA A;  2Y4Q A;  1B47 A;  2E30 A;  4PHK A;  1CFF A;  3BOW A;  1PUL A;  1F4Q A;  3ICB A;  4ORC B;  2AUC A;  2M49 B;  2Y9Y A;  2P6B B;  1A4P A;  2I94 A;  5DKR A;  1KWO B;  2M9G A;  1XVJ A;  1C7V A;  2OTG B;  4PE0 A;  4YGD B;  1OZO A;  4OVN F;  1FI5 A;  3DVM A;  1B8L A;  2ZRS A;  1PK0 D;  1G33 A;  3WHU B;  1Q80 A;  3DVE A;  1BF5 A;  5G08 A;  1G4Y R;  4CPV A;  2BE6 A;  2H2K A;  4MLW A;  4GFT A;  1KQM B;  2QAC A;  4N1F A;  5CSI A;  4OR9 B;  4GBA A;  1PSB A;  1KFU S;  2BBN A;  2KAX A;  2BL0 B;  1ZFS A;  3WXA A;  2LUX A;  4L9M A;  2KSP A;  1KFX L;  2AAO A;  1SBJ A;  2BKH B;  4CID A;  5KU1 A;  2E6W A;  4WQ3 A;  2MBX A;  1IRJ A;  4WQ2 A;  1BR1 B;  1ODB A;  3CR4 X;  2K7C A;  4PE4 A;  3VGO A;  2ZKM X;  1KK8 B;  1ZUZ A;  5HKW A;  1SR6 B;  2LV7 A;  4YRU A;  5ER4 X;  2IS9 A;  4YGA A;  4NDD A;  1XFZ O;  3TDZ A;  2JRF A;  5HYD A;  3KHE A;  4XJK B;  2QPT A;  2H61 C;  2L4I A;  2BE4 A;  3BUN B;  4N5X A;  5I2Q A;  4E68 A;  2KBM A;  3O2P A;  3I5G C;  2EGD A;  2ZFD A;  1UP5 A;  2F3Z A;  2KOT A;  3CTN A;  3TZ1 A;  1GJY A;  2CCM A;  1QLS A;  3PFV A;  4JQ0 D;  4FTG A;  3OP0 A;  4QJ3 B;  3EVV A;  1UWO A;  5PAL A;  2L5X B;  1SNL A;  4DCK A;  1TNX A;  3O4Y A;  4XJK A;  1WY9 A;  3SIA A;  5AFP A;  3KF9 A;  1IKU A;  2JUL A;  1NX1 A;  1S6I A;  2MHH A;  4MEW A;  1IG5 A;  1WDC C;  1L2O C;  5HLV A;  4CLN A;  3SG7 A;  2JT3 A;  4PHJ A;  1SKT A;  5D7F A;  2WCF A;  3LK1 A;  3QRX A;  5AEQ A;  2BCX A;  4ZCV A;  1J55 A;  1KFU L;  1OSA A;  2O5G A;  3IF7 A;  1YTZ C;  1TNW A;  4ETO A;  4GGF A;  1PVA A;  1M46 A;  1MR8 A;  2BCA A;  1AP4 A;  2GGM A;  1K90 D;  2CXJ A;  3TDU A;  1K94 A;  4A4C A;  3PM8 A;  1F71 A;  2OPO A;  1TCO B;  1S6J A;  5I8N A;  2LNK A;  1UUS A;  4YI9 A;  2BKI B;  4DRW A;  2OS8 C;  1LVC D;  2KQ6 A;  1VRK A;  4PCW A;  1J7Q A;  5F6T A;  4BY4 A;  2KI4 C;  3OX6 A;  1CFP A;  5JJG A;  2JT8 A;  2AMI A;  1KSM A;  2K7D A;  1YX8 A;  2KDH A;  1RWY A;  2L50 A;  1QIV A;  4N1G A;  5AER A;  1BJF A;  1ZMZ A;  1RTP 1;  1WLZ A;  5HLO A;  2I7A A;  1QTX A;  1CM1 A;  2G2B A;  3O6B A;  4YGB B;  1CMF A;  5CSN A;  1K96 A;  2CTN A;  2JNX A;  3D0Y A;  1YVH A;  1TNP A;  1OMV A;  2K2F A;  2Q91 A;  3E3R A;  1PVB A;  4I5K A;  3OX5 A;  2D8N A;  5J3X A;  2JT0 A;  2MA2 A;  3PN7 C;  3I5G B;  5I2L A;  4MZL A;  2K0J A;  1CDM A;  5D69 A;  4NQG A;  4PE7 A;  1Y1U A;  3BYA A;  1QVI Y;  1DGV A;  3AAJ A;  3D10 A;  3AKB A;  1V1F A;  4GUK A;  2HQW A;  1SL7 A;  1W7I B;  2LAN A;  1J7O A;  1AUI B;  1KK7 Y;  3BUX B;  3MSE B;  1NPQ A;  4F0Z B;  2KFG A;  4YBH B;  1IJ6 A;  2PMY A;  3BOW B;  2CNP A;  1SY9 A;  1WDC B;  1L2O B;  2LLU A;  3KO0 A;  4MSP A;  2KHN A;  1RRO A;  3OB2 B;  5K89 A;  2KI6 C;  3VRQ A;  1A2X A;  1KSO A;  1MUX A;  2KBI A;  1QS7 A;  2EHB A;  1N2D A;  3OB1 B;  2PAS A;  3SG2 A;  3A8R A;  1EG3 A;  1N0Y A;  4GGF C;  3LK0 A;  1Y6W A;  4ICB A;  2Y9Z A;  1WRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...