4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Fibroblast growth factor 12
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
2ZRSA 3DD4A 2H61C 5HLVA 1V1GA 2COLB 4P2YB 4YGDB 1CTRA 1YUTA 2M3WA 1J7QA 4Q04A 3GK2A 3OHMB 1WLZA 2LHIA 4CIDA 1F71A 2Y9YA 3GK4X 5IBWA 1NWDA 2JTZA 2KI4C 4PHMA 2M1UA 4XJKB 4DS7A 4NDDA 3D0YA 2ZKMX 3I5FB 1K90D 1HQVA 1SPYA 1YX8A 5DKQA 1TNXA 1QS7A 1XFVO 3EK7A 3AKAA 4QJ5B 3ZNIA 4YI9A 4D1EA 1JFKA 1KQMC 1VRKA 1K9KA 2MA2A 3DVEA 3OX5A 4N1FA 2K7BA 1YX7A 4YI8A 3M0WA 2ZN8A 1UHIA 3CS1A 4MVFA 4YGBB 1NIWA 1NSHA 1GQMA 1B7TZ 1OQPA 1L7ZA 2LLUA 4NQGA 1GGWA 1CFCA 2JXCA 1OMVA 2KAXA 2KFGA 1DJGA 1SCVA 1M63B 4QJ4B 1KQMB 1CM4A 3ICBA 5B8IB 1JBAA 2LMTA 3GK1A 1F55A 1PK0D 2P6BB 1YUSA 2KI6D 2L5XB 3O4YA 2FJUB 1BU3A 1YURA 1K96A 1KFUS 1TIZA 1ALVA 3SG3A 1B7TY 2F2PA 3I5HB 1QASA 2Y5IA 3EVRA 3OB2B 4YBHB 4CLNA 2FCDA 2LC5A 3CR2A 1OMRA 2HPSA 3VRNA 4A4CA 1QATA 5ER4X 3EVUA 3OB1B 4AOMA 1QV1A 2F3ZA 1L2OC 3KF9A 3O78A 3SJSA 2KHNA 3CR4X 1OFCX 1Y1AA 1CLLA 2M29A 4XJKA 2FCEA 3D0YB 1MUXA 1EJ3A 5HKYA 1F54A 1QX5B 1QLKA 3NXAA 4YGEB 1TTXA 1QX7A 2PMYA 4ORAB 4CFRA 1DJIA 5D7FA 1WY9A 4NDBA 1KSOA 2LLTA 2BECA 2BBMA 1XO5A 3KO0A 3PATA 4WQ3A 5F6TA 1V1FA 2H2KA 2PASA 1S36A 1CMFA 2OTGB 1KWOC 4DRWA 3O2PA 1CLBA 1PULA 1A4PA 1BJFA 1QV0A 2LMUA 3SIAA 1BT6A 2BCXA 2I7AA 2CCMA 1TNWA 3K21A 5KU1A 2KFFA 3NSIA 2JT0A 3JVTB 2K2FA 1ZUZA 2WNDA 2NCOA 3NSKA 1A75B 1L2OB 4PHJA 1PALA 3F45A 2K0JA 1S26D 1SK6D 3PSRA 2CNPA 1SL8A 2JRFA 3SG2A 3SIBA 2LV7A 1CFFA 2V53A 1JSAA 4MLWA 2JXLA 1DGVA 3I5IC 1ZACA 1JF2A 3E3RA 1MR8A 4ZCUA 3WXAA 1XFUO 5K89A 1GGZA 2KYCA 1OOJA 3CTNA 3ZWHA 1G33A 4ORCB 2BKIB 3EVVA 2M97A 1FI5A 1SNLA 2CXJA 1BOCA 1AVSA 1TNQA 2MBXA 1DJWA 1F4QA 1S3PA 4MEWA 1J1DA 2LMVA 3I5IB 1IQ3A 5HLOA 3FS7A 4USLA 2M1KB 3JVTC 2TN4A 1S1EA 3O6BA 2F2OA 1U5IA 2LP2A 2PRUA 2Q4UA 1A29A 1RROA 1UWOA 3CR5X 4GNKB 4PDZA 1J7OA 1KQVA 2ZNDA 1QIVA 1XK4C 4GPLB 1EH2A 1N0YA 4PCWA 5AXIA 2KI6C 1IG5A 1MXEA 5AERA 1CDPA 1AP4A 3I5HC 4JPZB 1FW4A 1S6CA 2WC8A 2KGRA 1OSAA 4ETOA 1YTZC 3CLNA 1IRJA 1XA5A 3A8RA 1CKKA 1SL9A 4R1EA 1XK4A 1UHJA 2KNEA 3IQQA 1AJ4A 1J7RA 1RFJA 2DOQA 3BUXB 5D69A 1M31A 3CZTX 2BBNA 2BCAA 2MAZA 5ER5A 3C1VA 4OCIA 1ZOTB 4UPGA 1KFUL 4IL1A 1CNPA 2Y1NA 1BODA 1HT9A 2MRDA 1QTXA 3A4UB 3VRRA 2NCPA 1UURA 2G9BA 1UHKA 3H4SE 2JWWA 1QVIY 1TCOB 4N5XA 1U5IB 4AQJA 2M49B 2GGMA 1J7PA 4N1GA 2GV5A 4PALA 1K94A 1G8IA 2LUXA 2ZN9A 1AK8A 1QJTA 1RWYA 3PFVA 3DVMA 3GOFA 5AANA 3WNXB 1CDNA 1S6IA 2L0PA 1GJYA 2OPOA 1MXLC 1D1OA 4OV2A 2M7LA 2SASA 1PSRA 2SCPA 3BXKA 1ZFSA 5KSZA 1N65A 2ISDA 3SG4A 1JUOA 1DJYA 2O60A 1BLQA 3EK8A 5I2QA 2AAOA 2K7CA 3FWCA 2M0RA 1CFDA 2OS8C 3DF0A 3JTDB 1F8HA 2I18A 3IQOA 2MHHA 1N2DA 1MHOA 1A75A 3DVKA 4GGFC 4JWQA 4YRUA 1S6JA 2GGZA 2WORA 5PALA 2JNXA 2L50A 2HF5A 2Q91A 2NXQA 1DT7B 2Y9ZA 2PVBA 2BE6A 1NCZA 2IS9A 2OTGC 2AMIA 4PHKA 1YR5A 4PHNA 4L9MA 3AAJA 1FPWA 1DJZA 1J55A 4I5NB 1KK8C 2B1UA 2LHLA 2F8PA 1AHRA 5HYDA 1IKUA 1B8LA 2K2AA 4C0JA 1NCYA 3FIAA 1QXPA 2LANA 2VRGA 2K8MB 2WCBA 3LK0A 1DGUA 4FQOA 3OX6A 1DTLA 3RM1A 1CFPA 2LP3A 2LNKA 2JULA 3VRPA 1OZOA 5JJGA 1KK7Z 2I94A 3HX4A 1KK8B 1JWDA 1W7JB 1R2UA 2JZIA 2Y1MA 4BY5A 4OKHA 1C7WA 2JT3A 2LVIA 3VROA 2LLSA 2JTTA 3BYAA 2WCEA 2MJWB 3TUYB 1QX2A 2JPTA 2KQYA 1LXFC 3KHEA 5I8NA 2KYFA 1ODBA 1ALWA 1XFYO 1LA3A 1NYAA 4DUQA 1YRUB 1H8BA 2LVKA 2L51A 1DF0B 1SYMA 2ZNEA 4M2QA 2KBMA 1BR4B 1QVIZ 3KEVA 3LLEA 2JQ6A 1LVCD 1NX3A 1JFJA 3LL8B 1SR6C 1NX0A 2AUCA 3VRQA 1C07A 3BUWB 1IQ5A 2KAVA 4CFQA 4HRHA 5AEQA 2I2RE 3IF7A 3AAKA 3WHTB 4YGAA 1NCXA 2BL0C 1B9AA 2M9GA 1FBVA 1YRTB 1MWNA 1MQ1A 3NSLA 1UUSA 1Y6WA 3OP0A 2L4IA 2LM5A 1B1GA 4MN0A 5G08A 2HQWA 5I2LA 1FF1A 1M46A 1XYDA 5TNCA 1M39A 2QPTA 3CWGA 4ZCVA 3NSOA 1E8AA 4PE1A 1Y1UA 4MBEA 4JQ0D 1CMGA 4P5OE 4HRGA 1PVAA 1OMDA 4GGNA 5HKWA 3EK4A 2Y4QA 1LINA 1SRAA 3I5FC 4AQIA 3DF0B 2KAYA 3TUYC 4MZJA 2KDHA 4ICBA 1KSMA 1WDCC 1W7IB 1XVJA 1NX1A 4PE4A 2F33A 1IWQA 2WOSA 2HQ8A 4GBAA 2LE9B 1R6PA 2BE4A 1KFXL 1PRWA 3LK1A 1K95A 1XFWO 3BUNB 1H4BA 2CBLA 1RECA 2E30A 2JC2A 1TN4A 5HKZA 1SR6B 2KOTA 4I5KA 2KGBC 1YVLA 1LKJA 1Y1XA 2QACA 2H61A 4C0LA 2PALA 3HCMA 2LVVA 1PSBA 1A03A 3I5GC 3EKJA 1IGVA 4I5JA 1CDLA 3PN7B 3SG5A 5AFPA 1TRFA 2E6WA 2LAPA 5BPJA 3PN7C 2L4HA 3BQ3A 3KPXA 2KSPA 1JC2A 1FI6A 4DCKA 2BCBA 1OE9B 2CTNA 2LVJA 2MLEC 5CSIA 2MLFC 3SG7A 2EHBA 1K8UA 1AUIB 1SL7A 4GUKA 1OZSA 4OR9B 3AKBA 1G4YR 4HREE 1A2XA 4OVNF 5GQQC 3BOWA 5J3XA 3QRXA 1K2HA 1DMOA 1X02A 4GFTA 4TNCA 1SBJA 1YUUA 1QIWA 2JNFA 3BOWB 3TDZA 1SMGA 1DF0A 1DJHA 5CPVA 1KK7Y 5I2OA 4F0ZB 1B8RA 1EL4A 2HETA 3PALA 1YVHA 2LUCA 3DVJA 2KQ6A 1XFZO 4MRYA 4MZLA 1ZMZA 4MSPA 2OS8B 1WLMA 5CSJA 2PSRA 3I5GB 1WRZA 2CT9A 1IJ6A 1J1EA 3MSEB 2NLNA 4FTGA 3EKHA 4CPVA 3TS5C 5CSFA 1CM1A 3CGAA 3FWBA 3TS5B 1F4OA 1TNPA 1CLMA 1WRLA 4A4BA 1UP5A 1WDCB 5CSNA 4YGCB 1CB1A 1B8CA 4M2PA 1EG4A 2EC6C 1NP8A 2BL0B 4C0KA 1RK9A 4HSZA 1NUBA 2JT8A 3LCPC 3SG6A 1S5GY 4DIRA 2ZFDA 1TCFA 1CDMA 1SKTA 2NZ0A 4NDCA 1DVIA 4PE7A 5DKNA 1B4CA 5KTYA 2G2BA 1SCMB 1IH0A 2KBIA 2A4JA 1SY9A 1AJ5A 5FYXA 1PVBA 1KWOB 1BR1B 1F70A 4WRIA 1DJXA 1NPQA 4MZKA 4XYNA 1BMOA 2ZRTA 2M7NA 4MRXA 2KFHA 1KCYA 1MF8B 2BKHB 2F3YA 1QLSA 3VGOA 4PE0A 2R2IA 3WHUB 3PM8A 1Q80A 1WRKA 1K9UA 2EGDA 2K7OA 2JOJA 4U8DA 3TDUA 2FOTA 2KI4B 4BY4A 1UHNA 3TZ1A 1SCMC 3TDIA 1S5GZ 4E68A 5JOLA 1Y0VH 2K61A 1UHHA 1RJVA 1K93D 4GAOA 1JF0A 2O5GA 1EG3A 1BF5A 2D8NA 4I5LB 2K7DA 2EC6B 1M45A 2L98A 2M8UA 4QJ3B 1EXRA 2L2EA 3JTDC 1BG1A 1NX2A 1LA0A 4M2OA 2LCPA 3D10A 3PLFB 1B47A 3BUOB 1XFXO 4ORBB 3BUMB 1K9PA 2JU0A 2RGIA 1KFXS 1TOPA 1RTP1 2WCFA 4WQ2A 1SW8A 3RLZA 1IJ5A 5DKRA 1C7VA 4GGFA
chains in the Genus database with same CATH superfamily
3W68A 2Y0EA 2P2UA 1IFDA 1J7QA 1NH4A 2LHIA 1MUUA 5IBWA 2KLEA 3EWKA 2YXQB 2KNCB 2KI4C 4PHMA 2M1UA 4XJKB 2PP6A 2R5DA 3AE7C 3D0YA 4LC1A 3SSUA 2ZKMX 3I5FB 1K90D 2WCLA 1NTMJ 3F5HA 1TNXA 1PPJE 1BSHA 1QS7A 3EK7A 2KPHA 3MIWA 1ZN5A 2KYVA 1JFKA 1KQMC 1RF0A 4N1FA 4EIJA 3S1KA 1R5SA 3B5NA 3M0WA 2ZN8A 2QJKC 3RK2D 4GKGA 3CS1A 4MVFA 2BNXA 1GQMA 1B7TZ 1L7ZA 2QJYB 1M90Q 1USDA 1SCVA 2ERBA 1J1EB 3QWOC 4QJ4B 5B8IB 3ICBA 2LMTA 3L72G 2KI6D 3T97A 1N73C 1BGYE 1L4AB 5APSA 3SG3A 3I5HB 4IFFA 3Q2YA 3EVRA 1M7LA 4YBHB 1OMIA 2RKLA 3KYQA 3VRNA 3CWBJ 1BGYD 4A4CA 2FBWC 4JYCA 3V4QA 3OB1B 4AOMA 1AVOA 1SFCA 2WCKA 1UIIA 3VP8A 1K9MQ 4UB6E 3L36A 3MUDC 3D0YB 3TF5A 2L5GB 1NTMD 2WZ7A 4PD4E 1QX5B 3IAOA 1TTXA 2A06E 1DJIA 2BECA 1RF1B 1XO5A 4I1LA 4W7ZA 1EDLA 1NHLA 2PASA 1RE4A 2Y0CA 2OTGB 1YJ9P 2H8PD 3O2PA 2KS1B 2HPCA 2OQQA 1LGHB 1A4PA 1P28A 5BVZA 1SQPE 2OTLP 3VP9A 1PIXA 3CCUP 2CCMA 3N7HA 1FE6A 4AUWA 1LT1A 1LTJC 2IBZD 2IYOA 3H1HE 3NSKA 3SS5A 1A75B 3O6QA 1L2OB 5APYA 4PHJA 3L35A 1IFJA 1YTZI 4XA4A 2OARA 3CC4P 1JSAA 4KYNA 1MZ9A 1OOGA 1N86A 2IBZE 2JXLA 2P70A 2WSCJ 3KPEA 1LS8A 2N1TB 3B71A 1MR8A 1L0NK 1DEBA 3SWYA 1GGZA 3ZWHA 1M1JA 2WSFH 1DIPA 2BKIB 3BASA 1AVSA 1YQ3C 2Z4EA 1ZV8A 1SFCD 2F2OA 1U5IA 1LJ2A 3CR5X 4PDZA 4F7FA 3V4WA 2WTYA 3M06A 2ZNDA 1QIVA 1ZXGA 1X0TA 1N0YA 5AXIA 3N4XA 3I5HC 2B87A 1FW4A 1S6CA 2WC8A 1NTZK 1IRJA 5GTHE 2ZAEB 4R1EA 1XK4A 1L0NE 5KAIH 3L4AA 5B66H 4EOTA 5D69A 2M8RA 4OCIA 2B89A 2Y1NA 2ZXEB 2MRDA 1QTXA 1J2JB 2NCPA 2ZYGA 4JYBA 1LT9A 3H4SE 2JWWA 4AQJA 1QGKB 1J7PA 2GGMA 4N1GA 2GV5A 4PALA 3S0DA 3VB1A 1G8IA 2O3JA 3AE1C 3NHTA 1CDNA 1S6IA 2FKWB 2OPOA 1FZBA 1MXLC 2WMMA 1PSRA 2SPZA 2QIWA 3JSVC 1N65A 3SG4A 3GHGA 2Q3EA 1MFZA 1BLQA 5AVTB 3A7OA 2AAOA 5CCHD 3G6EP 4LGDE 2BCCG 1QL1A 2MHHA 2W83C 1MHOA 1LNQA 1VPCA 3DVKA 3G71P 3FX0A 2L50A 2HF5A 2Q91A 2NXQA 4PJ0H 2PVBA 4AQRD 1PPJG 1EZVD 3AAJA 1FPWA 3MUDA 2P67A 4I5NB 2E76B 1AHRA 1IKUA 4WY4B 5AVQB 3FGAD 3FXDA 1URQD 2LANA 1DGUA 3RM1A 5KJ7C 3MHVA 1CFPA 3H1JG 1FZCC 5GTHH 1KK7Z 1NTKE 3L4LA 3OAKA 4H44D 3VMXA 1NU1K 1KK8B 3ABVC 1FU1A 5B66E 1IZNB 1W7JB 1AFOA 3L75D 3L72E 3DZTA 1FBMA 2WPQA 3EFFK 4L75A 1OOFA 5CJ0A 1WRGA 4Z1MH 3JC22 4K3AA 3A5TA 1XFYO 1LA3A 3Q1MA 1YRUB 4GIFA 2LVKA 3K5BA 3GHGB 2KBMA 2XZRA 2YIUC 5D3OA 1RY3A 1PGOA 1NX0A 3VRQA 3MZWB 2IPPA 3BUWB 5APWA 2KAVA 1VF5C 1LWUC 2WVRA 4YGAA 2BL0C 4I6MC 5CHXA 1YRTB 1LTAC 1MWNA 1MQ1A 3NSLA 5KJ7A 1VQ4P 1RQUA 2FXOA 2H88C 2WSCH 4Y99B 2K1AA 1VQNP 5TNCA 1M39A 2QPTA 2IDBA 1OVVA 1E8AA 1ZW0A 3HE5B 2FYUE 4XE5B 4P5OE 2K37A 4H44B 1PVAA 4GGNA 5HKWA 4D6TG 1L4AC 5DJTB 3TUYC 4MZJA 3PRJA 2IBZI 2FFDC 1WT6A 4M3LA 2HQ8A 1FS0E 2J5UA 1KFXL 2WSEH 1PRWA 1RF1C 3LK1A 1XFWO 2AXTE 5HKZA 4TT3H 1SR6B 4I5KA 4BWNA 1OX3A 2OTKE 1M57D 1LTJA 4JKTA 2LVVA 2YKPA 3P8CD 3I5GC 5KKZC 5CCHC 2LAPA 1H88A 3MP7B 5KAFH 2KSPA 1JC2A 3S4RA 1H0TB 1QVGO 2ZT9B 1QX8A 2MLFC 3SG7A 1K8UA 4GUKA 5KLVD 4MN4C 1LP1A 4OVNF 5J3XA 3QRXA 1X02A 1G1IA 2PFXA 3BRVB 3TSIA 3B5ND 3CC2P 4F0ZB 2HETA 3P32A 5TISH 2KK7A 2RMZA 2N9YB 4HYTB 2ZYAA 1BE3J 4MSPA 1GL2C 5CSJA 1JOCA 1OW8A 4OGQC 3S0AA 1URQB 2Q1KA 1KTMA 1J1EA 1JMBA 4CPVA 3B4SA 3D73A 3TS5C 3BCCG 5AVYB 1NKZB 5AW2B 1S1CX 4IOIH 4CPGA 4A4BA 4YGCB 1CB1A 1NTZG 1B8CA 2EC6C 4IFDK 2OYHB 1RK9A 3H1KE 1KC8Q 2XU6A 1TCFA 1CDMA 2CPSA 3HRNA 4H44C 3CXHH 4PE7A 5DKNA 1CSBA 1GW3A 4PD4H 1CI6B 2A45I 3L47A 2MKVA 5FYXA 1KWOB 1BR1B 1DJXA 4MZKA 1E79H 5CCGC 3CCVP 2ZRTA 2M7NA 1JCCA 3RL0C 2I1JA 2H89C 3M0DA 2R2IA 4U8DA 2FOTA 4GOFA 1Y8AA 3VYIA 3M9QA 1SCMC 2GA1A 3TDIA 1NKNA 4E68A 1UHHA 4GAOA 1JF0A 5KLIB 1EG3A 1BF5A 2FYNC 2JO1A 1L0LG 3B87A 1M45A 4QJ3B 3GG2A 3CABA 3D74A 2L2EA 3JTDC 1BG1A 3Q5SA 4U7JA 2IYPA 3HD7D 2LCPA 1LTSC 3H1LD 5APQA 1B47A 2C9NY 2IZ1A 2RGIA 2J59M 4WB4A 1KFXS 4AYCA 2I1KA 2QEBA 1NAYA 4WQ2A 4H13B 3CI9A 3RLZA 1IJ5A 5DKRA 1JCDA 2D2CD 5BU5A 1V1GA 4YGDB 3L71G 1CTRA 2M3WA 4Y99C 1HGZA 2Q9IA 3OHMB 3B86A 1VQ6P 4CIDA 1F71A 1PGPA 2Y9YA 3GK4X 3NHIA 1NTKJ 1JB0J 2UWJE 4H0LD 3BJHA 1HQVA 4GODA 1YX8A 1YYCA 1XTCC 1P84I 1XFVO 4QJ5B 1BE3D 4L74A 2JKVA 4DOJA 1CI6A 1S5LX 4D1EA 1N7SB 1VRKA 2ZVNB 3H25A 4HKZH 2VRSA 3IR9A 3UIAA 1Q7YQ 1NSHA 2LLUA 1X8YA 5C39A 3O6QB 3AE5C 2AXTH 2WSEJ 1JBAA 3GK1A 3CCJP 2KLDA 1DH3A 1YUSA 2KI7B 3O4YA 3VMYA 2FJUB 5TJHA 3L70G 1TIZA 4JF7A 1OOHA 2Q7CA 5KLVG 3OB2B 4CLNA 2BCCD 2LC5A 1FZFA 3RK3B 2HPSA 2HR3A 1SQVK 3PTZA 1QATA 5AVVB 4D6TE 3WU2E 3B5NB 3SJSA 2XNXA 2YMKA 3N7NA 2M29A 3CX5D 3PJIA 3EFGA 1IO4A 1EJ3A 5CMZA 3NFQA 2GTEA 4YGEB 3GMAA 2PMYA 4ORAB 1SQPD 1J1DC 3V2RA 2LLTA 5FI2A 3KO0A 2B87B 2BAPA 1TWOA 5F6TA 4RKUJ 2H2KA 3R72A 1S36A 1IK9A 3H6PA 4A7PA 2KP8A 1J1EC 1QV0A 1QL2A 1N7SC 2I7AA 5KU1A 5CJ4A 3B88A 3NSIA 1MFTA 2JT0A 3JVTB 1L2PA 2WNDA 2C0XA 3CXHI 4KT0J 4ZKUA 1PALA 3F45A 2A45H 4ASVA 2K0JA 2LKMA 3D6YA 1SK6D 3SG2A 1HTLC 2C9LY 4OWFA 2JJLA 3M0DC 5AVSB 2LV7A 1CFFA 2L5YA 1DGVA 1ZACA 3TYYA 4WBAA 2FYZA 1IK7A 3WXAA 3RK3D 1T2KC 2KYCA 3CCLP 1G33A 3A0HE 1M1JC 2K9JA 5KJ7D 3EG5B 1SNLA 2CXJA 3PM2A 3V2LA 3S0BA 2R3SA 1S3PA 1AVYA 1J1DA 1DEKA 3PH0A 3CZ2A 2LP2A 2Q4UA 1OW7A 3I5CA 1Q2NA 1KQVA 4GPLB 1IG5A 1JMMA 1T8ZA 1CDPA 3AE9C 2K9YA 1SQQE 1XFRA 2FYUK 4IL6X 2KGRA 1OSAA 4ETOA 1FDMA 3A8RA 2N1TD 2PRRA 1VF5D 2KNEA 3CWBD 2QSIA 3Q5RA 3KZIH 1RFJA 1SQPK 2DOQA 1NU1D 4XFJA 3TDKA 4Y28J 2CPBA 1PP9J 4UPGA 3AEDC 3E1IA 3KXDA 1HT9A 2QEXP 1KD1Q 1FAVA 2E75B 2KZIA 3VRRA 3KDPB 3A0BH 4OH8B 1PFIA 1UHKA 4PD4D 4N5XA 2M49B 1AK8A 2ZN9A 1QJTA 1AV1A 1KILC 2YO2A 3GOFA 4I7ZB 4U3FD 4OZDA 1NOHA 2XKMA 3L74J 2W8ZA 1NVOA 3LW5H 2M5AB 5K5GB 5KSZA 1DJYA 3HUSA 3EK8A 1ZRTE 3FWCA 4GT1A 2M0RA 3RL0B 5AVXB 3IQOA 1EZVE 1N2DA 1BGYG 2NRGA 4GGFC 1U7MA 1S6JA 2JNXA 1DT7B 4UB8E 1QLED 2Y9ZA 4HH2A 3IN6A 5APUA 1NCZA 4NPFX 1YJNP 5DICA 2WPRA 1KK8C 3AECC 2LHLA 1SQBJ 3NXSA 1PL5A 2VRGA 2K8MB 4LLHA 3VTPC 3HE5A 1OZOA 1UIXA 3HX4A 1JWDA 2POHA 2QEVA 1R2UA 2LXCB 3KHUA 4BY5A 3B6XA 1C7WA 2LVIA 1KQFB 5TISE 2ZFCA 3KZIE 3G4SP 3KHEA 2KYFA 1KV4A 1RE4C 1PP9D 1QEXA 1U7JA 2G8YA 2HG5D 1DF0B 1KB9D 4RO0A 4M2QA 2L91A 1BR4B 1FC2C 3R1PA 2YKQA 5HL1A 5E79E 1NX3A 1E5WA 3LIDA 1JY2N 1GDTA 2AUCA 3RK2C 1C07A 1ZRTD 1IQ5A 3AAKA 2O01N 3WHTB 1NCXA 1BE3G 2R44A 1W2BO 2WPVB 3H1IE 1KYOE 4MN0A 2HQWA 1FF1A 3U1AA 2OYHA 1M46A 2NPSB 2HFED 1Q81Q 1SLQA 1QWVA 4OGQD 4PE1A 1Y1UA 3DXLA 4JQ0D 1CMGA 1SQXE 3CDNA 1R8EA 3SS4A 2L2CA 3EK4A 3AEAC 3F89A 3BCCE 1HJBA 2Y4QA 3B5NC 1NU1J 1N8RQ 1OW6A 3V6IA 3DF0B 3D77A 2KAYA 3L73E 2KDHA 1Y47A 1XVJA 3SWKA 2WOSA 1SVFA 3GF3A 3VMZA 2BE4A 1ZR2A 3NGVA 1H4BA 1RECA 2E30A 4ZMDA 2HODB 3WUUA 1P84E 2KOTA 3BFAA 3V5BA 1LKJA 1Y1XA 2PALA 3HCMA 1PSBA 3AE8C 1A03A 3EKJA 3SG5A 1CDLA 3PN7B 3WMM0 2MJZA 2L4HA 1GD2E 1FI6A 4DCKA 1BCCD 1OE9B 2LVJA 1FZEA 3TNUA 2NPSA 3JCUE 3CCRP 2R3CA 4OR9B 1RQVA 1G4YR 1A2XA 4OGQB 1SQVE 1K2HA 3A0BE 2AXCA 1QIWA 3TDZA 3I56P 5I2OA 4O9BA 1YVHA 1SQBE 3WUTA 3D70A 1BDDA 1SQXD 2KQ6A 1WMKA 1OVUA 5H2FH 4MRYA 2K60A 2K88A 4R4LA 4N3YB 1NTMG 4EYYQ 2V7QJ 1VQMP 2H43A 1K04A 1WRZA 2XV5A 3MSEB 3H1JD 1CM1A 1ZLLA 3CGAA 3FWBA 3TS5B 1CLMA 1WRLA 1UP5A 4M2PA 2WT7A 3MD0A 1NP8A 4C0KA 3HD7A 2FYUJ 4HSZA 2JT8A 4DIRA 1S5GY 1PGJA 1SKTA 2NZ0A 3H1JE 4B86A 1NTKG 2IFMA 2IZ0A 2H8VA 1A02J 1IFMA 1SCMB 5B5EH 2JP3A 3O8ZA 1IFIA 4XYNA 1NPQA 2D2CC 1BCCJ 1EZVG 2P58A 4WWIA 1EXJA 4C46A 1MF8B 1PV3A 4H0LB 2F3YA 5AW7B 1QLSA 2Z5HA 1P84H 2EGDA 5CCGA 2KI4B 2Q5UA 1Q82Q 5JOLA 1Y0VH 1RF1A 3IFMA 2O5GA 1FZCA 1IC2A 1JO5A 2K7DA 1C3YA 2M8UA 2L98A 2FYNB 2OYIB 3PLFB 5M1BA 1XFXO 3BUMB 1ZMEC 2JR8A 1SW8A 5BU8B 4GGFA 3JCUH 5CCGD 3DD4A 2H61C 1BDCA 2COLB 1NGMB 1NWDA 1BSNA 2A06D 4N78D 1NU1G 1NAFA 5AVUB 3M91A 1KYOD 1OZHA 2Z5IA 1OIPA 3AKAA 1JTHA 3ZNIA 3CMEP 1S9KD 1Z4HA 1K9KA 1W9ZA 3OX5A 1YQ4C 4UB8H 3CLQA 2K7BA 2W6BA 4YI8A 1YBKA 3AE2C 2D2CB 5GTIE 4YGBB 1NIWA 1GGWA 1OMVA 2KAXA 2ZJSE 3FXEA 1M63B 3RK3C 1T2KD 2I8DA 2BEZF 4IFMA 2P6BB 3A0HH 2L5XB 3H1KD 3CCMP 2B9BA 2KNCA 1YURA 1M1KQ 1LWUB 1K96A 1ALVA 1B7TY 2F2PA 4DZOA 4HJGH 1H8AA 2ZT9C 3H32B 3CZ1A 3R4YA 1HGVA 5ER4X 2XNDH 3EVUA 2F3ZA 1L2OC 1BGYJ 3KF9A 4INWA 3O78A 1Y1AA 1SFCB 3C8VA 2FCEA 1MUXA 3AEFC 1QX7A 5D7FA 2WCHA 3S0EA 2BBMA 4WQ3A 4FQTA 2M5AA 2Y0DA 2KLVA 5I94A 1BJFA 3HUSB 2LMUA 2WCJA 1DEEG 1BT6A 1TNWA 3K21A 1ZUZA 2NCOA 1D7MA 4YTPC 3CD6P 1SSEB 3QH9A 5AW3B 2CNPA 5KLVK 2JRFA 1JEKA 1KZUB 2XDJA 3SIBA 1YI2P 2YKOA 3TGUD 2V53A 2N1TA 2R32A 1IJDB 4U3FE 2RH0A 1YJWP 1JF2A 3E3RA 4ZCUA 1DX7A 1VQ5P 3BCCD 4ORCB 1L0LD 3Q3DA 1SQVJ 1M1JB 3L73D 1BOCA 1NTZD 2K9JB 4NPEA 2E75D 2MBXA 1X79B 3I5IB 2LMVA 1IQ3A 3L73J 4I2LC 2RN0A 1LTTC 5AVRB 3Q5PA 1L0LJ 2TN4A 1S1EA 3O6BA 4GNKB 1J7OA 1A29A 2KSJA 3L70J 1L0LE 1XK4C 1EH2A 5E79H 5AW8B 2KI6C 1MXEA 2OGUA 4C7NB 3T97B 1VDFA 3M0AA 3CYZA 3AEBC 1CKKA 3H1JJ 1Q90D 1SL9A 1UHJA 2Q3IA 3IQQA 1AJ4A 1J7RA 3L74E 2P10A 1M31A 3CMAP 3CZTX 2BBNA 2BCAA 3L71E 1SQQD 3P8MC 4WY4C 3LW5J 1DD3A 4ZKPA 2O1KA 1UURA 1T6AA 2G9BA 2NPSC 2ITAA 5CBNA 1U5IB 2QJPB 1K94A 2LUXA 1RWYA 4EDFA 3PFVA 2E76C 2KB7P 5AW5B 3WNXB 2L0PA 1GJYA 1KILE 1KFMA 1D1OA 3A2AA 2M7LA 1HF9A 2SASA 3U1CA 2QDIA 2ISDA 2JEEA 1KB9I 5I2QA 4RJTA 3H1IG 2K7CA 2BCCJ 1S9KE 2OS8C 3DF0A 3JTDB 1F8HA 2I18A 1G1JA 1Z56A 3L70E 1A75A 3GW6A 3HE4B 2GGZA 3RBZA 3TGUE 1VL2A 2BE6A 2IS9A 1W2EA 1GU5A 2OTGC 4PHNA 4L9MA 1VQPP 3AEEC 1YITP 1J55A 1SQXK 2PGDA 1B8LA 4C0JA 1LTJB 1SQPJ 1NCYA 3FIAA 3L74D 3LK0A 2WCBA 4IJ7A 4FQOA 5AVZB 2P71A 1SFCC 1YHQP 2LNKA 3VRPA 1GZLA 3USSA 2JT3A 1VQ7P 3S0GA 2KIKA 3VROA 1HWTC 3CC7P 2JTTA 3DY9A 3BYAA 2Q6QA 2WCEA 2FFDA 3BCCJ 3TUYB 2JPTA 2KQYA 3CWBE 1ODBA 1JY2P 1ALWA 4DUQA 1H8BA 2L51A 2GUSA 2V7QH 1SYMA 3L71D 4GOEA 3ZDMA 1QVIZ 2E74C 2JQ6A 3HTKB 1OOIX 4R4MA 2QRXA 1JFJA 3EQ2A 1URQC 1SR6C 4HRHA 2KUBA 1B9AA 1FBVA 1MKMA 1UUSA 1Y6WA 3OP0A 1M56D 2CK3H 3B7AA 1HBWA 1SQBK 2KSEA 2QA4P 5EFWB 3CL3D 3SWFA 2PQLA 2E74D 1OMDA 3L70D 1VQOP 2QJKB 3I5FC 1SQQG 3MGNA 4ICBA 2QEHA 2LR2A 2H7HA 3GHGC 3CCQP 4GBAA 2LE9B 2BCCE 3A3YB 1USEA 4PV1D 1K95A 3BUNB 4K35A 3SFEC 2JC2A 3PJSK 1TN4A 1MV8A 1LTBC 1GL2A 5KAFE 2KGBC 2FXMA 4PJ0E 1HJ0A 2ZXXA 1N73A 2QACA 2OYOA 4C0LA 3L75J 5AFPA 4I5JA 1PZQA 1SQQJ 2E75C 5BPJA 3PN7C 3BQ3A 3KPXA 1OVRA 1JY3N 2BCBA 3H1ID 3OW2O 5KLVJ 5CSIA 2WSSH 3AE4C 4PD4I 1AUIB 1SL7A 1OZSA 2E5TA 3AKBA 4HREE 5EL2A 5GQQC 3BOWA 4KHXA 1SBJA 1SMGA 1G2CA 1KK7Y 3H1LE 5AW9B 1B8RA 1JY3P 4WVZA 5FI6A 3DVJA 2B88A 5AW1B 1XFZO 1JM0A 1ZMZA 2GM4A 1IIOA 4WY4D 1WLMA 2PSRA 4H13D 3I5GB 3AE6C 1IJ6A 3V2PA 3G3ZA 3EKHA 3H1HJ 3BFBA 1URQA 1KMIZ 2JWDA 1H0TA 2N9BA 1F4OA 2LXBA 3H1HG 1T3JA 1Q86Q 4H0LC 3SG6A 2WT7B 2ZFDA 1OXZA 1DVIA 1KQLA 3AE3C 2IBZG 1B4CA 5KTYA 2G2BA 3FE6A 1W5CE 1JTHB 3H1KJ 1HH0A 1PP9G 2KBIA 2A4JA 1SY9A 1N7SD 1FOSF 1AJ5A 1VQLP 1FJKA 3UO9A 3RL0g 3P8CE 1BMOA 5CBOA 2KFHA 1KCYA 3D76A 3L37A 1Q80A 4N6JA 1K9UA 2K7OA 3VN0A 4BY4A 3TZ1A 1HVVA 1S5GZ 3CX5H 1H89A 1K93D 4I5LB 3CCEP 3K1EA 1G2CB 2EC6B 1YTZT 1LWUA 1EXRA 3H1LJ 1N7SA 2HYNA 1LA0A 4M2OA 2W6JH 4ORBB 2OYIA 1K9PA 2JU0A 1GW4A 3LIEA 1RTP1 2WCFA 2WPSA 1NYHA 1C7VA 1L0NG 4QMAA 1JUNA 2ZRSA 5HLVA 4P2YB 5KKZB 1YUTA 3VOPA 3V2QA 4Q04A 5AW0B 3GK2A 2QG4A 1WLZA 2JTZA 4DS7A 4NDDA 2QVAA 1SPYA 5DKQA 3D71A 1LP1B 1FZCB 3FE8A 4YI9A 2NZ2A 1KFNA 2MA2A 3DVEA 3VMAA 4DT0A 3RK3E 3IF4A 1YX7A 1GK6A 2YO3A 3OA7A 1PPJD 2BEQD 2JWAA 1UHIA 4NQGA 1OQPA 1CFCA 2JXCA 4U3FG 2KFGA 3PP5A 1DJGA 3PLNA 1KQMB 1CM4A 2AEFA 1YIJP 1F55A 3UNWA 1PK0D 5AW6B 5KTBA 3M9BA 1BU3A 2QEOA 1Y9BA 2O01H 1KFUS 2QM7A 5CCHA 3L75G 2HPCB 1QASA 2Y5IA 1KILB 1U57A 4H13C 1KORA 1SS1A 3FWNA 2FCDA 3CR2A 1OMRA 3SFDC 2E43A 1FZAA 1TUZA 3G9RA 1QV1A 3O4XA 2KHNA 3CR4X 2W6AA 1AQTA 1S72P 1OFCX 3I55P 2WC5A 4BRYB 1CLLA 4XJKA 3D75A 1SQVG 3C9IA 3C1LA 2E42A 5FI7A 3R1VA 5HKYA 1F54A 1QLKA 3NXAA 3L72J 3WU2H 3AEGC 1LTIC 3U59A 4RESB 4CFRA 4JD9A 1WY9A 4NDBA 1VQ9P 1KSOA 3L74G 3PATA 1NTZJ 2KS1A 5DJUB 1V1FA 1CMFA 1KWOC 3DYEA 4DRWA 1FJPA 1CLBA 1PULA 2KOGA 3SIAA 3BRTB 2BCXA 3HUSC 4TLFA 2R5BA 3MTUE 2KFFA 1EC5A 2K2FA 3NTNA 1AA0A 1RE3C 3TGUJ 2YNYA 2P1JA 3TK1A 1S26D 3PSRA 2ZYDA 4N78E 1FDOA 1SL8A 2QE7H 4MLWA 1TU3F 1KILA 1EXIA 3I5IC 1KILD 4NPDA 1RH5B 3FE9A 1ZP0C 1XFUO 5K89A 3CPWO 3CTNA 3BATA 1OOJA 1S2EA 3EVVA 2M97A 1A02F 1FI5A 1TNQA 1DJWA 3CCSP 1F4QA 4MEWA 5HLOA 1TUJA 3FS7A 2M1KB 3JVTC 4USLA 2N1TC 1PGQA 1NTKD 1J1DB 1EZVI 2PRUA 1RROA 1UWOA 2GUVA 2P7JA 4HB1A 1L0ND 4PCWA 2FFDB 2A45G 5AERA 1AP4A 4JPZB 1YTZC 3CLNA 1XA5A 3S0FA 2WQYC 3CZ0A 2A06G 1PP9E 1BCCG 4IL6H 3BUXB 1JY2O 4D6TD 2MAZA 5ER5A 4C7RA 3C1VA 1ZOTB 1KFUL 2O1JA 3ITKA 4IL1A 1K05A 1CNPA 1QVFO 1IFPA 1BODA 3A4UB 1NJIQ 1CW5A 1HUCA 5KLVE 1NU1E 1QVIY 1TCOB 1SQXG 1T14A 1T3UA 1RF0C 3OGNA 3RGUA 3DVMA 5AANA 2E76D 4C7NA 1VQKP 2QM8A 2E5YA 4OV2A 2SCPA 3BXKA 5GTIH 1ZFSA 3IVTA 1JUOA 2O60A 2G3AA 3H1HD 3KQGA 1LTGC 3E1RA 1CFDA 2WC6A 5KLIC 1L0LK 2M0BA 4JWQA 4YRUA 2WORA 5PALA 3HE4A 4INXA 2AMIA 4PHKA 1YR5A 1DJZA 1NTMK 1VF5B 1R5LA 4WY4A 4I7ZC 2B1UA 1GL2B 2F8PA 5HYDA 2K2AA 2C0WA 1NTZE 1N73B 2FYUD 1QXPA 4KJMA 4ZNCA 3OX6A 1DTLA 3H1KG 1S4XA 2LP3A 2JULA 2WSFJ 5JJGA 2I94A 1EDJA 2JZIA 2Y1MA 1DD4A 4OKHA 2HLOA 3FWLA 3CXHE 1NWQA 2LLSA 2DW3A 4IL6E 1SQBG 1Z2CB 5H2FE 1GM0A 4PT1A 2MJWB 2M3EA 1QX2A 1LXFC 5I8NA 1NYAA 3L75E 4L73A 1NTME 4D6TJ 2ZNEA 1SQVD 3KEVA 1DELA 3LLEA 1LVCD 1AJYA 2E74B 1EDKA 3PHLA 3OBVA 3RL0D 3LL8B 3CX5I 3H1IJ 4CFQA 4YXDC 2KLUA 1KB9E 5AEQA 2I2RE 3IF7A 3Q8IA 4GDOA 1GU4A 4ASWA 2W27A 2M9GA 5AW4B 1LT9B 1ZR4A 2L4IA 5B5EE 1GK4A 1CZQA 2LM5A 1B1GA 5G08A 2KXPB 4YPCA 1S5LE 1AQ5A 2YXRB 5I2LA 1KYOI 4PV1B 2WITA 1XYDA 3H1LG 2PYQA 3CWGA 1SQXJ 4ZCVA 3NSOA 2AEMA 4MBEA 2K3RA 4YXWH 1S3JA 3P7KA 1K8AQ 1IFNA 1X22A 3HTKA 4HRGA 2OYIC 1LINA 1SRAA 4AQIA 3GF7A 3RBXA 3HD7C 1KSMA 2ZT9D 3CXHD 1WDCC 5APXA 3TNUB 1GTWA 1W7IB 1NX1A 5AVWB 4PE4A 2F33A 1IWQA 4JBZA 3L71J 3WUVA 1R6PA 2WWWA 1C3ZA 1OW4A 4W7YA 2CBLA 1L0NJ 2V4HA 1M8OB 1KQSO 3RK2B 3W67A 1YVLA 3D78A 1KQGB 2H61A 1SQPG 1IGVA 3CX5E 1TRFA 2E6WA 3L72D 2JDIH 5APVA 2CTNA 4BXLA 1FOSE 2MLEC 1LT9C 2EHBA 2IFNA 3SS3A 2O01J 2W90A 2FXPA 1KB9H 1EQ7A 1N7LA 4DJGA 1DMOA 1BCCE 4GFTA 4TNCA 1N2DC 1DQEA 1YUUA 2JNFA 3BOWB 1GMJA 1DF0A 1DJHA 5CPVA 1RHZB 1VQ8P 1EL4A 3PALA 2J58A 4U3FJ 4EI2A 2LUCA 3TGUG 4MZLA 1GL2D 1DC1A 3RZSA 1JNMA 2OS8B 2YIUB 2FYUG 2PAJA 3QMEA 4L76A 3B8EB 2CT9A 2JPOA 4PV1C 2NLNA 4FTGA 1OWAA 3BFHA 4W80A 1FZGA 5CSFA 3NMDA 1SP4A 1NTKK 3HD7B 1TNPA 2WCMA 1WDCB 5CSNA 2QJYC 1KN7A 1EG4A 2BL0B 1ORGA 3D6ZA 1NUBA 3LCPC 1BE3E 3H32A 2BASA 4NDCA 2IX7C 1P84D 2QJPC 3V2NA 1IH0A 3S9OA 3E7KA 1PVBA 1F70A 4WRIA 4MRXA 1SQQK 3R2PA 1X9VA 3L4FA 2BKHB 2OYHC 2YGUA 2KZJA 1NO4A 3VGOA 4PE0A 4BRYA 1RE3A 3WHUB 3PM8A 3CWBG 5APTA 1WRKA 5KAIE 2JOJA 3TDUA 2FJYA 1UHNA 2FY8A 5L8RJ 1FDIA 2K61A 3OJAB 1RJVA 2M3BA 1JY3O 2D8NA 3GLMA 2OTJP 1ZOYC 2YMYA 1L4AD 1L4AA 3L73G 3M9HA 1NX2A 1XTGB 2ZVOB 3II6A 2HODA 3D10A 1K73Q 3BUOB 1KYOH 2NPSD 4UB6H 1SQBD 1TOPA 3R1OA 2AEJA 1S5LH 3BVHA 1EDIA
chains in the Genus database with same CATH topology
2ZRSA 3DD4A 2H61C 5HLVA 1V1GA 2COLB 4P2YB 4YGDB 1CTRA 1YUTA 2M3WA 1J7QA 4Q04A 3GK2A 3OHMB 1WLZA 2LHIA 4CIDA 1F71A 2Y9YA 3GK4X 5IBWA 1NWDA 2JTZA 2KI4C 4PHMA 2M1UA 4XJKB 4DS7A 4NDDA 3D0YA 2ZKMX 3I5FB 1K90D 1HQVA 1SPYA 1YX8A 5DKQA 1TNXA 1QS7A 1XFVO 3EK7A 3AKAA 4QJ5B 3ZNIA 4YI9A 4D1EA 1JFKA 1KQMC 1VRKA 1K9KA 2MA2A 3DVEA 3OX5A 4N1FA 2K7BA 1YX7A 4YI8A 3M0WA 2ZN8A 1UHIA 3CS1A 4MVFA 4YGBB 1NIWA 1NSHA 1GQMA 1B7TZ 1OQPA 1L7ZA 2LLUA 4NQGA 1GGWA 1CFCA 2JXCA 1OMVA 2KAXA 2KFGA 1DJGA 1SCVA 1M63B 4QJ4B 1KQMB 1CM4A 3ICBA 5B8IB 1JBAA 2LMTA 3GK1A 1F55A 1PK0D 2P6BB 1YUSA 2KI6D 2L5XB 3O4YA 2FJUB 1BU3A 1YURA 1K96A 1KFUS 1TIZA 1ALVA 3SG3A 1B7TY 2F2PA 3I5HB 1QASA 2Y5IA 3EVRA 3OB2B 4YBHB 4CLNA 2FCDA 2LC5A 3CR2A 1OMRA 2HPSA 3VRNA 4A4CA 1QATA 5ER4X 3EVUA 3OB1B 4AOMA 1QV1A 2F3ZA 1L2OC 3KF9A 3O78A 3SJSA 2KHNA 3CR4X 1OFCX 1Y1AA 1CLLA 2M29A 4XJKA 2FCEA 3D0YB 1MUXA 1EJ3A 5HKYA 1F54A 1QX5B 1QLKA 3NXAA 4YGEB 1TTXA 1QX7A 2PMYA 4ORAB 4CFRA 1DJIA 5D7FA 1WY9A 4NDBA 1KSOA 2LLTA 2BECA 2BBMA 1XO5A 3KO0A 3PATA 4WQ3A 5F6TA 1V1FA 2H2KA 2PASA 1S36A 1CMFA 2OTGB 1KWOC 4DRWA 3O2PA 1CLBA 1PULA 1A4PA 1BJFA 1QV0A 2LMUA 3SIAA 1BT6A 2BCXA 2I7AA 2CCMA 1TNWA 3K21A 5KU1A 2KFFA 3NSIA 2JT0A 3JVTB 2K2FA 1ZUZA 2WNDA 2NCOA 3NSKA 1A75B 1L2OB 4PHJA 1PALA 3F45A 2K0JA 1S26D 1SK6D 3PSRA 2CNPA 1SL8A 2JRFA 3SG2A 3SIBA 2LV7A 1CFFA 2V53A 1JSAA 4MLWA 2JXLA 1DGVA 3I5IC 1ZACA 1JF2A 3E3RA 1MR8A 4ZCUA 3WXAA 1XFUO 5K89A 1GGZA 2KYCA 1OOJA 3CTNA 3ZWHA 1G33A 4ORCB 2BKIB 3EVVA 2M97A 1FI5A 1SNLA 2CXJA 1BOCA 1AVSA 1TNQA 2MBXA 1DJWA 1F4QA 1S3PA 4MEWA 1J1DA 2LMVA 3I5IB 1IQ3A 5HLOA 3FS7A 4USLA 2M1KB 3JVTC 2TN4A 1S1EA 3O6BA 2F2OA 1U5IA 2LP2A 2PRUA 2Q4UA 1A29A 1RROA 1UWOA 3CR5X 4GNKB 4PDZA 1J7OA 1KQVA 2ZNDA 1QIVA 1XK4C 4GPLB 1EH2A 1N0YA 4PCWA 5AXIA 2KI6C 1IG5A 1MXEA 5AERA 1CDPA 1AP4A 3I5HC 4JPZB 1FW4A 1S6CA 2WC8A 2KGRA 1OSAA 4ETOA 1YTZC 3CLNA 1IRJA 1XA5A 3A8RA 1CKKA 1SL9A 4R1EA 1XK4A 1UHJA 2KNEA 3IQQA 1AJ4A 1J7RA 1RFJA 2DOQA 3BUXB 5D69A 1M31A 3CZTX 2BBNA 2BCAA 2MAZA 5ER5A 3C1VA 4OCIA 1ZOTB 4UPGA 1KFUL 4IL1A 1CNPA 2Y1NA 1BODA 1HT9A 2MRDA 1QTXA 3A4UB 3VRRA 2NCPA 1UURA 2G9BA 1UHKA 3H4SE 2JWWA 1QVIY 1TCOB 4N5XA 1U5IB 4AQJA 2M49B 2GGMA 1J7PA 4N1GA 2GV5A 4PALA 1K94A 1G8IA 2LUXA 2ZN9A 1AK8A 1QJTA 1RWYA 3PFVA 3DVMA 3GOFA 5AANA 3WNXB 1CDNA 1S6IA 2L0PA 1GJYA 2OPOA 1MXLC 1D1OA 4OV2A 2M7LA 2SASA 1PSRA 2SCPA 3BXKA 1ZFSA 5KSZA 1N65A 2ISDA 3SG4A 1JUOA 1DJYA 2O60A 1BLQA 3EK8A 5I2QA 2AAOA 2K7CA 3FWCA 2M0RA 1CFDA 2OS8C 3DF0A 3JTDB 1F8HA 2I18A 3IQOA 2MHHA 1N2DA 1MHOA 1A75A 3DVKA 4GGFC 4JWQA 4YRUA 1S6JA 2GGZA 2WORA 5PALA 2JNXA 2L50A 2HF5A 2Q91A 2NXQA 1DT7B 2Y9ZA 2PVBA 2BE6A 1NCZA 2IS9A 2OTGC 2AMIA 4PHKA 1YR5A 4PHNA 4L9MA 3AAJA 1FPWA 1DJZA 1J55A 4I5NB 1KK8C 2B1UA 2LHLA 2F8PA 1AHRA 5HYDA 1IKUA 1B8LA 2K2AA 4C0JA 1NCYA 3FIAA 1QXPA 2LANA 2VRGA 2K8MB 2WCBA 3LK0A 1DGUA 4FQOA 3OX6A 1DTLA 3RM1A 1CFPA 2LP3A 2LNKA 2JULA 3VRPA 1OZOA 5JJGA 1KK7Z 2I94A 3HX4A 1KK8B 1JWDA 1W7JB 1R2UA 2JZIA 2Y1MA 4BY5A 4OKHA 1C7WA 2JT3A 2LVIA 3VROA 2LLSA 2JTTA 3BYAA 2WCEA 2MJWB 3TUYB 1QX2A 2JPTA 2KQYA 1LXFC 3KHEA 5I8NA 2KYFA 1ODBA 1ALWA 1XFYO 1LA3A 1NYAA 4DUQA 1YRUB 1H8BA 2LVKA 2L51A 1DF0B 1SYMA 2ZNEA 4M2QA 2KBMA 1BR4B 1QVIZ 3KEVA 3LLEA 2JQ6A 1LVCD 1NX3A 1JFJA 3LL8B 1SR6C 1NX0A 2AUCA 3VRQA 1C07A 3BUWB 1IQ5A 2KAVA 4CFQA 4HRHA 5AEQA 2I2RE 3IF7A 3AAKA 3WHTB 4YGAA 1NCXA 2BL0C 1B9AA 2M9GA 1FBVA 1YRTB 1MWNA 1MQ1A 3NSLA 1UUSA 1Y6WA 3OP0A 2L4IA 2LM5A 1B1GA 4MN0A 5G08A 2HQWA 5I2LA 1FF1A 1M46A 1XYDA 5TNCA 1M39A 2QPTA 3CWGA 4ZCVA 3NSOA 1E8AA 4PE1A 1Y1UA 4MBEA 4JQ0D 1CMGA 4P5OE 4HRGA 1PVAA 1OMDA 4GGNA 5HKWA 3EK4A 2Y4QA 1LINA 1SRAA 3I5FC 4AQIA 3DF0B 2KAYA 3TUYC 4MZJA 2KDHA 4ICBA 1KSMA 1WDCC 1W7IB 1XVJA 1NX1A 4PE4A 2F33A 1IWQA 2WOSA 2HQ8A 4GBAA 2LE9B 1R6PA 2BE4A 1KFXL 1PRWA 3LK1A 1K95A 1XFWO 3BUNB 1H4BA 2CBLA 1RECA 2E30A 2JC2A 1TN4A 5HKZA 1SR6B 2KOTA 4I5KA 2KGBC 1YVLA 1LKJA 1Y1XA 2QACA 2H61A 4C0LA 2PALA 3HCMA 2LVVA 1PSBA 1A03A 3I5GC 3EKJA 1IGVA 4I5JA 1CDLA 3PN7B 3SG5A 5AFPA 1TRFA 2E6WA 2LAPA 5BPJA 3PN7C 2L4HA 3BQ3A 3KPXA 2KSPA 1JC2A 1FI6A 4DCKA 2BCBA 1OE9B 2CTNA 2LVJA 2MLEC 5CSIA 2MLFC 3SG7A 2EHBA 1K8UA 1AUIB 1SL7A 4GUKA 1OZSA 4OR9B 3AKBA 1G4YR 4HREE 1A2XA 4OVNF 5GQQC 3BOWA 5J3XA 3QRXA 1K2HA 1DMOA 1X02A 4GFTA 4TNCA 1SBJA 1YUUA 1QIWA 2JNFA 3BOWB 3TDZA 1SMGA 1DF0A 1DJHA 5CPVA 1KK7Y 5I2OA 4F0ZB 1B8RA 1EL4A 2HETA 3PALA 1YVHA 2LUCA 3DVJA 2KQ6A 1XFZO 4MRYA 4MZLA 1ZMZA 4MSPA 2OS8B 1WLMA 5CSJA 2PSRA 3I5GB 1WRZA 2CT9A 1IJ6A 1J1EA 3MSEB 2NLNA 4FTGA 3EKHA 4CPVA 3TS5C 5CSFA 1CM1A 3CGAA 3FWBA 3TS5B 1F4OA 1TNPA 1CLMA 1WRLA 4A4BA 1UP5A 1WDCB 5CSNA 4YGCB 1CB1A 1B8CA 4M2PA 1EG4A 2EC6C 1NP8A 2BL0B 4C0KA 1RK9A 4HSZA 1NUBA 2JT8A 3LCPC 3SG6A 1S5GY 4DIRA 2ZFDA 1TCFA 1CDMA 1SKTA 2NZ0A 4NDCA 1DVIA 4PE7A 5DKNA 1B4CA 5KTYA 2G2BA 1SCMB 1IH0A 2KBIA 2A4JA 1SY9A 1AJ5A 5FYXA 1PVBA 1KWOB 1BR1B 1F70A 4WRIA 1DJXA 1NPQA 4MZKA 4XYNA 1BMOA 2ZRTA 2M7NA 4MRXA 2KFHA 1KCYA 1MF8B 2BKHB 2F3YA 1QLSA 3VGOA 4PE0A 2R2IA 3WHUB 3PM8A 1Q80A 1WRKA 1K9UA 2EGDA 2K7OA 2JOJA 4U8DA 3TDUA 2FOTA 2KI4B 4BY4A 1UHNA 3TZ1A 1SCMC 3TDIA 1S5GZ 4E68A 5JOLA 1Y0VH 2K61A 1UHHA 1RJVA 1K93D 4GAOA 1JF0A 2O5GA 1EG3A 1BF5A 2D8NA 4I5LB 2K7DA 2EC6B 1M45A 2L98A 2M8UA 4QJ3B 1EXRA 2L2EA 3JTDC 1BG1A 1NX2A 1LA0A 4M2OA 2LCPA 3D10A 3PLFB 1B47A 3BUOB 1XFXO 4ORBB 3BUMB 1K9PA 2JU0A 2RGIA 1KFXS 1TOPA 1RTP1 2WCFA 4WQ2A 1SW8A 3RLZA 1IJ5A 5DKRA 1C7VA 4GGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZRS A;  3DD4 A;  2H61 C;  5HLV A;  1V1G A;  2COL B;  4P2Y B;  4YGD B;  1CTR A;  1YUT A;  2M3W A;  1J7Q A;  4Q04 A;  3GK2 A;  3OHM B;  1WLZ A;  2LHI A;  4CID A;  1F71 A;  2Y9Y A;  3GK4 X;  5IBW A;  1NWD A;  2JTZ A;  2KI4 C;  4PHM A;  2M1U A;  4XJK B;  4DS7 A;  4NDD A;  3D0Y A;  2ZKM X;  3I5F B;  1K90 D;  1HQV A;  1SPY A;  1YX8 A;  5DKQ A;  1TNX A;  1QS7 A;  1XFV O;  3EK7 A;  3AKA A;  4QJ5 B;  3ZNI A;  4YI9 A;  4D1E A;  1JFK A;  1KQM C;  1VRK A;  1K9K A;  2MA2 A;  3DVE A;  3OX5 A;  4N1F A;  2K7B A;  1YX7 A;  4YI8 A;  3M0W A;  2ZN8 A;  1UHI A;  3CS1 A;  4MVF A;  4YGB B;  1NIW A;  1NSH A;  1GQM A;  1B7T Z;  1OQP A;  1L7Z A;  2LLU A;  4NQG A;  1GGW A;  1CFC A;  2JXC A;  1OMV A;  2KAX A;  2KFG A;  1DJG A;  1SCV A;  1M63 B;  4QJ4 B;  1KQM B;  1CM4 A;  3ICB A;  5B8I B;  1JBA A;  2LMT A;  3GK1 A;  1F55 A;  1PK0 D;  2P6B B;  1YUS A;  2KI6 D;  2L5X B;  3O4Y A;  2FJU B;  1BU3 A;  1YUR A;  1K96 A;  1KFU S;  1TIZ A;  1ALV A;  3SG3 A;  1B7T Y;  2F2P A;  3I5H B;  1QAS A;  2Y5I A;  3EVR A;  3OB2 B;  4YBH B;  4CLN A;  2FCD A;  2LC5 A;  3CR2 A;  1OMR A;  2HPS A;  3VRN A;  4A4C A;  1QAT A;  5ER4 X;  3EVU A;  3OB1 B;  4AOM A;  1QV1 A;  2F3Z A;  1L2O C;  3KF9 A;  3O78 A;  3SJS A;  2KHN A;  3CR4 X;  1OFC X;  1Y1A A;  1CLL A;  2M29 A;  4XJK A;  2FCE A;  3D0Y B;  1MUX A;  1EJ3 A;  5HKY A;  1F54 A;  1QX5 B;  1QLK A;  3NXA A;  4YGE B;  1TTX A;  1QX7 A;  2PMY A;  4ORA B;  4CFR A;  1DJI A;  5D7F A;  1WY9 A;  4NDB A;  1KSO A;  2LLT A;  2BEC A;  2BBM A;  1XO5 A;  3KO0 A;  3PAT A;  4WQ3 A;  5F6T A;  1V1F A;  2H2K A;  2PAS A;  1S36 A;  1CMF A;  2OTG B;  1KWO C;  4DRW A;  3O2P A;  1CLB A;  1PUL A;  1A4P A;  1BJF A;  1QV0 A;  2LMU A;  3SIA A;  1BT6 A;  2BCX A;  2I7A A;  2CCM A;  1TNW A;  3K21 A;  5KU1 A;  2KFF A;  3NSI A;  2JT0 A;  3JVT B;  2K2F A;  1ZUZ A;  2WND A;  2NCO A;  3NSK A;  1A75 B;  1L2O B;  4PHJ A;  1PAL A;  3F45 A;  2K0J A;  1S26 D;  1SK6 D;  3PSR A;  2CNP A;  1SL8 A;  2JRF A;  3SG2 A;  3SIB A;  2LV7 A;  1CFF A;  2V53 A;  1JSA A;  4MLW A;  2JXL A;  1DGV A;  3I5I C;  1ZAC A;  1JF2 A;  3E3R A;  1MR8 A;  4ZCU A;  3WXA A;  1XFU O;  5K89 A;  1GGZ A;  2KYC A;  1OOJ A;  3CTN A;  3ZWH A;  1G33 A;  4ORC B;  2BKI B;  3EVV A;  2M97 A;  1FI5 A;  1SNL A;  2CXJ A;  1BOC A;  1AVS A;  1TNQ A;  2MBX A;  1DJW A;  1F4Q A;  1S3P A;  4MEW A;  1J1D A;  2LMV A;  3I5I B;  1IQ3 A;  5HLO A;  3FS7 A;  4USL A;  2M1K B;  3JVT C;  2TN4 A;  1S1E A;  3O6B A;  2F2O A;  1U5I A;  2LP2 A;  2PRU A;  2Q4U A;  1A29 A;  1RRO A;  1UWO A;  3CR5 X;  4GNK B;  4PDZ A;  1J7O A;  1KQV A;  2ZND A;  1QIV A;  1XK4 C;  4GPL B;  1EH2 A;  1N0Y A;  4PCW A;  5AXI A;  2KI6 C;  1IG5 A;  1MXE A;  5AER A;  1CDP A;  1AP4 A;  3I5H C;  4JPZ B;  1FW4 A;  1S6C A;  2WC8 A;  2KGR A;  1OSA A;  4ETO A;  1YTZ C;  3CLN A;  1IRJ A;  1XA5 A;  3A8R A;  1CKK A;  1SL9 A;  4R1E A;  1XK4 A;  1UHJ A;  2KNE A;  3IQQ A;  1AJ4 A;  1J7R A;  1RFJ A;  2DOQ A;  3BUX B;  5D69 A;  1M31 A;  3CZT X;  2BBN A;  2BCA A;  2MAZ A;  5ER5 A;  3C1V A;  4OCI A;  1ZOT B;  4UPG A;  1KFU L;  4IL1 A;  1CNP A;  2Y1N A;  1BOD A;  1HT9 A;  2MRD A;  1QTX A;  3A4U B;  3VRR A;  2NCP A;  1UUR A;  2G9B A;  1UHK A;  3H4S E;  2JWW A;  1QVI Y;  1TCO B;  4N5X A;  1U5I B;  4AQJ A;  2M49 B;  2GGM A;  1J7P A;  4N1G A;  2GV5 A;  4PAL A;  1K94 A;  1G8I A;  2LUX A;  2ZN9 A;  1AK8 A;  1QJT A;  1RWY A;  3PFV A;  3DVM A;  3GOF A;  5AAN A;  3WNX B;  1CDN A;  1S6I A;  2L0P A;  1GJY A;  2OPO A;  1MXL C;  1D1O A;  4OV2 A;  2M7L A;  2SAS A;  1PSR A;  2SCP A;  3BXK A;  1ZFS A;  5KSZ A;  1N65 A;  2ISD A;  3SG4 A;  1JUO A;  1DJY A;  2O60 A;  1BLQ A;  3EK8 A;  5I2Q A;  2AAO A;  2K7C A;  3FWC A;  2M0R A;  1CFD A;  2OS8 C;  3DF0 A;  3JTD B;  1F8H A;  2I18 A;  3IQO A;  2MHH A;  1N2D A;  1MHO A;  1A75 A;  3DVK A;  4GGF C;  4JWQ A;  4YRU A;  1S6J A;  2GGZ A;  2WOR A;  5PAL A;  2JNX A;  2L50 A;  2HF5 A;  2Q91 A;  2NXQ A;  1DT7 B;  2Y9Z A;  2PVB A;  2BE6 A;  1NCZ A;  2IS9 A;  2OTG C;  2AMI A;  4PHK A;  1YR5 A;  4PHN A;  4L9M A;  3AAJ A;  1FPW A;  1DJZ A;  1J55 A;  4I5N B;  1KK8 C;  2B1U A;  2LHL A;  2F8P A;  1AHR A;  5HYD A;  1IKU A;  1B8L A;  2K2A A;  4C0J A;  1NCY A;  3FIA A;  1QXP A;  2LAN A;  2VRG A;  2K8M B;  2WCB A;  3LK0 A;  1DGU A;  4FQO A;  3OX6 A;  1DTL A;  3RM1 A;  1CFP A;  2LP3 A;  2LNK A;  2JUL A;  3VRP A;  1OZO A;  5JJG A;  1KK7 Z;  2I94 A;  3HX4 A;  1KK8 B;  1JWD A;  1W7J B;  1R2U A;  2JZI A;  2Y1M A;  4BY5 A;  4OKH A;  1C7W A;  2JT3 A;  2LVI A;  3VRO A;  2LLS A;  2JTT A;  3BYA A;  2WCE A;  2MJW B;  3TUY B;  1QX2 A;  2JPT A;  2KQY A;  1LXF C;  3KHE A;  5I8N A;  2KYF A;  1ODB A;  1ALW A;  1XFY O;  1LA3 A;  1NYA A;  4DUQ A;  1YRU B;  1H8B A;  2LVK A;  2L51 A;  1DF0 B;  1SYM A;  2ZNE A;  4M2Q A;  2KBM A;  1BR4 B;  1QVI Z;  3KEV A;  3LLE A;  2JQ6 A;  1LVC D;  1NX3 A;  1JFJ A;  3LL8 B;  1SR6 C;  1NX0 A;  2AUC A;  3VRQ A;  1C07 A;  3BUW B;  1IQ5 A;  2KAV A;  4CFQ A;  4HRH A;  5AEQ A;  2I2R E;  3IF7 A;  3AAK A;  3WHT B;  4YGA A;  1NCX A;  2BL0 C;  1B9A A;  2M9G A;  1FBV A;  1YRT B;  1MWN A;  1MQ1 A;  3NSL A;  1UUS A;  1Y6W A;  3OP0 A;  2L4I A;  2LM5 A;  1B1G A;  4MN0 A;  5G08 A;  2HQW A;  5I2L A;  1FF1 A;  1M46 A;  1XYD A;  5TNC A;  1M39 A;  2QPT A;  3CWG A;  4ZCV A;  3NSO A;  1E8A A;  4PE1 A;  1Y1U A;  4MBE A;  4JQ0 D;  1CMG A;  4P5O E;  4HRG A;  1PVA A;  1OMD A;  4GGN A;  5HKW A;  3EK4 A;  2Y4Q A;  1LIN A;  1SRA A;  3I5F C;  4AQI A;  3DF0 B;  2KAY A;  3TUY C;  4MZJ A;  2KDH A;  4ICB A;  1KSM A;  1WDC C;  1W7I B;  1XVJ A;  1NX1 A;  4PE4 A;  2F33 A;  1IWQ A;  2WOS A;  2HQ8 A;  4GBA A;  2LE9 B;  1R6P A;  2BE4 A;  1KFX L;  1PRW A;  3LK1 A;  1K95 A;  1XFW O;  3BUN B;  1H4B A;  2CBL A;  1REC A;  2E30 A;  2JC2 A;  1TN4 A;  5HKZ A;  1SR6 B;  2KOT A;  4I5K A;  2KGB C;  1YVL A;  1LKJ A;  1Y1X A;  2QAC A;  2H61 A;  4C0L A;  2PAL A;  3HCM A;  2LVV A;  1PSB A;  1A03 A;  3I5G C;  3EKJ A;  1IGV A;  4I5J A;  1CDL A;  3PN7 B;  3SG5 A;  5AFP A;  1TRF A;  2E6W A;  2LAP A;  5BPJ A;  3PN7 C;  2L4H A;  3BQ3 A;  3KPX A;  2KSP A;  1JC2 A;  1FI6 A;  4DCK A;  2BCB A;  1OE9 B;  2CTN A;  2LVJ A;  2MLE C;  5CSI A;  2MLF C;  3SG7 A;  2EHB A;  1K8U A;  1AUI B;  1SL7 A;  4GUK A;  1OZS A;  4OR9 B;  3AKB A;  1G4Y R;  4HRE E;  1A2X A;  4OVN F;  5GQQ C;  3BOW A;  5J3X A;  3QRX A;  1K2H A;  1DMO A;  1X02 A;  4GFT A;  4TNC A;  1SBJ A;  1YUU A;  1QIW A;  2JNF A;  3BOW B;  3TDZ A;  1SMG A;  1DF0 A;  1DJH A;  5CPV A;  1KK7 Y;  5I2O A;  4F0Z B;  1B8R A;  1EL4 A;  2HET A;  3PAL A;  1YVH A;  2LUC A;  3DVJ A;  2KQ6 A;  1XFZ O;  4MRY A;  4MZL A;  1ZMZ A;  4MSP A;  2OS8 B;  1WLM A;  5CSJ A;  2PSR A;  3I5G B;  1WRZ A;  2CT9 A;  1IJ6 A;  1J1E A;  3MSE B;  2NLN A;  4FTG A;  3EKH A;  4CPV A;  3TS5 C;  5CSF A;  1CM1 A;  3CGA A;  3FWB A;  3TS5 B;  1F4O A;  1TNP A;  1CLM A;  1WRL A;  4A4B A;  1UP5 A;  1WDC B;  5CSN A;  4YGC B;  1CB1 A;  1B8C A;  4M2P A;  1EG4 A;  2EC6 C;  1NP8 A;  2BL0 B;  4C0K A;  1RK9 A;  4HSZ A;  1NUB A;  2JT8 A;  3LCP C;  3SG6 A;  1S5G Y;  4DIR A;  2ZFD A;  1TCF A;  1CDM A;  1SKT A;  2NZ0 A;  4NDC A;  1DVI A;  4PE7 A;  5DKN A;  1B4C A;  5KTY A;  2G2B A;  1SCM B;  1IH0 A;  2KBI A;  2A4J A;  1SY9 A;  1AJ5 A;  5FYX A;  1PVB A;  1KWO B;  1BR1 B;  1F70 A;  4WRI A;  1DJX A;  1NPQ A;  4MZK A;  4XYN A;  1BMO A;  2ZRT A;  2M7N A;  4MRX A;  2KFH A;  1KCY A;  1MF8 B;  2BKH B;  2F3Y A;  1QLS A;  3VGO A;  4PE0 A;  2R2I A;  3WHU B;  3PM8 A;  1Q80 A;  1WRK A;  1K9U A;  2EGD A;  2K7O A;  2JOJ A;  4U8D A;  3TDU A;  2FOT A;  2KI4 B;  4BY4 A;  1UHN A;  3TZ1 A;  1SCM C;  3TDI A;  1S5G Z;  4E68 A;  5JOL A;  1Y0V H;  2K61 A;  1UHH A;  1RJV A;  1K93 D;  4GAO A;  1JF0 A;  2O5G A;  1EG3 A;  1BF5 A;  2D8N A;  4I5L B;  2K7D A;  2EC6 B;  1M45 A;  2L98 A;  2M8U A;  4QJ3 B;  1EXR A;  2L2E A;  3JTD C;  1BG1 A;  1NX2 A;  1LA0 A;  4M2O A;  2LCP A;  3D10 A;  3PLF B;  1B47 A;  3BUO B;  1XFX O;  4ORB B;  3BUM B;  1K9P A;  2JU0 A;  2RGI A;  1KFX S;  1TOP A;  1RTP 1;  2WCF A;  4WQ2 A;  1SW8 A;  3RLZ A;  1IJ5 A;  5DKR A;  1C7V A;  4GGF A; 
#chains in the Genus database with same CATH topology
 3W68 A;  2Y0E A;  2P2U A;  1IFD A;  1J7Q A;  1NH4 A;  2LHI A;  1MUU A;  5IBW A;  2KLE A;  3EWK A;  2YXQ B;  2KNC B;  2KI4 C;  4PHM A;  2M1U A;  4XJK B;  2PP6 A;  2R5D A;  3AE7 C;  3D0Y A;  4LC1 A;  3SSU A;  2ZKM X;  3I5F B;  1K90 D;  2WCL A;  1NTM J;  3F5H A;  1TNX A;  1PPJ E;  1BSH A;  1QS7 A;  3EK7 A;  2KPH A;  3MIW A;  1ZN5 A;  2KYV A;  1JFK A;  1KQM C;  1RF0 A;  4N1F A;  4EIJ A;  3S1K A;  1R5S A;  3B5N A;  3M0W A;  2ZN8 A;  2QJK C;  3RK2 D;  4GKG A;  3CS1 A;  4MVF A;  2BNX A;  1GQM A;  1B7T Z;  1L7Z A;  2QJY B;  1M90 Q;  1USD A;  1SCV A;  2ERB A;  1J1E B;  3QWO C;  4QJ4 B;  5B8I B;  3ICB A;  2LMT A;  3L72 G;  2KI6 D;  3T97 A;  1N73 C;  1BGY E;  1L4A B;  5APS A;  3SG3 A;  3I5H B;  4IFF A;  3Q2Y A;  3EVR A;  1M7L A;  4YBH B;  1OMI A;  2RKL A;  3KYQ A;  3VRN A;  3CWB J;  1BGY D;  4A4C A;  2FBW C;  4JYC A;  3V4Q A;  3OB1 B;  4AOM A;  1AVO A;  1SFC A;  2WCK A;  1UII A;  3VP8 A;  1K9M Q;  4UB6 E;  3L36 A;  3MUD C;  3D0Y B;  3TF5 A;  2L5G B;  1NTM D;  2WZ7 A;  4PD4 E;  1QX5 B;  3IAO A;  1TTX A;  2A06 E;  1DJI A;  2BEC A;  1RF1 B;  1XO5 A;  4I1L A;  4W7Z A;  1EDL A;  1NHL A;  2PAS A;  1RE4 A;  2Y0C A;  2OTG B;  1YJ9 P;  2H8P D;  3O2P A;  2KS1 B;  2HPC A;  2OQQ A;  1LGH B;  1A4P A;  1P28 A;  5BVZ A;  1SQP E;  2OTL P;  3VP9 A;  1PIX A;  3CCU P;  2CCM A;  3N7H A;  1FE6 A;  4AUW A;  1LT1 A;  1LTJ C;  2IBZ D;  2IYO A;  3H1H E;  3NSK A;  3SS5 A;  1A75 B;  3O6Q A;  1L2O B;  5APY A;  4PHJ A;  3L35 A;  1IFJ A;  1YTZ I;  4XA4 A;  2OAR A;  3CC4 P;  1JSA A;  4KYN A;  1MZ9 A;  1OOG A;  1N86 A;  2IBZ E;  2JXL A;  2P70 A;  2WSC J;  3KPE A;  1LS8 A;  2N1T B;  3B71 A;  1MR8 A;  1L0N K;  1DEB A;  3SWY A;  1GGZ A;  3ZWH A;  1M1J A;  2WSF H;  1DIP A;  2BKI B;  3BAS A;  1AVS A;  1YQ3 C;  2Z4E A;  1ZV8 A;  1SFC D;  2F2O A;  1U5I A;  1LJ2 A;  3CR5 X;  4PDZ A;  4F7F A;  3V4W A;  2WTY A;  3M06 A;  2ZND A;  1QIV A;  1ZXG A;  1X0T A;  1N0Y A;  5AXI A;  3N4X A;  3I5H C;  2B87 A;  1FW4 A;  1S6C A;  2WC8 A;  1NTZ K;  1IRJ A;  5GTH E;  2ZAE B;  4R1E A;  1XK4 A;  1L0N E;  5KAI H;  3L4A A;  5B66 H;  4EOT A;  5D69 A;  2M8R A;  4OCI A;  2B89 A;  2Y1N A;  2ZXE B;  2MRD A;  1QTX A;  1J2J B;  2NCP A;  2ZYG A;  4JYB A;  1LT9 A;  3H4S E;  2JWW A;  4AQJ A;  1QGK B;  1J7P A;  2GGM A;  4N1G A;  2GV5 A;  4PAL A;  3S0D A;  3VB1 A;  1G8I A;  2O3J A;  3AE1 C;  3NHT A;  1CDN A;  1S6I A;  2FKW B;  2OPO A;  1FZB A;  1MXL C;  2WMM A;  1PSR A;  2SPZ A;  2QIW A;  3JSV C;  1N65 A;  3SG4 A;  3GHG A;  2Q3E A;  1MFZ A;  1BLQ A;  5AVT B;  3A7O A;  2AAO A;  5CCH D;  3G6E P;  4LGD E;  2BCC G;  1QL1 A;  2MHH A;  2W83 C;  1MHO A;  1LNQ A;  1VPC A;  3DVK A;  3G71 P;  3FX0 A;  2L50 A;  2HF5 A;  2Q91 A;  2NXQ A;  4PJ0 H;  2PVB A;  4AQR D;  1PPJ G;  1EZV D;  3AAJ A;  1FPW A;  3MUD A;  2P67 A;  4I5N B;  2E76 B;  1AHR A;  1IKU A;  4WY4 B;  5AVQ B;  3FGA D;  3FXD A;  1URQ D;  2LAN A;  1DGU A;  3RM1 A;  5KJ7 C;  3MHV A;  1CFP A;  3H1J G;  1FZC C;  5GTH H;  1KK7 Z;  1NTK E;  3L4L A;  3OAK A;  4H44 D;  3VMX A;  1NU1 K;  1KK8 B;  3ABV C;  1FU1 A;  5B66 E;  1IZN B;  1W7J B;  1AFO A;  3L75 D;  3L72 E;  3DZT A;  1FBM A;  2WPQ A;  3EFF K;  4L75 A;  1OOF A;  5CJ0 A;  1WRG A;  4Z1M H;  3JC2 2;  4K3A A;  3A5T A;  1XFY O;  1LA3 A;  3Q1M A;  1YRU B;  4GIF A;  2LVK A;  3K5B A;  3GHG B;  2KBM A;  2XZR A;  2YIU C;  5D3O A;  1RY3 A;  1PGO A;  1NX0 A;  3VRQ A;  3MZW B;  2IPP A;  3BUW B;  5APW A;  2KAV A;  1VF5 C;  1LWU C;  2WVR A;  4YGA A;  2BL0 C;  4I6M C;  5CHX A;  1YRT B;  1LTA C;  1MWN A;  1MQ1 A;  3NSL A;  5KJ7 A;  1VQ4 P;  1RQU A;  2FXO A;  2H88 C;  2WSC H;  4Y99 B;  2K1A A;  1VQN P;  5TNC A;  1M39 A;  2QPT A;  2IDB A;  1OVV A;  1E8A A;  1ZW0 A;  3HE5 B;  2FYU E;  4XE5 B;  4P5O E;  2K37 A;  4H44 B;  1PVA A;  4GGN A;  5HKW A;  4D6T G;  1L4A C;  5DJT B;  3TUY C;  4MZJ A;  3PRJ A;  2IBZ I;  2FFD C;  1WT6 A;  4M3L A;  2HQ8 A;  1FS0 E;  2J5U A;  1KFX L;  2WSE H;  1PRW A;  1RF1 C;  3LK1 A;  1XFW O;  2AXT E;  5HKZ A;  4TT3 H;  1SR6 B;  4I5K A;  4BWN A;  1OX3 A;  2OTK E;  1M57 D;  1LTJ A;  4JKT A;  2LVV A;  2YKP A;  3P8C D;  3I5G C;  5KKZ C;  5CCH C;  2LAP A;  1H88 A;  3MP7 B;  5KAF H;  2KSP A;  1JC2 A;  3S4R A;  1H0T B;  1QVG O;  2ZT9 B;  1QX8 A;  2MLF C;  3SG7 A;  1K8U A;  4GUK A;  5KLV D;  4MN4 C;  1LP1 A;  4OVN F;  5J3X A;  3QRX A;  1X02 A;  1G1I A;  2PFX A;  3BRV B;  3TSI A;  3B5N D;  3CC2 P;  4F0Z B;  2HET A;  3P32 A;  5TIS H;  2KK7 A;  2RMZ A;  2N9Y B;  4HYT B;  2ZYA A;  1BE3 J;  4MSP A;  1GL2 C;  5CSJ A;  1JOC A;  1OW8 A;  4OGQ C;  3S0A A;  1URQ B;  2Q1K A;  1KTM A;  1J1E A;  1JMB A;  4CPV A;  3B4S A;  3D73 A;  3TS5 C;  3BCC G;  5AVY B;  1NKZ B;  5AW2 B;  1S1C X;  4IOI H;  4CPG A;  4A4B A;  4YGC B;  1CB1 A;  1NTZ G;  1B8C A;  2EC6 C;  4IFD K;  2OYH B;  1RK9 A;  3H1K E;  1KC8 Q;  2XU6 A;  1TCF A;  1CDM A;  2CPS A;  3HRN A;  4H44 C;  3CXH H;  4PE7 A;  5DKN A;  1CSB A;  1GW3 A;  4PD4 H;  1CI6 B;  2A45 I;  3L47 A;  2MKV A;  5FYX A;  1KWO B;  1BR1 B;  1DJX A;  4MZK A;  1E79 H;  5CCG C;  3CCV P;  2ZRT A;  2M7N A;  1JCC A;  3RL0 C;  2I1J A;  2H89 C;  3M0D A;  2R2I A;  4U8D A;  2FOT A;  4GOF A;  1Y8A A;  3VYI A;  3M9Q A;  1SCM C;  2GA1 A;  3TDI A;  1NKN A;  4E68 A;  1UHH A;  4GAO A;  1JF0 A;  5KLI B;  1EG3 A;  1BF5 A;  2FYN C;  2JO1 A;  1L0L G;  3B87 A;  1M45 A;  4QJ3 B;  3GG2 A;  3CAB A;  3D74 A;  2L2E A;  3JTD C;  1BG1 A;  3Q5S A;  4U7J A;  2IYP A;  3HD7 D;  2LCP A;  1LTS C;  3H1L D;  5APQ A;  1B47 A;  2C9N Y;  2IZ1 A;  2RGI A;  2J59 M;  4WB4 A;  1KFX S;  4AYC A;  2I1K A;  2QEB A;  1NAY A;  4WQ2 A;  4H13 B;  3CI9 A;  3RLZ A;  1IJ5 A;  5DKR A;  1JCD A;  2D2C D;  5BU5 A;  1V1G A;  4YGD B;  3L71 G;  1CTR A;  2M3W A;  4Y99 C;  1HGZ A;  2Q9I A;  3OHM B;  3B86 A;  1VQ6 P;  4CID A;  1F71 A;  1PGP A;  2Y9Y A;  3GK4 X;  3NHI A;  1NTK J;  1JB0 J;  2UWJ E;  4H0L D;  3BJH A;  1HQV A;  4GOD A;  1YX8 A;  1YYC A;  1XTC C;  1P84 I;  1XFV O;  4QJ5 B;  1BE3 D;  4L74 A;  2JKV A;  4DOJ A;  1CI6 A;  1S5L X;  4D1E A;  1N7S B;  1VRK A;  2ZVN B;  3H25 A;  4HKZ H;  2VRS A;  3IR9 A;  3UIA A;  1Q7Y Q;  1NSH A;  2LLU A;  1X8Y A;  5C39 A;  3O6Q B;  3AE5 C;  2AXT H;  2WSE J;  1JBA A;  3GK1 A;  3CCJ P;  2KLD A;  1DH3 A;  1YUS A;  2KI7 B;  3O4Y A;  3VMY A;  2FJU B;  5TJH A;  3L70 G;  1TIZ A;  4JF7 A;  1OOH A;  2Q7C A;  5KLV G;  3OB2 B;  4CLN A;  2BCC D;  2LC5 A;  1FZF A;  3RK3 B;  2HPS A;  2HR3 A;  1SQV K;  3PTZ A;  1QAT A;  5AVV B;  4D6T E;  3WU2 E;  3B5N B;  3SJS A;  2XNX A;  2YMK A;  3N7N A;  2M29 A;  3CX5 D;  3PJI A;  3EFG A;  1IO4 A;  1EJ3 A;  5CMZ A;  3NFQ A;  2GTE A;  4YGE B;  3GMA A;  2PMY A;  4ORA B;  1SQP D;  1J1D C;  3V2R A;  2LLT A;  5FI2 A;  3KO0 A;  2B87 B;  2BAP A;  1TWO A;  5F6T A;  4RKU J;  2H2K A;  3R72 A;  1S36 A;  1IK9 A;  3H6P A;  4A7P A;  2KP8 A;  1J1E C;  1QV0 A;  1QL2 A;  1N7S C;  2I7A A;  5KU1 A;  5CJ4 A;  3B88 A;  3NSI A;  1MFT A;  2JT0 A;  3JVT B;  1L2P A;  2WND A;  2C0X A;  3CXH I;  4KT0 J;  4ZKU A;  1PAL A;  3F45 A;  2A45 H;  4ASV A;  2K0J A;  2LKM A;  3D6Y A;  1SK6 D;  3SG2 A;  1HTL C;  2C9L Y;  4OWF A;  2JJL A;  3M0D C;  5AVS B;  2LV7 A;  1CFF A;  2L5Y A;  1DGV A;  1ZAC A;  3TYY A;  4WBA A;  2FYZ A;  1IK7 A;  3WXA A;  3RK3 D;  1T2K C;  2KYC A;  3CCL P;  1G33 A;  3A0H E;  1M1J C;  2K9J A;  5KJ7 D;  3EG5 B;  1SNL A;  2CXJ A;  3PM2 A;  3V2L A;  3S0B A;  2R3S A;  1S3P A;  1AVY A;  1J1D A;  1DEK A;  3PH0 A;  3CZ2 A;  2LP2 A;  2Q4U A;  1OW7 A;  3I5C A;  1Q2N A;  1KQV A;  4GPL B;  1IG5 A;  1JMM A;  1T8Z A;  1CDP A;  3AE9 C;  2K9Y A;  1SQQ E;  1XFR A;  2FYU K;  4IL6 X;  2KGR A;  1OSA A;  4ETO A;  1FDM A;  3A8R A;  2N1T D;  2PRR A;  1VF5 D;  2KNE A;  3CWB D;  2QSI A;  3Q5R A;  3KZI H;  1RFJ A;  1SQP K;  2DOQ A;  1NU1 D;  4XFJ A;  3TDK A;  4Y28 J;  2CPB A;  1PP9 J;  4UPG A;  3AED C;  3E1I A;  3KXD A;  1HT9 A;  2QEX P;  1KD1 Q;  1FAV A;  2E75 B;  2KZI A;  3VRR A;  3KDP B;  3A0B H;  4OH8 B;  1PFI A;  1UHK A;  4PD4 D;  4N5X A;  2M49 B;  1AK8 A;  2ZN9 A;  1QJT A;  1AV1 A;  1KIL C;  2YO2 A;  3GOF A;  4I7Z B;  4U3F D;  4OZD A;  1NOH A;  2XKM A;  3L74 J;  2W8Z A;  1NVO A;  3LW5 H;  2M5A B;  5K5G B;  5KSZ A;  1DJY A;  3HUS A;  3EK8 A;  1ZRT E;  3FWC A;  4GT1 A;  2M0R A;  3RL0 B;  5AVX B;  3IQO A;  1EZV E;  1N2D A;  1BGY G;  2NRG A;  4GGF C;  1U7M A;  1S6J A;  2JNX A;  1DT7 B;  4UB8 E;  1QLE D;  2Y9Z A;  4HH2 A;  3IN6 A;  5APU A;  1NCZ A;  4NPF X;  1YJN P;  5DIC A;  2WPR A;  1KK8 C;  3AEC C;  2LHL A;  1SQB J;  3NXS A;  1PL5 A;  2VRG A;  2K8M B;  4LLH A;  3VTP C;  3HE5 A;  1OZO A;  1UIX A;  3HX4 A;  1JWD A;  2POH A;  2QEV A;  1R2U A;  2LXC B;  3KHU A;  4BY5 A;  3B6X A;  1C7W A;  2LVI A;  1KQF B;  5TIS E;  2ZFC A;  3KZI E;  3G4S P;  3KHE A;  2KYF A;  1KV4 A;  1RE4 C;  1PP9 D;  1QEX A;  1U7J A;  2G8Y A;  2HG5 D;  1DF0 B;  1KB9 D;  4RO0 A;  4M2Q A;  2L91 A;  1BR4 B;  1FC2 C;  3R1P A;  2YKQ A;  5HL1 A;  5E79 E;  1NX3 A;  1E5W A;  3LID A;  1JY2 N;  1GDT A;  2AUC A;  3RK2 C;  1C07 A;  1ZRT D;  1IQ5 A;  3AAK A;  2O01 N;  3WHT B;  1NCX A;  1BE3 G;  2R44 A;  1W2B O;  2WPV B;  3H1I E;  1KYO E;  4MN0 A;  2HQW A;  1FF1 A;  3U1A A;  2OYH A;  1M46 A;  2NPS B;  2HFE D;  1Q81 Q;  1SLQ A;  1QWV A;  4OGQ D;  4PE1 A;  1Y1U A;  3DXL A;  4JQ0 D;  1CMG A;  1SQX E;  3CDN A;  1R8E A;  3SS4 A;  2L2C A;  3EK4 A;  3AEA C;  3F89 A;  3BCC E;  1HJB A;  2Y4Q A;  3B5N C;  1NU1 J;  1N8R Q;  1OW6 A;  3V6I A;  3DF0 B;  3D77 A;  2KAY A;  3L73 E;  2KDH A;  1Y47 A;  1XVJ A;  3SWK A;  2WOS A;  1SVF A;  3GF3 A;  3VMZ A;  2BE4 A;  1ZR2 A;  3NGV A;  1H4B A;  1REC A;  2E30 A;  4ZMD A;  2HOD B;  3WUU A;  1P84 E;  2KOT A;  3BFA A;  3V5B A;  1LKJ A;  1Y1X A;  2PAL A;  3HCM A;  1PSB A;  3AE8 C;  1A03 A;  3EKJ A;  3SG5 A;  1CDL A;  3PN7 B;  3WMM 0;  2MJZ A;  2L4H A;  1GD2 E;  1FI6 A;  4DCK A;  1BCC D;  1OE9 B;  2LVJ A;  1FZE A;  3TNU A;  2NPS A;  3JCU E;  3CCR P;  2R3C A;  4OR9 B;  1RQV A;  1G4Y R;  1A2X A;  4OGQ B;  1SQV E;  1K2H A;  3A0B E;  2AXC A;  1QIW A;  3TDZ A;  3I56 P;  5I2O A;  4O9B A;  1YVH A;  1SQB E;  3WUT A;  3D70 A;  1BDD A;  1SQX D;  2KQ6 A;  1WMK A;  1OVU A;  5H2F H;  4MRY A;  2K60 A;  2K88 A;  4R4L A;  4N3Y B;  1NTM G;  4EYY Q;  2V7Q J;  1VQM P;  2H43 A;  1K04 A;  1WRZ A;  2XV5 A;  3MSE B;  3H1J D;  1CM1 A;  1ZLL A;  3CGA A;  3FWB A;  3TS5 B;  1CLM A;  1WRL A;  1UP5 A;  4M2P A;  2WT7 A;  3MD0 A;  1NP8 A;  4C0K A;  3HD7 A;  2FYU J;  4HSZ A;  2JT8 A;  4DIR A;  1S5G Y;  1PGJ A;  1SKT A;  2NZ0 A;  3H1J E;  4B86 A;  1NTK G;  2IFM A;  2IZ0 A;  2H8V A;  1A02 J;  1IFM A;  1SCM B;  5B5E H;  2JP3 A;  3O8Z A;  1IFI A;  4XYN A;  1NPQ A;  2D2C C;  1BCC J;  1EZV G;  2P58 A;  4WWI A;  1EXJ A;  4C46 A;  1MF8 B;  1PV3 A;  4H0L B;  2F3Y A;  5AW7 B;  1QLS A;  2Z5H A;  1P84 H;  2EGD A;  5CCG A;  2KI4 B;  2Q5U A;  1Q82 Q;  5JOL A;  1Y0V H;  1RF1 A;  3IFM A;  2O5G A;  1FZC A;  1IC2 A;  1JO5 A;  2K7D A;  1C3Y A;  2M8U A;  2L98 A;  2FYN B;  2OYI B;  3PLF B;  5M1B A;  1XFX O;  3BUM B;  1ZME C;  2JR8 A;  1SW8 A;  5BU8 B;  4GGF A;  3JCU H;  5CCG D;  3DD4 A;  2H61 C;  1BDC A;  2COL B;  1NGM B;  1NWD A;  1BSN A;  2A06 D;  4N78 D;  1NU1 G;  1NAF A;  5AVU B;  3M91 A;  1KYO D;  1OZH A;  2Z5I A;  1OIP A;  3AKA A;  1JTH A;  3ZNI A;  3CME P;  1S9K D;  1Z4H A;  1K9K A;  1W9Z A;  3OX5 A;  1YQ4 C;  4UB8 H;  3CLQ A;  2K7B A;  2W6B A;  4YI8 A;  1YBK A;  3AE2 C;  2D2C B;  5GTI E;  4YGB B;  1NIW A;  1GGW A;  1OMV A;  2KAX A;  2ZJS E;  3FXE A;  1M63 B;  3RK3 C;  1T2K D;  2I8D A;  2BEZ F;  4IFM A;  2P6B B;  3A0H H;  2L5X B;  3H1K D;  3CCM P;  2B9B A;  2KNC A;  1YUR A;  1M1K Q;  1LWU B;  1K96 A;  1ALV A;  1B7T Y;  2F2P A;  4DZO A;  4HJG H;  1H8A A;  2ZT9 C;  3H32 B;  3CZ1 A;  3R4Y A;  1HGV A;  5ER4 X;  2XND H;  3EVU A;  2F3Z A;  1L2O C;  1BGY J;  3KF9 A;  4INW A;  3O78 A;  1Y1A A;  1SFC B;  3C8V A;  2FCE A;  1MUX A;  3AEF C;  1QX7 A;  5D7F A;  2WCH A;  3S0E A;  2BBM A;  4WQ3 A;  4FQT A;  2M5A A;  2Y0D A;  2KLV A;  5I94 A;  1BJF A;  3HUS B;  2LMU A;  2WCJ A;  1DEE G;  1BT6 A;  1TNW A;  3K21 A;  1ZUZ A;  2NCO A;  1D7M A;  4YTP C;  3CD6 P;  1SSE B;  3QH9 A;  5AW3 B;  2CNP A;  5KLV K;  2JRF A;  1JEK A;  1KZU B;  2XDJ A;  3SIB A;  1YI2 P;  2YKO A;  3TGU D;  2V53 A;  2N1T A;  2R32 A;  1IJD B;  4U3F E;  2RH0 A;  1YJW P;  1JF2 A;  3E3R A;  4ZCU A;  1DX7 A;  1VQ5 P;  3BCC D;  4ORC B;  1L0L D;  3Q3D A;  1SQV J;  1M1J B;  3L73 D;  1BOC A;  1NTZ D;  2K9J B;  4NPE A;  2E75 D;  2MBX A;  1X79 B;  3I5I B;  2LMV A;  1IQ3 A;  3L73 J;  4I2L C;  2RN0 A;  1LTT C;  5AVR B;  3Q5P A;  1L0L J;  2TN4 A;  1S1E A;  3O6B A;  4GNK B;  1J7O A;  1A29 A;  2KSJ A;  3L70 J;  1L0L E;  1XK4 C;  1EH2 A;  5E79 H;  5AW8 B;  2KI6 C;  1MXE A;  2OGU A;  4C7N B;  3T97 B;  1VDF A;  3M0A A;  3CYZ A;  3AEB C;  1CKK A;  3H1J J;  1Q90 D;  1SL9 A;  1UHJ A;  2Q3I A;  3IQQ A;  1AJ4 A;  1J7R A;  3L74 E;  2P10 A;  1M31 A;  3CMA P;  3CZT X;  2BBN A;  2BCA A;  3L71 E;  1SQQ D;  3P8M C;  4WY4 C;  3LW5 J;  1DD3 A;  4ZKP A;  2O1K A;  1UUR A;  1T6A A;  2G9B A;  2NPS C;  2ITA A;  5CBN A;  1U5I B;  2QJP B;  1K94 A;  2LUX A;  1RWY A;  4EDF A;  3PFV A;  2E76 C;  2KB7 P;  5AW5 B;  3WNX B;  2L0P A;  1GJY A;  1KIL E;  1KFM A;  1D1O A;  3A2A A;  2M7L A;  1HF9 A;  2SAS A;  3U1C A;  2QDI A;  2ISD A;  2JEE A;  1KB9 I;  5I2Q A;  4RJT A;  3H1I G;  2K7C A;  2BCC J;  1S9K E;  2OS8 C;  3DF0 A;  3JTD B;  1F8H A;  2I18 A;  1G1J A;  1Z56 A;  3L70 E;  1A75 A;  3GW6 A;  3HE4 B;  2GGZ A;  3RBZ A;  3TGU E;  1VL2 A;  2BE6 A;  2IS9 A;  1W2E A;  1GU5 A;  2OTG C;  4PHN A;  4L9M A;  1VQP P;  3AEE C;  1YIT P;  1J55 A;  1SQX K;  2PGD A;  1B8L A;  4C0J A;  1LTJ B;  1SQP J;  1NCY A;  3FIA A;  3L74 D;  3LK0 A;  2WCB A;  4IJ7 A;  4FQO A;  5AVZ B;  2P71 A;  1SFC C;  1YHQ P;  2LNK A;  3VRP A;  1GZL A;  3USS A;  2JT3 A;  1VQ7 P;  3S0G A;  2KIK A;  3VRO A;  1HWT C;  3CC7 P;  2JTT A;  3DY9 A;  3BYA A;  2Q6Q A;  2WCE A;  2FFD A;  3BCC J;  3TUY B;  2JPT A;  2KQY A;  3CWB E;  1ODB A;  1JY2 P;  1ALW A;  4DUQ A;  1H8B A;  2L51 A;  2GUS A;  2V7Q H;  1SYM A;  3L71 D;  4GOE A;  3ZDM A;  1QVI Z;  2E74 C;  2JQ6 A;  3HTK B;  1OOI X;  4R4M A;  2QRX A;  1JFJ A;  3EQ2 A;  1URQ C;  1SR6 C;  4HRH A;  2KUB A;  1B9A A;  1FBV A;  1MKM A;  1UUS A;  1Y6W A;  3OP0 A;  1M56 D;  2CK3 H;  3B7A A;  1HBW A;  1SQB K;  2KSE A;  2QA4 P;  5EFW B;  3CL3 D;  3SWF A;  2PQL A;  2E74 D;  1OMD A;  3L70 D;  1VQO P;  2QJK B;  3I5F C;  1SQQ G;  3MGN A;  4ICB A;  2QEH A;  2LR2 A;  2H7H A;  3GHG C;  3CCQ P;  4GBA A;  2LE9 B;  2BCC E;  3A3Y B;  1USE A;  4PV1 D;  1K95 A;  3BUN B;  4K35 A;  3SFE C;  2JC2 A;  3PJS K;  1TN4 A;  1MV8 A;  1LTB C;  1GL2 A;  5KAF E;  2KGB C;  2FXM A;  4PJ0 E;  1HJ0 A;  2ZXX A;  1N73 A;  2QAC A;  2OYO A;  4C0L A;  3L75 J;  5AFP A;  4I5J A;  1PZQ A;  1SQQ J;  2E75 C;  5BPJ A;  3PN7 C;  3BQ3 A;  3KPX A;  1OVR A;  1JY3 N;  2BCB A;  3H1I D;  3OW2 O;  5KLV J;  5CSI A;  2WSS H;  3AE4 C;  4PD4 I;  1AUI B;  1SL7 A;  1OZS A;  2E5T A;  3AKB A;  4HRE E;  5EL2 A;  5GQQ C;  3BOW A;  4KHX A;  1SBJ A;  1SMG A;  1G2C A;  1KK7 Y;  3H1L E;  5AW9 B;  1B8R A;  1JY3 P;  4WVZ A;  5FI6 A;  3DVJ A;  2B88 A;  5AW1 B;  1XFZ O;  1JM0 A;  1ZMZ A;  2GM4 A;  1IIO A;  4WY4 D;  1WLM A;  2PSR A;  4H13 D;  3I5G B;  3AE6 C;  1IJ6 A;  3V2P A;  3G3Z A;  3EKH A;  3H1H J;  3BFB A;  1URQ A;  1KMI Z;  2JWD A;  1H0T A;  2N9B A;  1F4O A;  2LXB A;  3H1H G;  1T3J A;  1Q86 Q;  4H0L C;  3SG6 A;  2WT7 B;  2ZFD A;  1OXZ A;  1DVI A;  1KQL A;  3AE3 C;  2IBZ G;  1B4C A;  5KTY A;  2G2B A;  3FE6 A;  1W5C E;  1JTH B;  3H1K J;  1HH0 A;  1PP9 G;  2KBI A;  2A4J A;  1SY9 A;  1N7S D;  1FOS F;  1AJ5 A;  1VQL P;  1FJK A;  3UO9 A;  3RL0 g;  3P8C E;  1BMO A;  5CBO A;  2KFH A;  1KCY A;  3D76 A;  3L37 A;  1Q80 A;  4N6J A;  1K9U A;  2K7O A;  3VN0 A;  4BY4 A;  3TZ1 A;  1HVV A;  1S5G Z;  3CX5 H;  1H89 A;  1K93 D;  4I5L B;  3CCE P;  3K1E A;  1G2C B;  2EC6 B;  1YTZ T;  1LWU A;  1EXR A;  3H1L J;  1N7S A;  2HYN A;  1LA0 A;  4M2O A;  2W6J H;  4ORB B;  2OYI A;  1K9P A;  2JU0 A;  1GW4 A;  3LIE A;  1RTP 1;  2WCF A;  2WPS A;  1NYH A;  1C7V A;  1L0N G;  4QMA A;  1JUN A;  2ZRS A;  5HLV A;  4P2Y B;  5KKZ B;  1YUT A;  3VOP A;  3V2Q A;  4Q04 A;  5AW0 B;  3GK2 A;  2QG4 A;  1WLZ A;  2JTZ A;  4DS7 A;  4NDD A;  2QVA A;  1SPY A;  5DKQ A;  3D71 A;  1LP1 B;  1FZC B;  3FE8 A;  4YI9 A;  2NZ2 A;  1KFN A;  2MA2 A;  3DVE A;  3VMA A;  4DT0 A;  3RK3 E;  3IF4 A;  1YX7 A;  1GK6 A;  2YO3 A;  3OA7 A;  1PPJ D;  2BEQ D;  2JWA A;  1UHI A;  4NQG A;  1OQP A;  1CFC A;  2JXC A;  4U3F G;  2KFG A;  3PP5 A;  1DJG A;  3PLN A;  1KQM B;  1CM4 A;  2AEF A;  1YIJ P;  1F55 A;  3UNW A;  1PK0 D;  5AW6 B;  5KTB A;  3M9B A;  1BU3 A;  2QEO A;  1Y9B A;  2O01 H;  1KFU S;  2QM7 A;  5CCH A;  3L75 G;  2HPC B;  1QAS A;  2Y5I A;  1KIL B;  1U57 A;  4H13 C;  1KOR A;  1SS1 A;  3FWN A;  2FCD A;  3CR2 A;  1OMR A;  3SFD C;  2E43 A;  1FZA A;  1TUZ A;  3G9R A;  1QV1 A;  3O4X A;  2KHN A;  3CR4 X;  2W6A A;  1AQT A;  1S72 P;  1OFC X;  3I55 P;  2WC5 A;  4BRY B;  1CLL A;  4XJK A;  3D75 A;  1SQV G;  3C9I A;  3C1L A;  2E42 A;  5FI7 A;  3R1V A;  5HKY A;  1F54 A;  1QLK A;  3NXA A;  3L72 J;  3WU2 H;  3AEG C;  1LTI C;  3U59 A;  4RES B;  4CFR A;  4JD9 A;  1WY9 A;  4NDB A;  1VQ9 P;  1KSO A;  3L74 G;  3PAT A;  1NTZ J;  2KS1 A;  5DJU B;  1V1F A;  1CMF A;  1KWO C;  3DYE A;  4DRW A;  1FJP A;  1CLB A;  1PUL A;  2KOG A;  3SIA A;  3BRT B;  2BCX A;  3HUS C;  4TLF A;  2R5B A;  3MTU E;  2KFF A;  1EC5 A;  2K2F A;  3NTN A;  1AA0 A;  1RE3 C;  3TGU J;  2YNY A;  2P1J A;  3TK1 A;  1S26 D;  3PSR A;  2ZYD A;  4N78 E;  1FDO A;  1SL8 A;  2QE7 H;  4MLW A;  1TU3 F;  1KIL A;  1EXI A;  3I5I C;  1KIL D;  4NPD A;  1RH5 B;  3FE9 A;  1ZP0 C;  1XFU O;  5K89 A;  3CPW O;  3CTN A;  3BAT A;  1OOJ A;  1S2E A;  3EVV A;  2M97 A;  1A02 F;  1FI5 A;  1TNQ A;  1DJW A;  3CCS P;  1F4Q A;  4MEW A;  5HLO A;  1TUJ A;  3FS7 A;  2M1K B;  3JVT C;  4USL A;  2N1T C;  1PGQ A;  1NTK D;  1J1D B;  1EZV I;  2PRU A;  1RRO A;  1UWO A;  2GUV A;  2P7J A;  4HB1 A;  1L0N D;  4PCW A;  2FFD B;  2A45 G;  5AER A;  1AP4 A;  4JPZ B;  1YTZ C;  3CLN A;  1XA5 A;  3S0F A;  2WQY C;  3CZ0 A;  2A06 G;  1PP9 E;  1BCC G;  4IL6 H;  3BUX B;  1JY2 O;  4D6T D;  2MAZ A;  5ER5 A;  4C7R A;  3C1V A;  1ZOT B;  1KFU L;  2O1J A;  3ITK A;  4IL1 A;  1K05 A;  1CNP A;  1QVF O;  1IFP A;  1BOD A;  3A4U B;  1NJI Q;  1CW5 A;  1HUC A;  5KLV E;  1NU1 E;  1QVI Y;  1TCO B;  1SQX G;  1T14 A;  1T3U A;  1RF0 C;  3OGN A;  3RGU A;  3DVM A;  5AAN A;  2E76 D;  4C7N A;  1VQK P;  2QM8 A;  2E5Y A;  4OV2 A;  2SCP A;  3BXK A;  5GTI H;  1ZFS A;  3IVT A;  1JUO A;  2O60 A;  2G3A A;  3H1H D;  3KQG A;  1LTG C;  3E1R A;  1CFD A;  2WC6 A;  5KLI C;  1L0L K;  2M0B A;  4JWQ A;  4YRU A;  2WOR A;  5PAL A;  3HE4 A;  4INX A;  2AMI A;  4PHK A;  1YR5 A;  1DJZ A;  1NTM K;  1VF5 B;  1R5L A;  4WY4 A;  4I7Z C;  2B1U A;  1GL2 B;  2F8P A;  5HYD A;  2K2A A;  2C0W A;  1NTZ E;  1N73 B;  2FYU D;  1QXP A;  4KJM A;  4ZNC A;  3OX6 A;  1DTL A;  3H1K G;  1S4X A;  2LP3 A;  2JUL A;  2WSF J;  5JJG A;  2I94 A;  1EDJ A;  2JZI A;  2Y1M A;  1DD4 A;  4OKH A;  2HLO A;  3FWL A;  3CXH E;  1NWQ A;  2LLS A;  2DW3 A;  4IL6 E;  1SQB G;  1Z2C B;  5H2F E;  1GM0 A;  4PT1 A;  2MJW B;  2M3E A;  1QX2 A;  1LXF C;  5I8N A;  1NYA A;  3L75 E;  4L73 A;  1NTM E;  4D6T J;  2ZNE A;  1SQV D;  3KEV A;  1DEL A;  3LLE A;  1LVC D;  1AJY A;  2E74 B;  1EDK A;  3PHL A;  3OBV A;  3RL0 D;  3LL8 B;  3CX5 I;  3H1I J;  4CFQ A;  4YXD C;  2KLU A;  1KB9 E;  5AEQ A;  2I2R E;  3IF7 A;  3Q8I A;  4GDO A;  1GU4 A;  4ASW A;  2W27 A;  2M9G A;  5AW4 B;  1LT9 B;  1ZR4 A;  2L4I A;  5B5E E;  1GK4 A;  1CZQ A;  2LM5 A;  1B1G A;  5G08 A;  2KXP B;  4YPC A;  1S5L E;  1AQ5 A;  2YXR B;  5I2L A;  1KYO I;  4PV1 B;  2WIT A;  1XYD A;  3H1L G;  2PYQ A;  3CWG A;  1SQX J;  4ZCV A;  3NSO A;  2AEM A;  4MBE A;  2K3R A;  4YXW H;  1S3J A;  3P7K A;  1K8A Q;  1IFN A;  1X22 A;  3HTK A;  4HRG A;  2OYI C;  1LIN A;  1SRA A;  4AQI A;  3GF7 A;  3RBX A;  3HD7 C;  1KSM A;  2ZT9 D;  3CXH D;  1WDC C;  5APX A;  3TNU B;  1GTW A;  1W7I B;  1NX1 A;  5AVW B;  4PE4 A;  2F33 A;  1IWQ A;  4JBZ A;  3L71 J;  3WUV A;  1R6P A;  2WWW A;  1C3Z A;  1OW4 A;  4W7Y A;  2CBL A;  1L0N J;  2V4H A;  1M8O B;  1KQS O;  3RK2 B;  3W67 A;  1YVL A;  3D78 A;  1KQG B;  2H61 A;  1SQP G;  1IGV A;  3CX5 E;  1TRF A;  2E6W A;  3L72 D;  2JDI H;  5APV A;  2CTN A;  4BXL A;  1FOS E;  2MLE C;  1LT9 C;  2EHB A;  2IFN A;  3SS3 A;  2O01 J;  2W90 A;  2FXP A;  1KB9 H;  1EQ7 A;  1N7L A;  4DJG A;  1DMO A;  1BCC E;  4GFT A;  4TNC A;  1N2D C;  1DQE A;  1YUU A;  2JNF A;  3BOW B;  1GMJ A;  1DF0 A;  1DJH A;  5CPV A;  1RHZ B;  1VQ8 P;  1EL4 A;  3PAL A;  2J58 A;  4U3F J;  4EI2 A;  2LUC A;  3TGU G;  4MZL A;  1GL2 D;  1DC1 A;  3RZS A;  1JNM A;  2OS8 B;  2YIU B;  2FYU G;  2PAJ A;  3QME A;  4L76 A;  3B8E B;  2CT9 A;  2JPO A;  4PV1 C;  2NLN A;  4FTG A;  1OWA A;  3BFH A;  4W80 A;  1FZG A;  5CSF A;  3NMD A;  1SP4 A;  1NTK K;  3HD7 B;  1TNP A;  2WCM A;  1WDC B;  5CSN A;  2QJY C;  1KN7 A;  1EG4 A;  2BL0 B;  1ORG A;  3D6Z A;  1NUB A;  3LCP C;  1BE3 E;  3H32 A;  2BAS A;  4NDC A;  2IX7 C;  1P84 D;  2QJP C;  3V2N A;  1IH0 A;  3S9O A;  3E7K A;  1PVB A;  1F70 A;  4WRI A;  4MRX A;  1SQQ K;  3R2P A;  1X9V A;  3L4F A;  2BKH B;  2OYH C;  2YGU A;  2KZJ A;  1NO4 A;  3VGO A;  4PE0 A;  4BRY A;  1RE3 A;  3WHU B;  3PM8 A;  3CWB G;  5APT A;  1WRK A;  5KAI E;  2JOJ A;  3TDU A;  2FJY A;  1UHN A;  2FY8 A;  5L8R J;  1FDI A;  2K61 A;  3OJA B;  1RJV A;  2M3B A;  1JY3 O;  2D8N A;  3GLM A;  2OTJ P;  1ZOY C;  2YMY A;  1L4A D;  1L4A A;  3L73 G;  3M9H A;  1NX2 A;  1XTG B;  2ZVO B;  3II6 A;  2HOD A;  3D10 A;  1K73 Q;  3BUO B;  1KYO H;  2NPS D;  4UB6 H;  1SQB D;  1TOP A;  3R1O A;  2AEJ A;  1S5L H;  3BVH A;  1EDI A; 
#chains in the Genus database with same CATH homology
 2ZRS A;  3DD4 A;  2H61 C;  5HLV A;  1V1G A;  2COL B;  4P2Y B;  4YGD B;  1CTR A;  1YUT A;  2M3W A;  1J7Q A;  4Q04 A;  3GK2 A;  3OHM B;  1WLZ A;  2LHI A;  4CID A;  1F71 A;  2Y9Y A;  3GK4 X;  5IBW A;  1NWD A;  2JTZ A;  2KI4 C;  4PHM A;  2M1U A;  4XJK B;  4DS7 A;  4NDD A;  3D0Y A;  2ZKM X;  3I5F B;  1K90 D;  1HQV A;  1SPY A;  1YX8 A;  5DKQ A;  1TNX A;  1QS7 A;  1XFV O;  3EK7 A;  3AKA A;  4QJ5 B;  3ZNI A;  4YI9 A;  4D1E A;  1JFK A;  1KQM C;  1VRK A;  1K9K A;  2MA2 A;  3DVE A;  3OX5 A;  4N1F A;  2K7B A;  1YX7 A;  4YI8 A;  3M0W A;  2ZN8 A;  1UHI A;  3CS1 A;  4MVF A;  4YGB B;  1NIW A;  1NSH A;  1GQM A;  1B7T Z;  1OQP A;  1L7Z A;  2LLU A;  4NQG A;  1GGW A;  1CFC A;  2JXC A;  1OMV A;  2KAX A;  2KFG A;  1DJG A;  1SCV A;  1M63 B;  4QJ4 B;  1KQM B;  1CM4 A;  3ICB A;  5B8I B;  1JBA A;  2LMT A;  3GK1 A;  1F55 A;  1PK0 D;  2P6B B;  1YUS A;  2KI6 D;  2L5X B;  3O4Y A;  2FJU B;  1BU3 A;  1YUR A;  1K96 A;  1KFU S;  1TIZ A;  1ALV A;  3SG3 A;  1B7T Y;  2F2P A;  3I5H B;  1QAS A;  2Y5I A;  3EVR A;  3OB2 B;  4YBH B;  4CLN A;  2FCD A;  2LC5 A;  3CR2 A;  1OMR A;  2HPS A;  3VRN A;  4A4C A;  1QAT A;  5ER4 X;  3EVU A;  3OB1 B;  4AOM A;  1QV1 A;  2F3Z A;  1L2O C;  3KF9 A;  3O78 A;  3SJS A;  2KHN A;  3CR4 X;  1OFC X;  1Y1A A;  1CLL A;  2M29 A;  4XJK A;  2FCE A;  3D0Y B;  1MUX A;  1EJ3 A;  5HKY A;  1F54 A;  1QX5 B;  1QLK A;  3NXA A;  4YGE B;  1TTX A;  1QX7 A;  2PMY A;  4ORA B;  4CFR A;  1DJI A;  5D7F A;  1WY9 A;  4NDB A;  1KSO A;  2LLT A;  2BEC A;  2BBM A;  1XO5 A;  3KO0 A;  3PAT A;  4WQ3 A;  5F6T A;  1V1F A;  2H2K A;  2PAS A;  1S36 A;  1CMF A;  2OTG B;  1KWO C;  4DRW A;  3O2P A;  1CLB A;  1PUL A;  1A4P A;  1BJF A;  1QV0 A;  2LMU A;  3SIA A;  1BT6 A;  2BCX A;  2I7A A;  2CCM A;  1TNW A;  3K21 A;  5KU1 A;  2KFF A;  3NSI A;  2JT0 A;  3JVT B;  2K2F A;  1ZUZ A;  2WND A;  2NCO A;  3NSK A;  1A75 B;  1L2O B;  4PHJ A;  1PAL A;  3F45 A;  2K0J A;  1S26 D;  1SK6 D;  3PSR A;  2CNP A;  1SL8 A;  2JRF A;  3SG2 A;  3SIB A;  2LV7 A;  1CFF A;  2V53 A;  1JSA A;  4MLW A;  2JXL A;  1DGV A;  3I5I C;  1ZAC A;  1JF2 A;  3E3R A;  1MR8 A;  4ZCU A;  3WXA A;  1XFU O;  5K89 A;  1GGZ A;  2KYC A;  1OOJ A;  3CTN A;  3ZWH A;  1G33 A;  4ORC B;  2BKI B;  3EVV A;  2M97 A;  1FI5 A;  1SNL A;  2CXJ A;  1BOC A;  1AVS A;  1TNQ A;  2MBX A;  1DJW A;  1F4Q A;  1S3P A;  4MEW A;  1J1D A;  2LMV A;  3I5I B;  1IQ3 A;  5HLO A;  3FS7 A;  4USL A;  2M1K B;  3JVT C;  2TN4 A;  1S1E A;  3O6B A;  2F2O A;  1U5I A;  2LP2 A;  2PRU A;  2Q4U A;  1A29 A;  1RRO A;  1UWO A;  3CR5 X;  4GNK B;  4PDZ A;  1J7O A;  1KQV A;  2ZND A;  1QIV A;  1XK4 C;  4GPL B;  1EH2 A;  1N0Y A;  4PCW A;  5AXI A;  2KI6 C;  1IG5 A;  1MXE A;  5AER A;  1CDP A;  1AP4 A;  3I5H C;  4JPZ B;  1FW4 A;  1S6C A;  2WC8 A;  2KGR A;  1OSA A;  4ETO A;  1YTZ C;  3CLN A;  1IRJ A;  1XA5 A;  3A8R A;  1CKK A;  1SL9 A;  4R1E A;  1XK4 A;  1UHJ A;  2KNE A;  3IQQ A;  1AJ4 A;  1J7R A;  1RFJ A;  2DOQ A;  3BUX B;  5D69 A;  1M31 A;  3CZT X;  2BBN A;  2BCA A;  2MAZ A;  5ER5 A;  3C1V A;  4OCI A;  1ZOT B;  4UPG A;  1KFU L;  4IL1 A;  1CNP A;  2Y1N A;  1BOD A;  1HT9 A;  2MRD A;  1QTX A;  3A4U B;  3VRR A;  2NCP A;  1UUR A;  2G9B A;  1UHK A;  3H4S E;  2JWW A;  1QVI Y;  1TCO B;  4N5X A;  1U5I B;  4AQJ A;  2M49 B;  2GGM A;  1J7P A;  4N1G A;  2GV5 A;  4PAL A;  1K94 A;  1G8I A;  2LUX A;  2ZN9 A;  1AK8 A;  1QJT A;  1RWY A;  3PFV A;  3DVM A;  3GOF A;  5AAN A;  3WNX B;  1CDN A;  1S6I A;  2L0P A;  1GJY A;  2OPO A;  1MXL C;  1D1O A;  4OV2 A;  2M7L A;  2SAS A;  1PSR A;  2SCP A;  3BXK A;  1ZFS A;  5KSZ A;  1N65 A;  2ISD A;  3SG4 A;  1JUO A;  1DJY A;  2O60 A;  1BLQ A;  3EK8 A;  5I2Q A;  2AAO A;  2K7C A;  3FWC A;  2M0R A;  1CFD A;  2OS8 C;  3DF0 A;  3JTD B;  1F8H A;  2I18 A;  3IQO A;  2MHH A;  1N2D A;  1MHO A;  1A75 A;  3DVK A;  4GGF C;  4JWQ A;  4YRU A;  1S6J A;  2GGZ A;  2WOR A;  5PAL A;  2JNX A;  2L50 A;  2HF5 A;  2Q91 A;  2NXQ A;  1DT7 B;  2Y9Z A;  2PVB A;  2BE6 A;  1NCZ A;  2IS9 A;  2OTG C;  2AMI A;  4PHK A;  1YR5 A;  4PHN A;  4L9M A;  3AAJ A;  1FPW A;  1DJZ A;  1J55 A;  4I5N B;  1KK8 C;  2B1U A;  2LHL A;  2F8P A;  1AHR A;  5HYD A;  1IKU A;  1B8L A;  2K2A A;  4C0J A;  1NCY A;  3FIA A;  1QXP A;  2LAN A;  2VRG A;  2K8M B;  2WCB A;  3LK0 A;  1DGU A;  4FQO A;  3OX6 A;  1DTL A;  3RM1 A;  1CFP A;  2LP3 A;  2LNK A;  2JUL A;  3VRP A;  1OZO A;  5JJG A;  1KK7 Z;  2I94 A;  3HX4 A;  1KK8 B;  1JWD A;  1W7J B;  1R2U A;  2JZI A;  2Y1M A;  4BY5 A;  4OKH A;  1C7W A;  2JT3 A;  2LVI A;  3VRO A;  2LLS A;  2JTT A;  3BYA A;  2WCE A;  2MJW B;  3TUY B;  1QX2 A;  2JPT A;  2KQY A;  1LXF C;  3KHE A;  5I8N A;  2KYF A;  1ODB A;  1ALW A;  1XFY O;  1LA3 A;  1NYA A;  4DUQ A;  1YRU B;  1H8B A;  2LVK A;  2L51 A;  1DF0 B;  1SYM A;  2ZNE A;  4M2Q A;  2KBM A;  1BR4 B;  1QVI Z;  3KEV A;  3LLE A;  2JQ6 A;  1LVC D;  1NX3 A;  1JFJ A;  3LL8 B;  1SR6 C;  1NX0 A;  2AUC A;  3VRQ A;  1C07 A;  3BUW B;  1IQ5 A;  2KAV A;  4CFQ A;  4HRH A;  5AEQ A;  2I2R E;  3IF7 A;  3AAK A;  3WHT B;  4YGA A;  1NCX A;  2BL0 C;  1B9A A;  2M9G A;  1FBV A;  1YRT B;  1MWN A;  1MQ1 A;  3NSL A;  1UUS A;  1Y6W A;  3OP0 A;  2L4I A;  2LM5 A;  1B1G A;  4MN0 A;  5G08 A;  2HQW A;  5I2L A;  1FF1 A;  1M46 A;  1XYD A;  5TNC A;  1M39 A;  2QPT A;  3CWG A;  4ZCV A;  3NSO A;  1E8A A;  4PE1 A;  1Y1U A;  4MBE A;  4JQ0 D;  1CMG A;  4P5O E;  4HRG A;  1PVA A;  1OMD A;  4GGN A;  5HKW A;  3EK4 A;  2Y4Q A;  1LIN A;  1SRA A;  3I5F C;  4AQI A;  3DF0 B;  2KAY A;  3TUY C;  4MZJ A;  2KDH A;  4ICB A;  1KSM A;  1WDC C;  1W7I B;  1XVJ A;  1NX1 A;  4PE4 A;  2F33 A;  1IWQ A;  2WOS A;  2HQ8 A;  4GBA A;  2LE9 B;  1R6P A;  2BE4 A;  1KFX L;  1PRW A;  3LK1 A;  1K95 A;  1XFW O;  3BUN B;  1H4B A;  2CBL A;  1REC A;  2E30 A;  2JC2 A;  1TN4 A;  5HKZ A;  1SR6 B;  2KOT A;  4I5K A;  2KGB C;  1YVL A;  1LKJ A;  1Y1X A;  2QAC A;  2H61 A;  4C0L A;  2PAL A;  3HCM A;  2LVV A;  1PSB A;  1A03 A;  3I5G C;  3EKJ A;  1IGV A;  4I5J A;  1CDL A;  3PN7 B;  3SG5 A;  5AFP A;  1TRF A;  2E6W A;  2LAP A;  5BPJ A;  3PN7 C;  2L4H A;  3BQ3 A;  3KPX A;  2KSP A;  1JC2 A;  1FI6 A;  4DCK A;  2BCB A;  1OE9 B;  2CTN A;  2LVJ A;  2MLE C;  5CSI A;  2MLF C;  3SG7 A;  2EHB A;  1K8U A;  1AUI B;  1SL7 A;  4GUK A;  1OZS A;  4OR9 B;  3AKB A;  1G4Y R;  4HRE E;  1A2X A;  4OVN F;  5GQQ C;  3BOW A;  5J3X A;  3QRX A;  1K2H A;  1DMO A;  1X02 A;  4GFT A;  4TNC A;  1SBJ A;  1YUU A;  1QIW A;  2JNF A;  3BOW B;  3TDZ A;  1SMG A;  1DF0 A;  1DJH A;  5CPV A;  1KK7 Y;  5I2O A;  4F0Z B;  1B8R A;  1EL4 A;  2HET A;  3PAL A;  1YVH A;  2LUC A;  3DVJ A;  2KQ6 A;  1XFZ O;  4MRY A;  4MZL A;  1ZMZ A;  4MSP A;  2OS8 B;  1WLM A;  5CSJ A;  2PSR A;  3I5G B;  1WRZ A;  2CT9 A;  1IJ6 A;  1J1E A;  3MSE B;  2NLN A;  4FTG A;  3EKH A;  4CPV A;  3TS5 C;  5CSF A;  1CM1 A;  3CGA A;  3FWB A;  3TS5 B;  1F4O A;  1TNP A;  1CLM A;  1WRL A;  4A4B A;  1UP5 A;  1WDC B;  5CSN A;  4YGC B;  1CB1 A;  1B8C A;  4M2P A;  1EG4 A;  2EC6 C;  1NP8 A;  2BL0 B;  4C0K A;  1RK9 A;  4HSZ A;  1NUB A;  2JT8 A;  3LCP C;  3SG6 A;  1S5G Y;  4DIR A;  2ZFD A;  1TCF A;  1CDM A;  1SKT A;  2NZ0 A;  4NDC A;  1DVI A;  4PE7 A;  5DKN A;  1B4C A;  5KTY A;  2G2B A;  1SCM B;  1IH0 A;  2KBI A;  2A4J A;  1SY9 A;  1AJ5 A;  5FYX A;  1PVB A;  1KWO B;  1BR1 B;  1F70 A;  4WRI A;  1DJX A;  1NPQ A;  4MZK A;  4XYN A;  1BMO A;  2ZRT A;  2M7N A;  4MRX A;  2KFH A;  1KCY A;  1MF8 B;  2BKH B;  2F3Y A;  1QLS A;  3VGO A;  4PE0 A;  2R2I A;  3WHU B;  3PM8 A;  1Q80 A;  1WRK A;  1K9U A;  2EGD A;  2K7O A;  2JOJ A;  4U8D A;  3TDU A;  2FOT A;  2KI4 B;  4BY4 A;  1UHN A;  3TZ1 A;  1SCM C;  3TDI A;  1S5G Z;  4E68 A;  5JOL A;  1Y0V H;  2K61 A;  1UHH A;  1RJV A;  1K93 D;  4GAO A;  1JF0 A;  2O5G A;  1EG3 A;  1BF5 A;  2D8N A;  4I5L B;  2K7D A;  2EC6 B;  1M45 A;  2L98 A;  2M8U A;  4QJ3 B;  1EXR A;  2L2E A;  3JTD C;  1BG1 A;  1NX2 A;  1LA0 A;  4M2O A;  2LCP A;  3D10 A;  3PLF B;  1B47 A;  3BUO B;  1XFX O;  4ORB B;  3BUM B;  1K9P A;  2JU0 A;  2RGI A;  1KFX S;  1TOP A;  1RTP 1;  2WCF A;  4WQ2 A;  1SW8 A;  3RLZ A;  1IJ5 A;  5DKR A;  1C7V A;  4GGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...