4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Fibroblast growth factor 12
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
4PE0A 1AHRA 1QLKA 3SG3A 3GOFA 4MN0A 1UHKA 2M1UA 4PHJA 2F2PA 2GV5A 5JJGA 3ICBA 1K95A 2K8MB 1IRJA 1BF5A 3WHTB 3AAJA 2M9GA 2LUXA 2K7OA 1B47A 3PATA 5D7FA 3IQOA 3ZWHA 1J55A 1FW4A 2DOQA 3OX6A 1YVLA 1IG5A 1QV1A 2LE9B 4NDDA 1N0YA 4I5LB 3BUMB 2OPOA 5ER5A 4YGDB 1KFXS 1AP4A 4QJ3B 4PHKA 1RECA 1WRLA 3BQ3A 3GK1A 3CWGA 1SR6C 2O5GA 3KHEA 1F8HA 5CPVA 3I5GB 5CSFA 5HLVA 1Y0VH 2NCOA 1BU3A 1JBAA 1YRUB 3H4SE 2H61C 1HT9A 2L0PA 2EC6C 1DJZA 3I5FB 1TNWA 5CSJA 1QTXA 1V1GA 1KQVA 1IGVA 1OOJA 4ICBA 3O2PA 2EGDA 4OKHA 1K96A 3PM8A 1BODA 1EXRA 1DJHA 1YVHA 2JNFA 2COLB 2NZ0A 5JOLA 2FCEA 4N1GA 1YUSA 4A4CA 2Y1MA 2WNDA 4C0KA 1DJIA 1SR6B 1K2HA 1C7VA 1IJ5A 3DVKA 1SNLA 5DKNA 4HSZA 4R1EA 3SG2A 1NSHA 3BXKA 4JQ0D 2GGMA 4PHMA 1FBVA 3DVEA 1EL4A 1ZOTB 3SJSA 1NP8A 1TCOB 3CLNA 1CFFA 1JF2A 1SY9A 5HLOA 3TDUA 4PALA 1J7QA 1NPQA 1OZSA 1KFUS 2LNKA 4ORCB 1PSRA 1YX7A 5KTYA 2E6WA 2BECA 1UUSA 1LXFC 1JC2A 3LLEA 2KI4B 1AK8A 4WRIA 4HREE 1XFYO 4OR9B 2BKIB 3EK4A 4MSPA 2QPTA 3CS1A 5KSZA 1CLLA 2HETA 1K8UA 1QX7A 3GK2A 4PCWA 2JTTA 2K2AA 1BT6A 2BCAA 3DVJA 3TUYB 2KNEA 4L9MA 1IH0A 2EHBA 2M3WA 1WRZA 4N1FA 3ZNIA 1MR8A 1NX1A 1OZOA 1YURA 4HRHA 2L51A 1JSAA 2WORA 3DF0A 4GFTA 1RROA 2LMUA 1F71A 2JU0A 2MAZA 2LAPA 1RTP1 1JFKA 1TOPA 2LVKA 2LM5A 1A2XA 1K9UA 4AQJA 1XK4A 3M0WA 2JT3A 1G33A 1YRTB 3F45A 1C07A 1JF0A 1JUOA 1OE9B 3EKHA 3O6BA 1BJFA 2ZNEA 2F3ZA 1Y6WA 5TNCA 1KFXL 1L7ZA 1S3PA 2KBIA 2LV7A 1GJYA 2JTZA 1CMGA 1QX5B 1S5GY 5CSIA 3LK0A 2JT8A 2M7LA 1R2UA 1RJVA 1XA5A 1M46A 5DKQA 4M2OA 4MZKA 1UHIA 2BL0B 3I5GC 3WHUB 1KQMC 3OHMB 2AMIA 3LCPC 2KAYA 4GGFA 1CDLA 1DJGA 1M45A 1KK8C 2CXJA 2PSRA 1UWOA 5HKYA 1FPWA 1CM1A 2LANA 1WRKA 1NIWA 1OMDA 1YR5A 2CT9A 4UPGA 4Q04A 2JULA 3D0YA 2L5XB 1NCXA 2BKHB 1BMOA 3NSKA 5AERA 4N5XA 1K90D 3D10A 3LL8B 1QLSA 4FQOA 3WNXB 2H2KA 1SL7A 2MJWB 1J1DA 4PE4A 1CMFA 1YUUA 4PDZA 2P6BB 1W7JB 5ER4X 4BY5A 2KI6D 3AKBA 4DCKA 1TTXA 1CDNA 1M31A 4PE7A 2WCFA 2TN4A 4MVFA 4MRXA 4YI9A 1X02A 4ETOA 2Y5IA 1XYDA 3MSEB 2LVIA 1B8LA 1W7IB 3EKJA 3NSOA 1TNQA 2FCDA 3FWBA 3TUYC 3CTNA 2G2BA 2WCBA 1CTRA 1QVIY 2BBNA 2M7NA 5BPJA 2CTNA 3PLFB 1S26D 2MLEC 1DJXA 3TZ1A 5I2QA 1B9AA 3SIBA 2F2OA 3D0YB 3K21A 1IQ5A 1QASA 1WLZA 2CNPA 4D1EA 5CSNA 1L2OC 1YTZC 2K7DA 2GGZA 1K9KA 3DF0B 1UHNA 4MZJA 1BLQA 4DS7A 1CFPA 2BL0C 1LA3A 2KOTA 2CCMA 1B4CA 1H4BA 4GBAA 2M0RA 1CKKA 3PSRA 2KGRA 1A4PA 1N2DA 3CR2A 1CLBA 3KPXA 2E30A 2OTGC 1DF0B 1PVAA 3TS5B 4DUQA 1MWNA 1NX3A 2JNXA 5K89A 1IJ6A 1XFWO 2SCPA 1BOCA 3DD4A 4YGBB 1H8BA 1E8AA 4I5JA 2KGBC 2PALA 5I8NA 3AKAA 1QIVA 2JPTA 4A4BA 4JWQA 4PHNA 1F4QA 4CFQA 4P5OE 2Y9YA 4C0JA 1F55A 1M63B 1KK7Z 1WY9A 2FOTA 1U5IA 1OSAA 1K93D 1QXPA 1TIZA 1ZACA 2BE6A 5HKZA 2M1KB 1V1FA 1TNXA 2VRGA 1SBJA 4USLA 5FYXA 1S6JA 4MEWA 4DRWA 1A75B 2QACA 1KSMA 4GPLB 2IS9A 2PRUA 3BUOB 2K2FA 3VROA 5B8IB 2M49B 4NQGA 5HKWA 1IKUA 1ALWA 2NXQA 3DVMA 1DTLA 2MHHA 3O4YA 2JT0A 1AJ4A 1PALA 3HX4A 2F33A 1PULA 3QRXA 5AEQA 1LA0A 1CB1A 2OS8C 2LUCA 2ZKMX 1NYAA 2JXCA 2HQ8A 2KHNA 2KI4C 4YI8A 1QS7A 1CDMA 3VRNA 2Q4UA 1TRFA 2HPSA 3AAKA 1EJ3A 2K7CA 2ZNDA 3VRPA 4M2QA 4TNCA 4YBHB 3SG6A 2FJUB 1K9PA 2K0JA 2KAXA 3RLZA 2K61A 1F70A 1XFVO 4OV2A 1J7OA 2JQ6A 2CBLA 2L50A 3CZTX 3EVVA 2ZN9A 1QATA 2KFGA 1NX2A 3JTDB 1DJWA 1GGZA 2KAVA 4ORAB 2SASA 1DGVA 2AAOA 2EC6B 5D69A 1S5GZ 5F6TA 3OB2B 1G4YR 2LP2A 3VGOA 1SCMB 1UHJA 3A4UB 1QVIZ 3O78A 2JZIA 4WQ3A 1SYMA 3NSIA 2K7BA 4ZCVA 1NX0A 1SK6D 1LKJA 3E3RA 1A75A 1BR4B 3BUWB 2OTGB 3TS5C 1GGWA 1UHHA 1CLMA 2HF5A 4GUKA 1CNPA 1OMRA 3HCMA 2Y9ZA 1WDCB 1F4OA 2LMTA 3GK4X 1SCVA 5PALA 4BY4A 4MBEA 2PMYA 3EK8A 2ISDA 1C7WA 1KWOB 4PE1A 4JPZB 3IF7A 1IQ3A 2G9BA 1JFJA 1YX8A 3FWCA 4M2PA 1N65A 2OS8B 1SMGA 1SKTA 4IL1A 4MRYA 1NCZA 2LHLA 4QJ5B 1F54A 2Y1NA 3A8RA 2KFFA 3C1VA 1AJ5A 3NXAA 1RFJA 1XO5A 1BR1B 1ZFSA 2AUCA 2ZRSA 3EK7A 2KBMA 2M8UA 3SG7A 1EG3A 1G8IA 1QX2A 2F3YA 2L2EA 1MXLC 1VRKA 4HRGA 4YGCB 5DKRA 2R2IA 3JVTB 1GQMA 3SG4A 1PRWA 1BG1A 2BCBA 3I5IB 2HQWA 2WCEA 5GQQC 2KQ6A 2KSPA 1OMVA 4WQ2A 3PN7C 1NCYA 1J7PA 4NDBA 3TDIA 5HYDA 4DIRA 1PSBA 5KU1A 1UURA 2I18A 1MHOA 4YGAA 2JOJA 3OP0A 1Y1UA 1B7TY 1B8CA 2KDHA 2NLNA 3I5HC 4GGFC 1TCFA 1FI5A 1U5IB 2ZN8A 3FS7A 4XJKA 1EH2A 3EVUA 2ZRTA 1SRAA 2NCPA 1ODBA 1MQ1A 1SL9A 1WLMA 3NSLA 3OX5A 5I2OA 2WOSA 3KF9A 2LVVA 1FF1A 1AUIB 4XJKB 1S1EA 2V53A 4MLWA 1B1GA 4QJ4B 2LCPA 1PK0D 1Y1XA 1KSOA 1DT7B 3I5HB 4GNKB 1TN4A 3BYAA 1XFUO 1CM4A 3SG5A 1JWDA 1SPYA 2I7AA 3OB1B 2MBXA 4YRUA 1LINA 4C0LA 2JC2A 2LVJA 1NWDA 2BCXA 3LK1A 4P2YB 1S6CA 1MF8B 2LLUA 1DF0A 1A03A 2BBMA 1A29A 3SIAA 2JXLA 4MZLA 4CPVA 4NDCA 4CLNA 1EG4A 5IBWA 3RM1A 1QV0A 5AFPA 2LLSA 1ALVA 4AQIA 2JRFA 2KYCA 1CFCA 1NUBA 2LMVA 3CGAA 1CDPA 1J7RA 3BOWB 2M97A 1LVCD 1ZUZA 5AANA 1UP5A 1D1OA 2I94A 1Y1AA 4F0ZB 2I2RE 1QJTA 1MXEA 1DJYA 3EVRA 1DVIA 2B1UA 3CR4X 2MA2A 4I5NB 3KO0A 1KK8B 5I2LA 1KWOC 1ZMZA 1M39A 1QIWA 2M29A 4OVNF 1OFCX 3VRRA 1RK9A 2F8PA 1WDCC 5J3XA 3BUXB 3CR5X 4AOMA 2ZFDA 2KI6C 4ORBB 1DMOA 4GGNA 2L4IA 1R6PA 1XVJA 2KYFA 2LC5A 4I5KA 1K94A 4OCIA 2LHIA 4E68A 3TDZA 1L2OB 1S36A 1SW8A 5G08A 1KQMB 2BE4A 4CFRA 1XK4C 1KCYA 5AXIA 4U8DA 2MRDA 1B7TZ 1HQVA 2JWWA 2O60A 1SCMC 2LP3A 3PFVA 1CFDA 1KFUL 3FIAA 1XFXO 3VRQA 3PN7B 1Q80A 1IWQA 2KQYA 2A4JA 4CIDA 2LLTA 3I5FC 3PALA 3JTDC 1KK7Y 3I5IC 1DGUA 2Y4QA 1AVSA 1FI6A 1TNPA 3BUNB 1PVBA 2L4HA 1YUTA 1OQPA 1XFZO 3BOWA 3JVTC 1J1EA 4GAOA 2WC8A 2MLFC 1RWYA 4YGEB 3IQQA 3WXAA 2H61A 4FTGA 4XYNA 1S6IA 1B8RA 3KEVA 1MUXA 2PVBA 2L98A 2RGIA 2KFHA 2PASA 2Q91A 2D8NA 4ZCUA 1SL8A
chains in the Genus database with same CATH superfamily
1QLKA 3GOFA 4MN0A 1UHKA 3AE3C 1KV4A 1IRJA 2KNCA 3AAJA 1AA0A 2LUXA 3CCSP 3CX5I 1QV1A 4NDDA 1N0YA 1AP4A 1KFXS 1QL2A 4PHKA 1RECA 3GK1A 2OTLP 3H32B 1OW4A 1NYHA 5EFWB 3BRVB 2M5AA 1BCCG 3A0BE 2H61C 1AVYA 2D2CC 2J58A 2YKPA 1FC2C 3PM8A 2JWAA 5JOLA 4N1GA 2Y1MA 3H1IJ 1K2HA 2OARA 4L75A 1M1JC 1K73Q 4HSZA 3H32A 2KLUA 1Q2NA 1NSHA 4JQ0D 2P67A 4PHMA 3DVEA 3QWOC 3A3YB 1Q81Q 1OOHA 1CFFA 2BASA 1JF2A 1RH5B 1NPQA 1OZSA 3CCLP 2LNKA 1EXIA 4PV1D 5AVWB 3ZDMA 5KTYA 2E6WA 2BECA 4IL6X 1NTKE 3LLEA 2KI4B 3L74D 4M3LA 2N9BA 2HYNA 2Q3IA 3H1LD 2O01J 1U7MA 4GOEA 1CLLA 1FE6A 1K8UA 4PCWA 1G1IA 2ERBA 3DVJA 3L72G 2EHBA 2M3WA 1ZR2A 3M0AA 1MFTA 3SWKA 1NX1A 1KILB 4C46A 2JEEA 1JSAA 2HG5D 2MAZA 4A7PA 3AEEC 1RTP1 4FQTA 1XK4A 1PGPA 3B88A 3CMEP 2WCKA 1C07A 4R4MA 2MKVA 3H1JE 3O6BA 3EKHA 1OE9B 2WTYA 3B87A 3L4FA 1NWQA 1Y6WA 5TNCA 2LV7A 1OOFA 3L73E 1GJYA 2JTZA 1QX5B 1S5GY 3NHIA 5CSIA 2H8PD 2M7LA 3TK1A 3CCJP 3WHUB 3I5GC 4Y28J 4WWIA 1SFCC 3H1HE 2AMIA 2KAYA 4GGFA 1CDLA 3BCCD 1KK8C 1CI6B 2ZVOB 2R44A 1FBMA 2WSFJ 1AV1A 4Q04A 1SQBG 5D3OA 3NSKA 2E43A 3CC4P 5AW4B 3PM2A 1QLSA 2H2KA 4PE4A 1J1EB 1FAVA 2P6BB 3HD7D 5DICA 3S1KA 5ER4X 1NTZK 5CCGC 1CSBA 1R5LA 5KLIC 4PJ0H 1TTXA 1CDNA 2OYHB 3NMDA 2IZ0A 1PFIA 1IZNB 4ETOA 4JKTA 1JY3P 3EKJA 3L73D 4WY4B 2FCDA 3CTNA 1NTZD 3V2RA 1CTRA 1HJBA 1SQBK 1S26D 2KSJA 3SIBA 4JYBA 4JF7A 2F2OA 2GUVA 1WLZA 4D1EA 3L75D 1L2OC 1JY3O 3P32A 1ZV8A 3D70A 2OYIC 1UHNA 1RE3C 3LW5J 4DS7A 4GODA 1LA3A 3HE4B 3NXSA 2K60A 2FYNC 4OGQB 1BE3J 1VQ4P 2Z5IA 1CKKA 1M1JB 4D6TE 2E30A 4DUQA 5AVUB 3HE4A 1MWNA 5K89A 3DD4A 1DX7A 1PZQA 1E8AA 1SS1A 1M1JA 2KGBC 1QIVA 2JPTA 4A4BA 1GL2A 4JWQA 5AVTB 1VF5D 4C0JA 4PT1A 5GTHH 1M63B 1KK7Z 1U5IA 4L74A 3AE6C 1TIZA 5HKZA 1YI2P 1SQPE 2Q5UA 1S4XA 3H25A 1GZLA 5KLVE 5KLIB 1L4AC 4DRWA 5CJ4A 1KSMA 3BUOB 3L36A 4NQGA 3DVMA 5E79E 1M8OB 1DELA 3CWBD 1AJYA 2FFDA 2KS1A 4XE5B 1FDOA 2F33A 4HKZH 1PULA 3QRXA 5AEQA 1LA0A 3M91A 4OGQD 3JCUH 1PGJA 4YI8A 2Q1KA 1NTKD 2HPSA 2QE7H 3VRPA 4M2QA 4XFJA 3DY9A 1K9PA 4EYYQ 2E5YA 2IBZI 3AEDC 1GW4A 3CZTX 3EVVA 1VQ5P 2E75C 1DGVA 2AAOA 3AEAC 3MHVA 5D69A 1S5GZ 4JYCA 1G4YR 1JMMA 1KILA 1VQOP 1UHJA 3A4UB 1EC5A 3O78A 2Q7CA 4ZCVA 1NX0A 3BFBA 1SK6D 3E3RA 2GUSA 3BUWB 2K9YA 4XA4A 3H1ID 4GUKA 3VTPC 2LR2A 2GM4A 3CABA 1D7MA 2P7JA 2Y9ZA 1LT9C 4H13B 1SQXD 1Z2CB 3GHGA 1T8ZA 2WSEJ 5PALA 1LTSC 1NKNA 2ISDA 2H89C 3CLQA 1C7WA 3A2AA 1JFJA 2G9BA 1YX8A 2KB7P 3UIAA 4ZMDA 1SKTA 4IL1A 1NCZA 5AVQB 3A8RA 3CZ1A 3L75E 4GDOA 3C1VA 3NXAA 3G3ZA 1PGQA 4QMAA 1QX2A 1X79B 1A03A 4PD4I 2B88A 1BG1A 2BCBA 2LXCB 2W6BA 2WCEA 5GQQC 1DIPA 3RK2C 2BNXA 1LT9A 3V2LA 5HYDA 4DIRA 2M5AB 4YGAA 1KYOE 3K5BA 3VMZA 2WPQA 1KC8Q 2NLNA 3WU2E 2JPOA 3PJIA 1UIIA 4WY4A 3WUVA 2P70A 4XJKA 3AE2C 1L0NK 3A7OA 5B5EE 1R8EA 3EVUA 1SRAA 3M06A 1SL9A 5I2OA 2A45G 2LVVA 1FF1A 1PP9G 4XJKB 3KXDA 2LCPA 1QGKB 1BSHA 2PP6A 2L91A 3KPEA 2Y0EA 1Q86Q 4PV1B 4TLFA 3M9QA 4GNKB 1TN4A 1XFUO 1JWDA 1T3JA 2R3SA 2I7AA 1W2EA 4C0LA 4P2YB 1L4AA 3L4AA 1S6CA 1MF8B 2LLUA 3M9HA 4NPFX 1A29A 1EG4A 1QV0A 3CXHE 1ALVA 2ITAA 4DOJA 2KLVA 3Q1MA 4KJMA 3BOWB 2AXTH 1OOGA 3OBVA 1USDA 2KUBA 4F0ZB 1Y1AA 2P10A 4ZCUA 2FXPA 2B89A 1ZN5A 1OMIA 5KTBA 1SQVE 1VQ6P 1J1EC 2B87B 2XZRA 4JBZA 3A0HH 1KWOC 1KB9D 1FZGA 1QIWA 3BASA 3PRJA 1LS8A 1T2KC 2Y0CA 3VRRA 1YTZT 1DC1A 2FYNB 3U1CA 4AOMA 3QH9A 2ZXEB 3H1JG 1KQLA 3TDZA 4ASWA 3TNUB 3CZ0A 1GL2D 2OQQA 1SFCB 1KQMB 2QIWA 4CFRA 1XK4C 4U8DA 1HQVA 2JWWA 3DXLA 2O60A 1BCCJ 2BCCD 1LTAC 4KHXA 3VRQA 2KQYA 1ZMEC 1IK9A 1KK7Y 1JUNA 1IJDB 1QX8A 1DGUA 2N1TB 1OVVA 1FI6A 2WCJA 4IFMA 2H7HA 1S72P 3H1JJ 1VQ9P 1B8RA 1W2BO 3QMEA 3KEVA 2Q91A 4PE0A 1AHRA 1PP9D 2O01H 1EZVG 2F2PA 2GV5A 1TUJA 1T14A 3H1HJ 3ICBA 2K8MB 3VN0A 2FYUJ 3WHTB 4YTPC 5CCGA 2C9LY 1B47A 5D7FA 2FFDC 1J55A 1R5SA 3C1LA 1X22A 2NRGA 1IG5A 1LJ2A 3BUMB 2OPOA 1M57D 2QEHA 1VDFA 1WRLA 1CZQA 2QA4P 2WCHA 1SR6C 2O5GA 1F8HA 2W83C 5HLVA 1Y0VH 1N7SD 2NCOA 5FI6A 1AQ5A 1YRUB 1FDIA 1GK4A 3I5FB 1LNQA 3D76A 1V1GA 1KQVA 3TGUE 1LGHB 4OKHA 1N73A 3CD6P 1EXRA 1YVHA 1L0NE 1YUSA 4A4CA 2POHA 2XDJA 3GMAA 4F7FA 1DJIA 2E76C 2WQYC 2E75B 3DVKA 3D73A 2RMZA 1KILC 4R1EA 3SG2A 2A06E 1BE3D 3BXKA 2N1TD 3CXHD 1QL1A 1EL4A 4B86A 3NTNA 2WSEH 5AVXB 1PSRA 5AVZB 4GOFA 5KJ7A 3FWNA 4L73A 5KKZC 4HREE 1XFYO 5BU8B 5I94A 2XNDH 1SP4A 4MSPA 3CS1A 5KSZA 2ZYGA 4I1LA 1QX7A 3S9OA 2M8RA 2K2AA 1NTZJ 1FOSE 4L9MA 1IH0A 3KZIH 4DZOA 3TDKA 4DT0A 3R72A 1CW5A 1OZHA 3ZNIA 3H1IG 1GU4A 1YURA 4MN4C 4GFTA 3VMAA 1PPJD 1F71A 2LAPA 1KFNA 1FOSF 2BEQD 1Z56A 1A2XA 3M0WA 2FKWB 3CC2P 3F45A 1OIPA 2V7QJ 1JF0A 3B7AA 1NKZB 1YJ9P 1S5LH 1TU3F 2XU6A 1IFNA 2FXMA 1R2UA 4WVZA 1PV3A 3B8EB 4M2OA 1UHIA 2Q6QA 1AQTA 3BCCJ 2KSEA 3FWLA 4IOIH 4RESB 1EZVD 3CC7P 1UWOA 4HJGH 2WPRA 1WRKA 1NIWA 1OMDA 2CT9A 2I1JA 2WT7B 2L5XB 1NCXA 3A5TA 1BMOA 1RE3A 3LL8B 1OWAA 3WNXB 2YIUB 2W90A 1CMFA 4PDZA 1W7JB 5CHXA 1NU1K 2QG4A 4BY5A 2KI6D 4DCKA 3L71G 1NH4A 2WCFA 2IBZD 4MRXA 1LWUC 1X02A 2YGUA 3MSEB 1LP1A 1B8LA 3RBZA 3D75A 3LIDA 1VQPP 3BFHA 3BVHA 3TUYC 2G2BA 2WCBA 4D6TG 2BBNA 2M7NA 3PLFB 2MLEC 5I2QA 4W80A 5AW0B 2P1JA 5APYA 2ZYDA 5AVRB 3MZWB 2W6AA 3T97B 2NPSC 1YTZC 2GGZA 3VMYA 3DF0B 3L71E 1CFPA 1EXJA 1NTMD 2K1AA 2CCMA 3UO9A 1USEA 3ITKA 5TISE 1N2DA 3BJHA 3TS5B 1PVAA 3H1LE 2W6JH 1XFWO 2SCPA 1H8BA 1L0LD 1QLED 3IAOA 2PALA 1M1KQ 3I55P 1F4QA 2JR8A 4ZKPA 3A0HE 1JO5A 1S2EA 3L74J 2XKMA 2NPSD 3F5HA 2M1KB 1SBJA 4USLA 5APWA 1SQBD 3TYYA 1WMKA 5AVVB 1MUUA 4UB8E 3WU2H 4GPLB 2GA1A 1OVRA 3VROA 5B8IB 3CCMP 3FXDA 5HKWA 3VB1A 2FYUD 2JT0A 3GW6A 1PALA 1RE4A 1NYAA 1RHZB 2KHNA 3GF3A 4W7ZA 3OW2O 1KILD 3BCCG 1SFCD 1L4AB 3SG6A 2FYUK 3RLZA 1S5LE 3O4XA 2K61A 2H88C 2QRXA 1J7OA 3IN6A 2JQ6A 3S0FA 1GL2B 2A06D 1IK7A 5KLVG 3CDNA 1QATA 2O3JA 2WSSH 2KAVA 4ORAB 3HUSA 1PL5A 2EC6B 2M0BA 1KZUB 2O1KA 3VGOA 3L70G 1SCMB 2K88A 2JZIA 3NFQA 1BGYG 1VQMP 2D2CB 1A75A 2WC6A 1CLMA 2HF5A 1NTZG 4UB8H 5APUA 3FXEA 2QJPC 1VQNP 3BATA 1WDCB 1F4OA 2WSCJ 1J1DC 4ZNCA 2IYPA 4BY4A 3EK8A 4PE1A 4JPZB 1N7SB 2KNCB 2M3EA 4M2PA 4BRYB 3HTKA 1N65A 2OS8B 1ORGA 3S0GA 4MRYA 2RH0A 2LHLA 4QJ5B 2QJYC 2Y1NA 2KFFA 1BR1B 1ZFSA 1L2PA 4UB6H 2KBMA 3SG7A 3R1OA 1RQUA 2F3YA 4HRGA 1VRKA 3M9BA 4U3FE 2VRSA 1ZP0C 4WQ2A 1JY2N 3PN7C 1BSNA 1W9ZA 1J7PA 2YO2A 4HB1A 3W67A 3GHGC 3V2QA 1VQKP 1UURA 2Y0DA 3AE8C 3VP8A 1M56D 2JOJA 2W8ZA 3OP0A 1GMJA 3CI9A 1PGOA 2KDHA 2Z5HA 2FY8A 2E5TA 1TCFA 2AEJA 1GDTA 3FS7A 2ZRTA 2HPCB 2WCLA 1E5WA 1WLMA 3OX5A 2J59M 2WOSA 4K3AA 1DEKA 2L2CA 3S0BA 1B1GA 1PK0D 1NO4A 4AYCA 4YXDC 1Y1XA 3AE5C 3KHUA 1KSOA 2ZT9D 4H0LC 3H1HD 1SPYA 2A06G 4YRUA 1SQVD 2CPSA 3LK1A 1RF1C 1DF0A 3BRTB 3UNWA 3LIEA 4MZLA 3RBXA 4CPVA 5FI2A 5IBWA 1OW6A 3RM1A 3RL0B 5AFPA 4AQIA 1KILE 3VOPA 3USSA 1KQFB 1PPJE 1CDPA 1J7RA 5KAIH 1DH3A 1LVCD 3PH0A 2AXCA 3II6A 3L72E 2QDIA 1H88A 2B9BA 3HRNA 1QJTA 4I7ZC 1DJYA 3EVRA 4I5NB 1HF9A 1KK8B 2M29A 1SQXG 1NGMB 1RK9A 3BUXB 1ZRTD 2NPSA 1H0TA 2KI6C 4ORBB 1GM0A 1R6PA 2LC5A 3SFEC 1K94A 3PP5A 2NPSB 3E7KA 3L73G 1URQD 2NZ2A 2BE4A 3KZIE 3H1KD 1B7TZ 5APSA 1C3YA 3PN7B 1URQB 3I5IC 3AEGC 1NU1J 3M0DC 2WSFH 1AVSA 1TNPA 3L74G 3GHGB 2L4HA 1H89A 1L0NJ 4GAOA 2WC8A 2MLFC 1NTMG 1OW7A 5TJHA 3TGUD 3IQQA 4PD4H 2H61A 4XYNA 1MFZA 3SFDC 1MUXA 4C7RA 2L98A 2RGIA 2LXBA 2KFHA 3CXHI 1HBWA 4O9BA 1SQVJ 3SG3A 3E1IA 2M1UA 2FBWC 1YBKA 1C3ZA 2M9GA 2K7OA 2JP3A 5KKZB 2WWWA 3H1KE 1P28A 1X8YA 5ER5A 4YGDB 4QJ3B 5E79H 3CCQP 3BQ3A 4U7JA 1YJNP 3GF7A 3RGUA 4N6JA 1BDDA 5CPVA 3MTUE 5EL2A 2BAPA 1IIOA 5CSFA 4PD4D 5AW7B 1L0LG 3HD7A 3HUSC 1BU3A 3RK3B 1JBAA 3O6QB 3H4SE 1HT9A 3FE8A 2L0PA 2EC6C 3OJAB 1SVFA 1QTXA 1IGVA 3CWBG 2EGDA 1NU1G 1K9MQ 2P58A 5KAFH 2COLB 2NZ0A 2FCEA 1GTWA 1ZLLA 3L72D 2KXPB 2OYIA 2QM7A 1IJ5A 1SNLA 5DKNA 1VL2A 2GGMA 3N4XA 3EWKA 3T97A 1ZOTB 2WCMA 2BCCG 1DQEA 3V2PA 3SJSA 1IFIA 1NP8A 1TCOB 3CLNA 2B87A 1IO4A 1SY9A 4PALA 1J7QA 1KFUS 4I6MC 1YX7A 3HD7B 1UUSA 2A45H 1AK8A 4TT3H 4WRIA 2FFDB 1KORA 2BKIB 3EK4A 3HTKB 5TISH 2HETA 1NAFA 2IDBA 2JO1A 3DZTA 2KNEA 1SQPD 1NTKK 1WRZA 5AW2B 3U1AA 1OZOA 4HRHA 1PIXA 2L51A 2I8DA 4IFFA 2WC5A 5CCHA 3DF0A 1SQBE 1RROA 3NGVA 2LMUA 1URQC 4IFDK 2L5YA 1TOPA 1JFKA 2LVKA 2LM5A 1K9UA 4AQJA 2JT3A 5AVSB 1G2CB 1BGYD 1K04A 4PJ0E 3U59A 1BJFA 2KPHA 2Z4EA 4BXLA 3AEFC 1S3PA 2KBIA 1P84H 1KMIZ 1LTBC 3TGUG 3LK0A 2JT8A 3L47A 2V7QH 5DKQA 3N7NA 5DJUB 4MZKA 1KQMC 2IBZG 4RKUJ 3OHMB 3P7KA 1SSEB 1H0TB 2OYOA 2HPCA 1YIJP 4U3FD 4IL6E 5HKYA 1CM1A 3C8VA 1L0LJ 1JY2P 2PFXA 4UPGA 2ZJSE 3EFGA 2QM8A 2JULA 5APTA 1FS0E 3WUTA 2IYOA 2BKHB 3MIWA 4N78D 1RY3A 4N5XA 1K90D 3CWBJ 3JC22 5APQA 4FQOA 1NTZE 3CZ2A 1W5CE 3FX0A 2IBZE 2JKVA 1EDKA 1RF1A 1JMBA 4YI9A 1Y47A 2Y5IA 1XYDA 1SQQK 2N1TC 3NSOA 2FJYA 3D74A 5GTHE 4AUWA 1QVIY 2CTNA 3H1LJ 1LTJB 1DJXA 3V6IA 1B9AA 2OTKE 4WY4D 2QVAA 3K21A 1QASA 1BE3G 1N7SC 2CNPA 5CSNA 2C0WA 3MGNA 2FYUG 2K7DA 1K9KA 1LTTC 1BLQA 2BL0C 2KOTA 3FE6A 1H4BA 3B5NA 4GBAA 1NTMJ 2M0RA 3PSRA 2KGRA 2I1KA 1A4PA 3CR2A 1CLBA 3IF4A 3H1HG 2OTGC 1NX3A 1VF5B 1IJ6A 3OA7A 4YGBB 4I5JA 2C9NY 4U3FJ 4C7NA 4Z1MH 5I8NA 3AKAA 4LLHA 4PHNA 2FYUE 4CFQA 2Y9YA 1WY9A 4WY4C 1IFDA 1OSAA 1K93D 1ZACA 4I2LC 2BE6A 1KB9I 4H0LD 3WMM0 3RK2B 4DJGA 2QEBA 5FYXA 1S6JA 1KB9E 2PRRA 2YMYA 1A75B 2QACA 3K1EA 1NOHA 2IS9A 3CPWO 1JTHB 1IKUA 1ALWA 2NXQA 1DTLA 3L75G 3O4YA 4N3YB 1AJ4A 1Y8AA 3E1RA 1SLQA 2LUCA 2ZKMX 3VRNA 2Q4UA 1BGYE 3AAKA 2ZNDA 4YBHB 4TNCA 4D6TD 2FJUB 1MKMA 2JJLA 2K0JA 2PGDA 1F70A 1XFVO 1S9KD 1SQPG 1UIXA 3IVTA 2YNYA 2L50A 1VQLP 3L71D 2KFGA 2QJKC 1NX2A 3JTDB 1DJWA 2H43A 1GGZA 2E76B 2UWJE 3HE5B 1BDCA 3OB2B 3H1LG 2LP2A 2AEMA 1SYMA 3TSIA 3NSIA 1QVGO 2K7BA 1EDJA 1LP1B 1BR4B 3TS5C 2WPSA 2OYHA 3L72J 3B6XA 1L0LK 2WITA 2R32A 3GLMA 2ZVNB 4KYNA 3GK4X 1SCVA 3TNUA 3Q5SA 1VPCA 5KJ7C 3PHLA 2E75D 1Z4HA 3IR9A 1LTIC 1SMGA 1XFRA 4N78E 1N8RQ 1PP9E 3BFAA 2M8UA 4IJ7A 1YYCA 1EG3A 4H13C 1G8IA 4YGCB 2L2EA 5DKRA 1SQQG 1GQMA 1PRWA 4Y99B 3BCCE 1LTGC 2HQWA 1JB0J 4HH2A 2KQ6A 2KSPA 3RK3D 1OMVA 2K37A 2WZ7A 1NCYA 1RF0C 1E79H 4NDBA 3TDIA 3B5ND 2E74D 3Q2YA 3AE9C 1PSBA 3DYEA 2I18A 1MHOA 2XNXA 3L37A 1N73B 3I5HC 2E76D 2FXOA 2ZYAA 1JNMA 2QJKB 1FI5A 1AVOA 2SPZA 1U5IB 1EH2A 1YHQP 3L70J 1SQQE 1ODBA 1MQ1A 2A45I 1ZR4A 1LTJA 4H13D 1AUIB 2LKMA 3JCUE 2K9JB 3L70D 1ZW0A 2KYVA 3PTZA 3AE1C 3H1KJ 5K5GB 1GK6A 2R5DA 3BYAA 1JY2O 3OB1B 2KP8A 3SSUA 5KLVD 2D2CD 2C0XA 2YO3A 2JC2A 2LVJA 2BCXA 2IZ1A 2ZFCA 2BBMA 4H44D 1GW3A 3M0DA 1FJKA 4CLNA 4EIJA 3H1JD 1HTLC 1HWTC 4IL6H 4EDFA 5B5EH 2LLSA 3EFFK 1CFCA 4U3FG 5BU5A 1ZUZA 3D78A 1D1OA 2I94A 1IFJA 1X9VA 3HE5A 2BCCJ 2AEFA 3CR4X 3KQGA 1T6AA 1OFCX 3CYZA 4JD9A 2KZJA 1WDCC 5J3XA 2HR3A 3L74E 1KQSO 4H44C 1N7SA 1DMOA 1G1JA 1HGVA 3CXHH 2KYFA 4I5KA 2LHIA 4E68A 1L2OB 1SW8A 2WT7A 5GTIE 4GKGA 5G08A 3JSVC 1KCYA 3F89A 3RK2D 2MRDA 1JCCA 3A0BH 5CBOA 4I7ZB 1SCMC 3PFVA 5CJ0A 1CFDA 1KFUL 3FIAA 1XFXO 3V2NA 3S0AA 3OGNA 1P84D 1N73C 4ZKUA 5B66E 1IWQA 2A4JA 4INXA 5HL1A 4C7NB 2LLTA 3I5FC 3W68A 3PALA 3D77A 3CCEP 2Y4QA 4GT1A 5BVZA 1PVBA 1VQ8P 1XFZO 2Q9IA 3RL0C 1FJPA 1WRGA 1J1EA 3CL3D 5C39A 1HH0A 1S6IA 4D6TJ 3MUDA 2PVBA 1RF1B 2HFED 2YXQB 1RF0A 1SL8A 3G9RA 3N7HA 4PHJA 2WPVB 3VP9A 1CI6A 2E74B 1FZBA 5JJGA 1IFMA 1K95A 1PPJG 1U57A 3WUUA 1BF5A 2RKLA 4K35A 1NU1E 3PATA 4AQRD 4CPGA 3IQOA 1G2CA 3ZWHA 1FW4A 2DOQA 3OX6A 1YVLA 1P84I 2LE9B 4I5LB 3AE4C 2QEOA 2G3AA 3CWGA 3P8CD 1N86A 3KHEA 3I5GB 1SQXE 1NTMK 3O8ZA 3KYQA 2IX7C 3SS4A 4W7YA 1IC2A 3S0EA 1DJZA 3B71A 1TNWA 5CSJA 3LW5H 1OOJA 4ICBA 3O2PA 1FZCA 5DJTB 1FU1A 1K96A 1BODA 1DJHA 2JNFA 1KQGB 1XTCC 1RQVA 1DD4A 3Q3DA 3O6QA 2WNDA 4C0KA 1JY3N 1SR6B 1FZFA 1C7VA 2PYQA 1Q82Q 3KDPB 3B86A 3AE7C 1LT1A 1YQ3C 3RK3C 3D6ZA 3H1KG 4H44B 1FBVA 1N2DC 3TDUA 5HLOA 1NJIQ 1SQBJ 4ORCB 1FZAA 2R3CA 2ZT9B 1LXFC 1JC2A 4GIFA 5FI7A 4OR9B 2L5GB 3MD0A 5AW1B 1T2KD 2QPTA 3GK2A 1TWOA 3CWBE 2JTTA 4OWFA 1BT6A 2BCAA 3TUYB 3P8MC 1NAYA 1EZVI 4N1FA 5AVYB 3S0DA 1MR8A 1LWUB 2WORA 3L4LA 2JU0A 2YXRB 2W27A 1FZEA 2ZXXA 1G33A 1YRTB 1NTKG 3CCVP 1L0LE 5CBNA 3C9IA 1JUOA 1RE4C 1VF5C 2ZNEA 2F3ZA 1KFXL 1L7ZA 1CMGA 1JTHA 3V4WA 2N1TA 2N9YB 1LWUA 1RJVA 2DW3A 1XA5A 1M46A 2BL0B 3AEBC 1YITP 3LCPC 3RK3E 1KB9H 4NPDA 3R2PA 4KT0J 1DJGA 1M45A 2CXJA 2PSRA 2YKQA 1FPWA 2M3BA 2LANA 1KYOI 1NTKJ 1YR5A 1QVFO 3G71P 1LTJC 3R1VA 2OYIB 3D0YA 1URQA 1JM0A 5AERA 3D10A 1JCDA 1DD3A 2V4HA 1SL7A 2MJWB 1J1DA 2O1JA 3MP7B 1YUUA 2QSIA 3NHTA 1OVUA 1M7LA 4PD4E 1EZVE 1YJWP 3AKBA 1MV8A 2OYHC 1M31A 4PE7A 2TN4A 4MVFA 3CCRP 1JOCA 5CCHC 1WT6A 2LVIA 1W7IB 1SQPJ 1TNQA 3FWBA 4INWA 3H1IE 1J2JB 3I5CA 5BPJA 2WVRA 3L73J 2CK3H 3TZ1A 4PV1C 2P2UA 1T3UA 1FZCC 3B5NB 1SQPK 3CMAP 3D0YB 1IQ5A 1YQ4C 3R4YA 2PQLA 1YTZI 1DEEG 3CX5D 4MZJA 1BGYJ 1L4AD 2YMKA 1B4CA 3ABVC 1HJ0A 4WB4A 3KPXA 1DF0B 3L75J 2JNXA 2KZIA 1BOCA 4UB6E 3L35A 3SWYA 4P5OE 1F55A 2FOTA 4HYTB 2HLOA 4Y99C 3I56P 1OX3A 4OH8B 2GTEA 1S3JA 1QXPA 1SQVK 1BE3E 2KIKA 5KAFE 1V1FA 1QWVA 1TNXA 2VRGA 1IFPA 1ZRTE 1GU5A 5H2FE 3EQ2A 4MEWA 2XV5A 2PRUA 2CPBA 2K2FA 5H2FH 3G6EP 3L70E 2M49B 1HGZA 2YIUC 1FDMA 2MHHA 1SQXK 3HX4A 3D71A 2OGUA 1VQ7P 1CB1A 5AW3B 2OS8C 1X0TA 1H8AA 2JXCA 2HQ8A 3V4QA 2KI4C 1QS7A 1CDMA 1LT9B 2IFNA 3V5BA 2MJZA 5M1BA 1TRFA 3HD7C 1M90Q 1EJ3A 2K7CA 1OOIX 3VYIA 2KAXA 1KYOD 1S5LX 4OV2A 1L0ND 1NHLA 1OXZA 2QJPB 2CBLA 2ZN9A 2SASA 4LC1A 5F6TA 1QEXA 1SFCA 4OZDA 5AW6B 1QVIZ 3HUSB 4WQ3A 2HODA 2O01N 2R5BA 5B66H 1LKJA 4R4LA 1KD1Q 1A02F 2OTGB 3P8CE 1GGWA 1UHHA 4ASVA 1CNPA 1OMRA 1PP9J 3HCMA 2QEVA 3FGAD 3SS5A 2LMTA 1KYOH 1JEKA 1AFOA 4NPEA 4MBEA 2PMYA 5L8RJ 1KWOB 3TGUJ 1XTGB 4YXWH 3IF7A 1IQ3A 3FE9A 3FWCA 2ZT9C 1NTME 2OTJP 1NU1D 3TF5A 2E42A 1Q7YQ 3R1PA 1F54A 2AXTE 1Y9BA 3Q5PA 1AJ5A 1J1DB 4WBAA 1RFJA 1XO5A 1EDLA 1TUZA 2AUCA 2ZRSA 3EK7A 1BCCD 3SG4A 1MXLC 2R2IA 3JVTB 2G8YA 3RZSA 1A02J 3GG2A 3I5IB 2KS1B 2IPPA 5KU1A 1DEBA 5KLVJ 5AW8B 1S9KE 1Y1UA 1K8AQ 5KAIE 1B7TY 2WMMA 5AW5B 1B8CA 4GGFC 4BRYA 3IFMA 4OGQC 1GL2C 2ZN8A 1HVVA 2IFMA 2NCPA 3NSLA 3KF9A 3H6PA 1ZOYC 2KI7B 2P71A 1S1EA 2V53A 4MLWA 2RN0A 4QJ4B 3SS3A 2KOGA 1DT7B 2K3RA 5CMZA 3I5HB 3CX5H 3SG5A 1CM4A 2E74C 3Q8IA 5AW9B 4RJTA 1P84E 2MBXA 2YKOA 1LINA 1EDIA 1SQQJ 1NWDA 2BCCE 1FZCB 5KJ7D 3S4RA 1U7JA 3B4SA 3SIAA 2JXLA 4NDCA 4EOTA 3SWFA 3RL0g 2JRFA 2KYCA 1NUBA 2LMVA 3CGAA 2M97A 3PLNA 5AANA 1KFMA 1UP5A 1S1CX 4H0LB 4LGDE 2Q3EA 2JDIH 4BWNA 2I2RE 3VMXA 2H8VA 1MXEA 2FYZA 1DVIA 2B1UA 2MA2A 3KO0A 5I2LA 1ZMZA 1M39A 3RL0D 3AECC 4L76A 3PJSK 5GTIH 1NVOA 4OVNF 2K9JA 1Q90D 2F8PA 2KLDA 3EG5B 3MUDC 3CCUP 3CR5X 2ZAEB 2ZFDA 2J5UA 1N7LA 1ZXGA 4GGNA 2L4IA 2WSCH 1XVJA 4OCIA 1EQ7A 1S36A 5CCHD 3OAKA 5AXIA 5APVA 1MZ9A 2PAJA 1KN7A 1KTMA 1SQVG 3B5NC 1L0NG 3Q5RA 2LP3A 4RO0A 5CCGD 1Q80A 4CIDA 2KLEA 2JWDA 1GD2E 3JTDC 2HODB 3L71J 2BEZF 1K05A 3BUNB 3JVTC 5APXA 1YUTA 1OQPA 3BOWA 2QEXP 1RWYA 4YGEB 3WXAA 3CX5E 4FTGA 3G4SP 2KK7A 4YPCA 2QJYB 1OW8A 5KLVK 2PASA 1SQXJ 1HUCA 3D6YA 2D8NA 1BCCE 1SQQD 4EI2A
chains in the Genus database with same CATH topology
4PE0A 1AHRA 1QLKA 3SG3A 3GOFA 4MN0A 1UHKA 2M1UA 4PHJA 2F2PA 2GV5A 5JJGA 3ICBA 1K95A 2K8MB 1IRJA 1BF5A 3WHTB 3AAJA 2M9GA 2LUXA 2K7OA 1B47A 3PATA 5D7FA 3IQOA 3ZWHA 1J55A 1FW4A 2DOQA 3OX6A 1YVLA 1IG5A 1QV1A 2LE9B 4NDDA 1N0YA 4I5LB 3BUMB 2OPOA 5ER5A 4YGDB 1KFXS 1AP4A 4QJ3B 4PHKA 1RECA 1WRLA 3BQ3A 3GK1A 3CWGA 1SR6C 2O5GA 3KHEA 1F8HA 5CPVA 3I5GB 5CSFA 5HLVA 1Y0VH 2NCOA 1BU3A 1JBAA 1YRUB 3H4SE 2H61C 1HT9A 2L0PA 2EC6C 1DJZA 3I5FB 1TNWA 5CSJA 1QTXA 1V1GA 1KQVA 1IGVA 1OOJA 4ICBA 3O2PA 2EGDA 4OKHA 1K96A 3PM8A 1BODA 1EXRA 1DJHA 1YVHA 2JNFA 2COLB 2NZ0A 5JOLA 2FCEA 4N1GA 1YUSA 4A4CA 2Y1MA 2WNDA 4C0KA 1DJIA 1SR6B 1K2HA 1C7VA 1IJ5A 3DVKA 1SNLA 5DKNA 4HSZA 4R1EA 3SG2A 1NSHA 3BXKA 4JQ0D 2GGMA 4PHMA 1FBVA 3DVEA 1EL4A 1ZOTB 3SJSA 1NP8A 1TCOB 3CLNA 1CFFA 1JF2A 1SY9A 5HLOA 3TDUA 4PALA 1J7QA 1NPQA 1OZSA 1KFUS 2LNKA 4ORCB 1PSRA 1YX7A 5KTYA 2E6WA 2BECA 1UUSA 1LXFC 1JC2A 3LLEA 2KI4B 1AK8A 4WRIA 4HREE 1XFYO 4OR9B 2BKIB 3EK4A 4MSPA 2QPTA 3CS1A 5KSZA 1CLLA 2HETA 1K8UA 1QX7A 3GK2A 4PCWA 2JTTA 2K2AA 1BT6A 2BCAA 3DVJA 3TUYB 2KNEA 4L9MA 1IH0A 2EHBA 2M3WA 1WRZA 4N1FA 3ZNIA 1MR8A 1NX1A 1OZOA 1YURA 4HRHA 2L51A 1JSAA 2WORA 3DF0A 4GFTA 1RROA 2LMUA 1F71A 2JU0A 2MAZA 2LAPA 1RTP1 1JFKA 1TOPA 2LVKA 2LM5A 1A2XA 1K9UA 4AQJA 1XK4A 3M0WA 2JT3A 1G33A 1YRTB 3F45A 1C07A 1JF0A 1JUOA 1OE9B 3EKHA 3O6BA 1BJFA 2ZNEA 2F3ZA 1Y6WA 5TNCA 1KFXL 1L7ZA 1S3PA 2KBIA 2LV7A 1GJYA 2JTZA 1CMGA 1QX5B 1S5GY 5CSIA 3LK0A 2JT8A 2M7LA 1R2UA 1RJVA 1XA5A 1M46A 5DKQA 4M2OA 4MZKA 1UHIA 2BL0B 3I5GC 3WHUB 1KQMC 3OHMB 2AMIA 3LCPC 2KAYA 4GGFA 1CDLA 1DJGA 1M45A 1KK8C 2CXJA 2PSRA 1UWOA 5HKYA 1FPWA 1CM1A 2LANA 1WRKA 1NIWA 1OMDA 1YR5A 2CT9A 4UPGA 4Q04A 2JULA 3D0YA 2L5XB 1NCXA 2BKHB 1BMOA 3NSKA 5AERA 4N5XA 1K90D 3D10A 3LL8B 1QLSA 4FQOA 3WNXB 2H2KA 1SL7A 2MJWB 1J1DA 4PE4A 1CMFA 1YUUA 4PDZA 2P6BB 1W7JB 5ER4X 4BY5A 2KI6D 3AKBA 4DCKA 1TTXA 1CDNA 1M31A 4PE7A 2WCFA 2TN4A 4MVFA 4MRXA 4YI9A 1X02A 4ETOA 2Y5IA 1XYDA 3MSEB 2LVIA 1B8LA 1W7IB 3EKJA 3NSOA 1TNQA 2FCDA 3FWBA 3TUYC 3CTNA 2G2BA 2WCBA 1CTRA 1QVIY 2BBNA 2M7NA 5BPJA 2CTNA 3PLFB 1S26D 2MLEC 1DJXA 3TZ1A 5I2QA 1B9AA 3SIBA 2F2OA 3D0YB 3K21A 1IQ5A 1QASA 1WLZA 2CNPA 4D1EA 5CSNA 1L2OC 1YTZC 2K7DA 2GGZA 1K9KA 3DF0B 1UHNA 4MZJA 1BLQA 4DS7A 1CFPA 2BL0C 1LA3A 2KOTA 2CCMA 1B4CA 1H4BA 4GBAA 2M0RA 1CKKA 3PSRA 2KGRA 1A4PA 1N2DA 3CR2A 1CLBA 3KPXA 2E30A 2OTGC 1DF0B 1PVAA 3TS5B 4DUQA 1MWNA 1NX3A 2JNXA 5K89A 1IJ6A 1XFWO 2SCPA 1BOCA 3DD4A 4YGBB 1H8BA 1E8AA 4I5JA 2KGBC 2PALA 5I8NA 3AKAA 1QIVA 2JPTA 4A4BA 4JWQA 4PHNA 1F4QA 4CFQA 4P5OE 2Y9YA 4C0JA 1F55A 1M63B 1KK7Z 1WY9A 2FOTA 1U5IA 1OSAA 1K93D 1QXPA 1TIZA 1ZACA 2BE6A 5HKZA 2M1KB 1V1FA 1TNXA 2VRGA 1SBJA 4USLA 5FYXA 1S6JA 4MEWA 4DRWA 1A75B 2QACA 1KSMA 4GPLB 2IS9A 2PRUA 3BUOB 2K2FA 3VROA 5B8IB 2M49B 4NQGA 5HKWA 1IKUA 1ALWA 2NXQA 3DVMA 1DTLA 2MHHA 3O4YA 2JT0A 1AJ4A 1PALA 3HX4A 2F33A 1PULA 3QRXA 5AEQA 1LA0A 1CB1A 2OS8C 2LUCA 2ZKMX 1NYAA 2JXCA 2HQ8A 2KHNA 2KI4C 4YI8A 1QS7A 1CDMA 3VRNA 2Q4UA 1TRFA 2HPSA 3AAKA 1EJ3A 2K7CA 2ZNDA 3VRPA 4M2QA 4TNCA 4YBHB 3SG6A 2FJUB 1K9PA 2K0JA 2KAXA 3RLZA 2K61A 1F70A 1XFVO 4OV2A 1J7OA 2JQ6A 2CBLA 2L50A 3CZTX 3EVVA 2ZN9A 1QATA 2KFGA 1NX2A 3JTDB 1DJWA 1GGZA 2KAVA 4ORAB 2SASA 1DGVA 2AAOA 2EC6B 5D69A 1S5GZ 5F6TA 3OB2B 1G4YR 2LP2A 3VGOA 1SCMB 1UHJA 3A4UB 1QVIZ 3O78A 2JZIA 4WQ3A 1SYMA 3NSIA 2K7BA 4ZCVA 1NX0A 1SK6D 1LKJA 3E3RA 1A75A 1BR4B 3BUWB 2OTGB 3TS5C 1GGWA 1UHHA 1CLMA 2HF5A 4GUKA 1CNPA 1OMRA 3HCMA 2Y9ZA 1WDCB 1F4OA 2LMTA 3GK4X 1SCVA 5PALA 4BY4A 4MBEA 2PMYA 3EK8A 2ISDA 1C7WA 1KWOB 4PE1A 4JPZB 3IF7A 1IQ3A 2G9BA 1JFJA 1YX8A 3FWCA 4M2PA 1N65A 2OS8B 1SMGA 1SKTA 4IL1A 4MRYA 1NCZA 2LHLA 4QJ5B 1F54A 2Y1NA 3A8RA 2KFFA 3C1VA 1AJ5A 3NXAA 1RFJA 1XO5A 1BR1B 1ZFSA 2AUCA 2ZRSA 3EK7A 2KBMA 2M8UA 3SG7A 1EG3A 1G8IA 1QX2A 2F3YA 2L2EA 1MXLC 1VRKA 4HRGA 4YGCB 5DKRA 2R2IA 3JVTB 1GQMA 3SG4A 1PRWA 1BG1A 2BCBA 3I5IB 2HQWA 2WCEA 5GQQC 2KQ6A 2KSPA 1OMVA 4WQ2A 3PN7C 1NCYA 1J7PA 4NDBA 3TDIA 5HYDA 4DIRA 1PSBA 5KU1A 1UURA 2I18A 1MHOA 4YGAA 2JOJA 3OP0A 1Y1UA 1B7TY 1B8CA 2KDHA 2NLNA 3I5HC 4GGFC 1TCFA 1FI5A 1U5IB 2ZN8A 3FS7A 4XJKA 1EH2A 3EVUA 2ZRTA 1SRAA 2NCPA 1ODBA 1MQ1A 1SL9A 1WLMA 3NSLA 3OX5A 5I2OA 2WOSA 3KF9A 2LVVA 1FF1A 1AUIB 4XJKB 1S1EA 2V53A 4MLWA 1B1GA 4QJ4B 2LCPA 1PK0D 1Y1XA 1KSOA 1DT7B 3I5HB 4GNKB 1TN4A 3BYAA 1XFUO 1CM4A 3SG5A 1JWDA 1SPYA 2I7AA 3OB1B 2MBXA 4YRUA 1LINA 4C0LA 2JC2A 2LVJA 1NWDA 2BCXA 3LK1A 4P2YB 1S6CA 1MF8B 2LLUA 1DF0A 1A03A 2BBMA 1A29A 3SIAA 2JXLA 4MZLA 4CPVA 4NDCA 4CLNA 1EG4A 5IBWA 3RM1A 1QV0A 5AFPA 2LLSA 1ALVA 4AQIA 2JRFA 2KYCA 1CFCA 1NUBA 2LMVA 3CGAA 1CDPA 1J7RA 3BOWB 2M97A 1LVCD 1ZUZA 5AANA 1UP5A 1D1OA 2I94A 1Y1AA 4F0ZB 2I2RE 1QJTA 1MXEA 1DJYA 3EVRA 1DVIA 2B1UA 3CR4X 2MA2A 4I5NB 3KO0A 1KK8B 5I2LA 1KWOC 1ZMZA 1M39A 1QIWA 2M29A 4OVNF 1OFCX 3VRRA 1RK9A 2F8PA 1WDCC 5J3XA 3BUXB 3CR5X 4AOMA 2ZFDA 2KI6C 4ORBB 1DMOA 4GGNA 2L4IA 1R6PA 1XVJA 2KYFA 2LC5A 4I5KA 1K94A 4OCIA 2LHIA 4E68A 3TDZA 1L2OB 1S36A 1SW8A 5G08A 1KQMB 2BE4A 4CFRA 1XK4C 1KCYA 5AXIA 4U8DA 2MRDA 1B7TZ 1HQVA 2JWWA 2O60A 1SCMC 2LP3A 3PFVA 1CFDA 1KFUL 3FIAA 1XFXO 3VRQA 3PN7B 1Q80A 1IWQA 2KQYA 2A4JA 4CIDA 2LLTA 3I5FC 3PALA 3JTDC 1KK7Y 3I5IC 1DGUA 2Y4QA 1AVSA 1FI6A 1TNPA 3BUNB 1PVBA 2L4HA 1YUTA 1OQPA 1XFZO 3BOWA 3JVTC 1J1EA 4GAOA 2WC8A 2MLFC 1RWYA 4YGEB 3IQQA 3WXAA 2H61A 4FTGA 4XYNA 1S6IA 1B8RA 3KEVA 1MUXA 2PVBA 2L98A 2RGIA 2KFHA 2PASA 2Q91A 2D8NA 4ZCUA 1SL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE0 A;  1AHR A;  1QLK A;  3SG3 A;  3GOF A;  4MN0 A;  1UHK A;  2M1U A;  4PHJ A;  2F2P A;  2GV5 A;  5JJG A;  3ICB A;  1K95 A;  2K8M B;  1IRJ A;  1BF5 A;  3WHT B;  3AAJ A;  2M9G A;  2LUX A;  2K7O A;  1B47 A;  3PAT A;  5D7F A;  3IQO A;  3ZWH A;  1J55 A;  1FW4 A;  2DOQ A;  3OX6 A;  1YVL A;  1IG5 A;  1QV1 A;  2LE9 B;  4NDD A;  1N0Y A;  4I5L B;  3BUM B;  2OPO A;  5ER5 A;  4YGD B;  1KFX S;  1AP4 A;  4QJ3 B;  4PHK A;  1REC A;  1WRL A;  3BQ3 A;  3GK1 A;  3CWG A;  1SR6 C;  2O5G A;  3KHE A;  1F8H A;  5CPV A;  3I5G B;  5CSF A;  5HLV A;  1Y0V H;  2NCO A;  1BU3 A;  1JBA A;  1YRU B;  3H4S E;  2H61 C;  1HT9 A;  2L0P A;  2EC6 C;  1DJZ A;  3I5F B;  1TNW A;  5CSJ A;  1QTX A;  1V1G A;  1KQV A;  1IGV A;  1OOJ A;  4ICB A;  3O2P A;  2EGD A;  4OKH A;  1K96 A;  3PM8 A;  1BOD A;  1EXR A;  1DJH A;  1YVH A;  2JNF A;  2COL B;  2NZ0 A;  5JOL A;  2FCE A;  4N1G A;  1YUS A;  4A4C A;  2Y1M A;  2WND A;  4C0K A;  1DJI A;  1SR6 B;  1K2H A;  1C7V A;  1IJ5 A;  3DVK A;  1SNL A;  5DKN A;  4HSZ A;  4R1E A;  3SG2 A;  1NSH A;  3BXK A;  4JQ0 D;  2GGM A;  4PHM A;  1FBV A;  3DVE A;  1EL4 A;  1ZOT B;  3SJS A;  1NP8 A;  1TCO B;  3CLN A;  1CFF A;  1JF2 A;  1SY9 A;  5HLO A;  3TDU A;  4PAL A;  1J7Q A;  1NPQ A;  1OZS A;  1KFU S;  2LNK A;  4ORC B;  1PSR A;  1YX7 A;  5KTY A;  2E6W A;  2BEC A;  1UUS A;  1LXF C;  1JC2 A;  3LLE A;  2KI4 B;  1AK8 A;  4WRI A;  4HRE E;  1XFY O;  4OR9 B;  2BKI B;  3EK4 A;  4MSP A;  2QPT A;  3CS1 A;  5KSZ A;  1CLL A;  2HET A;  1K8U A;  1QX7 A;  3GK2 A;  4PCW A;  2JTT A;  2K2A A;  1BT6 A;  2BCA A;  3DVJ A;  3TUY B;  2KNE A;  4L9M A;  1IH0 A;  2EHB A;  2M3W A;  1WRZ A;  4N1F A;  3ZNI A;  1MR8 A;  1NX1 A;  1OZO A;  1YUR A;  4HRH A;  2L51 A;  1JSA A;  2WOR A;  3DF0 A;  4GFT A;  1RRO A;  2LMU A;  1F71 A;  2JU0 A;  2MAZ A;  2LAP A;  1RTP 1;  1JFK A;  1TOP A;  2LVK A;  2LM5 A;  1A2X A;  1K9U A;  4AQJ A;  1XK4 A;  3M0W A;  2JT3 A;  1G33 A;  1YRT B;  3F45 A;  1C07 A;  1JF0 A;  1JUO A;  1OE9 B;  3EKH A;  3O6B A;  1BJF A;  2ZNE A;  2F3Z A;  1Y6W A;  5TNC A;  1KFX L;  1L7Z A;  1S3P A;  2KBI A;  2LV7 A;  1GJY A;  2JTZ A;  1CMG A;  1QX5 B;  1S5G Y;  5CSI A;  3LK0 A;  2JT8 A;  2M7L A;  1R2U A;  1RJV A;  1XA5 A;  1M46 A;  5DKQ A;  4M2O A;  4MZK A;  1UHI A;  2BL0 B;  3I5G C;  3WHU B;  1KQM C;  3OHM B;  2AMI A;  3LCP C;  2KAY A;  4GGF A;  1CDL A;  1DJG A;  1M45 A;  1KK8 C;  2CXJ A;  2PSR A;  1UWO A;  5HKY A;  1FPW A;  1CM1 A;  2LAN A;  1WRK A;  1NIW A;  1OMD A;  1YR5 A;  2CT9 A;  4UPG A;  4Q04 A;  2JUL A;  3D0Y A;  2L5X B;  1NCX A;  2BKH B;  1BMO A;  3NSK A;  5AER A;  4N5X A;  1K90 D;  3D10 A;  3LL8 B;  1QLS A;  4FQO A;  3WNX B;  2H2K A;  1SL7 A;  2MJW B;  1J1D A;  4PE4 A;  1CMF A;  1YUU A;  4PDZ A;  2P6B B;  1W7J B;  5ER4 X;  4BY5 A;  2KI6 D;  3AKB A;  4DCK A;  1TTX A;  1CDN A;  1M31 A;  4PE7 A;  2WCF A;  2TN4 A;  4MVF A;  4MRX A;  4YI9 A;  1X02 A;  4ETO A;  2Y5I A;  1XYD A;  3MSE B;  2LVI A;  1B8L A;  1W7I B;  3EKJ A;  3NSO A;  1TNQ A;  2FCD A;  3FWB A;  3TUY C;  3CTN A;  2G2B A;  2WCB A;  1CTR A;  1QVI Y;  2BBN A;  2M7N A;  5BPJ A;  2CTN A;  3PLF B;  1S26 D;  2MLE C;  1DJX A;  3TZ1 A;  5I2Q A;  1B9A A;  3SIB A;  2F2O A;  3D0Y B;  3K21 A;  1IQ5 A;  1QAS A;  1WLZ A;  2CNP A;  4D1E A;  5CSN A;  1L2O C;  1YTZ C;  2K7D A;  2GGZ A;  1K9K A;  3DF0 B;  1UHN A;  4MZJ A;  1BLQ A;  4DS7 A;  1CFP A;  2BL0 C;  1LA3 A;  2KOT A;  2CCM A;  1B4C A;  1H4B A;  4GBA A;  2M0R A;  1CKK A;  3PSR A;  2KGR A;  1A4P A;  1N2D A;  3CR2 A;  1CLB A;  3KPX A;  2E30 A;  2OTG C;  1DF0 B;  1PVA A;  3TS5 B;  4DUQ A;  1MWN A;  1NX3 A;  2JNX A;  5K89 A;  1IJ6 A;  1XFW O;  2SCP A;  1BOC A;  3DD4 A;  4YGB B;  1H8B A;  1E8A A;  4I5J A;  2KGB C;  2PAL A;  5I8N A;  3AKA A;  1QIV A;  2JPT A;  4A4B A;  4JWQ A;  4PHN A;  1F4Q A;  4CFQ A;  4P5O E;  2Y9Y A;  4C0J A;  1F55 A;  1M63 B;  1KK7 Z;  1WY9 A;  2FOT A;  1U5I A;  1OSA A;  1K93 D;  1QXP A;  1TIZ A;  1ZAC A;  2BE6 A;  5HKZ A;  2M1K B;  1V1F A;  1TNX A;  2VRG A;  1SBJ A;  4USL A;  5FYX A;  1S6J A;  4MEW A;  4DRW A;  1A75 B;  2QAC A;  1KSM A;  4GPL B;  2IS9 A;  2PRU A;  3BUO B;  2K2F A;  3VRO A;  5B8I B;  2M49 B;  4NQG A;  5HKW A;  1IKU A;  1ALW A;  2NXQ A;  3DVM A;  1DTL A;  2MHH A;  3O4Y A;  2JT0 A;  1AJ4 A;  1PAL A;  3HX4 A;  2F33 A;  1PUL A;  3QRX A;  5AEQ A;  1LA0 A;  1CB1 A;  2OS8 C;  2LUC A;  2ZKM X;  1NYA A;  2JXC A;  2HQ8 A;  2KHN A;  2KI4 C;  4YI8 A;  1QS7 A;  1CDM A;  3VRN A;  2Q4U A;  1TRF A;  2HPS A;  3AAK A;  1EJ3 A;  2K7C A;  2ZND A;  3VRP A;  4M2Q A;  4TNC A;  4YBH B;  3SG6 A;  2FJU B;  1K9P A;  2K0J A;  2KAX A;  3RLZ A;  2K61 A;  1F70 A;  1XFV O;  4OV2 A;  1J7O A;  2JQ6 A;  2CBL A;  2L50 A;  3CZT X;  3EVV A;  2ZN9 A;  1QAT A;  2KFG A;  1NX2 A;  3JTD B;  1DJW A;  1GGZ A;  2KAV A;  4ORA B;  2SAS A;  1DGV A;  2AAO A;  2EC6 B;  5D69 A;  1S5G Z;  5F6T A;  3OB2 B;  1G4Y R;  2LP2 A;  3VGO A;  1SCM B;  1UHJ A;  3A4U B;  1QVI Z;  3O78 A;  2JZI A;  4WQ3 A;  1SYM A;  3NSI A;  2K7B A;  4ZCV A;  1NX0 A;  1SK6 D;  1LKJ A;  3E3R A;  1A75 A;  1BR4 B;  3BUW B;  2OTG B;  3TS5 C;  1GGW A;  1UHH A;  1CLM A;  2HF5 A;  4GUK A;  1CNP A;  1OMR A;  3HCM A;  2Y9Z A;  1WDC B;  1F4O A;  2LMT A;  3GK4 X;  1SCV A;  5PAL A;  4BY4 A;  4MBE A;  2PMY A;  3EK8 A;  2ISD A;  1C7W A;  1KWO B;  4PE1 A;  4JPZ B;  3IF7 A;  1IQ3 A;  2G9B A;  1JFJ A;  1YX8 A;  3FWC A;  4M2P A;  1N65 A;  2OS8 B;  1SMG A;  1SKT A;  4IL1 A;  4MRY A;  1NCZ A;  2LHL A;  4QJ5 B;  1F54 A;  2Y1N A;  3A8R A;  2KFF A;  3C1V A;  1AJ5 A;  3NXA A;  1RFJ A;  1XO5 A;  1BR1 B;  1ZFS A;  2AUC A;  2ZRS A;  3EK7 A;  2KBM A;  2M8U A;  3SG7 A;  1EG3 A;  1G8I A;  1QX2 A;  2F3Y A;  2L2E A;  1MXL C;  1VRK A;  4HRG A;  4YGC B;  5DKR A;  2R2I A;  3JVT B;  1GQM A;  3SG4 A;  1PRW A;  1BG1 A;  2BCB A;  3I5I B;  2HQW A;  2WCE A;  5GQQ C;  2KQ6 A;  2KSP A;  1OMV A;  4WQ2 A;  3PN7 C;  1NCY A;  1J7P A;  4NDB A;  3TDI A;  5HYD A;  4DIR A;  1PSB A;  5KU1 A;  1UUR A;  2I18 A;  1MHO A;  4YGA A;  2JOJ A;  3OP0 A;  1Y1U A;  1B7T Y;  1B8C A;  2KDH A;  2NLN A;  3I5H C;  4GGF C;  1TCF A;  1FI5 A;  1U5I B;  2ZN8 A;  3FS7 A;  4XJK A;  1EH2 A;  3EVU A;  2ZRT A;  1SRA A;  2NCP A;  1ODB A;  1MQ1 A;  1SL9 A;  1WLM A;  3NSL A;  3OX5 A;  5I2O A;  2WOS A;  3KF9 A;  2LVV A;  1FF1 A;  1AUI B;  4XJK B;  1S1E A;  2V53 A;  4MLW A;  1B1G A;  4QJ4 B;  2LCP A;  1PK0 D;  1Y1X A;  1KSO A;  1DT7 B;  3I5H B;  4GNK B;  1TN4 A;  3BYA A;  1XFU O;  1CM4 A;  3SG5 A;  1JWD A;  1SPY A;  2I7A A;  3OB1 B;  2MBX A;  4YRU A;  1LIN A;  4C0L A;  2JC2 A;  2LVJ A;  1NWD A;  2BCX A;  3LK1 A;  4P2Y B;  1S6C A;  1MF8 B;  2LLU A;  1DF0 A;  1A03 A;  2BBM A;  1A29 A;  3SIA A;  2JXL A;  4MZL A;  4CPV A;  4NDC A;  4CLN A;  1EG4 A;  5IBW A;  3RM1 A;  1QV0 A;  5AFP A;  2LLS A;  1ALV A;  4AQI A;  2JRF A;  2KYC A;  1CFC A;  1NUB A;  2LMV A;  3CGA A;  1CDP A;  1J7R A;  3BOW B;  2M97 A;  1LVC D;  1ZUZ A;  5AAN A;  1UP5 A;  1D1O A;  2I94 A;  1Y1A A;  4F0Z B;  2I2R E;  1QJT A;  1MXE A;  1DJY A;  3EVR A;  1DVI A;  2B1U A;  3CR4 X;  2MA2 A;  4I5N B;  3KO0 A;  1KK8 B;  5I2L A;  1KWO C;  1ZMZ A;  1M39 A;  1QIW A;  2M29 A;  4OVN F;  1OFC X;  3VRR A;  1RK9 A;  2F8P A;  1WDC C;  5J3X A;  3BUX B;  3CR5 X;  4AOM A;  2ZFD A;  2KI6 C;  4ORB B;  1DMO A;  4GGN A;  2L4I A;  1R6P A;  1XVJ A;  2KYF A;  2LC5 A;  4I5K A;  1K94 A;  4OCI A;  2LHI A;  4E68 A;  3TDZ A;  1L2O B;  1S36 A;  1SW8 A;  5G08 A;  1KQM B;  2BE4 A;  4CFR A;  1XK4 C;  1KCY A;  5AXI A;  4U8D A;  2MRD A;  1B7T Z;  1HQV A;  2JWW A;  2O60 A;  1SCM C;  2LP3 A;  3PFV A;  1CFD A;  1KFU L;  3FIA A;  1XFX O;  3VRQ A;  3PN7 B;  1Q80 A;  1IWQ A;  2KQY A;  2A4J A;  4CID A;  2LLT A;  3I5F C;  3PAL A;  3JTD C;  1KK7 Y;  3I5I C;  1DGU A;  2Y4Q A;  1AVS A;  1FI6 A;  1TNP A;  3BUN B;  1PVB A;  2L4H A;  1YUT A;  1OQP A;  1XFZ O;  3BOW A;  3JVT C;  1J1E A;  4GAO A;  2WC8 A;  2MLF C;  1RWY A;  4YGE B;  3IQQ A;  3WXA A;  2H61 A;  4FTG A;  4XYN A;  1S6I A;  1B8R A;  3KEV A;  1MUX A;  2PVB A;  2L98 A;  2RGI A;  2KFH A;  2PAS A;  2Q91 A;  2D8N A;  4ZCU A;  1SL8 A; 
#chains in the Genus database with same CATH topology
 1QLK A;  3GOF A;  4MN0 A;  1UHK A;  3AE3 C;  1KV4 A;  1IRJ A;  2KNC A;  3AAJ A;  1AA0 A;  2LUX A;  3CCS P;  3CX5 I;  1QV1 A;  4NDD A;  1N0Y A;  1AP4 A;  1KFX S;  1QL2 A;  4PHK A;  1REC A;  3GK1 A;  2OTL P;  3H32 B;  1OW4 A;  1NYH A;  5EFW B;  3BRV B;  2M5A A;  1BCC G;  3A0B E;  2H61 C;  1AVY A;  2D2C C;  2J58 A;  2YKP A;  1FC2 C;  3PM8 A;  2JWA A;  5JOL A;  4N1G A;  2Y1M A;  3H1I J;  1K2H A;  2OAR A;  4L75 A;  1M1J C;  1K73 Q;  4HSZ A;  3H32 A;  2KLU A;  1Q2N A;  1NSH A;  4JQ0 D;  2P67 A;  4PHM A;  3DVE A;  3QWO C;  3A3Y B;  1Q81 Q;  1OOH A;  1CFF A;  2BAS A;  1JF2 A;  1RH5 B;  1NPQ A;  1OZS A;  3CCL P;  2LNK A;  1EXI A;  4PV1 D;  5AVW B;  3ZDM A;  5KTY A;  2E6W A;  2BEC A;  4IL6 X;  1NTK E;  3LLE A;  2KI4 B;  3L74 D;  4M3L A;  2N9B A;  2HYN A;  2Q3I A;  3H1L D;  2O01 J;  1U7M A;  4GOE A;  1CLL A;  1FE6 A;  1K8U A;  4PCW A;  1G1I A;  2ERB A;  3DVJ A;  3L72 G;  2EHB A;  2M3W A;  1ZR2 A;  3M0A A;  1MFT A;  3SWK A;  1NX1 A;  1KIL B;  4C46 A;  2JEE A;  1JSA A;  2HG5 D;  2MAZ A;  4A7P A;  3AEE C;  1RTP 1;  4FQT A;  1XK4 A;  1PGP A;  3B88 A;  3CME P;  2WCK A;  1C07 A;  4R4M A;  2MKV A;  3H1J E;  3O6B A;  3EKH A;  1OE9 B;  2WTY A;  3B87 A;  3L4F A;  1NWQ A;  1Y6W A;  5TNC A;  2LV7 A;  1OOF A;  3L73 E;  1GJY A;  2JTZ A;  1QX5 B;  1S5G Y;  3NHI A;  5CSI A;  2H8P D;  2M7L A;  3TK1 A;  3CCJ P;  3WHU B;  3I5G C;  4Y28 J;  4WWI A;  1SFC C;  3H1H E;  2AMI A;  2KAY A;  4GGF A;  1CDL A;  3BCC D;  1KK8 C;  1CI6 B;  2ZVO B;  2R44 A;  1FBM A;  2WSF J;  1AV1 A;  4Q04 A;  1SQB G;  5D3O A;  3NSK A;  2E43 A;  3CC4 P;  5AW4 B;  3PM2 A;  1QLS A;  2H2K A;  4PE4 A;  1J1E B;  1FAV A;  2P6B B;  3HD7 D;  5DIC A;  3S1K A;  5ER4 X;  1NTZ K;  5CCG C;  1CSB A;  1R5L A;  5KLI C;  4PJ0 H;  1TTX A;  1CDN A;  2OYH B;  3NMD A;  2IZ0 A;  1PFI A;  1IZN B;  4ETO A;  4JKT A;  1JY3 P;  3EKJ A;  3L73 D;  4WY4 B;  2FCD A;  3CTN A;  1NTZ D;  3V2R A;  1CTR A;  1HJB A;  1SQB K;  1S26 D;  2KSJ A;  3SIB A;  4JYB A;  4JF7 A;  2F2O A;  2GUV A;  1WLZ A;  4D1E A;  3L75 D;  1L2O C;  1JY3 O;  3P32 A;  1ZV8 A;  3D70 A;  2OYI C;  1UHN A;  1RE3 C;  3LW5 J;  4DS7 A;  4GOD A;  1LA3 A;  3HE4 B;  3NXS A;  2K60 A;  2FYN C;  4OGQ B;  1BE3 J;  1VQ4 P;  2Z5I A;  1CKK A;  1M1J B;  4D6T E;  2E30 A;  4DUQ A;  5AVU B;  3HE4 A;  1MWN A;  5K89 A;  3DD4 A;  1DX7 A;  1PZQ A;  1E8A A;  1SS1 A;  1M1J A;  2KGB C;  1QIV A;  2JPT A;  4A4B A;  1GL2 A;  4JWQ A;  5AVT B;  1VF5 D;  4C0J A;  4PT1 A;  5GTH H;  1M63 B;  1KK7 Z;  1U5I A;  4L74 A;  3AE6 C;  1TIZ A;  5HKZ A;  1YI2 P;  1SQP E;  2Q5U A;  1S4X A;  3H25 A;  1GZL A;  5KLV E;  5KLI B;  1L4A C;  4DRW A;  5CJ4 A;  1KSM A;  3BUO B;  3L36 A;  4NQG A;  3DVM A;  5E79 E;  1M8O B;  1DEL A;  3CWB D;  1AJY A;  2FFD A;  2KS1 A;  4XE5 B;  1FDO A;  2F33 A;  4HKZ H;  1PUL A;  3QRX A;  5AEQ A;  1LA0 A;  3M91 A;  4OGQ D;  3JCU H;  1PGJ A;  4YI8 A;  2Q1K A;  1NTK D;  2HPS A;  2QE7 H;  3VRP A;  4M2Q A;  4XFJ A;  3DY9 A;  1K9P A;  4EYY Q;  2E5Y A;  2IBZ I;  3AED C;  1GW4 A;  3CZT X;  3EVV A;  1VQ5 P;  2E75 C;  1DGV A;  2AAO A;  3AEA C;  3MHV A;  5D69 A;  1S5G Z;  4JYC A;  1G4Y R;  1JMM A;  1KIL A;  1VQO P;  1UHJ A;  3A4U B;  1EC5 A;  3O78 A;  2Q7C A;  4ZCV A;  1NX0 A;  3BFB A;  1SK6 D;  3E3R A;  2GUS A;  3BUW B;  2K9Y A;  4XA4 A;  3H1I D;  4GUK A;  3VTP C;  2LR2 A;  2GM4 A;  3CAB A;  1D7M A;  2P7J A;  2Y9Z A;  1LT9 C;  4H13 B;  1SQX D;  1Z2C B;  3GHG A;  1T8Z A;  2WSE J;  5PAL A;  1LTS C;  1NKN A;  2ISD A;  2H89 C;  3CLQ A;  1C7W A;  3A2A A;  1JFJ A;  2G9B A;  1YX8 A;  2KB7 P;  3UIA A;  4ZMD A;  1SKT A;  4IL1 A;  1NCZ A;  5AVQ B;  3A8R A;  3CZ1 A;  3L75 E;  4GDO A;  3C1V A;  3NXA A;  3G3Z A;  1PGQ A;  4QMA A;  1QX2 A;  1X79 B;  1A03 A;  4PD4 I;  2B88 A;  1BG1 A;  2BCB A;  2LXC B;  2W6B A;  2WCE A;  5GQQ C;  1DIP A;  3RK2 C;  2BNX A;  1LT9 A;  3V2L A;  5HYD A;  4DIR A;  2M5A B;  4YGA A;  1KYO E;  3K5B A;  3VMZ A;  2WPQ A;  1KC8 Q;  2NLN A;  3WU2 E;  2JPO A;  3PJI A;  1UII A;  4WY4 A;  3WUV A;  2P70 A;  4XJK A;  3AE2 C;  1L0N K;  3A7O A;  5B5E E;  1R8E A;  3EVU A;  1SRA A;  3M06 A;  1SL9 A;  5I2O A;  2A45 G;  2LVV A;  1FF1 A;  1PP9 G;  4XJK B;  3KXD A;  2LCP A;  1QGK B;  1BSH A;  2PP6 A;  2L91 A;  3KPE A;  2Y0E A;  1Q86 Q;  4PV1 B;  4TLF A;  3M9Q A;  4GNK B;  1TN4 A;  1XFU O;  1JWD A;  1T3J A;  2R3S A;  2I7A A;  1W2E A;  4C0L A;  4P2Y B;  1L4A A;  3L4A A;  1S6C A;  1MF8 B;  2LLU A;  3M9H A;  4NPF X;  1A29 A;  1EG4 A;  1QV0 A;  3CXH E;  1ALV A;  2ITA A;  4DOJ A;  2KLV A;  3Q1M A;  4KJM A;  3BOW B;  2AXT H;  1OOG A;  3OBV A;  1USD A;  2KUB A;  4F0Z B;  1Y1A A;  2P10 A;  4ZCU A;  2FXP A;  2B89 A;  1ZN5 A;  1OMI A;  5KTB A;  1SQV E;  1VQ6 P;  1J1E C;  2B87 B;  2XZR A;  4JBZ A;  3A0H H;  1KWO C;  1KB9 D;  1FZG A;  1QIW A;  3BAS A;  3PRJ A;  1LS8 A;  1T2K C;  2Y0C A;  3VRR A;  1YTZ T;  1DC1 A;  2FYN B;  3U1C A;  4AOM A;  3QH9 A;  2ZXE B;  3H1J G;  1KQL A;  3TDZ A;  4ASW A;  3TNU B;  3CZ0 A;  1GL2 D;  2OQQ A;  1SFC B;  1KQM B;  2QIW A;  4CFR A;  1XK4 C;  4U8D A;  1HQV A;  2JWW A;  3DXL A;  2O60 A;  1BCC J;  2BCC D;  1LTA C;  4KHX A;  3VRQ A;  2KQY A;  1ZME C;  1IK9 A;  1KK7 Y;  1JUN A;  1IJD B;  1QX8 A;  1DGU A;  2N1T B;  1OVV A;  1FI6 A;  2WCJ A;  4IFM A;  2H7H A;  1S72 P;  3H1J J;  1VQ9 P;  1B8R A;  1W2B O;  3QME A;  3KEV A;  2Q91 A;  4PE0 A;  1AHR A;  1PP9 D;  2O01 H;  1EZV G;  2F2P A;  2GV5 A;  1TUJ A;  1T14 A;  3H1H J;  3ICB A;  2K8M B;  3VN0 A;  2FYU J;  3WHT B;  4YTP C;  5CCG A;  2C9L Y;  1B47 A;  5D7F A;  2FFD C;  1J55 A;  1R5S A;  3C1L A;  1X22 A;  2NRG A;  1IG5 A;  1LJ2 A;  3BUM B;  2OPO A;  1M57 D;  2QEH A;  1VDF A;  1WRL A;  1CZQ A;  2QA4 P;  2WCH A;  1SR6 C;  2O5G A;  1F8H A;  2W83 C;  5HLV A;  1Y0V H;  1N7S D;  2NCO A;  5FI6 A;  1AQ5 A;  1YRU B;  1FDI A;  1GK4 A;  3I5F B;  1LNQ A;  3D76 A;  1V1G A;  1KQV A;  3TGU E;  1LGH B;  4OKH A;  1N73 A;  3CD6 P;  1EXR A;  1YVH A;  1L0N E;  1YUS A;  4A4C A;  2POH A;  2XDJ A;  3GMA A;  4F7F A;  1DJI A;  2E76 C;  2WQY C;  2E75 B;  3DVK A;  3D73 A;  2RMZ A;  1KIL C;  4R1E A;  3SG2 A;  2A06 E;  1BE3 D;  3BXK A;  2N1T D;  3CXH D;  1QL1 A;  1EL4 A;  4B86 A;  3NTN A;  2WSE H;  5AVX B;  1PSR A;  5AVZ B;  4GOF A;  5KJ7 A;  3FWN A;  4L73 A;  5KKZ C;  4HRE E;  1XFY O;  5BU8 B;  5I94 A;  2XND H;  1SP4 A;  4MSP A;  3CS1 A;  5KSZ A;  2ZYG A;  4I1L A;  1QX7 A;  3S9O A;  2M8R A;  2K2A A;  1NTZ J;  1FOS E;  4L9M A;  1IH0 A;  3KZI H;  4DZO A;  3TDK A;  4DT0 A;  3R72 A;  1CW5 A;  1OZH A;  3ZNI A;  3H1I G;  1GU4 A;  1YUR A;  4MN4 C;  4GFT A;  3VMA A;  1PPJ D;  1F71 A;  2LAP A;  1KFN A;  1FOS F;  2BEQ D;  1Z56 A;  1A2X A;  3M0W A;  2FKW B;  3CC2 P;  3F45 A;  1OIP A;  2V7Q J;  1JF0 A;  3B7A A;  1NKZ B;  1YJ9 P;  1S5L H;  1TU3 F;  2XU6 A;  1IFN A;  2FXM A;  1R2U A;  4WVZ A;  1PV3 A;  3B8E B;  4M2O A;  1UHI A;  2Q6Q A;  1AQT A;  3BCC J;  2KSE A;  3FWL A;  4IOI H;  4RES B;  1EZV D;  3CC7 P;  1UWO A;  4HJG H;  2WPR A;  1WRK A;  1NIW A;  1OMD A;  2CT9 A;  2I1J A;  2WT7 B;  2L5X B;  1NCX A;  3A5T A;  1BMO A;  1RE3 A;  3LL8 B;  1OWA A;  3WNX B;  2YIU B;  2W90 A;  1CMF A;  4PDZ A;  1W7J B;  5CHX A;  1NU1 K;  2QG4 A;  4BY5 A;  2KI6 D;  4DCK A;  3L71 G;  1NH4 A;  2WCF A;  2IBZ D;  4MRX A;  1LWU C;  1X02 A;  2YGU A;  3MSE B;  1LP1 A;  1B8L A;  3RBZ A;  3D75 A;  3LID A;  1VQP P;  3BFH A;  3BVH A;  3TUY C;  2G2B A;  2WCB A;  4D6T G;  2BBN A;  2M7N A;  3PLF B;  2MLE C;  5I2Q A;  4W80 A;  5AW0 B;  2P1J A;  5APY A;  2ZYD A;  5AVR B;  3MZW B;  2W6A A;  3T97 B;  2NPS C;  1YTZ C;  2GGZ A;  3VMY A;  3DF0 B;  3L71 E;  1CFP A;  1EXJ A;  1NTM D;  2K1A A;  2CCM A;  3UO9 A;  1USE A;  3ITK A;  5TIS E;  1N2D A;  3BJH A;  3TS5 B;  1PVA A;  3H1L E;  2W6J H;  1XFW O;  2SCP A;  1H8B A;  1L0L D;  1QLE D;  3IAO A;  2PAL A;  1M1K Q;  3I55 P;  1F4Q A;  2JR8 A;  4ZKP A;  3A0H E;  1JO5 A;  1S2E A;  3L74 J;  2XKM A;  2NPS D;  3F5H A;  2M1K B;  1SBJ A;  4USL A;  5APW A;  1SQB D;  3TYY A;  1WMK A;  5AVV B;  1MUU A;  4UB8 E;  3WU2 H;  4GPL B;  2GA1 A;  1OVR A;  3VRO A;  5B8I B;  3CCM P;  3FXD A;  5HKW A;  3VB1 A;  2FYU D;  2JT0 A;  3GW6 A;  1PAL A;  1RE4 A;  1NYA A;  1RHZ B;  2KHN A;  3GF3 A;  4W7Z A;  3OW2 O;  1KIL D;  3BCC G;  1SFC D;  1L4A B;  3SG6 A;  2FYU K;  3RLZ A;  1S5L E;  3O4X A;  2K61 A;  2H88 C;  2QRX A;  1J7O A;  3IN6 A;  2JQ6 A;  3S0F A;  1GL2 B;  2A06 D;  1IK7 A;  5KLV G;  3CDN A;  1QAT A;  2O3J A;  2WSS H;  2KAV A;  4ORA B;  3HUS A;  1PL5 A;  2EC6 B;  2M0B A;  1KZU B;  2O1K A;  3VGO A;  3L70 G;  1SCM B;  2K88 A;  2JZI A;  3NFQ A;  1BGY G;  1VQM P;  2D2C B;  1A75 A;  2WC6 A;  1CLM A;  2HF5 A;  1NTZ G;  4UB8 H;  5APU A;  3FXE A;  2QJP C;  1VQN P;  3BAT A;  1WDC B;  1F4O A;  2WSC J;  1J1D C;  4ZNC A;  2IYP A;  4BY4 A;  3EK8 A;  4PE1 A;  4JPZ B;  1N7S B;  2KNC B;  2M3E A;  4M2P A;  4BRY B;  3HTK A;  1N65 A;  2OS8 B;  1ORG A;  3S0G A;  4MRY A;  2RH0 A;  2LHL A;  4QJ5 B;  2QJY C;  2Y1N A;  2KFF A;  1BR1 B;  1ZFS A;  1L2P A;  4UB6 H;  2KBM A;  3SG7 A;  3R1O A;  1RQU A;  2F3Y A;  4HRG A;  1VRK A;  3M9B A;  4U3F E;  2VRS A;  1ZP0 C;  4WQ2 A;  1JY2 N;  3PN7 C;  1BSN A;  1W9Z A;  1J7P A;  2YO2 A;  4HB1 A;  3W67 A;  3GHG C;  3V2Q A;  1VQK P;  1UUR A;  2Y0D A;  3AE8 C;  3VP8 A;  1M56 D;  2JOJ A;  2W8Z A;  3OP0 A;  1GMJ A;  3CI9 A;  1PGO A;  2KDH A;  2Z5H A;  2FY8 A;  2E5T A;  1TCF A;  2AEJ A;  1GDT A;  3FS7 A;  2ZRT A;  2HPC B;  2WCL A;  1E5W A;  1WLM A;  3OX5 A;  2J59 M;  2WOS A;  4K3A A;  1DEK A;  2L2C A;  3S0B A;  1B1G A;  1PK0 D;  1NO4 A;  4AYC A;  4YXD C;  1Y1X A;  3AE5 C;  3KHU A;  1KSO A;  2ZT9 D;  4H0L C;  3H1H D;  1SPY A;  2A06 G;  4YRU A;  1SQV D;  2CPS A;  3LK1 A;  1RF1 C;  1DF0 A;  3BRT B;  3UNW A;  3LIE A;  4MZL A;  3RBX A;  4CPV A;  5FI2 A;  5IBW A;  1OW6 A;  3RM1 A;  3RL0 B;  5AFP A;  4AQI A;  1KIL E;  3VOP A;  3USS A;  1KQF B;  1PPJ E;  1CDP A;  1J7R A;  5KAI H;  1DH3 A;  1LVC D;  3PH0 A;  2AXC A;  3II6 A;  3L72 E;  2QDI A;  1H88 A;  2B9B A;  3HRN A;  1QJT A;  4I7Z C;  1DJY A;  3EVR A;  4I5N B;  1HF9 A;  1KK8 B;  2M29 A;  1SQX G;  1NGM B;  1RK9 A;  3BUX B;  1ZRT D;  2NPS A;  1H0T A;  2KI6 C;  4ORB B;  1GM0 A;  1R6P A;  2LC5 A;  3SFE C;  1K94 A;  3PP5 A;  2NPS B;  3E7K A;  3L73 G;  1URQ D;  2NZ2 A;  2BE4 A;  3KZI E;  3H1K D;  1B7T Z;  5APS A;  1C3Y A;  3PN7 B;  1URQ B;  3I5I C;  3AEG C;  1NU1 J;  3M0D C;  2WSF H;  1AVS A;  1TNP A;  3L74 G;  3GHG B;  2L4H A;  1H89 A;  1L0N J;  4GAO A;  2WC8 A;  2MLF C;  1NTM G;  1OW7 A;  5TJH A;  3TGU D;  3IQQ A;  4PD4 H;  2H61 A;  4XYN A;  1MFZ A;  3SFD C;  1MUX A;  4C7R A;  2L98 A;  2RGI A;  2LXB A;  2KFH A;  3CXH I;  1HBW A;  4O9B A;  1SQV J;  3SG3 A;  3E1I A;  2M1U A;  2FBW C;  1YBK A;  1C3Z A;  2M9G A;  2K7O A;  2JP3 A;  5KKZ B;  2WWW A;  3H1K E;  1P28 A;  1X8Y A;  5ER5 A;  4YGD B;  4QJ3 B;  5E79 H;  3CCQ P;  3BQ3 A;  4U7J A;  1YJN P;  3GF7 A;  3RGU A;  4N6J A;  1BDD A;  5CPV A;  3MTU E;  5EL2 A;  2BAP A;  1IIO A;  5CSF A;  4PD4 D;  5AW7 B;  1L0L G;  3HD7 A;  3HUS C;  1BU3 A;  3RK3 B;  1JBA A;  3O6Q B;  3H4S E;  1HT9 A;  3FE8 A;  2L0P A;  2EC6 C;  3OJA B;  1SVF A;  1QTX A;  1IGV A;  3CWB G;  2EGD A;  1NU1 G;  1K9M Q;  2P58 A;  5KAF H;  2COL B;  2NZ0 A;  2FCE A;  1GTW A;  1ZLL A;  3L72 D;  2KXP B;  2OYI A;  2QM7 A;  1IJ5 A;  1SNL A;  5DKN A;  1VL2 A;  2GGM A;  3N4X A;  3EWK A;  3T97 A;  1ZOT B;  2WCM A;  2BCC G;  1DQE A;  3V2P A;  3SJS A;  1IFI A;  1NP8 A;  1TCO B;  3CLN A;  2B87 A;  1IO4 A;  1SY9 A;  4PAL A;  1J7Q A;  1KFU S;  4I6M C;  1YX7 A;  3HD7 B;  1UUS A;  2A45 H;  1AK8 A;  4TT3 H;  4WRI A;  2FFD B;  1KOR A;  2BKI B;  3EK4 A;  3HTK B;  5TIS H;  2HET A;  1NAF A;  2IDB A;  2JO1 A;  3DZT A;  2KNE A;  1SQP D;  1NTK K;  1WRZ A;  5AW2 B;  3U1A A;  1OZO A;  4HRH A;  1PIX A;  2L51 A;  2I8D A;  4IFF A;  2WC5 A;  5CCH A;  3DF0 A;  1SQB E;  1RRO A;  3NGV A;  2LMU A;  1URQ C;  4IFD K;  2L5Y A;  1TOP A;  1JFK A;  2LVK A;  2LM5 A;  1K9U A;  4AQJ A;  2JT3 A;  5AVS B;  1G2C B;  1BGY D;  1K04 A;  4PJ0 E;  3U59 A;  1BJF A;  2KPH A;  2Z4E A;  4BXL A;  3AEF C;  1S3P A;  2KBI A;  1P84 H;  1KMI Z;  1LTB C;  3TGU G;  3LK0 A;  2JT8 A;  3L47 A;  2V7Q H;  5DKQ A;  3N7N A;  5DJU B;  4MZK A;  1KQM C;  2IBZ G;  4RKU J;  3OHM B;  3P7K A;  1SSE B;  1H0T B;  2OYO A;  2HPC A;  1YIJ P;  4U3F D;  4IL6 E;  5HKY A;  1CM1 A;  3C8V A;  1L0L J;  1JY2 P;  2PFX A;  4UPG A;  2ZJS E;  3EFG A;  2QM8 A;  2JUL A;  5APT A;  1FS0 E;  3WUT A;  2IYO A;  2BKH B;  3MIW A;  4N78 D;  1RY3 A;  4N5X A;  1K90 D;  3CWB J;  3JC2 2;  5APQ A;  4FQO A;  1NTZ E;  3CZ2 A;  1W5C E;  3FX0 A;  2IBZ E;  2JKV A;  1EDK A;  1RF1 A;  1JMB A;  4YI9 A;  1Y47 A;  2Y5I A;  1XYD A;  1SQQ K;  2N1T C;  3NSO A;  2FJY A;  3D74 A;  5GTH E;  4AUW A;  1QVI Y;  2CTN A;  3H1L J;  1LTJ B;  1DJX A;  3V6I A;  1B9A A;  2OTK E;  4WY4 D;  2QVA A;  3K21 A;  1QAS A;  1BE3 G;  1N7S C;  2CNP A;  5CSN A;  2C0W A;  3MGN A;  2FYU G;  2K7D A;  1K9K A;  1LTT C;  1BLQ A;  2BL0 C;  2KOT A;  3FE6 A;  1H4B A;  3B5N A;  4GBA A;  1NTM J;  2M0R A;  3PSR A;  2KGR A;  2I1K A;  1A4P A;  3CR2 A;  1CLB A;  3IF4 A;  3H1H G;  2OTG C;  1NX3 A;  1VF5 B;  1IJ6 A;  3OA7 A;  4YGB B;  4I5J A;  2C9N Y;  4U3F J;  4C7N A;  4Z1M H;  5I8N A;  3AKA A;  4LLH A;  4PHN A;  2FYU E;  4CFQ A;  2Y9Y A;  1WY9 A;  4WY4 C;  1IFD A;  1OSA A;  1K93 D;  1ZAC A;  4I2L C;  2BE6 A;  1KB9 I;  4H0L D;  3WMM 0;  3RK2 B;  4DJG A;  2QEB A;  5FYX A;  1S6J A;  1KB9 E;  2PRR A;  2YMY A;  1A75 B;  2QAC A;  3K1E A;  1NOH A;  2IS9 A;  3CPW O;  1JTH B;  1IKU A;  1ALW A;  2NXQ A;  1DTL A;  3L75 G;  3O4Y A;  4N3Y B;  1AJ4 A;  1Y8A A;  3E1R A;  1SLQ A;  2LUC A;  2ZKM X;  3VRN A;  2Q4U A;  1BGY E;  3AAK A;  2ZND A;  4YBH B;  4TNC A;  4D6T D;  2FJU B;  1MKM A;  2JJL A;  2K0J A;  2PGD A;  1F70 A;  1XFV O;  1S9K D;  1SQP G;  1UIX A;  3IVT A;  2YNY A;  2L50 A;  1VQL P;  3L71 D;  2KFG A;  2QJK C;  1NX2 A;  3JTD B;  1DJW A;  2H43 A;  1GGZ A;  2E76 B;  2UWJ E;  3HE5 B;  1BDC A;  3OB2 B;  3H1L G;  2LP2 A;  2AEM A;  1SYM A;  3TSI A;  3NSI A;  1QVG O;  2K7B A;  1EDJ A;  1LP1 B;  1BR4 B;  3TS5 C;  2WPS A;  2OYH A;  3L72 J;  3B6X A;  1L0L K;  2WIT A;  2R32 A;  3GLM A;  2ZVN B;  4KYN A;  3GK4 X;  1SCV A;  3TNU A;  3Q5S A;  1VPC A;  5KJ7 C;  3PHL A;  2E75 D;  1Z4H A;  3IR9 A;  1LTI C;  1SMG A;  1XFR A;  4N78 E;  1N8R Q;  1PP9 E;  3BFA A;  2M8U A;  4IJ7 A;  1YYC A;  1EG3 A;  4H13 C;  1G8I A;  4YGC B;  2L2E A;  5DKR A;  1SQQ G;  1GQM A;  1PRW A;  4Y99 B;  3BCC E;  1LTG C;  2HQW A;  1JB0 J;  4HH2 A;  2KQ6 A;  2KSP A;  3RK3 D;  1OMV A;  2K37 A;  2WZ7 A;  1NCY A;  1RF0 C;  1E79 H;  4NDB A;  3TDI A;  3B5N D;  2E74 D;  3Q2Y A;  3AE9 C;  1PSB A;  3DYE A;  2I18 A;  1MHO A;  2XNX A;  3L37 A;  1N73 B;  3I5H C;  2E76 D;  2FXO A;  2ZYA A;  1JNM A;  2QJK B;  1FI5 A;  1AVO A;  2SPZ A;  1U5I B;  1EH2 A;  1YHQ P;  3L70 J;  1SQQ E;  1ODB A;  1MQ1 A;  2A45 I;  1ZR4 A;  1LTJ A;  4H13 D;  1AUI B;  2LKM A;  3JCU E;  2K9J B;  3L70 D;  1ZW0 A;  2KYV A;  3PTZ A;  3AE1 C;  3H1K J;  5K5G B;  1GK6 A;  2R5D A;  3BYA A;  1JY2 O;  3OB1 B;  2KP8 A;  3SSU A;  5KLV D;  2D2C D;  2C0X A;  2YO3 A;  2JC2 A;  2LVJ A;  2BCX A;  2IZ1 A;  2ZFC A;  2BBM A;  4H44 D;  1GW3 A;  3M0D A;  1FJK A;  4CLN A;  4EIJ A;  3H1J D;  1HTL C;  1HWT C;  4IL6 H;  4EDF A;  5B5E H;  2LLS A;  3EFF K;  1CFC A;  4U3F G;  5BU5 A;  1ZUZ A;  3D78 A;  1D1O A;  2I94 A;  1IFJ A;  1X9V A;  3HE5 A;  2BCC J;  2AEF A;  3CR4 X;  3KQG A;  1T6A A;  1OFC X;  3CYZ A;  4JD9 A;  2KZJ A;  1WDC C;  5J3X A;  2HR3 A;  3L74 E;  1KQS O;  4H44 C;  1N7S A;  1DMO A;  1G1J A;  1HGV A;  3CXH H;  2KYF A;  4I5K A;  2LHI A;  4E68 A;  1L2O B;  1SW8 A;  2WT7 A;  5GTI E;  4GKG A;  5G08 A;  3JSV C;  1KCY A;  3F89 A;  3RK2 D;  2MRD A;  1JCC A;  3A0B H;  5CBO A;  4I7Z B;  1SCM C;  3PFV A;  5CJ0 A;  1CFD A;  1KFU L;  3FIA A;  1XFX O;  3V2N A;  3S0A A;  3OGN A;  1P84 D;  1N73 C;  4ZKU A;  5B66 E;  1IWQ A;  2A4J A;  4INX A;  5HL1 A;  4C7N B;  2LLT A;  3I5F C;  3W68 A;  3PAL A;  3D77 A;  3CCE P;  2Y4Q A;  4GT1 A;  5BVZ A;  1PVB A;  1VQ8 P;  1XFZ O;  2Q9I A;  3RL0 C;  1FJP A;  1WRG A;  1J1E A;  3CL3 D;  5C39 A;  1HH0 A;  1S6I A;  4D6T J;  3MUD A;  2PVB A;  1RF1 B;  2HFE D;  2YXQ B;  1RF0 A;  1SL8 A;  3G9R A;  3N7H A;  4PHJ A;  2WPV B;  3VP9 A;  1CI6 A;  2E74 B;  1FZB A;  5JJG A;  1IFM A;  1K95 A;  1PPJ G;  1U57 A;  3WUU A;  1BF5 A;  2RKL A;  4K35 A;  1NU1 E;  3PAT A;  4AQR D;  4CPG A;  3IQO A;  1G2C A;  3ZWH A;  1FW4 A;  2DOQ A;  3OX6 A;  1YVL A;  1P84 I;  2LE9 B;  4I5L B;  3AE4 C;  2QEO A;  2G3A A;  3CWG A;  3P8C D;  1N86 A;  3KHE A;  3I5G B;  1SQX E;  1NTM K;  3O8Z A;  3KYQ A;  2IX7 C;  3SS4 A;  4W7Y A;  1IC2 A;  3S0E A;  1DJZ A;  3B71 A;  1TNW A;  5CSJ A;  3LW5 H;  1OOJ A;  4ICB A;  3O2P A;  1FZC A;  5DJT B;  1FU1 A;  1K96 A;  1BOD A;  1DJH A;  2JNF A;  1KQG B;  1XTC C;  1RQV A;  1DD4 A;  3Q3D A;  3O6Q A;  2WND A;  4C0K A;  1JY3 N;  1SR6 B;  1FZF A;  1C7V A;  2PYQ A;  1Q82 Q;  3KDP B;  3B86 A;  3AE7 C;  1LT1 A;  1YQ3 C;  3RK3 C;  3D6Z A;  3H1K G;  4H44 B;  1FBV A;  1N2D C;  3TDU A;  5HLO A;  1NJI Q;  1SQB J;  4ORC B;  1FZA A;  2R3C A;  2ZT9 B;  1LXF C;  1JC2 A;  4GIF A;  5FI7 A;  4OR9 B;  2L5G B;  3MD0 A;  5AW1 B;  1T2K D;  2QPT A;  3GK2 A;  1TWO A;  3CWB E;  2JTT A;  4OWF A;  1BT6 A;  2BCA A;  3TUY B;  3P8M C;  1NAY A;  1EZV I;  4N1F A;  5AVY B;  3S0D A;  1MR8 A;  1LWU B;  2WOR A;  3L4L A;  2JU0 A;  2YXR B;  2W27 A;  1FZE A;  2ZXX A;  1G33 A;  1YRT B;  1NTK G;  3CCV P;  1L0L E;  5CBN A;  3C9I A;  1JUO A;  1RE4 C;  1VF5 C;  2ZNE A;  2F3Z A;  1KFX L;  1L7Z A;  1CMG A;  1JTH A;  3V4W A;  2N1T A;  2N9Y B;  1LWU A;  1RJV A;  2DW3 A;  1XA5 A;  1M46 A;  2BL0 B;  3AEB C;  1YIT P;  3LCP C;  3RK3 E;  1KB9 H;  4NPD A;  3R2P A;  4KT0 J;  1DJG A;  1M45 A;  2CXJ A;  2PSR A;  2YKQ A;  1FPW A;  2M3B A;  2LAN A;  1KYO I;  1NTK J;  1YR5 A;  1QVF O;  3G71 P;  1LTJ C;  3R1V A;  2OYI B;  3D0Y A;  1URQ A;  1JM0 A;  5AER A;  3D10 A;  1JCD A;  1DD3 A;  2V4H A;  1SL7 A;  2MJW B;  1J1D A;  2O1J A;  3MP7 B;  1YUU A;  2QSI A;  3NHT A;  1OVU A;  1M7L A;  4PD4 E;  1EZV E;  1YJW P;  3AKB A;  1MV8 A;  2OYH C;  1M31 A;  4PE7 A;  2TN4 A;  4MVF A;  3CCR P;  1JOC A;  5CCH C;  1WT6 A;  2LVI A;  1W7I B;  1SQP J;  1TNQ A;  3FWB A;  4INW A;  3H1I E;  1J2J B;  3I5C A;  5BPJ A;  2WVR A;  3L73 J;  2CK3 H;  3TZ1 A;  4PV1 C;  2P2U A;  1T3U A;  1FZC C;  3B5N B;  1SQP K;  3CMA P;  3D0Y B;  1IQ5 A;  1YQ4 C;  3R4Y A;  2PQL A;  1YTZ I;  1DEE G;  3CX5 D;  4MZJ A;  1BGY J;  1L4A D;  2YMK A;  1B4C A;  3ABV C;  1HJ0 A;  4WB4 A;  3KPX A;  1DF0 B;  3L75 J;  2JNX A;  2KZI A;  1BOC A;  4UB6 E;  3L35 A;  3SWY A;  4P5O E;  1F55 A;  2FOT A;  4HYT B;  2HLO A;  4Y99 C;  3I56 P;  1OX3 A;  4OH8 B;  2GTE A;  1S3J A;  1QXP A;  1SQV K;  1BE3 E;  2KIK A;  5KAF E;  1V1F A;  1QWV A;  1TNX A;  2VRG A;  1IFP A;  1ZRT E;  1GU5 A;  5H2F E;  3EQ2 A;  4MEW A;  2XV5 A;  2PRU A;  2CPB A;  2K2F A;  5H2F H;  3G6E P;  3L70 E;  2M49 B;  1HGZ A;  2YIU C;  1FDM A;  2MHH A;  1SQX K;  3HX4 A;  3D71 A;  2OGU A;  1VQ7 P;  1CB1 A;  5AW3 B;  2OS8 C;  1X0T A;  1H8A A;  2JXC A;  2HQ8 A;  3V4Q A;  2KI4 C;  1QS7 A;  1CDM A;  1LT9 B;  2IFN A;  3V5B A;  2MJZ A;  5M1B A;  1TRF A;  3HD7 C;  1M90 Q;  1EJ3 A;  2K7C A;  1OOI X;  3VYI A;  2KAX A;  1KYO D;  1S5L X;  4OV2 A;  1L0N D;  1NHL A;  1OXZ A;  2QJP B;  2CBL A;  2ZN9 A;  2SAS A;  4LC1 A;  5F6T A;  1QEX A;  1SFC A;  4OZD A;  5AW6 B;  1QVI Z;  3HUS B;  4WQ3 A;  2HOD A;  2O01 N;  2R5B A;  5B66 H;  1LKJ A;  4R4L A;  1KD1 Q;  1A02 F;  2OTG B;  3P8C E;  1GGW A;  1UHH A;  4ASV A;  1CNP A;  1OMR A;  1PP9 J;  3HCM A;  2QEV A;  3FGA D;  3SS5 A;  2LMT A;  1KYO H;  1JEK A;  1AFO A;  4NPE A;  4MBE A;  2PMY A;  5L8R J;  1KWO B;  3TGU J;  1XTG B;  4YXW H;  3IF7 A;  1IQ3 A;  3FE9 A;  3FWC A;  2ZT9 C;  1NTM E;  2OTJ P;  1NU1 D;  3TF5 A;  2E42 A;  1Q7Y Q;  3R1P A;  1F54 A;  2AXT E;  1Y9B A;  3Q5P A;  1AJ5 A;  1J1D B;  4WBA A;  1RFJ A;  1XO5 A;  1EDL A;  1TUZ A;  2AUC A;  2ZRS A;  3EK7 A;  1BCC D;  3SG4 A;  1MXL C;  2R2I A;  3JVT B;  2G8Y A;  3RZS A;  1A02 J;  3GG2 A;  3I5I B;  2KS1 B;  2IPP A;  5KU1 A;  1DEB A;  5KLV J;  5AW8 B;  1S9K E;  1Y1U A;  1K8A Q;  5KAI E;  1B7T Y;  2WMM A;  5AW5 B;  1B8C A;  4GGF C;  4BRY A;  3IFM A;  4OGQ C;  1GL2 C;  2ZN8 A;  1HVV A;  2IFM A;  2NCP A;  3NSL A;  3KF9 A;  3H6P A;  1ZOY C;  2KI7 B;  2P71 A;  1S1E A;  2V53 A;  4MLW A;  2RN0 A;  4QJ4 B;  3SS3 A;  2KOG A;  1DT7 B;  2K3R A;  5CMZ A;  3I5H B;  3CX5 H;  3SG5 A;  1CM4 A;  2E74 C;  3Q8I A;  5AW9 B;  4RJT A;  1P84 E;  2MBX A;  2YKO A;  1LIN A;  1EDI A;  1SQQ J;  1NWD A;  2BCC E;  1FZC B;  5KJ7 D;  3S4R A;  1U7J A;  3B4S A;  3SIA A;  2JXL A;  4NDC A;  4EOT A;  3SWF A;  3RL0 g;  2JRF A;  2KYC A;  1NUB A;  2LMV A;  3CGA A;  2M97 A;  3PLN A;  5AAN A;  1KFM A;  1UP5 A;  1S1C X;  4H0L B;  4LGD E;  2Q3E A;  2JDI H;  4BWN A;  2I2R E;  3VMX A;  2H8V A;  1MXE A;  2FYZ A;  1DVI A;  2B1U A;  2MA2 A;  3KO0 A;  5I2L A;  1ZMZ A;  1M39 A;  3RL0 D;  3AEC C;  4L76 A;  3PJS K;  5GTI H;  1NVO A;  4OVN F;  2K9J A;  1Q90 D;  2F8P A;  2KLD A;  3EG5 B;  3MUD C;  3CCU P;  3CR5 X;  2ZAE B;  2ZFD A;  2J5U A;  1N7L A;  1ZXG A;  4GGN A;  2L4I A;  2WSC H;  1XVJ A;  4OCI A;  1EQ7 A;  1S36 A;  5CCH D;  3OAK A;  5AXI A;  5APV A;  1MZ9 A;  2PAJ A;  1KN7 A;  1KTM A;  1SQV G;  3B5N C;  1L0N G;  3Q5R A;  2LP3 A;  4RO0 A;  5CCG D;  1Q80 A;  4CID A;  2KLE A;  2JWD A;  1GD2 E;  3JTD C;  2HOD B;  3L71 J;  2BEZ F;  1K05 A;  3BUN B;  3JVT C;  5APX A;  1YUT A;  1OQP A;  3BOW A;  2QEX P;  1RWY A;  4YGE B;  3WXA A;  3CX5 E;  4FTG A;  3G4S P;  2KK7 A;  4YPC A;  2QJY B;  1OW8 A;  5KLV K;  2PAS A;  1SQX J;  1HUC A;  3D6Y A;  2D8N A;  1BCC E;  1SQQ D;  4EI2 A; 
#chains in the Genus database with same CATH homology
 4PE0 A;  1AHR A;  1QLK A;  3SG3 A;  3GOF A;  4MN0 A;  1UHK A;  2M1U A;  4PHJ A;  2F2P A;  2GV5 A;  5JJG A;  3ICB A;  1K95 A;  2K8M B;  1IRJ A;  1BF5 A;  3WHT B;  3AAJ A;  2M9G A;  2LUX A;  2K7O A;  1B47 A;  3PAT A;  5D7F A;  3IQO A;  3ZWH A;  1J55 A;  1FW4 A;  2DOQ A;  3OX6 A;  1YVL A;  1IG5 A;  1QV1 A;  2LE9 B;  4NDD A;  1N0Y A;  4I5L B;  3BUM B;  2OPO A;  5ER5 A;  4YGD B;  1KFX S;  1AP4 A;  4QJ3 B;  4PHK A;  1REC A;  1WRL A;  3BQ3 A;  3GK1 A;  3CWG A;  1SR6 C;  2O5G A;  3KHE A;  1F8H A;  5CPV A;  3I5G B;  5CSF A;  5HLV A;  1Y0V H;  2NCO A;  1BU3 A;  1JBA A;  1YRU B;  3H4S E;  2H61 C;  1HT9 A;  2L0P A;  2EC6 C;  1DJZ A;  3I5F B;  1TNW A;  5CSJ A;  1QTX A;  1V1G A;  1KQV A;  1IGV A;  1OOJ A;  4ICB A;  3O2P A;  2EGD A;  4OKH A;  1K96 A;  3PM8 A;  1BOD A;  1EXR A;  1DJH A;  1YVH A;  2JNF A;  2COL B;  2NZ0 A;  5JOL A;  2FCE A;  4N1G A;  1YUS A;  4A4C A;  2Y1M A;  2WND A;  4C0K A;  1DJI A;  1SR6 B;  1K2H A;  1C7V A;  1IJ5 A;  3DVK A;  1SNL A;  5DKN A;  4HSZ A;  4R1E A;  3SG2 A;  1NSH A;  3BXK A;  4JQ0 D;  2GGM A;  4PHM A;  1FBV A;  3DVE A;  1EL4 A;  1ZOT B;  3SJS A;  1NP8 A;  1TCO B;  3CLN A;  1CFF A;  1JF2 A;  1SY9 A;  5HLO A;  3TDU A;  4PAL A;  1J7Q A;  1NPQ A;  1OZS A;  1KFU S;  2LNK A;  4ORC B;  1PSR A;  1YX7 A;  5KTY A;  2E6W A;  2BEC A;  1UUS A;  1LXF C;  1JC2 A;  3LLE A;  2KI4 B;  1AK8 A;  4WRI A;  4HRE E;  1XFY O;  4OR9 B;  2BKI B;  3EK4 A;  4MSP A;  2QPT A;  3CS1 A;  5KSZ A;  1CLL A;  2HET A;  1K8U A;  1QX7 A;  3GK2 A;  4PCW A;  2JTT A;  2K2A A;  1BT6 A;  2BCA A;  3DVJ A;  3TUY B;  2KNE A;  4L9M A;  1IH0 A;  2EHB A;  2M3W A;  1WRZ A;  4N1F A;  3ZNI A;  1MR8 A;  1NX1 A;  1OZO A;  1YUR A;  4HRH A;  2L51 A;  1JSA A;  2WOR A;  3DF0 A;  4GFT A;  1RRO A;  2LMU A;  1F71 A;  2JU0 A;  2MAZ A;  2LAP A;  1RTP 1;  1JFK A;  1TOP A;  2LVK A;  2LM5 A;  1A2X A;  1K9U A;  4AQJ A;  1XK4 A;  3M0W A;  2JT3 A;  1G33 A;  1YRT B;  3F45 A;  1C07 A;  1JF0 A;  1JUO A;  1OE9 B;  3EKH A;  3O6B A;  1BJF A;  2ZNE A;  2F3Z A;  1Y6W A;  5TNC A;  1KFX L;  1L7Z A;  1S3P A;  2KBI A;  2LV7 A;  1GJY A;  2JTZ A;  1CMG A;  1QX5 B;  1S5G Y;  5CSI A;  3LK0 A;  2JT8 A;  2M7L A;  1R2U A;  1RJV A;  1XA5 A;  1M46 A;  5DKQ A;  4M2O A;  4MZK A;  1UHI A;  2BL0 B;  3I5G C;  3WHU B;  1KQM C;  3OHM B;  2AMI A;  3LCP C;  2KAY A;  4GGF A;  1CDL A;  1DJG A;  1M45 A;  1KK8 C;  2CXJ A;  2PSR A;  1UWO A;  5HKY A;  1FPW A;  1CM1 A;  2LAN A;  1WRK A;  1NIW A;  1OMD A;  1YR5 A;  2CT9 A;  4UPG A;  4Q04 A;  2JUL A;  3D0Y A;  2L5X B;  1NCX A;  2BKH B;  1BMO A;  3NSK A;  5AER A;  4N5X A;  1K90 D;  3D10 A;  3LL8 B;  1QLS A;  4FQO A;  3WNX B;  2H2K A;  1SL7 A;  2MJW B;  1J1D A;  4PE4 A;  1CMF A;  1YUU A;  4PDZ A;  2P6B B;  1W7J B;  5ER4 X;  4BY5 A;  2KI6 D;  3AKB A;  4DCK A;  1TTX A;  1CDN A;  1M31 A;  4PE7 A;  2WCF A;  2TN4 A;  4MVF A;  4MRX A;  4YI9 A;  1X02 A;  4ETO A;  2Y5I A;  1XYD A;  3MSE B;  2LVI A;  1B8L A;  1W7I B;  3EKJ A;  3NSO A;  1TNQ A;  2FCD A;  3FWB A;  3TUY C;  3CTN A;  2G2B A;  2WCB A;  1CTR A;  1QVI Y;  2BBN A;  2M7N A;  5BPJ A;  2CTN A;  3PLF B;  1S26 D;  2MLE C;  1DJX A;  3TZ1 A;  5I2Q A;  1B9A A;  3SIB A;  2F2O A;  3D0Y B;  3K21 A;  1IQ5 A;  1QAS A;  1WLZ A;  2CNP A;  4D1E A;  5CSN A;  1L2O C;  1YTZ C;  2K7D A;  2GGZ A;  1K9K A;  3DF0 B;  1UHN A;  4MZJ A;  1BLQ A;  4DS7 A;  1CFP A;  2BL0 C;  1LA3 A;  2KOT A;  2CCM A;  1B4C A;  1H4B A;  4GBA A;  2M0R A;  1CKK A;  3PSR A;  2KGR A;  1A4P A;  1N2D A;  3CR2 A;  1CLB A;  3KPX A;  2E30 A;  2OTG C;  1DF0 B;  1PVA A;  3TS5 B;  4DUQ A;  1MWN A;  1NX3 A;  2JNX A;  5K89 A;  1IJ6 A;  1XFW O;  2SCP A;  1BOC A;  3DD4 A;  4YGB B;  1H8B A;  1E8A A;  4I5J A;  2KGB C;  2PAL A;  5I8N A;  3AKA A;  1QIV A;  2JPT A;  4A4B A;  4JWQ A;  4PHN A;  1F4Q A;  4CFQ A;  4P5O E;  2Y9Y A;  4C0J A;  1F55 A;  1M63 B;  1KK7 Z;  1WY9 A;  2FOT A;  1U5I A;  1OSA A;  1K93 D;  1QXP A;  1TIZ A;  1ZAC A;  2BE6 A;  5HKZ A;  2M1K B;  1V1F A;  1TNX A;  2VRG A;  1SBJ A;  4USL A;  5FYX A;  1S6J A;  4MEW A;  4DRW A;  1A75 B;  2QAC A;  1KSM A;  4GPL B;  2IS9 A;  2PRU A;  3BUO B;  2K2F A;  3VRO A;  5B8I B;  2M49 B;  4NQG A;  5HKW A;  1IKU A;  1ALW A;  2NXQ A;  3DVM A;  1DTL A;  2MHH A;  3O4Y A;  2JT0 A;  1AJ4 A;  1PAL A;  3HX4 A;  2F33 A;  1PUL A;  3QRX A;  5AEQ A;  1LA0 A;  1CB1 A;  2OS8 C;  2LUC A;  2ZKM X;  1NYA A;  2JXC A;  2HQ8 A;  2KHN A;  2KI4 C;  4YI8 A;  1QS7 A;  1CDM A;  3VRN A;  2Q4U A;  1TRF A;  2HPS A;  3AAK A;  1EJ3 A;  2K7C A;  2ZND A;  3VRP A;  4M2Q A;  4TNC A;  4YBH B;  3SG6 A;  2FJU B;  1K9P A;  2K0J A;  2KAX A;  3RLZ A;  2K61 A;  1F70 A;  1XFV O;  4OV2 A;  1J7O A;  2JQ6 A;  2CBL A;  2L50 A;  3CZT X;  3EVV A;  2ZN9 A;  1QAT A;  2KFG A;  1NX2 A;  3JTD B;  1DJW A;  1GGZ A;  2KAV A;  4ORA B;  2SAS A;  1DGV A;  2AAO A;  2EC6 B;  5D69 A;  1S5G Z;  5F6T A;  3OB2 B;  1G4Y R;  2LP2 A;  3VGO A;  1SCM B;  1UHJ A;  3A4U B;  1QVI Z;  3O78 A;  2JZI A;  4WQ3 A;  1SYM A;  3NSI A;  2K7B A;  4ZCV A;  1NX0 A;  1SK6 D;  1LKJ A;  3E3R A;  1A75 A;  1BR4 B;  3BUW B;  2OTG B;  3TS5 C;  1GGW A;  1UHH A;  1CLM A;  2HF5 A;  4GUK A;  1CNP A;  1OMR A;  3HCM A;  2Y9Z A;  1WDC B;  1F4O A;  2LMT A;  3GK4 X;  1SCV A;  5PAL A;  4BY4 A;  4MBE A;  2PMY A;  3EK8 A;  2ISD A;  1C7W A;  1KWO B;  4PE1 A;  4JPZ B;  3IF7 A;  1IQ3 A;  2G9B A;  1JFJ A;  1YX8 A;  3FWC A;  4M2P A;  1N65 A;  2OS8 B;  1SMG A;  1SKT A;  4IL1 A;  4MRY A;  1NCZ A;  2LHL A;  4QJ5 B;  1F54 A;  2Y1N A;  3A8R A;  2KFF A;  3C1V A;  1AJ5 A;  3NXA A;  1RFJ A;  1XO5 A;  1BR1 B;  1ZFS A;  2AUC A;  2ZRS A;  3EK7 A;  2KBM A;  2M8U A;  3SG7 A;  1EG3 A;  1G8I A;  1QX2 A;  2F3Y A;  2L2E A;  1MXL C;  1VRK A;  4HRG A;  4YGC B;  5DKR A;  2R2I A;  3JVT B;  1GQM A;  3SG4 A;  1PRW A;  1BG1 A;  2BCB A;  3I5I B;  2HQW A;  2WCE A;  5GQQ C;  2KQ6 A;  2KSP A;  1OMV A;  4WQ2 A;  3PN7 C;  1NCY A;  1J7P A;  4NDB A;  3TDI A;  5HYD A;  4DIR A;  1PSB A;  5KU1 A;  1UUR A;  2I18 A;  1MHO A;  4YGA A;  2JOJ A;  3OP0 A;  1Y1U A;  1B7T Y;  1B8C A;  2KDH A;  2NLN A;  3I5H C;  4GGF C;  1TCF A;  1FI5 A;  1U5I B;  2ZN8 A;  3FS7 A;  4XJK A;  1EH2 A;  3EVU A;  2ZRT A;  1SRA A;  2NCP A;  1ODB A;  1MQ1 A;  1SL9 A;  1WLM A;  3NSL A;  3OX5 A;  5I2O A;  2WOS A;  3KF9 A;  2LVV A;  1FF1 A;  1AUI B;  4XJK B;  1S1E A;  2V53 A;  4MLW A;  1B1G A;  4QJ4 B;  2LCP A;  1PK0 D;  1Y1X A;  1KSO A;  1DT7 B;  3I5H B;  4GNK B;  1TN4 A;  3BYA A;  1XFU O;  1CM4 A;  3SG5 A;  1JWD A;  1SPY A;  2I7A A;  3OB1 B;  2MBX A;  4YRU A;  1LIN A;  4C0L A;  2JC2 A;  2LVJ A;  1NWD A;  2BCX A;  3LK1 A;  4P2Y B;  1S6C A;  1MF8 B;  2LLU A;  1DF0 A;  1A03 A;  2BBM A;  1A29 A;  3SIA A;  2JXL A;  4MZL A;  4CPV A;  4NDC A;  4CLN A;  1EG4 A;  5IBW A;  3RM1 A;  1QV0 A;  5AFP A;  2LLS A;  1ALV A;  4AQI A;  2JRF A;  2KYC A;  1CFC A;  1NUB A;  2LMV A;  3CGA A;  1CDP A;  1J7R A;  3BOW B;  2M97 A;  1LVC D;  1ZUZ A;  5AAN A;  1UP5 A;  1D1O A;  2I94 A;  1Y1A A;  4F0Z B;  2I2R E;  1QJT A;  1MXE A;  1DJY A;  3EVR A;  1DVI A;  2B1U A;  3CR4 X;  2MA2 A;  4I5N B;  3KO0 A;  1KK8 B;  5I2L A;  1KWO C;  1ZMZ A;  1M39 A;  1QIW A;  2M29 A;  4OVN F;  1OFC X;  3VRR A;  1RK9 A;  2F8P A;  1WDC C;  5J3X A;  3BUX B;  3CR5 X;  4AOM A;  2ZFD A;  2KI6 C;  4ORB B;  1DMO A;  4GGN A;  2L4I A;  1R6P A;  1XVJ A;  2KYF A;  2LC5 A;  4I5K A;  1K94 A;  4OCI A;  2LHI A;  4E68 A;  3TDZ A;  1L2O B;  1S36 A;  1SW8 A;  5G08 A;  1KQM B;  2BE4 A;  4CFR A;  1XK4 C;  1KCY A;  5AXI A;  4U8D A;  2MRD A;  1B7T Z;  1HQV A;  2JWW A;  2O60 A;  1SCM C;  2LP3 A;  3PFV A;  1CFD A;  1KFU L;  3FIA A;  1XFX O;  3VRQ A;  3PN7 B;  1Q80 A;  1IWQ A;  2KQY A;  2A4J A;  4CID A;  2LLT A;  3I5F C;  3PAL A;  3JTD C;  1KK7 Y;  3I5I C;  1DGU A;  2Y4Q A;  1AVS A;  1FI6 A;  1TNP A;  3BUN B;  1PVB A;  2L4H A;  1YUT A;  1OQP A;  1XFZ O;  3BOW A;  3JVT C;  1J1E A;  4GAO A;  2WC8 A;  2MLF C;  1RWY A;  4YGE B;  3IQQ A;  3WXA A;  2H61 A;  4FTG A;  4XYN A;  1S6I A;  1B8R A;  3KEV A;  1MUX A;  2PVB A;  2L98 A;  2RGI A;  2KFH A;  2PAS A;  2Q91 A;  2D8N A;  4ZCU A;  1SL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...