4JQ0D

Voltage-gated sodium channel 1.5 c-terminal domain in complex with fgf12b and ca2+/calmodulin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
LSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Fibroblast growth factor 12
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jq0D01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jq0D02
1BOCA 1H8BA 1FW4A 2MA2A 1UWOA 3TDUA 2LVVA 2BL0C 1UHKA 2JXLA 3O78A 1DVIA 1SR6B 1AUIB 1JF0A 2E6WA 2K61A 1F71A 2HF5A 2LMTA 1Y1AA 4F0ZB 1QASA 2WORA 2WCFA 1ZFSA 2M0RA 1FBVA 3TDZA 3ICBA 1LINA 1WY9A 2GV5A 1RK9A 1GQMA 4I5LB 4JWQA 3PN7B 1M31A 1CNPA 1XA5A 5I2LA 1JWDA 4HRHA 1SK6D 4GGFA 2CXJA 1DF0A 3I5GC 3LK1A 1F8HA 1SCMB 1QX7A 2WOSA 4BY4A 2LM5A 4MSPA 2FJUB 4XJKA 2SCPA 3EK4A 1PULA 3ZNIA 2KNEA 2LVKA 1BT6A 1UHNA 2LE9B 2WCEA 1KQVA 3TZ1A 4XJKB 1JUOA 3SIAA 1MR8A 2LUCA 1NPQA 3FWBA 1YVLA 1CFCA 2KYFA 1C7WA 3CZTX 2LLUA 1HT9A 3KF9A 1BG1A 1CFPA 2I18A 1IGVA 2I94A 1B47A 1UHJA 1XFZO 2G2BA 1UURA 3DVEA 2ZRSA 4D1EA 1YUUA 1MHOA 3I5FB 2JRFA 2L2EA 5ER5A 1KFUL 3WXAA 3E3RA 2BCBA 2WC8A 2JT3A 3VGOA 1DTLA 2FCDA 2KGBC 1SL9A 1XFXO 4QJ4B 1NCYA 1S5GZ 4MRXA 2PVBA 2BCXA 4N5XA 2BECA 1EJ3A 1TTXA 2F33A 3DVJA 4WQ2A 1BLQA 1CLBA 1AP4A 4I5KA 3PATA 2FCEA 3BXKA 1MXEA 2KI6D 1K93D 1C7VA 5HKYA 1CM4A 3QRXA 2MRDA 1KWOC 4IL1A 2MBXA 1QX2A 1NUBA 1QVIY 4PHNA 1J7RA 4YGAA 2KSPA 1DGUA 2LCPA 3AAKA 1QJTA 2BBNA 1YURA 2ZN8A 2PRUA 2LLTA 1DJXA 1YX8A 1DJHA 2M29A 4ORCB 4GPLB 5CSJA 1J7QA 1NX0A 1RTP1 3VRPA 1QXPA 3O2PA 5AEQA 1B7TY 1IH0A 4PHMA 3WHUB 5JJGA 3VRNA 2OS8C 4OKHA 4CLNA 1GGZA 1YUSA 1OFCX 2IS9A 2BCAA 3GK2A 4FQOA 3SG3A 1S36A 1CDLA 1M46A 1AJ5A 1XO5A 2WCBA 4JQ0D 1F54A 1CDPA 2Y4QA 1KK7Y 1L7ZA 2JNFA 1MF8B 3JVTC 3WHTB 1NSHA 2JXCA 2NXQA 4CIDA 2JULA 3BYAA 2MJWB 2KFGA 2JT8A 1SPYA 2LUXA 1TNPA 1M39A 3HX4A 3SG6A 3TUYC 1BMOA 1QS7A 2OTGB 4YGEB 2KAVA 2MHHA 2JTTA 2M3WA 3KHEA 1J1EA 1RECA 4P5OE 3EKHA 1ZACA 5BPJA 1PK0D 1EG4A 1CTRA 3EK7A 3LK0A 4HSZA 3RLZA 1SL7A 4OR9B 1CMFA 2AAOA 2V53A 1K2HA 3DVMA 3PN7C 2KYCA 3CR2A 3BUXB 4YRUA 1M63B 2F2PA 3KO0A 1X02A 2EC6B 2SASA 1PRWA 1K9PA 1SW8A 3K21A 1SCMC 3A8RA 2ZN9A 2JTZA 4GGNA 4GGFC 2JNXA 4PHKA 2Y9ZA 1CLMA 2K0JA 2F8PA 2LMUA 4ORBB 5ER4X 1WDCB 4I5JA 1FI5A 1L2OB 5HKZA 1DJIA 4DRWA 3DVKA 2KI4B 5PALA 2GGMA 1B7TZ 1HQVA 3CGAA 1J7PA 1G8IA 3WNXB 3EK8A 3BQ3A 3PM8A 1SCVA 2H61A 2PMYA 4E68A 1DT7B 1CDMA 1DMOA 2H2KA 4UPGA 1S1EA 4MEWA 4MZLA 1F70A 3DF0A 4MVFA 4U8DA 1KK7Z 4NDBA 1BU3A 4CPVA 5KSZA 3SG2A 3I5FC 2F2OA 1KK8B 1MWNA 2LVIA 1BR4B 3DF0B 5CSIA 1S6JA 2NLNA 4WRIA 4C0JA 1QV1A 1DJGA 2Y1NA 4TNCA 1OMRA 1PVBA 1S3PA 1Y1UA 2ISDA 2Y9YA 1G33A 1IJ6A 1VRKA 3PSRA 1LA0A 3NSIA 5CSFA 2M1UA 2G9BA 2LANA 1N65A 1WLZA 1ALWA 1TNWA 3IQQA 4YGBB 1NX2A 5AANA 1PSRA 4ETOA 1MUXA 1S6IA 2DOQA 3LL8B 1LXFC 4MZKA 3PLFB 2K2AA 4XYNA 4MRYA 1BJFA 1JBAA 5I2OA 1IJ5A 5CPVA 1KCYA 1F4OA 1QX5B 1YUTA 4WQ3A 3PFVA 2JU0A 3TS5C 1OQPA 4PHJA 3CR4X 3SG7A 3I5GB 2HETA 1K96A 2R2IA 1CB1A 1F4QA 2OPOA 1DJZA 1QIWA 1WRZA 2D8NA 2VRGA 3KPXA 1XFWO 2Q4UA 3I5HB 5KU1A 3NSKA 1UHHA 1YR5A 2K7DA 2NCPA 1XFUO 1JFKA 4R1EA 2KI6C 1GGWA 1QLSA 2LP2A 1R6PA 2CCMA 2JQ6A 1EL4A 4DCKA 1A75A 2KBMA 1BR1B 3CWGA 4C0KA 2ZKMX 2FOTA 3BUMB 3D10A 2BE4A 1H4BA 1A75B 3CS1A 3TDIA 2ZFDA 3JTDB 1SBJA 1FI6A 1OOJA 3DD4A 2LNKA 3OB2B 2MAZA 4YBHB 2LVJA 3GK4X 2M8UA 3I5IB 4ZCVA 1J55A 1K95A 3GK1A 2M49B 3EVRA 4N1GA 5GQQC 1IQ5A 2ZRTA 2QPTA 2CTNA 2GGZA 5G08A 5HKWA 1BODA 2LC5A 4ICBA 1F55A 1K8UA 2L51A 2EHBA 1OSAA 1AVSA 1UUSA 1B9AA 2I7AA 3IF7A 2JZIA 1YTZC 3SJSA 1MQ1A 1KWOB 1IQ3A 1TNQA 1B8LA 1CFDA 1SR6C 4PE7A 1FF1A 2JT0A 2QACA 1KQMB 1V1GA 1TOPA 1WDCC 2BE6A 2F3YA 2KGRA 1A2XA 1JFJA 1L2OC 4NDCA 4I5NB 4ZCUA 5TNCA 1C07A 1KFUS 3VRRA 2KI4C 4P2YB 4AQJA 3AKAA 2LHIA 1DGVA 1IKUA 1QLKA 1QVIZ 1DJWA 2L5XB 3CR5X 1YVHA 3PALA 4A4CA 2M9GA 1J1DA 1B4CA 2NZ0A 2H61C 4YI8A 2LP3A 1A4PA 2K8MB 1K94A 1WRKA 5HLVA 1KK8C 1WLMA 1DJYA 2JWWA 3EKJA 4OV2A 1ZMZA 3OB1B 1SMGA 2JOJA 3AAJA 2RGIA 2K7CA 2HQWA 1RROA 2AMIA 5AFPA 2BKHB 1U5IA 3O4YA 1CMGA 4NQGA 1XFYO 4C0LA 1NWDA 5D69A 2EGDA 4PDZA 5HYDA 1EH2A 4AOMA 2KAYA 1KFXL 4GAOA 1SRAA 1U5IB 1TCFA 1XK4A 3TUYB 1CKKA 3LCPC 1PALA 2BBMA 4CFRA 1SL8A 1S5GY 3BOWA 2KFFA 4N1FA 4ORAB 4GBAA 4QJ3B 1OE9B 1OMDA 4FTGA 2K2FA 3BOWB 2CNPA 2KQ6A 1Y6WA 4USLA 4DUQA 3O6BA 3CLNA 2I2RE 1TNXA 1KSMA 1EG3A 1M45A 4AQIA 5I2QA 1K9KA 4YGCB 2BL0B 1XFVO 3AKBA 2CT9A 4L9MA 3SIBA 1QIVA 5HLOA 4DS7A 5I8NA 4GUKA 4MLWA 4OVNF 1ALVA 1DF0B 3FS7A 3LLEA 1NX1A 3C1VA 3I5HC 2PASA 2L50A 1N2DA 5JOLA 2Y5IA 3A4UB 1UP5A 5AERA 3F45A 1CFFA 2KQYA 1IWQA 2JC2A 1S6CA 1GJYA 1J7OA 1IG5A 1W7JB 2HQ8A 5D7FA 2MLEC 3ZWHA 2K7BA 2LV7A 2O60A 2AUCA 4HRGA 3BUNB 2HPSA 1ODBA 2O5GA 4CFQA 1NP8A 1Q80A 1W7IB 1K9UA 3SG5A 3JTDC 2L4HA 1JSAA 3BUOB 1V1FA 1ZUZA 1RWYA 2PSRA 2M97A 3I5IC 2B1UA 1CDNA 1EXRA 2L4IA 1K90D 5J3XA 1SYMA 2M1KB 4MN0A 2L0PA 3RM1A 2LMVA 3FIAA 1NYAA 5KTYA 1XVJA 5DKRA 1TCOB 1YRUB 5DKNA 1FPWA 1BF5A 2COLB 4M2PA 4HREE 1D1OA 1JC2A 2TN4A 4MBEA 1AHRA 1NIWA 2OTGC 3D0YA 1B8RA 1KFXS 1B1GA 1OZSA 4A4BA 4DIRA 1KSOA 3BUWB 3OP0A 1NCXA 2KAXA 3IQOA 3VROA 4M2QA 1KQMC 1B8CA 4PCWA 3D0YB 2ZNEA 2NCOA 5AXIA 3OX6A 3NSOA 2PALA 2KDHA 3TS5B 1A29A 1YRTB 1QATA 3H4SE 1IRJA 2K7OA 3EVVA 4Q04A 2KOTA 2Q91A 3OX5A 2MLFC 4QJ5B 2EC6C 4YI9A 2Y1MA 1S26D 2CBLA 1TRFA 1ZOTB 4GNKB 1WRLA 1QV0A 2KBIA 3KEVA 3FWCA 5DKQA 4BY5A 1LVCD 1QTXA 1NX3A 1JF2A 1R2UA 4PE4A 3MSEB 1N0YA 2E30A 1PSBA 2F3ZA 1TN4A 2P6BB 5FYXA 1E8AA 1RFJA 3SG4A 3M0WA 2A4JA 1SKTA 2ZNDA 1OMVA 1G4YR 2LHLA 1LKJA 5B8IB 5CSNA 4PE1A 1Y1XA 1AJ4A 1Y0VH 3HCMA 1RJVA 3EVUA 3NXAA 1A03A 3CTNA 1MXLC 2JPTA 3VRQA 2KFHA 3NSLA 1LA3A 3OHMB 4GFTA 2L98A 1OZOA 5IBWA 4MZJA 2WNDA 1CM1A 1NCZA 2LAPA 2OS8B 1TIZA 3GOFA 4JPZB 4YGDB 1XK4C 1XYDA 1UHIA 1AK8A 1PVAA 1SNLA 2KHNA 5K89A 2BKIB 5F6TA 1YX7A 4M2OA 1SY9A 2M7LA 4PE0A 4NDDA 4OCIA 4PALA 2M7NA 3JVTB 1CLLA 2LLSA
chains in the Genus database with same CATH superfamily
5EFWB 1Z2CB 1UWOA 1LGHB 1UHKA 2H89C 3NHIA 1A02F 5AW0B 1EZVI 3II6A 2E6WA 3HE5B 4F0ZB 1YITP 1QASA 1CI6B 1ZFSA 1AVYA 3WMM0 1NTZG 2M5AA 1FBVA 2AEFA 3ICBA 1ZRTE 3PN7B 1M31A 1L0NE 1JWDA 1KFMA 5FI7A 1L0LJ 1HJBA 3LK1A 3RK3C 3CC4P 5AVSB 1EDIA 4MSPA 1KYOE 3W67A 2SCPA 3CC7P 2WCEA 1KQVA 1UHNA 1N7SC 3H1HJ 5KLVK 1MFTA 3TZ1A 4XJKB 1L0LK 5TISE 3V2LA 1OVRA 2LUCA 2K60A 2JEEA 2L5YA 1PFIA 5BU5A 1DD3A 1NH4A 1HT9A 3KF9A 3KHUA 1W2EA 4XA4A 3ITKA 1T2KD 2I18A 1UHJA 3PLNA 1OOIX 2ZRSA 1LT1A 1ZP0C 3BCCJ 1MHOA 1OWAA 2K9JA 2L2EA 2WC8A 3NGVA 1DTLA 2FCDA 1SL9A 3A3YB 2BCXA 1EJ3A 3TGUD 3DVJA 1BLQA 1GM0A 1KILC 3PRJA 1LJ2A 2WTYA 5KLVG 1L0LG 4PD4I 3QRXA 5CCGC 2MBXA 1QX2A 1NUBA 1MV8A 1J7RA 4BRYA 2ZXXA 3AEBC 2ZN8A 2Q7CA 3L75E 1NTKK 3H1HG 2QJYC 3D6YA 1SSEB 1KV4A 1AFOA 2IX7C 3KYQA 4IFMA 1SVFA 3O2PA 1B7TY 4PHMA 3WUVA 2BNXA 4LLHA 2W90A 4OKHA 3A5TA 1GGZA 1YUSA 4NPDA 3CI9A 2O1JA 3OJAB 3HRNA 5APTA 2KPHA 1S1CX 2BCAA 1J1DC 3BCCG 4NPEA 1K05A 1S36A 1OW4A 3NXSA 2Y4QA 1PGQA 3L74D 1IO4A 1NSHA 2JXCA 2JR8A 5AVTB 2KFGA 2O01H 2PYQA 1FZBA 5DICA 3G71P 1TNPA 1SLQA 5AVUB 3PM2A 2YXRB 2FKWB 2KAVA 3KHEA 3ZDMA 1HVVA 1OOGA 1JUNA 1USEA 1ZACA 1PK0D 1AVOA 1EG4A 1Z4HA 3LK0A 4HSZA 1CMFA 1SQQE 2V53A 3Q5RA 1QWVA 3DVMA 2P70A 2XU6A 5AW8B 2KYCA 3CMAP 2F2PA 3KO0A 1JOCA 1SQPK 2ZFCA 1FOSF 4GGFC 2LMUA 4ORBB 3B87A 4I5JA 1FI5A 1L2OB 1CZQA 2HFED 3H1JD 4DRWA 2M3EA 3RBXA 4PJ0H 2OYOA 3L35A 3CGAA 1G8IA 3EK8A 3PM8A 1SCVA 2PMYA 4BWNA 1DT7B 1CDMA 2H2KA 1S1EA 4MEWA 1HGZA 5CBOA 4U8DA 1KK7Z 4NDBA 4CPVA 1MWNA 3V2PA 2P10A 4WVZA 1BR4B 3DF0B 1BE3G 2E5YA 5APUA 1S6JA 2IYOA 4C0JA 1S9KD 2Y1NA 2NPSD 1GL2C 1PVBA 1Q82Q 1S3PA 2B9BA 1SQPG 2Y9YA 3TSIA 1SQXE 5GTIH 3C8VA 4AQRD 2A45H 2WSEH 1T3UA 2K3RA 1TNWA 2YMYA 4YGBB 1PSRA 1MUXA 3B7AA 2N9BA 2K2AA 1URQC 2AXTH 3OAKA 2YKPA 1KCYA 1YUTA 3UO9A 4JYCA 1IFIA 5KLIC 1OQPA 4PHJA 2HYNA 2OGUA 5AVRB 2HETA 2R2IA 1CB1A 3L73E 1F4QA 2E75B 1QIWA 3FWLA 3KPXA 3I5HB 3IF4A 4ASVA 1PIXA 2NCPA 1JFKA 4R1EA 3H1IE 1PP9J 2ZAEB 4H44C 2JQ6A 1LWUC 1EL4A 4DCKA 3L4FA 1A75A 4C0KA 3VYIA 2FOTA 4GDOA 2IFMA 2XZRA 3TDIA 3B86A 2W27A 3OB2B 4YBHB 4I7ZC 4JF7A 3S0EA 1SQVE 2E43A 2YIUB 4ZCVA 2FFDA 1TUZA 4TLFA 3NHTA 3Q8IA 5GQQC 1OOHA 3AE1C 1VQ6P 4N78D 1NTME 2QPTA 2GGZA 1BODA 2WSFJ 1K8UA 4Y99C 2EHBA 3VMZA 1DELA 5CCHD 3IF7A 2JZIA 2HR3A 2Z5IA 3HE4A 1CFDA 1L0NK 3Q2YA 2OTKE 3GMAA 1FF1A 2QACA 4H13C 1LP1B 1SFCB 2KGRA 1LTAC 4ZCUA 1C07A 2WPRA 1KZUB 1PP9G 3PTZA 1DGVA 1FZAA 2NRGA 1NTZD 2OQQA 2FY8A 1JTHA 1OVVA 2M9GA 1BGYE 3S0DA 2H61C 4GODA 1HTLC 1WRKA 1KK8C 1DJYA 3VB1A 3P8CD 1SMGA 3KZIH 2JOJA 3NTNA 1M7LA 2K9YA 2P2UA 5AFPA 5B5EE 1NHLA 2FBWC 3B5NB 1KFXL 3RL0g 4N3YB 1XK4A 2Q3EA 1SL8A 3EFGA 2KFFA 4N1FA 1JY2O 2KZJA 1OMDA 3BOWB 1L2PA 3RK3D 1TNXA 3BFAA 5APXA 1M45A 2FXMA 1K9KA 3AE7C 4N6JA 4L9MA 2KSEA 1VQ7P 5HLOA 1OOFA 4GUKA 4MLWA 1QX8A 1ALVA 3LLEA 1PL5A 1NX1A 3C1VA 3M9QA 3TGUJ 3AE5C 5KLVD 1L0LD 1T2KC 3L71E 1S5LE 1Q7YQ 5D7FA 1DC1A 2KI7B 3BUNB 1ODBA 4H0LC 2O5GA 1N7SA 1W7IB 1K9UA 4U3FJ 3HUSB 3V6IA 4INXA 3VOPA 2B1UA 1CDNA 4U7JA 1SQBE 2L4IA 3O6QA 1W9ZA 3D78A 2M1KB 3RM1A 2LMVA 5CCGD 3SFDC 3HTKB 1IFDA 5H2FH 1XVJA 1VQ9P 1TCOB 1YRUB 2WPSA 2COLB 3DZTA 1D1OA 1LTJC 2TN4A 2L5GB 2OTGC 3L74J 3D0YA 3AEAC 1B8RA 1FDIA 4DIRA 1IK9A 3BUWB 2KUBA 3VROA 1KQMC 4PCWA 1YQ4C 3TGUG 1QL2A 1NTKD 3NSOA 2WT7A 3TS5B 4PD4E 3EVVA 2E74B 1EXJA 2FYUJ 4Q04A 3VMYA 2Q91A 3L4LA 3OX5A 2BEQD 5CCGA 4QJ5B 3VTPC 1T14A 1ZOTB 3FWCA 5DKQA 1S2EA 1IK7A 3P7KA 4PE4A 3MSEB 4U3FG 3USSA 3CXHH 2QE7H 2FYUK 2O01N 2F3ZA 1TN4A 2P6BB 1RF1B 3H1HE 2M0BA 3CMEP 3M0WA 4IFFA 1OMVA 3IN6A 2LHLA 4PE1A 4GOEA 1Y1XA 3HCMA 2W6AA 2OYHB 3H1JJ 3PP5A 3OA7A 1KILE 2KFHA 2KIKA 1AJYA 4GFTA 3M0AA 1JMMA 1OZOA 2YKOA 3CXHD 1NCZA 3K1EA 1RE4C 3A7OA 2BCCE 3BCCE 4OGQB 1PVAA 5K89A 2KLDA 5AW4B 1YX7A 2IBZG 3H32A 3RL0C 3GF3A 1BE3D 1BOCA 1S72P 4YXWH 2BL0C 1SQPD 2PP6A 1AQTA 2FYUG 5AVZB 2HF5A 1NKNA 1Y1AA 2WORA 2QSIA 1DD4A 5B66H 1WY9A 1GQMA 4I5LB 1P84D 1USDA 2P71A 1CNPA 4GGFA 3I5GC 1JCDA 1R5LA 4CPGA 1KB9D 2NPSC 5AW3B 1SCMB 1BCCE 1QX7A 3AECC 3Q3DA 4BY4A 3TNUB 2WPVB 2LM5A 3H1JG 2FJUB 3CABA 1PPJE 1DIPA 1HJ0A 3AEGC 2YO2A 2KNEA 1JUOA 3AEFC 3CWBG 4W7ZA 4B86A 1VF5B 1NU1E 2KSJA 1RH5B 1N73C 3CZTX 3FGAD 4WB4A 2WZ7A 2KYVA 3GF7A 1Q81Q 1CFPA 3L72G 2W6JH 1XFZO 3DVEA 1UURA 4O9BA 3MUDA 3I5FB 1GL2A 2JRFA 2WCMA 3N7NA 2I1KA 4BXLA 2AXCA 3CLQA 3JSVC 4QJ4B 3AEEC 1S5GZ 4N5XA 1RHZB 3CX5E 2CK3H 2F33A 2ZT9B 2HPCB 3E1RA 3PATA 2FCEA 3BXKA 5HKYA 3NMDA 1URQA 2MRDA 1KWOC 4IL1A 4YGAA 2HODB 3CCMP 3AAKA 3CZ1A 3H1LE 3RK2D 2M29A 1RY3A 1S3JA 2A45I 3SSUA 2OYIB 4JBZA 3L47A 5B66E 3VRPA 1S5LX 2KNCA 1OW8A 1QXPA 2LKMA 1IH0A 5JJGA 2M3BA 3VRNA 3P8MC 1GDTA 1OFCX 1LWUA 1NTZJ 2RKLA 2IPPA 2CPBA 3SG3A 4GT1A 1CDLA 3FXDA 1YJ9P 1XO5A 2WCBA 5CCHC 2V7QJ 2WSFH 1L7ZA 1MF8B 1M1JC 2FFDB 2HLOA 4HYTB 4I2LC 2QEVA 1HUCA 5HL1A 4C7NA 3E7KA 1J2JB 2LUXA 3SG6A 3TUYC 1EC5A 1BMOA 1L4AB 1QS7A 4YGEB 1L0ND 3HD7B 1H0TA 2JTTA 2M3WA 2PRRA 2OTJP 2C0XA 2D2CB 1J1EA 1RECA 4P5OE 3EKHA 2JWAA 3BASA 1ZR2A 3TF5A 1KYOD 1FS0E 1IFJA 1YHQP 2R32A 3CCJP 1K2HA 3PN7C 5APVA 3BUXB 4YRUA 1M63B 3A2AA 4YPCA 5FI6A 5I94A 2SASA 1TU3F 2ZN9A 2JTZA 5GTHH 1FJKA 4GGNA 1VQOP 2Y9ZA 1EDJA 2F8PA 3U59A 1WDCB 2G8YA 1IIOA 2KI4B 2A06D 1PP9E 1GU5A 3BQ3A 5KLVJ 3SS3A 2H61A 1RF0C 1DMOA 1DQEA 4ZNCA 4UPGA 2QEXP 4MVFA 3SG2A 1N86A 2JWDA 2QEOA 4WRIA 1DJGA 4TNCA 1OMRA 2R5DA 1KQGB 1IJ6A 1LA0A 3NSIA 3EQ2A 2M1UA 2LANA 1WLZA 1ALWA 1LT9B 3CCQP 3IQQA 1Q2NA 4AYCA 4YXDC 3LL8B 4XYNA 3PLFB 4MRYA 3LIDA 1BJFA 3I5CA 5I2OA 1Y8AA 4H0LD 1GZLA 1F4OA 3L36A 4WQ3A 4XE5B 4KYNA 1ZMEC 2E76D 3CCLP 2YNYA 1NTKJ 1GW3A 4IL6E 1WRZA 2LR2A 1XFWO 2XNXA 1YR5A 1Y9BA 1N7SB 2K7DA 3SFEC 5AVXB 2KI6C 1R6PA 4OZDA 4U3FD 1BR1B 1DEBA 3Q5SA 1VQNP 3I56P 3PJIA 3DD4A 2M8UA 3I5IB 3N7HA 1J55A 1SP4A 2KLVA 3GK1A 3M91A 2M49B 1VQMP 1U7JA 5EL2A 1LTJA 5HKWA 3FX0A 1KILB 1F55A 2IBZD 1OSAA 1JEKA 4K3AA 4FQTA 5E79H 3LIEA 1MQ1A 2N1TB 1NTKG 1BE3J 1SR6C 2PGDA 3Q5PA 2FYUD 3TGUE 1V1GA 1TOPA 1SQPJ 2BE6A 5BVZA 1JFJA 1L2OC 5TNCA 4I5NB 4P2YB 2QJYB 3AKAA 2KZIA 1XTGB 5K5GB 3TDKA 1QVIZ 2L5XB 4A4CA 3PALA 1DH3A 3FWNA 2FXOA 2RN0A 2NZ0A 4WY4B 3RL0D 5AW7B 2K8MB 1J1DB 4OV2A 3OB1B 2FXPA 1KORA 1RROA 2BKHB 3L70J 1U5IA 3O4YA 4NQGA 1XFYO 4C0LA 1JY2N 1OIPA 1RE4A 4AOMA 3CWBD 4GAOA 3SWKA 4DT0A 1S5GY 2OARA 5CHXA 3L74E 4FTGA 3L72D 1JMBA 4PV1B 1GW4A 1UIXA 2CNPA 2KQ6A 2C9LY 3MUDC 1Y6WA 4USLA 1X9VA 2I2RE 2Q1KA 2L2CA 1EG3A 1K73Q 3H1ID 1XFVO 3IR9A 1G2CA 5I8NA 4RO0A 3CX5I 4OVNF 1CSBA 3I5HC 2WITA 2PASA 2E5TA 2K1AA 1OZHA 1VDFA 2Y5IA 1MUUA 3F45A 2B87A 2KQYA 2NPSA 1VQLP 1GK4A 1GJYA 1U57A 1W7JB 3QMEA 2IZ1A 2MLEC 3L70G 3D6ZA 2K7BA 4HRGA 4W7YA 3L4AA 3SWFA 3R2PA 4RJTA 3H1JE 3B71A 1NP8A 3SG5A 1V1FA 1P28A 1RWYA 2PSRA 2YIUC 1N73A 1GL2B 2R3SA 1K90D 1SYMA 4MN0A 2L0PA 5M1BA 4OWFA 4MN4C 2ZYGA 4PJ0E 1NGMB 1S9KE 3RK2C 1B1GA 1OZSA 4A4BA 1KSOA 1C3ZA 1URQB 1SFCC 2ZNEA 2NCOA 2RH0A 1DEKA 1J1EC 1L0NJ 2GUSA 2KDHA 1A29A 1M8OB 5CMZA 5L8RJ 4ZKUA 2EC6C 1U7MA 2Y1MA 4GKGA 1TRFA 2QA4P 4JKTA 2KBIA 1QV0A 5GTIE 1HBWA 4WWIA 2V7QH 4BY5A 1QTXA 4IL6X 3AE2C 3I55P 1X8YA 2E30A 2NZ2A 1QVFO 2JO1A 1DX7A 2IZ0A 5FYXA 2KK7A 2AXTE 5APYA 1RJVA 1MFZA 2ZVNB 3GLMA 5CCHA 3UIAA 1CM1A 2OS8B 1EZVD 4I7ZB 4JPZB 3T97B 2POHA 3AE6C 1AK8A 1M1JA 1FZCC 1SNLA 1UIIA 1H0TB 2BKIB 5F6TA 2W6BA 1SY9A 4PALA 2PQLA 3JVTB 1KN7A 1H8BA 1FW4A 1G1IA 1L0NG 4Y28J 2LVVA 3R1PA 2QJPC 4JD9A 3HE5A 3D76A 2QIWA 1GU4A 1AUIB 1JF0A 4N78E 3R72A 1LTGC 1NVOA 2WCFA 3TDZA 1N8RQ 1LINA 3CZ2A 1RQUA 4JWQA 1IC2A 3VP9A 2H88C 4HRHA 2M5AB 1SK6D 1BSNA 2WOSA 5APQA 4XJKA 3EK4A 3HUSC 2A06G 1PULA 2WSSH 1BT6A 1NTZE 4A7PA 1OW6A 1GMJA 3SIAA 1NPQA 2ZYDA 1RF0A 1YVLA 1CFCA 2JKVA 5FI2A 2WCHA 1C7WA 1QVGO 3U1AA 2LLUA 1PZQA 3NFQA 3P8CE 2P58A 4D6TD 1IGVA 3M9BA 1B47A 2HG5D 5AW2B 4PD4D 4D1EA 1CW5A 3VN0A 2H7HA 1NWQA 1KFUL 2E76C 3E3RA 2BCBA 4C46A 2K9JB 3U1CA 1SQQJ 2JT3A 2SPZA 3TK1A 3F5HA 1NCYA 4MRXA 2BECA 1TTXA 3BFBA 3KZIE 2GTEA 2H43A 1BSHA 1MXEA 2KI6D 1C7VA 1YBKA 3RK3E 1CM4A 1ZOYC 1SQQK 1KD1Q 4DOJA 1QVIY 4PHNA 5KAIH 4R4LA 2KSPA 1DGUA 2LCPA 1AV1A 1RF1C 2PRUA 2LLTA 4BRYB 2N1TD 4GPLB 2OYHC 1R8EA 5KLVE 3CPWO 1L0LE 5KKZC 1CLLA 3WHUB 1OX3A 3S1KA 3WU2H 1Q86Q 4OGQC 3MHVA 4FQOA 1F54A 1AJ5A 4JQ0D 1KK7Y 1SQXJ 2FYNB 3WHTB 1SQQG 2NXQA 4CIDA 3BYAA 2IDBA 3FE6A 3JCUH 3HX4A 2OTGB 3G3ZA 1SQXK 2MKVA 1X0TA 2WCKA 3MIWA 5BPJA 3CWBJ 4PT1A 3RLZA 1YTZI 1SL7A 2GUVA 3S0AA 5AW1B 2P67A 3QH9A 4DZOA 3CR2A 1OVUA 1P84H 3R1VA 2DW3A 2N9YB 3L72J 1VPCA 1PRWA 1K9PA 1SCMC 2JP3A 1VQ8P 1NTKE 1KB9H 2JJLA 3GHGC 4PHKA 5H2FE 2K0JA 5ER4X 1NAYA 3CD6P 1H88A 3H1IJ 1Q90D 3AEDC 3V2RA 5HKZA 1DJIA 2C9NY 3H1KD 2LLSA 4EYYQ 1JY3N 5PALA 1NOHA 3H6PA 1B7TZ 1HQVA 1J7PA 5KAIE 1SQXG 1M57D 4M3LA 5AW6B 2YXQB 4MZLA 1F70A 3DF0A 3P32A 2QM7A 5KSZA 2PAJA 3L70D 3I5FC 3PHLA 2NLNA 2QVAA 3PH0A 1Y1UA 2E75D 2ISDA 1VL2A 1M56D 3WU2E 4UB8H 4L76A 3CXHE 2WSCJ 4ASWA 2ZT9C 1SQVK 3VMAA 3H1LD 5CSFA 1M1KQ 2Y0EA 2G9BA 3D71A 2VRSA 1NTMK 5AANA 1FJPA 1S6IA 2DOQA 1BE3E 1LXFC 3JCUE 3KDPB 1JBAA 1KMIZ 2KLUA 3H1IG 1SQPE 1IJ5A 5CPVA 1QX5B 4HJGH 3AE3C 3PFVA 3SG7A 3I5GB 3L37A 2B87B 1BGYJ 3PJSK 1K96A 1PGOA 1DJZA 3A0BH 4GOFA 2XDJA 1Z56A 1P84E 2UWJE 1A02J 1T8ZA 3CYZA 1UHHA 1JB0J 1XFUO 1ZXGA 3S0GA 2QJKC 1NYHA 1KB9E 2CCMA 1Y47A 4L74A 1JY2P 2QEHA 1N73B 2KBMA 1LTSC 1NTMG 3CCVP 1FBMA 2AEMA 3D10A 2BE4A 1A75B 1SFCD 4EI2A 1TWOA 2ZFDA 3JTDB 1L4AC 1SBJA 3HD7C 3OGNA 2D2CC 5CBNA 2LVJA 3GK4X 2OTLP 3N4XA 4WBAA 1K95A 3EVRA 4N1GA 3S9OA 5G08A 3RZSA 3SS4A 1KYOH 3E1IA 2L51A 2O1KA 2J58A 3V4QA 1UUSA 1ZRTD 3CCSP 1BDDA 3BFHA 3SJSA 1BGYG 3BATA 4UB8E 1KWOB 1IQ3A 1LP1A 1SFCA 2JT0A 3HE4B 1WDCC 1LS8A 2QM8A 3B5ND 4NDCA 1KFUS 2KI4C 3L71J 1TUJA 4AQJA 1X79B 2CPSA 2LHIA 1IKUA 1R5SA 2LXBA 1LTBC 2ZYAA 2IYPA 1DJWA 2XV5A 1B4CA 1EQ7A 4YI8A 2LXCB 1JTHB 3RBZA 5HLVA 2P1JA 1SQBJ 1ZMZA 1T6AA 2BASA 2L91A 1PGPA 2AMIA 3B5NA 4INWA 2R5BA 1RE3C 5D69A 4IFDK 1EZVG 3V5BA 1IJDB 1SQBK 1JY3O 3TUYB 3CCUP 1RQVA 1FZCA 3F89A 3BOWA 4ORAB 4F7FA 1LT9C 1WT6A 4KJMA 2K2FA 3DXLA 1OW7A 4W80A 4D6TJ 4DUQA 5KAFH 4AQIA 5I2QA 3L71G 1FC2C 3GW6A 2O3JA 3AKBA 2CT9A 3L75D 4NPFX 3SIBA 1QIVA 3M0DC 1JO5A 3FS7A 2I1JA 4OH8B 2L50A 2KS1A 3A4UB 4DJGA 3DY9A 1SQBG 5AERA 3MTUE 1CFFA 3MD0A 1JCCA 2JC2A 1S6CA 5C39A 1J7OA 3S4RA 4HKZH 1IG5A 2HQ8A 2Z4EA 1FU1A 3HUSA 3RK3B 2LV7A 2HPSA 1Q80A 1KC8Q 2BCCJ 2A06E 4UB6H 1JSAA 3BUOB 2E74D 3BJHA 3I5IC 5D3OA 3D73A 3HTKA 5GTHE 3CC2P 1K8AQ 1XTCC 4IOIH 1YYCA 4D6TG 2QG4A 1YIJP 5KTYA 3O6QB 2Q9IA 4L75A 5DKNA 1OMIA 1ZN5A 2WWWA 2B88A 4HREE 4RESB 5DJTB 1JC2A 1SQQD 4MBEA 1AHRA 1NIWA 3K5BA 2N1TC 1QGKB 3OP0A 2KAXA 3IQOA 1HWTC 4M2QA 3GG2A 1B8CA 2GA1A 3D0YB 1K04A 2PALA 3RGUA 1QATA 4OGQD 2I8DA 2MJZA 1BCCJ 2WT7B 3UNWA 2CBLA 3R1OA 2K88A 3V2QA 3KEVA 5KAFE 4WY4C 1RF1A 1LVCD 1NX3A 1JF2A 1R2UA 5KJ7C 2BCCG 3CCEP 1QLED 2JPOA 1RFJA 2OYHA 3SG4A 1NU1J 3W68A 2A4JA 1SKTA 2ZNDA 2YMKA 5B8IB 2PFXA 3EG5B 1AJ4A 1Y0VH 3EVUA 1KTMA 3NXAA 1A03A 3CTNA 1MXLC 2JPTA 3VRQA 3H1KJ 3OHMB 3NSLA 1LA3A 5AW9B 2L98A 2Y0CA 4MZJA 1SQXD 2BEZF 2WNDA 1NU1K 2LAPA 2ZVOB 2Q3IA 1S4XA 1TIZA 1KFNA 4U3FE 4YGDB 1UHIA 1LTTC 2KHNA 4PV1C 4R4MA 4M2OA 3FE8A 4NDDA 4OCIA 2M7NA 1NAFA 4UB6E 2MA2A 5AVQB 3VMXA 2QDIA 3TDUA 2WCJA 3M06A 1YJWP 2R3CA 1QEXA 3H32B 3IFMA 2JXLA 3O78A 1BCCG 3CXHI 3MZWB 1WMKA 1VQ4P 1DVIA 1SR6B 1VF5D 1PPJG 3B6XA 2K61A 1F71A 2LMTA 4LC1A 3L73D 5APSA 3H1LJ 2IBZE 2M0RA 3FE9A 2GV5A 1N2DC 1RK9A 1EDKA 1FDOA 2XKMA 1XA5A 5I2LA 1QL1A 1NU1G 3TNUA 5AVVB 3GHGA 2CXJA 1DF0A 4KT0J 2FYUE 1F8HA 2G3AA 2E75C 5AVYB 4HB1A 1E5WA 3H1KG 2KLEA 4Z1MH 3ZNIA 4EIJA 2LVKA 2ZT9D 3KXDA 2LE9B 5E79E 2WSCH 1MR8A 3FWBA 1P84I 4JYBA 3LW5J 2KYFA 1SQVD 1YJNP 1KB9I 1YI2P 1BG1A 1VQPP 2I94A 4RKUJ 2V4HA 4ZKPA 1NTMD 2G2BA 3B8EB 1YUUA 3CZ0A 1JNMA 1KQFB 5ER5A 3WXAA 3KPEA 1ZLLA 3CWBE 2HPCA 3VGOA 3H1LG 2KGBC 1XFXO 3DYEA 3A0HH 3D75A 2PVBA 2XNDH 1E79H 3JC22 1FAVA 4WQ2A 1CLBA 1GD2E 1AP4A 4I5KA 3L72E 4ZMDA 1K93D 1GTWA 2HODA 1WRGA 3OBVA 5B5EH 3S0FA 1IFNA 1AQ5A 1JY3P 1BGYD 1QJTA 2OYIA 3CCRP 2BBNA 1YURA 4AUWA 1DJXA 1YX8A 1L4AD 5KLIB 3HD7D 1DJHA 4ORCB 1HF9A 5CSJA 3IVTA 1J7QA 4EOTA 2D2CD 1NX0A 1RTP1 1MZ9A 1HGVA 1C3YA 2WCLA 5AEQA 2KNCB 2OS8C 4CLNA 2IS9A 1PGJA 2QEBA 3GK2A 1M46A 3MP7B 1CDPA 2Y0DA 4H44B 2JNFA 1LWUB 3JVTC 2JULA 1L4AA 1N7LA 2MJWB 1SS1A 2KP8A 3FXEA 2JT8A 3HD7A 4L73A 3B5NC 1SPYA 1M39A 3SWYA 2C0WA 3RK2B 2MHHA 4C7NB 2KOGA 1VQKP 1S5LH 4XFJA 3EFFK 1CTRA 3EK7A 1J1EB 4OR9B 1HH0A 2AAOA 2W83C 3QWOC 4Y99B 1X02A 2EC6B 3G9RA 1SW8A 3K21A 1PV3A 3A8RA 3A0HE 3L71D 2JNXA 1CI6A 1YQ3C 1YTZT 3V4WA 1CLMA 4I1LA 5TJHA 5CJ0A 4H13B 4QMAA 3L75J 3MGNA 3EWKA 1KYOI 3DVKA 2KXPB 2GGMA 2J59M 3WNXB 4E68A 2WC6A 2ZXEB 4YTPC 1SQBD 1ZV8A 1BU3A 1D7MA 3TYYA 2F2OA 1LTIC 1KK8B 2LVIA 4PD4H 5CSIA 1MKMA 1FZCB 1LNQA 1QV1A 1RE3A 2H8PD 1KQSO 1G33A 1VRKA 1FZEA 1EZVE 4LGDE 5DJUB 1LT9A 1N7SD 2GM4A 3PSRA 2QJPB 3V2NA 1N65A 1JM0A 4HH2A 4ETOA 1NX2A 1T3JA 1H8AA 4MZKA 1NO4A 1ZR4A 1BDCA 2KS1B 3L75G 2JU0A 3TS5C 3M0DA 1IFMA 3CR4X 2E74C 3H1HD 1XFRA 1FZFA 1OXZA 1AA0A 3B88A 2RMZA 2OPOA 2D8NA 2VRGA 1K9MQ 2Q4UA 3CL3D 5KU1A 2YGUA 3NSKA 3KQGA 1KILD 1EXIA 1GGWA 1QLSA 2LP2A 2BCCD 2FYNC 3O4XA 3BCCD 3CWGA 2ZKMX 5CJ4A 3BUMB 1FDMA 2JDIH 1H4BA 3CS1A 4H0LB 1FI6A 3M9HA 3OW2O 1OOJA 4EDFA 3Q1MA 2LNKA 2MAZA 2E76B 2YKQA 1KILA 3SS5A 3VP8A 4D6TE 1IQ5A 2ZRTA 4WY4D 2CTNA 3AE4C 3WUTA 1W2BO 2LC5A 5KJ7D 4ICBA 2N1TA 2H8VA 2KB7P 1LTJB 1AVSA 5BU8B 1B9AA 2I7AA 2B89A 1YTZC 2O01J 1TNQA 1B8LA 4PE7A 2Q6QA 4C7RA 1KQMB 2J5UA 1BCCD 2F3YA 1A2XA 3D77A 3VRRA 1PPJD 1QLKA 2IBZI 3L73J 4WY4A 3H25A 3CR5X 4PV1D 1YVHA 5KJ7A 1J1DA 5KKZB 1NU1D 1IZNB 1DEEG 3S0BA 2LP3A 1A4PA 1K94A 3CX5H 1WLMA 2JWWA 3L74G 3EKJA 2W8ZA 1FOSE 3D70A 3AAJA 2RGIA 2K7CA 2HQWA 1VF5C 3CDNA 1ZW0A 4IJ7A 1CMGA 2Q5UA 1NWDA 2EGDA 4PDZA 5HYDA 1EH2A 1FZGA 2KAYA 2WVRA 1SRAA 1U5IB 1TCFA 1CKKA 3LCPC 1PALA 2BBMA 4CFRA 3CX5D 3AE8C 1W5CE 2BAPA 4GBAA 1SQVJ 4QJ3B 1OE9B 4KHXA 2AEJA 5APWA 3O6BA 1NTMJ 3RL0B 3CLNA 2WMMA 1KSMA 1IFPA 3BRTB 4YGCB 2BL0B 4DS7A 3L73G 1GL2D 3GHGB 1DF0B 1G2CB 2WSEJ 1N2DA 3AE9C 3LW5H 5JOLA 2R44A 5AVWB 1UP5A 2ZJSE 1IWQA 2OYIC 1G1JA 3ABVC 3ZWHA 2YO3A 1URQD 4TT3H 2NPSB 2O60A 2AUCA 5KTBA 2K37A 4CFQA 3H1KE 3JTDC 3C9IA 1M90Q 2L4HA 1KQLA 1ZUZA 2M97A 1SQVG 3BRVB 2QRXA 1ORGA 1EXRA 5J3XA 3FIAA 1NYAA 2FFDC 3L70E 5DKRA 1FPWA 1BF5A 2Z5HA 4GIFA 4H44D 2ITAA 1KFXS 3C1LA 1FE6A 2IFNA 1NCXA 1X22A 2FYZA 1VQ5P 2A45G 2ERBA 2FJYA 5AXIA 2WC5A 3OX6A 1YRTB 3H4SE 3BVHA 1IRJA 2K7OA 1H89A 2KOTA 2MLFC 1NKZB 3B4SA 4YI9A 1GK6A 1PP9D 1S26D 2WQYC 4GNKB 1WRLA 2M8RA 5TISH 1EDLA 1N0YA 1PSBA 2WPQA 2P7JA 2QJKB 2E42A 1E8AA 3IAOA 1G4YR 1LKJA 5CSNA 3R4YA 1NTZK 4H13D 3T97A 5IBWA 5AW5B 1NJIQ 3GOFA 1XK4C 1XYDA 4K35A 3G4SP 3G6EP 4I6MC 3A0BE 3WUUA 2M7LA 4PE0A 4M2PA 3D74A 1M1JB 4IL6H 3O8ZA
chains in the Genus database with same CATH topology
1BOCA 1H8BA 1FW4A 2MA2A 1UWOA 3TDUA 2LVVA 2BL0C 1UHKA 2JXLA 3O78A 1DVIA 1SR6B 1AUIB 1JF0A 2E6WA 2K61A 1F71A 2HF5A 2LMTA 1Y1AA 4F0ZB 1QASA 2WORA 2WCFA 1ZFSA 2M0RA 1FBVA 3TDZA 3ICBA 1LINA 1WY9A 2GV5A 1RK9A 1GQMA 4I5LB 4JWQA 3PN7B 1M31A 1CNPA 1XA5A 5I2LA 1JWDA 4HRHA 1SK6D 4GGFA 2CXJA 1DF0A 3I5GC 3LK1A 1F8HA 1SCMB 1QX7A 2WOSA 4BY4A 2LM5A 4MSPA 2FJUB 4XJKA 2SCPA 3EK4A 1PULA 3ZNIA 2KNEA 2LVKA 1BT6A 1UHNA 2LE9B 2WCEA 1KQVA 3TZ1A 4XJKB 1JUOA 3SIAA 1MR8A 2LUCA 1NPQA 3FWBA 1YVLA 1CFCA 2KYFA 1C7WA 3CZTX 2LLUA 1HT9A 3KF9A 1BG1A 1CFPA 2I18A 1IGVA 2I94A 1B47A 1UHJA 1XFZO 2G2BA 1UURA 3DVEA 2ZRSA 4D1EA 1YUUA 1MHOA 3I5FB 2JRFA 2L2EA 5ER5A 1KFUL 3WXAA 3E3RA 2BCBA 2WC8A 2JT3A 3VGOA 1DTLA 2FCDA 2KGBC 1SL9A 1XFXO 4QJ4B 1NCYA 1S5GZ 4MRXA 2PVBA 2BCXA 4N5XA 2BECA 1EJ3A 1TTXA 2F33A 3DVJA 4WQ2A 1BLQA 1CLBA 1AP4A 4I5KA 3PATA 2FCEA 3BXKA 1MXEA 2KI6D 1K93D 1C7VA 5HKYA 1CM4A 3QRXA 2MRDA 1KWOC 4IL1A 2MBXA 1QX2A 1NUBA 1QVIY 4PHNA 1J7RA 4YGAA 2KSPA 1DGUA 2LCPA 3AAKA 1QJTA 2BBNA 1YURA 2ZN8A 2PRUA 2LLTA 1DJXA 1YX8A 1DJHA 2M29A 4ORCB 4GPLB 5CSJA 1J7QA 1NX0A 1RTP1 3VRPA 1QXPA 3O2PA 5AEQA 1B7TY 1IH0A 4PHMA 3WHUB 5JJGA 3VRNA 2OS8C 4OKHA 4CLNA 1GGZA 1YUSA 1OFCX 2IS9A 2BCAA 3GK2A 4FQOA 3SG3A 1S36A 1CDLA 1M46A 1AJ5A 1XO5A 2WCBA 4JQ0D 1F54A 1CDPA 2Y4QA 1KK7Y 1L7ZA 2JNFA 1MF8B 3JVTC 3WHTB 1NSHA 2JXCA 2NXQA 4CIDA 2JULA 3BYAA 2MJWB 2KFGA 2JT8A 1SPYA 2LUXA 1TNPA 1M39A 3HX4A 3SG6A 3TUYC 1BMOA 1QS7A 2OTGB 4YGEB 2KAVA 2MHHA 2JTTA 2M3WA 3KHEA 1J1EA 1RECA 4P5OE 3EKHA 1ZACA 5BPJA 1PK0D 1EG4A 1CTRA 3EK7A 3LK0A 4HSZA 3RLZA 1SL7A 4OR9B 1CMFA 2AAOA 2V53A 1K2HA 3DVMA 3PN7C 2KYCA 3CR2A 3BUXB 4YRUA 1M63B 2F2PA 3KO0A 1X02A 2EC6B 2SASA 1PRWA 1K9PA 1SW8A 3K21A 1SCMC 3A8RA 2ZN9A 2JTZA 4GGNA 4GGFC 2JNXA 4PHKA 2Y9ZA 1CLMA 2K0JA 2F8PA 2LMUA 4ORBB 5ER4X 1WDCB 4I5JA 1FI5A 1L2OB 5HKZA 1DJIA 4DRWA 3DVKA 2KI4B 5PALA 2GGMA 1B7TZ 1HQVA 3CGAA 1J7PA 1G8IA 3WNXB 3EK8A 3BQ3A 3PM8A 1SCVA 2H61A 2PMYA 4E68A 1DT7B 1CDMA 1DMOA 2H2KA 4UPGA 1S1EA 4MEWA 4MZLA 1F70A 3DF0A 4MVFA 4U8DA 1KK7Z 4NDBA 1BU3A 4CPVA 5KSZA 3SG2A 3I5FC 2F2OA 1KK8B 1MWNA 2LVIA 1BR4B 3DF0B 5CSIA 1S6JA 2NLNA 4WRIA 4C0JA 1QV1A 1DJGA 2Y1NA 4TNCA 1OMRA 1PVBA 1S3PA 1Y1UA 2ISDA 2Y9YA 1G33A 1IJ6A 1VRKA 3PSRA 1LA0A 3NSIA 5CSFA 2M1UA 2G9BA 2LANA 1N65A 1WLZA 1ALWA 1TNWA 3IQQA 4YGBB 1NX2A 5AANA 1PSRA 4ETOA 1MUXA 1S6IA 2DOQA 3LL8B 1LXFC 4MZKA 3PLFB 2K2AA 4XYNA 4MRYA 1BJFA 1JBAA 5I2OA 1IJ5A 5CPVA 1KCYA 1F4OA 1QX5B 1YUTA 4WQ3A 3PFVA 2JU0A 3TS5C 1OQPA 4PHJA 3CR4X 3SG7A 3I5GB 2HETA 1K96A 2R2IA 1CB1A 1F4QA 2OPOA 1DJZA 1QIWA 1WRZA 2D8NA 2VRGA 3KPXA 1XFWO 2Q4UA 3I5HB 5KU1A 3NSKA 1UHHA 1YR5A 2K7DA 2NCPA 1XFUO 1JFKA 4R1EA 2KI6C 1GGWA 1QLSA 2LP2A 1R6PA 2CCMA 2JQ6A 1EL4A 4DCKA 1A75A 2KBMA 1BR1B 3CWGA 4C0KA 2ZKMX 2FOTA 3BUMB 3D10A 2BE4A 1H4BA 1A75B 3CS1A 3TDIA 2ZFDA 3JTDB 1SBJA 1FI6A 1OOJA 3DD4A 2LNKA 3OB2B 2MAZA 4YBHB 2LVJA 3GK4X 2M8UA 3I5IB 4ZCVA 1J55A 1K95A 3GK1A 2M49B 3EVRA 4N1GA 5GQQC 1IQ5A 2ZRTA 2QPTA 2CTNA 2GGZA 5G08A 5HKWA 1BODA 2LC5A 4ICBA 1F55A 1K8UA 2L51A 2EHBA 1OSAA 1AVSA 1UUSA 1B9AA 2I7AA 3IF7A 2JZIA 1YTZC 3SJSA 1MQ1A 1KWOB 1IQ3A 1TNQA 1B8LA 1CFDA 1SR6C 4PE7A 1FF1A 2JT0A 2QACA 1KQMB 1V1GA 1TOPA 1WDCC 2BE6A 2F3YA 2KGRA 1A2XA 1JFJA 1L2OC 4NDCA 4I5NB 4ZCUA 5TNCA 1C07A 1KFUS 3VRRA 2KI4C 4P2YB 4AQJA 3AKAA 2LHIA 1DGVA 1IKUA 1QLKA 1QVIZ 1DJWA 2L5XB 3CR5X 1YVHA 3PALA 4A4CA 2M9GA 1J1DA 1B4CA 2NZ0A 2H61C 4YI8A 2LP3A 1A4PA 2K8MB 1K94A 1WRKA 5HLVA 1KK8C 1WLMA 1DJYA 2JWWA 3EKJA 4OV2A 1ZMZA 3OB1B 1SMGA 2JOJA 3AAJA 2RGIA 2K7CA 2HQWA 1RROA 2AMIA 5AFPA 2BKHB 1U5IA 3O4YA 1CMGA 4NQGA 1XFYO 4C0LA 1NWDA 5D69A 2EGDA 4PDZA 5HYDA 1EH2A 4AOMA 2KAYA 1KFXL 4GAOA 1SRAA 1U5IB 1TCFA 1XK4A 3TUYB 1CKKA 3LCPC 1PALA 2BBMA 4CFRA 1SL8A 1S5GY 3BOWA 2KFFA 4N1FA 4ORAB 4GBAA 4QJ3B 1OE9B 1OMDA 4FTGA 2K2FA 3BOWB 2CNPA 2KQ6A 1Y6WA 4USLA 4DUQA 3O6BA 3CLNA 2I2RE 1TNXA 1KSMA 1EG3A 1M45A 4AQIA 5I2QA 1K9KA 4YGCB 2BL0B 1XFVO 3AKBA 2CT9A 4L9MA 3SIBA 1QIVA 5HLOA 4DS7A 5I8NA 4GUKA 4MLWA 4OVNF 1ALVA 1DF0B 3FS7A 3LLEA 1NX1A 3C1VA 3I5HC 2PASA 2L50A 1N2DA 5JOLA 2Y5IA 3A4UB 1UP5A 5AERA 3F45A 1CFFA 2KQYA 1IWQA 2JC2A 1S6CA 1GJYA 1J7OA 1IG5A 1W7JB 2HQ8A 5D7FA 2MLEC 3ZWHA 2K7BA 2LV7A 2O60A 2AUCA 4HRGA 3BUNB 2HPSA 1ODBA 2O5GA 4CFQA 1NP8A 1Q80A 1W7IB 1K9UA 3SG5A 3JTDC 2L4HA 1JSAA 3BUOB 1V1FA 1ZUZA 1RWYA 2PSRA 2M97A 3I5IC 2B1UA 1CDNA 1EXRA 2L4IA 1K90D 5J3XA 1SYMA 2M1KB 4MN0A 2L0PA 3RM1A 2LMVA 3FIAA 1NYAA 5KTYA 1XVJA 5DKRA 1TCOB 1YRUB 5DKNA 1FPWA 1BF5A 2COLB 4M2PA 4HREE 1D1OA 1JC2A 2TN4A 4MBEA 1AHRA 1NIWA 2OTGC 3D0YA 1B8RA 1KFXS 1B1GA 1OZSA 4A4BA 4DIRA 1KSOA 3BUWB 3OP0A 1NCXA 2KAXA 3IQOA 3VROA 4M2QA 1KQMC 1B8CA 4PCWA 3D0YB 2ZNEA 2NCOA 5AXIA 3OX6A 3NSOA 2PALA 2KDHA 3TS5B 1A29A 1YRTB 1QATA 3H4SE 1IRJA 2K7OA 3EVVA 4Q04A 2KOTA 2Q91A 3OX5A 2MLFC 4QJ5B 2EC6C 4YI9A 2Y1MA 1S26D 2CBLA 1TRFA 1ZOTB 4GNKB 1WRLA 1QV0A 2KBIA 3KEVA 3FWCA 5DKQA 4BY5A 1LVCD 1QTXA 1NX3A 1JF2A 1R2UA 4PE4A 3MSEB 1N0YA 2E30A 1PSBA 2F3ZA 1TN4A 2P6BB 5FYXA 1E8AA 1RFJA 3SG4A 3M0WA 2A4JA 1SKTA 2ZNDA 1OMVA 1G4YR 2LHLA 1LKJA 5B8IB 5CSNA 4PE1A 1Y1XA 1AJ4A 1Y0VH 3HCMA 1RJVA 3EVUA 3NXAA 1A03A 3CTNA 1MXLC 2JPTA 3VRQA 2KFHA 3NSLA 1LA3A 3OHMB 4GFTA 2L98A 1OZOA 5IBWA 4MZJA 2WNDA 1CM1A 1NCZA 2LAPA 2OS8B 1TIZA 3GOFA 4JPZB 4YGDB 1XK4C 1XYDA 1UHIA 1AK8A 1PVAA 1SNLA 2KHNA 5K89A 2BKIB 5F6TA 1YX7A 4M2OA 1SY9A 2M7LA 4PE0A 4NDDA 4OCIA 4PALA 2M7NA 3JVTB 1CLLA 2LLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOC A;  1H8B A;  1FW4 A;  2MA2 A;  1UWO A;  3TDU A;  2LVV A;  2BL0 C;  1UHK A;  2JXL A;  3O78 A;  1DVI A;  1SR6 B;  1AUI B;  1JF0 A;  2E6W A;  2K61 A;  1F71 A;  2HF5 A;  2LMT A;  1Y1A A;  4F0Z B;  1QAS A;  2WOR A;  2WCF A;  1ZFS A;  2M0R A;  1FBV A;  3TDZ A;  3ICB A;  1LIN A;  1WY9 A;  2GV5 A;  1RK9 A;  1GQM A;  4I5L B;  4JWQ A;  3PN7 B;  1M31 A;  1CNP A;  1XA5 A;  5I2L A;  1JWD A;  4HRH A;  1SK6 D;  4GGF A;  2CXJ A;  1DF0 A;  3I5G C;  3LK1 A;  1F8H A;  1SCM B;  1QX7 A;  2WOS A;  4BY4 A;  2LM5 A;  4MSP A;  2FJU B;  4XJK A;  2SCP A;  3EK4 A;  1PUL A;  3ZNI A;  2KNE A;  2LVK A;  1BT6 A;  1UHN A;  2LE9 B;  2WCE A;  1KQV A;  3TZ1 A;  4XJK B;  1JUO A;  3SIA A;  1MR8 A;  2LUC A;  1NPQ A;  3FWB A;  1YVL A;  1CFC A;  2KYF A;  1C7W A;  3CZT X;  2LLU A;  1HT9 A;  3KF9 A;  1BG1 A;  1CFP A;  2I18 A;  1IGV A;  2I94 A;  1B47 A;  1UHJ A;  1XFZ O;  2G2B A;  1UUR A;  3DVE A;  2ZRS A;  4D1E A;  1YUU A;  1MHO A;  3I5F B;  2JRF A;  2L2E A;  5ER5 A;  1KFU L;  3WXA A;  3E3R A;  2BCB A;  2WC8 A;  2JT3 A;  3VGO A;  1DTL A;  2FCD A;  2KGB C;  1SL9 A;  1XFX O;  4QJ4 B;  1NCY A;  1S5G Z;  4MRX A;  2PVB A;  2BCX A;  4N5X A;  2BEC A;  1EJ3 A;  1TTX A;  2F33 A;  3DVJ A;  4WQ2 A;  1BLQ A;  1CLB A;  1AP4 A;  4I5K A;  3PAT A;  2FCE A;  3BXK A;  1MXE A;  2KI6 D;  1K93 D;  1C7V A;  5HKY A;  1CM4 A;  3QRX A;  2MRD A;  1KWO C;  4IL1 A;  2MBX A;  1QX2 A;  1NUB A;  1QVI Y;  4PHN A;  1J7R A;  4YGA A;  2KSP A;  1DGU A;  2LCP A;  3AAK A;  1QJT A;  2BBN A;  1YUR A;  2ZN8 A;  2PRU A;  2LLT A;  1DJX A;  1YX8 A;  1DJH A;  2M29 A;  4ORC B;  4GPL B;  5CSJ A;  1J7Q A;  1NX0 A;  1RTP 1;  3VRP A;  1QXP A;  3O2P A;  5AEQ A;  1B7T Y;  1IH0 A;  4PHM A;  3WHU B;  5JJG A;  3VRN A;  2OS8 C;  4OKH A;  4CLN A;  1GGZ A;  1YUS A;  1OFC X;  2IS9 A;  2BCA A;  3GK2 A;  4FQO A;  3SG3 A;  1S36 A;  1CDL A;  1M46 A;  1AJ5 A;  1XO5 A;  2WCB A;  4JQ0 D;  1F54 A;  1CDP A;  2Y4Q A;  1KK7 Y;  1L7Z A;  2JNF A;  1MF8 B;  3JVT C;  3WHT B;  1NSH A;  2JXC A;  2NXQ A;  4CID A;  2JUL A;  3BYA A;  2MJW B;  2KFG A;  2JT8 A;  1SPY A;  2LUX A;  1TNP A;  1M39 A;  3HX4 A;  3SG6 A;  3TUY C;  1BMO A;  1QS7 A;  2OTG B;  4YGE B;  2KAV A;  2MHH A;  2JTT A;  2M3W A;  3KHE A;  1J1E A;  1REC A;  4P5O E;  3EKH A;  1ZAC A;  5BPJ A;  1PK0 D;  1EG4 A;  1CTR A;  3EK7 A;  3LK0 A;  4HSZ A;  3RLZ A;  1SL7 A;  4OR9 B;  1CMF A;  2AAO A;  2V53 A;  1K2H A;  3DVM A;  3PN7 C;  2KYC A;  3CR2 A;  3BUX B;  4YRU A;  1M63 B;  2F2P A;  3KO0 A;  1X02 A;  2EC6 B;  2SAS A;  1PRW A;  1K9P A;  1SW8 A;  3K21 A;  1SCM C;  3A8R A;  2ZN9 A;  2JTZ A;  4GGN A;  4GGF C;  2JNX A;  4PHK A;  2Y9Z A;  1CLM A;  2K0J A;  2F8P A;  2LMU A;  4ORB B;  5ER4 X;  1WDC B;  4I5J A;  1FI5 A;  1L2O B;  5HKZ A;  1DJI A;  4DRW A;  3DVK A;  2KI4 B;  5PAL A;  2GGM A;  1B7T Z;  1HQV A;  3CGA A;  1J7P A;  1G8I A;  3WNX B;  3EK8 A;  3BQ3 A;  3PM8 A;  1SCV A;  2H61 A;  2PMY A;  4E68 A;  1DT7 B;  1CDM A;  1DMO A;  2H2K A;  4UPG A;  1S1E A;  4MEW A;  4MZL A;  1F70 A;  3DF0 A;  4MVF A;  4U8D A;  1KK7 Z;  4NDB A;  1BU3 A;  4CPV A;  5KSZ A;  3SG2 A;  3I5F C;  2F2O A;  1KK8 B;  1MWN A;  2LVI A;  1BR4 B;  3DF0 B;  5CSI A;  1S6J A;  2NLN A;  4WRI A;  4C0J A;  1QV1 A;  1DJG A;  2Y1N A;  4TNC A;  1OMR A;  1PVB A;  1S3P A;  1Y1U A;  2ISD A;  2Y9Y A;  1G33 A;  1IJ6 A;  1VRK A;  3PSR A;  1LA0 A;  3NSI A;  5CSF A;  2M1U A;  2G9B A;  2LAN A;  1N65 A;  1WLZ A;  1ALW A;  1TNW A;  3IQQ A;  4YGB B;  1NX2 A;  5AAN A;  1PSR A;  4ETO A;  1MUX A;  1S6I A;  2DOQ A;  3LL8 B;  1LXF C;  4MZK A;  3PLF B;  2K2A A;  4XYN A;  4MRY A;  1BJF A;  1JBA A;  5I2O A;  1IJ5 A;  5CPV A;  1KCY A;  1F4O A;  1QX5 B;  1YUT A;  4WQ3 A;  3PFV A;  2JU0 A;  3TS5 C;  1OQP A;  4PHJ A;  3CR4 X;  3SG7 A;  3I5G B;  2HET A;  1K96 A;  2R2I A;  1CB1 A;  1F4Q A;  2OPO A;  1DJZ A;  1QIW A;  1WRZ A;  2D8N A;  2VRG A;  3KPX A;  1XFW O;  2Q4U A;  3I5H B;  5KU1 A;  3NSK A;  1UHH A;  1YR5 A;  2K7D A;  2NCP A;  1XFU O;  1JFK A;  4R1E A;  2KI6 C;  1GGW A;  1QLS A;  2LP2 A;  1R6P A;  2CCM A;  2JQ6 A;  1EL4 A;  4DCK A;  1A75 A;  2KBM A;  1BR1 B;  3CWG A;  4C0K A;  2ZKM X;  2FOT A;  3BUM B;  3D10 A;  2BE4 A;  1H4B A;  1A75 B;  3CS1 A;  3TDI A;  2ZFD A;  3JTD B;  1SBJ A;  1FI6 A;  1OOJ A;  3DD4 A;  2LNK A;  3OB2 B;  2MAZ A;  4YBH B;  2LVJ A;  3GK4 X;  2M8U A;  3I5I B;  4ZCV A;  1J55 A;  1K95 A;  3GK1 A;  2M49 B;  3EVR A;  4N1G A;  5GQQ C;  1IQ5 A;  2ZRT A;  2QPT A;  2CTN A;  2GGZ A;  5G08 A;  5HKW A;  1BOD A;  2LC5 A;  4ICB A;  1F55 A;  1K8U A;  2L51 A;  2EHB A;  1OSA A;  1AVS A;  1UUS A;  1B9A A;  2I7A A;  3IF7 A;  2JZI A;  1YTZ C;  3SJS A;  1MQ1 A;  1KWO B;  1IQ3 A;  1TNQ A;  1B8L A;  1CFD A;  1SR6 C;  4PE7 A;  1FF1 A;  2JT0 A;  2QAC A;  1KQM B;  1V1G A;  1TOP A;  1WDC C;  2BE6 A;  2F3Y A;  2KGR A;  1A2X A;  1JFJ A;  1L2O C;  4NDC A;  4I5N B;  4ZCU A;  5TNC A;  1C07 A;  1KFU S;  3VRR A;  2KI4 C;  4P2Y B;  4AQJ A;  3AKA A;  2LHI A;  1DGV A;  1IKU A;  1QLK A;  1QVI Z;  1DJW A;  2L5X B;  3CR5 X;  1YVH A;  3PAL A;  4A4C A;  2M9G A;  1J1D A;  1B4C A;  2NZ0 A;  2H61 C;  4YI8 A;  2LP3 A;  1A4P A;  2K8M B;  1K94 A;  1WRK A;  5HLV A;  1KK8 C;  1WLM A;  1DJY A;  2JWW A;  3EKJ A;  4OV2 A;  1ZMZ A;  3OB1 B;  1SMG A;  2JOJ A;  3AAJ A;  2RGI A;  2K7C A;  2HQW A;  1RRO A;  2AMI A;  5AFP A;  2BKH B;  1U5I A;  3O4Y A;  1CMG A;  4NQG A;  1XFY O;  4C0L A;  1NWD A;  5D69 A;  2EGD A;  4PDZ A;  5HYD A;  1EH2 A;  4AOM A;  2KAY A;  1KFX L;  4GAO A;  1SRA A;  1U5I B;  1TCF A;  1XK4 A;  3TUY B;  1CKK A;  3LCP C;  1PAL A;  2BBM A;  4CFR A;  1SL8 A;  1S5G Y;  3BOW A;  2KFF A;  4N1F A;  4ORA B;  4GBA A;  4QJ3 B;  1OE9 B;  1OMD A;  4FTG A;  2K2F A;  3BOW B;  2CNP A;  2KQ6 A;  1Y6W A;  4USL A;  4DUQ A;  3O6B A;  3CLN A;  2I2R E;  1TNX A;  1KSM A;  1EG3 A;  1M45 A;  4AQI A;  5I2Q A;  1K9K A;  4YGC B;  2BL0 B;  1XFV O;  3AKB A;  2CT9 A;  4L9M A;  3SIB A;  1QIV A;  5HLO A;  4DS7 A;  5I8N A;  4GUK A;  4MLW A;  4OVN F;  1ALV A;  1DF0 B;  3FS7 A;  3LLE A;  1NX1 A;  3C1V A;  3I5H C;  2PAS A;  2L50 A;  1N2D A;  5JOL A;  2Y5I A;  3A4U B;  1UP5 A;  5AER A;  3F45 A;  1CFF A;  2KQY A;  1IWQ A;  2JC2 A;  1S6C A;  1GJY A;  1J7O A;  1IG5 A;  1W7J B;  2HQ8 A;  5D7F A;  2MLE C;  3ZWH A;  2K7B A;  2LV7 A;  2O60 A;  2AUC A;  4HRG A;  3BUN B;  2HPS A;  1ODB A;  2O5G A;  4CFQ A;  1NP8 A;  1Q80 A;  1W7I B;  1K9U A;  3SG5 A;  3JTD C;  2L4H A;  1JSA A;  3BUO B;  1V1F A;  1ZUZ A;  1RWY A;  2PSR A;  2M97 A;  3I5I C;  2B1U A;  1CDN A;  1EXR A;  2L4I A;  1K90 D;  5J3X A;  1SYM A;  2M1K B;  4MN0 A;  2L0P A;  3RM1 A;  2LMV A;  3FIA A;  1NYA A;  5KTY A;  1XVJ A;  5DKR A;  1TCO B;  1YRU B;  5DKN A;  1FPW A;  1BF5 A;  2COL B;  4M2P A;  4HRE E;  1D1O A;  1JC2 A;  2TN4 A;  4MBE A;  1AHR A;  1NIW A;  2OTG C;  3D0Y A;  1B8R A;  1KFX S;  1B1G A;  1OZS A;  4A4B A;  4DIR A;  1KSO A;  3BUW B;  3OP0 A;  1NCX A;  2KAX A;  3IQO A;  3VRO A;  4M2Q A;  1KQM C;  1B8C A;  4PCW A;  3D0Y B;  2ZNE A;  2NCO A;  5AXI A;  3OX6 A;  3NSO A;  2PAL A;  2KDH A;  3TS5 B;  1A29 A;  1YRT B;  1QAT A;  3H4S E;  1IRJ A;  2K7O A;  3EVV A;  4Q04 A;  2KOT A;  2Q91 A;  3OX5 A;  2MLF C;  4QJ5 B;  2EC6 C;  4YI9 A;  2Y1M A;  1S26 D;  2CBL A;  1TRF A;  1ZOT B;  4GNK B;  1WRL A;  1QV0 A;  2KBI A;  3KEV A;  3FWC A;  5DKQ A;  4BY5 A;  1LVC D;  1QTX A;  1NX3 A;  1JF2 A;  1R2U A;  4PE4 A;  3MSE B;  1N0Y A;  2E30 A;  1PSB A;  2F3Z A;  1TN4 A;  2P6B B;  5FYX A;  1E8A A;  1RFJ A;  3SG4 A;  3M0W A;  2A4J A;  1SKT A;  2ZND A;  1OMV A;  1G4Y R;  2LHL A;  1LKJ A;  5B8I B;  5CSN A;  4PE1 A;  1Y1X A;  1AJ4 A;  1Y0V H;  3HCM A;  1RJV A;  3EVU A;  3NXA A;  1A03 A;  3CTN A;  1MXL C;  2JPT A;  3VRQ A;  2KFH A;  3NSL A;  1LA3 A;  3OHM B;  4GFT A;  2L98 A;  1OZO A;  5IBW A;  4MZJ A;  2WND A;  1CM1 A;  1NCZ A;  2LAP A;  2OS8 B;  1TIZ A;  3GOF A;  4JPZ B;  4YGD B;  1XK4 C;  1XYD A;  1UHI A;  1AK8 A;  1PVA A;  1SNL A;  2KHN A;  5K89 A;  2BKI B;  5F6T A;  1YX7 A;  4M2O A;  1SY9 A;  2M7L A;  4PE0 A;  4NDD A;  4OCI A;  4PAL A;  2M7N A;  3JVT B;  1CLL A;  2LLS A; 
#chains in the Genus database with same CATH topology
 5EFW B;  1Z2C B;  1UWO A;  1LGH B;  1UHK A;  2H89 C;  3NHI A;  1A02 F;  5AW0 B;  1EZV I;  3II6 A;  2E6W A;  3HE5 B;  4F0Z B;  1YIT P;  1QAS A;  1CI6 B;  1ZFS A;  1AVY A;  3WMM 0;  1NTZ G;  2M5A A;  1FBV A;  2AEF A;  3ICB A;  1ZRT E;  3PN7 B;  1M31 A;  1L0N E;  1JWD A;  1KFM A;  5FI7 A;  1L0L J;  1HJB A;  3LK1 A;  3RK3 C;  3CC4 P;  5AVS B;  1EDI A;  4MSP A;  1KYO E;  3W67 A;  2SCP A;  3CC7 P;  2WCE A;  1KQV A;  1UHN A;  1N7S C;  3H1H J;  5KLV K;  1MFT A;  3TZ1 A;  4XJK B;  1L0L K;  5TIS E;  3V2L A;  1OVR A;  2LUC A;  2K60 A;  2JEE A;  2L5Y A;  1PFI A;  5BU5 A;  1DD3 A;  1NH4 A;  1HT9 A;  3KF9 A;  3KHU A;  1W2E A;  4XA4 A;  3ITK A;  1T2K D;  2I18 A;  1UHJ A;  3PLN A;  1OOI X;  2ZRS A;  1LT1 A;  1ZP0 C;  3BCC J;  1MHO A;  1OWA A;  2K9J A;  2L2E A;  2WC8 A;  3NGV A;  1DTL A;  2FCD A;  1SL9 A;  3A3Y B;  2BCX A;  1EJ3 A;  3TGU D;  3DVJ A;  1BLQ A;  1GM0 A;  1KIL C;  3PRJ A;  1LJ2 A;  2WTY A;  5KLV G;  1L0L G;  4PD4 I;  3QRX A;  5CCG C;  2MBX A;  1QX2 A;  1NUB A;  1MV8 A;  1J7R A;  4BRY A;  2ZXX A;  3AEB C;  2ZN8 A;  2Q7C A;  3L75 E;  1NTK K;  3H1H G;  2QJY C;  3D6Y A;  1SSE B;  1KV4 A;  1AFO A;  2IX7 C;  3KYQ A;  4IFM A;  1SVF A;  3O2P A;  1B7T Y;  4PHM A;  3WUV A;  2BNX A;  4LLH A;  2W90 A;  4OKH A;  3A5T A;  1GGZ A;  1YUS A;  4NPD A;  3CI9 A;  2O1J A;  3OJA B;  3HRN A;  5APT A;  2KPH A;  1S1C X;  2BCA A;  1J1D C;  3BCC G;  4NPE A;  1K05 A;  1S36 A;  1OW4 A;  3NXS A;  2Y4Q A;  1PGQ A;  3L74 D;  1IO4 A;  1NSH A;  2JXC A;  2JR8 A;  5AVT B;  2KFG A;  2O01 H;  2PYQ A;  1FZB A;  5DIC A;  3G71 P;  1TNP A;  1SLQ A;  5AVU B;  3PM2 A;  2YXR B;  2FKW B;  2KAV A;  3KHE A;  3ZDM A;  1HVV A;  1OOG A;  1JUN A;  1USE A;  1ZAC A;  1PK0 D;  1AVO A;  1EG4 A;  1Z4H A;  3LK0 A;  4HSZ A;  1CMF A;  1SQQ E;  2V53 A;  3Q5R A;  1QWV A;  3DVM A;  2P70 A;  2XU6 A;  5AW8 B;  2KYC A;  3CMA P;  2F2P A;  3KO0 A;  1JOC A;  1SQP K;  2ZFC A;  1FOS F;  4GGF C;  2LMU A;  4ORB B;  3B87 A;  4I5J A;  1FI5 A;  1L2O B;  1CZQ A;  2HFE D;  3H1J D;  4DRW A;  2M3E A;  3RBX A;  4PJ0 H;  2OYO A;  3L35 A;  3CGA A;  1G8I A;  3EK8 A;  3PM8 A;  1SCV A;  2PMY A;  4BWN A;  1DT7 B;  1CDM A;  2H2K A;  1S1E A;  4MEW A;  1HGZ A;  5CBO A;  4U8D A;  1KK7 Z;  4NDB A;  4CPV A;  1MWN A;  3V2P A;  2P10 A;  4WVZ A;  1BR4 B;  3DF0 B;  1BE3 G;  2E5Y A;  5APU A;  1S6J A;  2IYO A;  4C0J A;  1S9K D;  2Y1N A;  2NPS D;  1GL2 C;  1PVB A;  1Q82 Q;  1S3P A;  2B9B A;  1SQP G;  2Y9Y A;  3TSI A;  1SQX E;  5GTI H;  3C8V A;  4AQR D;  2A45 H;  2WSE H;  1T3U A;  2K3R A;  1TNW A;  2YMY A;  4YGB B;  1PSR A;  1MUX A;  3B7A A;  2N9B A;  2K2A A;  1URQ C;  2AXT H;  3OAK A;  2YKP A;  1KCY A;  1YUT A;  3UO9 A;  4JYC A;  1IFI A;  5KLI C;  1OQP A;  4PHJ A;  2HYN A;  2OGU A;  5AVR B;  2HET A;  2R2I A;  1CB1 A;  3L73 E;  1F4Q A;  2E75 B;  1QIW A;  3FWL A;  3KPX A;  3I5H B;  3IF4 A;  4ASV A;  1PIX A;  2NCP A;  1JFK A;  4R1E A;  3H1I E;  1PP9 J;  2ZAE B;  4H44 C;  2JQ6 A;  1LWU C;  1EL4 A;  4DCK A;  3L4F A;  1A75 A;  4C0K A;  3VYI A;  2FOT A;  4GDO A;  2IFM A;  2XZR A;  3TDI A;  3B86 A;  2W27 A;  3OB2 B;  4YBH B;  4I7Z C;  4JF7 A;  3S0E A;  1SQV E;  2E43 A;  2YIU B;  4ZCV A;  2FFD A;  1TUZ A;  4TLF A;  3NHT A;  3Q8I A;  5GQQ C;  1OOH A;  3AE1 C;  1VQ6 P;  4N78 D;  1NTM E;  2QPT A;  2GGZ A;  1BOD A;  2WSF J;  1K8U A;  4Y99 C;  2EHB A;  3VMZ A;  1DEL A;  5CCH D;  3IF7 A;  2JZI A;  2HR3 A;  2Z5I A;  3HE4 A;  1CFD A;  1L0N K;  3Q2Y A;  2OTK E;  3GMA A;  1FF1 A;  2QAC A;  4H13 C;  1LP1 B;  1SFC B;  2KGR A;  1LTA C;  4ZCU A;  1C07 A;  2WPR A;  1KZU B;  1PP9 G;  3PTZ A;  1DGV A;  1FZA A;  2NRG A;  1NTZ D;  2OQQ A;  2FY8 A;  1JTH A;  1OVV A;  2M9G A;  1BGY E;  3S0D A;  2H61 C;  4GOD A;  1HTL C;  1WRK A;  1KK8 C;  1DJY A;  3VB1 A;  3P8C D;  1SMG A;  3KZI H;  2JOJ A;  3NTN A;  1M7L A;  2K9Y A;  2P2U A;  5AFP A;  5B5E E;  1NHL A;  2FBW C;  3B5N B;  1KFX L;  3RL0 g;  4N3Y B;  1XK4 A;  2Q3E A;  1SL8 A;  3EFG A;  2KFF A;  4N1F A;  1JY2 O;  2KZJ A;  1OMD A;  3BOW B;  1L2P A;  3RK3 D;  1TNX A;  3BFA A;  5APX A;  1M45 A;  2FXM A;  1K9K A;  3AE7 C;  4N6J A;  4L9M A;  2KSE A;  1VQ7 P;  5HLO A;  1OOF A;  4GUK A;  4MLW A;  1QX8 A;  1ALV A;  3LLE A;  1PL5 A;  1NX1 A;  3C1V A;  3M9Q A;  3TGU J;  3AE5 C;  5KLV D;  1L0L D;  1T2K C;  3L71 E;  1S5L E;  1Q7Y Q;  5D7F A;  1DC1 A;  2KI7 B;  3BUN B;  1ODB A;  4H0L C;  2O5G A;  1N7S A;  1W7I B;  1K9U A;  4U3F J;  3HUS B;  3V6I A;  4INX A;  3VOP A;  2B1U A;  1CDN A;  4U7J A;  1SQB E;  2L4I A;  3O6Q A;  1W9Z A;  3D78 A;  2M1K B;  3RM1 A;  2LMV A;  5CCG D;  3SFD C;  3HTK B;  1IFD A;  5H2F H;  1XVJ A;  1VQ9 P;  1TCO B;  1YRU B;  2WPS A;  2COL B;  3DZT A;  1D1O A;  1LTJ C;  2TN4 A;  2L5G B;  2OTG C;  3L74 J;  3D0Y A;  3AEA C;  1B8R A;  1FDI A;  4DIR A;  1IK9 A;  3BUW B;  2KUB A;  3VRO A;  1KQM C;  4PCW A;  1YQ4 C;  3TGU G;  1QL2 A;  1NTK D;  3NSO A;  2WT7 A;  3TS5 B;  4PD4 E;  3EVV A;  2E74 B;  1EXJ A;  2FYU J;  4Q04 A;  3VMY A;  2Q91 A;  3L4L A;  3OX5 A;  2BEQ D;  5CCG A;  4QJ5 B;  3VTP C;  1T14 A;  1ZOT B;  3FWC A;  5DKQ A;  1S2E A;  1IK7 A;  3P7K A;  4PE4 A;  3MSE B;  4U3F G;  3USS A;  3CXH H;  2QE7 H;  2FYU K;  2O01 N;  2F3Z A;  1TN4 A;  2P6B B;  1RF1 B;  3H1H E;  2M0B A;  3CME P;  3M0W A;  4IFF A;  1OMV A;  3IN6 A;  2LHL A;  4PE1 A;  4GOE A;  1Y1X A;  3HCM A;  2W6A A;  2OYH B;  3H1J J;  3PP5 A;  3OA7 A;  1KIL E;  2KFH A;  2KIK A;  1AJY A;  4GFT A;  3M0A A;  1JMM A;  1OZO A;  2YKO A;  3CXH D;  1NCZ A;  3K1E A;  1RE4 C;  3A7O A;  2BCC E;  3BCC E;  4OGQ B;  1PVA A;  5K89 A;  2KLD A;  5AW4 B;  1YX7 A;  2IBZ G;  3H32 A;  3RL0 C;  3GF3 A;  1BE3 D;  1BOC A;  1S72 P;  4YXW H;  2BL0 C;  1SQP D;  2PP6 A;  1AQT A;  2FYU G;  5AVZ B;  2HF5 A;  1NKN A;  1Y1A A;  2WOR A;  2QSI A;  1DD4 A;  5B66 H;  1WY9 A;  1GQM A;  4I5L B;  1P84 D;  1USD A;  2P71 A;  1CNP A;  4GGF A;  3I5G C;  1JCD A;  1R5L A;  4CPG A;  1KB9 D;  2NPS C;  5AW3 B;  1SCM B;  1BCC E;  1QX7 A;  3AEC C;  3Q3D A;  4BY4 A;  3TNU B;  2WPV B;  2LM5 A;  3H1J G;  2FJU B;  3CAB A;  1PPJ E;  1DIP A;  1HJ0 A;  3AEG C;  2YO2 A;  2KNE A;  1JUO A;  3AEF C;  3CWB G;  4W7Z A;  4B86 A;  1VF5 B;  1NU1 E;  2KSJ A;  1RH5 B;  1N73 C;  3CZT X;  3FGA D;  4WB4 A;  2WZ7 A;  2KYV A;  3GF7 A;  1Q81 Q;  1CFP A;  3L72 G;  2W6J H;  1XFZ O;  3DVE A;  1UUR A;  4O9B A;  3MUD A;  3I5F B;  1GL2 A;  2JRF A;  2WCM A;  3N7N A;  2I1K A;  4BXL A;  2AXC A;  3CLQ A;  3JSV C;  4QJ4 B;  3AEE C;  1S5G Z;  4N5X A;  1RHZ B;  3CX5 E;  2CK3 H;  2F33 A;  2ZT9 B;  2HPC B;  3E1R A;  3PAT A;  2FCE A;  3BXK A;  5HKY A;  3NMD A;  1URQ A;  2MRD A;  1KWO C;  4IL1 A;  4YGA A;  2HOD B;  3CCM P;  3AAK A;  3CZ1 A;  3H1L E;  3RK2 D;  2M29 A;  1RY3 A;  1S3J A;  2A45 I;  3SSU A;  2OYI B;  4JBZ A;  3L47 A;  5B66 E;  3VRP A;  1S5L X;  2KNC A;  1OW8 A;  1QXP A;  2LKM A;  1IH0 A;  5JJG A;  2M3B A;  3VRN A;  3P8M C;  1GDT A;  1OFC X;  1LWU A;  1NTZ J;  2RKL A;  2IPP A;  2CPB A;  3SG3 A;  4GT1 A;  1CDL A;  3FXD A;  1YJ9 P;  1XO5 A;  2WCB A;  5CCH C;  2V7Q J;  2WSF H;  1L7Z A;  1MF8 B;  1M1J C;  2FFD B;  2HLO A;  4HYT B;  4I2L C;  2QEV A;  1HUC A;  5HL1 A;  4C7N A;  3E7K A;  1J2J B;  2LUX A;  3SG6 A;  3TUY C;  1EC5 A;  1BMO A;  1L4A B;  1QS7 A;  4YGE B;  1L0N D;  3HD7 B;  1H0T A;  2JTT A;  2M3W A;  2PRR A;  2OTJ P;  2C0X A;  2D2C B;  1J1E A;  1REC A;  4P5O E;  3EKH A;  2JWA A;  3BAS A;  1ZR2 A;  3TF5 A;  1KYO D;  1FS0 E;  1IFJ A;  1YHQ P;  2R32 A;  3CCJ P;  1K2H A;  3PN7 C;  5APV A;  3BUX B;  4YRU A;  1M63 B;  3A2A A;  4YPC A;  5FI6 A;  5I94 A;  2SAS A;  1TU3 F;  2ZN9 A;  2JTZ A;  5GTH H;  1FJK A;  4GGN A;  1VQO P;  2Y9Z A;  1EDJ A;  2F8P A;  3U59 A;  1WDC B;  2G8Y A;  1IIO A;  2KI4 B;  2A06 D;  1PP9 E;  1GU5 A;  3BQ3 A;  5KLV J;  3SS3 A;  2H61 A;  1RF0 C;  1DMO A;  1DQE A;  4ZNC A;  4UPG A;  2QEX P;  4MVF A;  3SG2 A;  1N86 A;  2JWD A;  2QEO A;  4WRI A;  1DJG A;  4TNC A;  1OMR A;  2R5D A;  1KQG B;  1IJ6 A;  1LA0 A;  3NSI A;  3EQ2 A;  2M1U A;  2LAN A;  1WLZ A;  1ALW A;  1LT9 B;  3CCQ P;  3IQQ A;  1Q2N A;  4AYC A;  4YXD C;  3LL8 B;  4XYN A;  3PLF B;  4MRY A;  3LID A;  1BJF A;  3I5C A;  5I2O A;  1Y8A A;  4H0L D;  1GZL A;  1F4O A;  3L36 A;  4WQ3 A;  4XE5 B;  4KYN A;  1ZME C;  2E76 D;  3CCL P;  2YNY A;  1NTK J;  1GW3 A;  4IL6 E;  1WRZ A;  2LR2 A;  1XFW O;  2XNX A;  1YR5 A;  1Y9B A;  1N7S B;  2K7D A;  3SFE C;  5AVX B;  2KI6 C;  1R6P A;  4OZD A;  4U3F D;  1BR1 B;  1DEB A;  3Q5S A;  1VQN P;  3I56 P;  3PJI A;  3DD4 A;  2M8U A;  3I5I B;  3N7H A;  1J55 A;  1SP4 A;  2KLV A;  3GK1 A;  3M91 A;  2M49 B;  1VQM P;  1U7J A;  5EL2 A;  1LTJ A;  5HKW A;  3FX0 A;  1KIL B;  1F55 A;  2IBZ D;  1OSA A;  1JEK A;  4K3A A;  4FQT A;  5E79 H;  3LIE A;  1MQ1 A;  2N1T B;  1NTK G;  1BE3 J;  1SR6 C;  2PGD A;  3Q5P A;  2FYU D;  3TGU E;  1V1G A;  1TOP A;  1SQP J;  2BE6 A;  5BVZ A;  1JFJ A;  1L2O C;  5TNC A;  4I5N B;  4P2Y B;  2QJY B;  3AKA A;  2KZI A;  1XTG B;  5K5G B;  3TDK A;  1QVI Z;  2L5X B;  4A4C A;  3PAL A;  1DH3 A;  3FWN A;  2FXO A;  2RN0 A;  2NZ0 A;  4WY4 B;  3RL0 D;  5AW7 B;  2K8M B;  1J1D B;  4OV2 A;  3OB1 B;  2FXP A;  1KOR A;  1RRO A;  2BKH B;  3L70 J;  1U5I A;  3O4Y A;  4NQG A;  1XFY O;  4C0L A;  1JY2 N;  1OIP A;  1RE4 A;  4AOM A;  3CWB D;  4GAO A;  3SWK A;  4DT0 A;  1S5G Y;  2OAR A;  5CHX A;  3L74 E;  4FTG A;  3L72 D;  1JMB A;  4PV1 B;  1GW4 A;  1UIX A;  2CNP A;  2KQ6 A;  2C9L Y;  3MUD C;  1Y6W A;  4USL A;  1X9V A;  2I2R E;  2Q1K A;  2L2C A;  1EG3 A;  1K73 Q;  3H1I D;  1XFV O;  3IR9 A;  1G2C A;  5I8N A;  4RO0 A;  3CX5 I;  4OVN F;  1CSB A;  3I5H C;  2WIT A;  2PAS A;  2E5T A;  2K1A A;  1OZH A;  1VDF A;  2Y5I A;  1MUU A;  3F45 A;  2B87 A;  2KQY A;  2NPS A;  1VQL P;  1GK4 A;  1GJY A;  1U57 A;  1W7J B;  3QME A;  2IZ1 A;  2MLE C;  3L70 G;  3D6Z A;  2K7B A;  4HRG A;  4W7Y A;  3L4A A;  3SWF A;  3R2P A;  4RJT A;  3H1J E;  3B71 A;  1NP8 A;  3SG5 A;  1V1F A;  1P28 A;  1RWY A;  2PSR A;  2YIU C;  1N73 A;  1GL2 B;  2R3S A;  1K90 D;  1SYM A;  4MN0 A;  2L0P A;  5M1B A;  4OWF A;  4MN4 C;  2ZYG A;  4PJ0 E;  1NGM B;  1S9K E;  3RK2 C;  1B1G A;  1OZS A;  4A4B A;  1KSO A;  1C3Z A;  1URQ B;  1SFC C;  2ZNE A;  2NCO A;  2RH0 A;  1DEK A;  1J1E C;  1L0N J;  2GUS A;  2KDH A;  1A29 A;  1M8O B;  5CMZ A;  5L8R J;  4ZKU A;  2EC6 C;  1U7M A;  2Y1M A;  4GKG A;  1TRF A;  2QA4 P;  4JKT A;  2KBI A;  1QV0 A;  5GTI E;  1HBW A;  4WWI A;  2V7Q H;  4BY5 A;  1QTX A;  4IL6 X;  3AE2 C;  3I55 P;  1X8Y A;  2E30 A;  2NZ2 A;  1QVF O;  2JO1 A;  1DX7 A;  2IZ0 A;  5FYX A;  2KK7 A;  2AXT E;  5APY A;  1RJV A;  1MFZ A;  2ZVN B;  3GLM A;  5CCH A;  3UIA A;  1CM1 A;  2OS8 B;  1EZV D;  4I7Z B;  4JPZ B;  3T97 B;  2POH A;  3AE6 C;  1AK8 A;  1M1J A;  1FZC C;  1SNL A;  1UII A;  1H0T B;  2BKI B;  5F6T A;  2W6B A;  1SY9 A;  4PAL A;  2PQL A;  3JVT B;  1KN7 A;  1H8B A;  1FW4 A;  1G1I A;  1L0N G;  4Y28 J;  2LVV A;  3R1P A;  2QJP C;  4JD9 A;  3HE5 A;  3D76 A;  2QIW A;  1GU4 A;  1AUI B;  1JF0 A;  4N78 E;  3R72 A;  1LTG C;  1NVO A;  2WCF A;  3TDZ A;  1N8R Q;  1LIN A;  3CZ2 A;  1RQU A;  4JWQ A;  1IC2 A;  3VP9 A;  2H88 C;  4HRH A;  2M5A B;  1SK6 D;  1BSN A;  2WOS A;  5APQ A;  4XJK A;  3EK4 A;  3HUS C;  2A06 G;  1PUL A;  2WSS H;  1BT6 A;  1NTZ E;  4A7P A;  1OW6 A;  1GMJ A;  3SIA A;  1NPQ A;  2ZYD A;  1RF0 A;  1YVL A;  1CFC A;  2JKV A;  5FI2 A;  2WCH A;  1C7W A;  1QVG O;  3U1A A;  2LLU A;  1PZQ A;  3NFQ A;  3P8C E;  2P58 A;  4D6T D;  1IGV A;  3M9B A;  1B47 A;  2HG5 D;  5AW2 B;  4PD4 D;  4D1E A;  1CW5 A;  3VN0 A;  2H7H A;  1NWQ A;  1KFU L;  2E76 C;  3E3R A;  2BCB A;  4C46 A;  2K9J B;  3U1C A;  1SQQ J;  2JT3 A;  2SPZ A;  3TK1 A;  3F5H A;  1NCY A;  4MRX A;  2BEC A;  1TTX A;  3BFB A;  3KZI E;  2GTE A;  2H43 A;  1BSH A;  1MXE A;  2KI6 D;  1C7V A;  1YBK A;  3RK3 E;  1CM4 A;  1ZOY C;  1SQQ K;  1KD1 Q;  4DOJ A;  1QVI Y;  4PHN A;  5KAI H;  4R4L A;  2KSP A;  1DGU A;  2LCP A;  1AV1 A;  1RF1 C;  2PRU A;  2LLT A;  4BRY B;  2N1T D;  4GPL B;  2OYH C;  1R8E A;  5KLV E;  3CPW O;  1L0L E;  5KKZ C;  1CLL A;  3WHU B;  1OX3 A;  3S1K A;  3WU2 H;  1Q86 Q;  4OGQ C;  3MHV A;  4FQO A;  1F54 A;  1AJ5 A;  4JQ0 D;  1KK7 Y;  1SQX J;  2FYN B;  3WHT B;  1SQQ G;  2NXQ A;  4CID A;  3BYA A;  2IDB A;  3FE6 A;  3JCU H;  3HX4 A;  2OTG B;  3G3Z A;  1SQX K;  2MKV A;  1X0T A;  2WCK A;  3MIW A;  5BPJ A;  3CWB J;  4PT1 A;  3RLZ A;  1YTZ I;  1SL7 A;  2GUV A;  3S0A A;  5AW1 B;  2P67 A;  3QH9 A;  4DZO A;  3CR2 A;  1OVU A;  1P84 H;  3R1V A;  2DW3 A;  2N9Y B;  3L72 J;  1VPC A;  1PRW A;  1K9P A;  1SCM C;  2JP3 A;  1VQ8 P;  1NTK E;  1KB9 H;  2JJL A;  3GHG C;  4PHK A;  5H2F E;  2K0J A;  5ER4 X;  1NAY A;  3CD6 P;  1H88 A;  3H1I J;  1Q90 D;  3AED C;  3V2R A;  5HKZ A;  1DJI A;  2C9N Y;  3H1K D;  2LLS A;  4EYY Q;  1JY3 N;  5PAL A;  1NOH A;  3H6P A;  1B7T Z;  1HQV A;  1J7P A;  5KAI E;  1SQX G;  1M57 D;  4M3L A;  5AW6 B;  2YXQ B;  4MZL A;  1F70 A;  3DF0 A;  3P32 A;  2QM7 A;  5KSZ A;  2PAJ A;  3L70 D;  3I5F C;  3PHL A;  2NLN A;  2QVA A;  3PH0 A;  1Y1U A;  2E75 D;  2ISD A;  1VL2 A;  1M56 D;  3WU2 E;  4UB8 H;  4L76 A;  3CXH E;  2WSC J;  4ASW A;  2ZT9 C;  1SQV K;  3VMA A;  3H1L D;  5CSF A;  1M1K Q;  2Y0E A;  2G9B A;  3D71 A;  2VRS A;  1NTM K;  5AAN A;  1FJP A;  1S6I A;  2DOQ A;  1BE3 E;  1LXF C;  3JCU E;  3KDP B;  1JBA A;  1KMI Z;  2KLU A;  3H1I G;  1SQP E;  1IJ5 A;  5CPV A;  1QX5 B;  4HJG H;  3AE3 C;  3PFV A;  3SG7 A;  3I5G B;  3L37 A;  2B87 B;  1BGY J;  3PJS K;  1K96 A;  1PGO A;  1DJZ A;  3A0B H;  4GOF A;  2XDJ A;  1Z56 A;  1P84 E;  2UWJ E;  1A02 J;  1T8Z A;  3CYZ A;  1UHH A;  1JB0 J;  1XFU O;  1ZXG A;  3S0G A;  2QJK C;  1NYH A;  1KB9 E;  2CCM A;  1Y47 A;  4L74 A;  1JY2 P;  2QEH A;  1N73 B;  2KBM A;  1LTS C;  1NTM G;  3CCV P;  1FBM A;  2AEM A;  3D10 A;  2BE4 A;  1A75 B;  1SFC D;  4EI2 A;  1TWO A;  2ZFD A;  3JTD B;  1L4A C;  1SBJ A;  3HD7 C;  3OGN A;  2D2C C;  5CBN A;  2LVJ A;  3GK4 X;  2OTL P;  3N4X A;  4WBA A;  1K95 A;  3EVR A;  4N1G A;  3S9O A;  5G08 A;  3RZS A;  3SS4 A;  1KYO H;  3E1I A;  2L51 A;  2O1K A;  2J58 A;  3V4Q A;  1UUS A;  1ZRT D;  3CCS P;  1BDD A;  3BFH A;  3SJS A;  1BGY G;  3BAT A;  4UB8 E;  1KWO B;  1IQ3 A;  1LP1 A;  1SFC A;  2JT0 A;  3HE4 B;  1WDC C;  1LS8 A;  2QM8 A;  3B5N D;  4NDC A;  1KFU S;  2KI4 C;  3L71 J;  1TUJ A;  4AQJ A;  1X79 B;  2CPS A;  2LHI A;  1IKU A;  1R5S A;  2LXB A;  1LTB C;  2ZYA A;  2IYP A;  1DJW A;  2XV5 A;  1B4C A;  1EQ7 A;  4YI8 A;  2LXC B;  1JTH B;  3RBZ A;  5HLV A;  2P1J A;  1SQB J;  1ZMZ A;  1T6A A;  2BAS A;  2L91 A;  1PGP A;  2AMI A;  3B5N A;  4INW A;  2R5B A;  1RE3 C;  5D69 A;  4IFD K;  1EZV G;  3V5B A;  1IJD B;  1SQB K;  1JY3 O;  3TUY B;  3CCU P;  1RQV A;  1FZC A;  3F89 A;  3BOW A;  4ORA B;  4F7F A;  1LT9 C;  1WT6 A;  4KJM A;  2K2F A;  3DXL A;  1OW7 A;  4W80 A;  4D6T J;  4DUQ A;  5KAF H;  4AQI A;  5I2Q A;  3L71 G;  1FC2 C;  3GW6 A;  2O3J A;  3AKB A;  2CT9 A;  3L75 D;  4NPF X;  3SIB A;  1QIV A;  3M0D C;  1JO5 A;  3FS7 A;  2I1J A;  4OH8 B;  2L50 A;  2KS1 A;  3A4U B;  4DJG A;  3DY9 A;  1SQB G;  5AER A;  3MTU E;  1CFF A;  3MD0 A;  1JCC A;  2JC2 A;  1S6C A;  5C39 A;  1J7O A;  3S4R A;  4HKZ H;  1IG5 A;  2HQ8 A;  2Z4E A;  1FU1 A;  3HUS A;  3RK3 B;  2LV7 A;  2HPS A;  1Q80 A;  1KC8 Q;  2BCC J;  2A06 E;  4UB6 H;  1JSA A;  3BUO B;  2E74 D;  3BJH A;  3I5I C;  5D3O A;  3D73 A;  3HTK A;  5GTH E;  3CC2 P;  1K8A Q;  1XTC C;  4IOI H;  1YYC A;  4D6T G;  2QG4 A;  1YIJ P;  5KTY A;  3O6Q B;  2Q9I A;  4L75 A;  5DKN A;  1OMI A;  1ZN5 A;  2WWW A;  2B88 A;  4HRE E;  4RES B;  5DJT B;  1JC2 A;  1SQQ D;  4MBE A;  1AHR A;  1NIW A;  3K5B A;  2N1T C;  1QGK B;  3OP0 A;  2KAX A;  3IQO A;  1HWT C;  4M2Q A;  3GG2 A;  1B8C A;  2GA1 A;  3D0Y B;  1K04 A;  2PAL A;  3RGU A;  1QAT A;  4OGQ D;  2I8D A;  2MJZ A;  1BCC J;  2WT7 B;  3UNW A;  2CBL A;  3R1O A;  2K88 A;  3V2Q A;  3KEV A;  5KAF E;  4WY4 C;  1RF1 A;  1LVC D;  1NX3 A;  1JF2 A;  1R2U A;  5KJ7 C;  2BCC G;  3CCE P;  1QLE D;  2JPO A;  1RFJ A;  2OYH A;  3SG4 A;  1NU1 J;  3W68 A;  2A4J A;  1SKT A;  2ZND A;  2YMK A;  5B8I B;  2PFX A;  3EG5 B;  1AJ4 A;  1Y0V H;  3EVU A;  1KTM A;  3NXA A;  1A03 A;  3CTN A;  1MXL C;  2JPT A;  3VRQ A;  3H1K J;  3OHM B;  3NSL A;  1LA3 A;  5AW9 B;  2L98 A;  2Y0C A;  4MZJ A;  1SQX D;  2BEZ F;  2WND A;  1NU1 K;  2LAP A;  2ZVO B;  2Q3I A;  1S4X A;  1TIZ A;  1KFN A;  4U3F E;  4YGD B;  1UHI A;  1LTT C;  2KHN A;  4PV1 C;  4R4M A;  4M2O A;  3FE8 A;  4NDD A;  4OCI A;  2M7N A;  1NAF A;  4UB6 E;  2MA2 A;  5AVQ B;  3VMX A;  2QDI A;  3TDU A;  2WCJ A;  3M06 A;  1YJW P;  2R3C A;  1QEX A;  3H32 B;  3IFM A;  2JXL A;  3O78 A;  1BCC G;  3CXH I;  3MZW B;  1WMK A;  1VQ4 P;  1DVI A;  1SR6 B;  1VF5 D;  1PPJ G;  3B6X A;  2K61 A;  1F71 A;  2LMT A;  4LC1 A;  3L73 D;  5APS A;  3H1L J;  2IBZ E;  2M0R A;  3FE9 A;  2GV5 A;  1N2D C;  1RK9 A;  1EDK A;  1FDO A;  2XKM A;  1XA5 A;  5I2L A;  1QL1 A;  1NU1 G;  3TNU A;  5AVV B;  3GHG A;  2CXJ A;  1DF0 A;  4KT0 J;  2FYU E;  1F8H A;  2G3A A;  2E75 C;  5AVY B;  4HB1 A;  1E5W A;  3H1K G;  2KLE A;  4Z1M H;  3ZNI A;  4EIJ A;  2LVK A;  2ZT9 D;  3KXD A;  2LE9 B;  5E79 E;  2WSC H;  1MR8 A;  3FWB A;  1P84 I;  4JYB A;  3LW5 J;  2KYF A;  1SQV D;  1YJN P;  1KB9 I;  1YI2 P;  1BG1 A;  1VQP P;  2I94 A;  4RKU J;  2V4H A;  4ZKP A;  1NTM D;  2G2B A;  3B8E B;  1YUU A;  3CZ0 A;  1JNM A;  1KQF B;  5ER5 A;  3WXA A;  3KPE A;  1ZLL A;  3CWB E;  2HPC A;  3VGO A;  3H1L G;  2KGB C;  1XFX O;  3DYE A;  3A0H H;  3D75 A;  2PVB A;  2XND H;  1E79 H;  3JC2 2;  1FAV A;  4WQ2 A;  1CLB A;  1GD2 E;  1AP4 A;  4I5K A;  3L72 E;  4ZMD A;  1K93 D;  1GTW A;  2HOD A;  1WRG A;  3OBV A;  5B5E H;  3S0F A;  1IFN A;  1AQ5 A;  1JY3 P;  1BGY D;  1QJT A;  2OYI A;  3CCR P;  2BBN A;  1YUR A;  4AUW A;  1DJX A;  1YX8 A;  1L4A D;  5KLI B;  3HD7 D;  1DJH A;  4ORC B;  1HF9 A;  5CSJ A;  3IVT A;  1J7Q A;  4EOT A;  2D2C D;  1NX0 A;  1RTP 1;  1MZ9 A;  1HGV A;  1C3Y A;  2WCL A;  5AEQ A;  2KNC B;  2OS8 C;  4CLN A;  2IS9 A;  1PGJ A;  2QEB A;  3GK2 A;  1M46 A;  3MP7 B;  1CDP A;  2Y0D A;  4H44 B;  2JNF A;  1LWU B;  3JVT C;  2JUL A;  1L4A A;  1N7L A;  2MJW B;  1SS1 A;  2KP8 A;  3FXE A;  2JT8 A;  3HD7 A;  4L73 A;  3B5N C;  1SPY A;  1M39 A;  3SWY A;  2C0W A;  3RK2 B;  2MHH A;  4C7N B;  2KOG A;  1VQK P;  1S5L H;  4XFJ A;  3EFF K;  1CTR A;  3EK7 A;  1J1E B;  4OR9 B;  1HH0 A;  2AAO A;  2W83 C;  3QWO C;  4Y99 B;  1X02 A;  2EC6 B;  3G9R A;  1SW8 A;  3K21 A;  1PV3 A;  3A8R A;  3A0H E;  3L71 D;  2JNX A;  1CI6 A;  1YQ3 C;  1YTZ T;  3V4W A;  1CLM A;  4I1L A;  5TJH A;  5CJ0 A;  4H13 B;  4QMA A;  3L75 J;  3MGN A;  3EWK A;  1KYO I;  3DVK A;  2KXP B;  2GGM A;  2J59 M;  3WNX B;  4E68 A;  2WC6 A;  2ZXE B;  4YTP C;  1SQB D;  1ZV8 A;  1BU3 A;  1D7M A;  3TYY A;  2F2O A;  1LTI C;  1KK8 B;  2LVI A;  4PD4 H;  5CSI A;  1MKM A;  1FZC B;  1LNQ A;  1QV1 A;  1RE3 A;  2H8P D;  1KQS O;  1G33 A;  1VRK A;  1FZE A;  1EZV E;  4LGD E;  5DJU B;  1LT9 A;  1N7S D;  2GM4 A;  3PSR A;  2QJP B;  3V2N A;  1N65 A;  1JM0 A;  4HH2 A;  4ETO A;  1NX2 A;  1T3J A;  1H8A A;  4MZK A;  1NO4 A;  1ZR4 A;  1BDC A;  2KS1 B;  3L75 G;  2JU0 A;  3TS5 C;  3M0D A;  1IFM A;  3CR4 X;  2E74 C;  3H1H D;  1XFR A;  1FZF A;  1OXZ A;  1AA0 A;  3B88 A;  2RMZ A;  2OPO A;  2D8N A;  2VRG A;  1K9M Q;  2Q4U A;  3CL3 D;  5KU1 A;  2YGU A;  3NSK A;  3KQG A;  1KIL D;  1EXI A;  1GGW A;  1QLS A;  2LP2 A;  2BCC D;  2FYN C;  3O4X A;  3BCC D;  3CWG A;  2ZKM X;  5CJ4 A;  3BUM B;  1FDM A;  2JDI H;  1H4B A;  3CS1 A;  4H0L B;  1FI6 A;  3M9H A;  3OW2 O;  1OOJ A;  4EDF A;  3Q1M A;  2LNK A;  2MAZ A;  2E76 B;  2YKQ A;  1KIL A;  3SS5 A;  3VP8 A;  4D6T E;  1IQ5 A;  2ZRT A;  4WY4 D;  2CTN A;  3AE4 C;  3WUT A;  1W2B O;  2LC5 A;  5KJ7 D;  4ICB A;  2N1T A;  2H8V A;  2KB7 P;  1LTJ B;  1AVS A;  5BU8 B;  1B9A A;  2I7A A;  2B89 A;  1YTZ C;  2O01 J;  1TNQ A;  1B8L A;  4PE7 A;  2Q6Q A;  4C7R A;  1KQM B;  2J5U A;  1BCC D;  2F3Y A;  1A2X A;  3D77 A;  3VRR A;  1PPJ D;  1QLK A;  2IBZ I;  3L73 J;  4WY4 A;  3H25 A;  3CR5 X;  4PV1 D;  1YVH A;  5KJ7 A;  1J1D A;  5KKZ B;  1NU1 D;  1IZN B;  1DEE G;  3S0B A;  2LP3 A;  1A4P A;  1K94 A;  3CX5 H;  1WLM A;  2JWW A;  3L74 G;  3EKJ A;  2W8Z A;  1FOS E;  3D70 A;  3AAJ A;  2RGI A;  2K7C A;  2HQW A;  1VF5 C;  3CDN A;  1ZW0 A;  4IJ7 A;  1CMG A;  2Q5U A;  1NWD A;  2EGD A;  4PDZ A;  5HYD A;  1EH2 A;  1FZG A;  2KAY A;  2WVR A;  1SRA A;  1U5I B;  1TCF A;  1CKK A;  3LCP C;  1PAL A;  2BBM A;  4CFR A;  3CX5 D;  3AE8 C;  1W5C E;  2BAP A;  4GBA A;  1SQV J;  4QJ3 B;  1OE9 B;  4KHX A;  2AEJ A;  5APW A;  3O6B A;  1NTM J;  3RL0 B;  3CLN A;  2WMM A;  1KSM A;  1IFP A;  3BRT B;  4YGC B;  2BL0 B;  4DS7 A;  3L73 G;  1GL2 D;  3GHG B;  1DF0 B;  1G2C B;  2WSE J;  1N2D A;  3AE9 C;  3LW5 H;  5JOL A;  2R44 A;  5AVW B;  1UP5 A;  2ZJS E;  1IWQ A;  2OYI C;  1G1J A;  3ABV C;  3ZWH A;  2YO3 A;  1URQ D;  4TT3 H;  2NPS B;  2O60 A;  2AUC A;  5KTB A;  2K37 A;  4CFQ A;  3H1K E;  3JTD C;  3C9I A;  1M90 Q;  2L4H A;  1KQL A;  1ZUZ A;  2M97 A;  1SQV G;  3BRV B;  2QRX A;  1ORG A;  1EXR A;  5J3X A;  3FIA A;  1NYA A;  2FFD C;  3L70 E;  5DKR A;  1FPW A;  1BF5 A;  2Z5H A;  4GIF A;  4H44 D;  2ITA A;  1KFX S;  3C1L A;  1FE6 A;  2IFN A;  1NCX A;  1X22 A;  2FYZ A;  1VQ5 P;  2A45 G;  2ERB A;  2FJY A;  5AXI A;  2WC5 A;  3OX6 A;  1YRT B;  3H4S E;  3BVH A;  1IRJ A;  2K7O A;  1H89 A;  2KOT A;  2MLF C;  1NKZ B;  3B4S A;  4YI9 A;  1GK6 A;  1PP9 D;  1S26 D;  2WQY C;  4GNK B;  1WRL A;  2M8R A;  5TIS H;  1EDL A;  1N0Y A;  1PSB A;  2WPQ A;  2P7J A;  2QJK B;  2E42 A;  1E8A A;  3IAO A;  1G4Y R;  1LKJ A;  5CSN A;  3R4Y A;  1NTZ K;  4H13 D;  3T97 A;  5IBW A;  5AW5 B;  1NJI Q;  3GOF A;  1XK4 C;  1XYD A;  4K35 A;  3G4S P;  3G6E P;  4I6M C;  3A0B E;  3WUU A;  2M7L A;  4PE0 A;  4M2P A;  3D74 A;  1M1J B;  4IL6 H;  3O8Z A; 
#chains in the Genus database with same CATH homology
 1BOC A;  1H8B A;  1FW4 A;  2MA2 A;  1UWO A;  3TDU A;  2LVV A;  2BL0 C;  1UHK A;  2JXL A;  3O78 A;  1DVI A;  1SR6 B;  1AUI B;  1JF0 A;  2E6W A;  2K61 A;  1F71 A;  2HF5 A;  2LMT A;  1Y1A A;  4F0Z B;  1QAS A;  2WOR A;  2WCF A;  1ZFS A;  2M0R A;  1FBV A;  3TDZ A;  3ICB A;  1LIN A;  1WY9 A;  2GV5 A;  1RK9 A;  1GQM A;  4I5L B;  4JWQ A;  3PN7 B;  1M31 A;  1CNP A;  1XA5 A;  5I2L A;  1JWD A;  4HRH A;  1SK6 D;  4GGF A;  2CXJ A;  1DF0 A;  3I5G C;  3LK1 A;  1F8H A;  1SCM B;  1QX7 A;  2WOS A;  4BY4 A;  2LM5 A;  4MSP A;  2FJU B;  4XJK A;  2SCP A;  3EK4 A;  1PUL A;  3ZNI A;  2KNE A;  2LVK A;  1BT6 A;  1UHN A;  2LE9 B;  2WCE A;  1KQV A;  3TZ1 A;  4XJK B;  1JUO A;  3SIA A;  1MR8 A;  2LUC A;  1NPQ A;  3FWB A;  1YVL A;  1CFC A;  2KYF A;  1C7W A;  3CZT X;  2LLU A;  1HT9 A;  3KF9 A;  1BG1 A;  1CFP A;  2I18 A;  1IGV A;  2I94 A;  1B47 A;  1UHJ A;  1XFZ O;  2G2B A;  1UUR A;  3DVE A;  2ZRS A;  4D1E A;  1YUU A;  1MHO A;  3I5F B;  2JRF A;  2L2E A;  5ER5 A;  1KFU L;  3WXA A;  3E3R A;  2BCB A;  2WC8 A;  2JT3 A;  3VGO A;  1DTL A;  2FCD A;  2KGB C;  1SL9 A;  1XFX O;  4QJ4 B;  1NCY A;  1S5G Z;  4MRX A;  2PVB A;  2BCX A;  4N5X A;  2BEC A;  1EJ3 A;  1TTX A;  2F33 A;  3DVJ A;  4WQ2 A;  1BLQ A;  1CLB A;  1AP4 A;  4I5K A;  3PAT A;  2FCE A;  3BXK A;  1MXE A;  2KI6 D;  1K93 D;  1C7V A;  5HKY A;  1CM4 A;  3QRX A;  2MRD A;  1KWO C;  4IL1 A;  2MBX A;  1QX2 A;  1NUB A;  1QVI Y;  4PHN A;  1J7R A;  4YGA A;  2KSP A;  1DGU A;  2LCP A;  3AAK A;  1QJT A;  2BBN A;  1YUR A;  2ZN8 A;  2PRU A;  2LLT A;  1DJX A;  1YX8 A;  1DJH A;  2M29 A;  4ORC B;  4GPL B;  5CSJ A;  1J7Q A;  1NX0 A;  1RTP 1;  3VRP A;  1QXP A;  3O2P A;  5AEQ A;  1B7T Y;  1IH0 A;  4PHM A;  3WHU B;  5JJG A;  3VRN A;  2OS8 C;  4OKH A;  4CLN A;  1GGZ A;  1YUS A;  1OFC X;  2IS9 A;  2BCA A;  3GK2 A;  4FQO A;  3SG3 A;  1S36 A;  1CDL A;  1M46 A;  1AJ5 A;  1XO5 A;  2WCB A;  4JQ0 D;  1F54 A;  1CDP A;  2Y4Q A;  1KK7 Y;  1L7Z A;  2JNF A;  1MF8 B;  3JVT C;  3WHT B;  1NSH A;  2JXC A;  2NXQ A;  4CID A;  2JUL A;  3BYA A;  2MJW B;  2KFG A;  2JT8 A;  1SPY A;  2LUX A;  1TNP A;  1M39 A;  3HX4 A;  3SG6 A;  3TUY C;  1BMO A;  1QS7 A;  2OTG B;  4YGE B;  2KAV A;  2MHH A;  2JTT A;  2M3W A;  3KHE A;  1J1E A;  1REC A;  4P5O E;  3EKH A;  1ZAC A;  5BPJ A;  1PK0 D;  1EG4 A;  1CTR A;  3EK7 A;  3LK0 A;  4HSZ A;  3RLZ A;  1SL7 A;  4OR9 B;  1CMF A;  2AAO A;  2V53 A;  1K2H A;  3DVM A;  3PN7 C;  2KYC A;  3CR2 A;  3BUX B;  4YRU A;  1M63 B;  2F2P A;  3KO0 A;  1X02 A;  2EC6 B;  2SAS A;  1PRW A;  1K9P A;  1SW8 A;  3K21 A;  1SCM C;  3A8R A;  2ZN9 A;  2JTZ A;  4GGN A;  4GGF C;  2JNX A;  4PHK A;  2Y9Z A;  1CLM A;  2K0J A;  2F8P A;  2LMU A;  4ORB B;  5ER4 X;  1WDC B;  4I5J A;  1FI5 A;  1L2O B;  5HKZ A;  1DJI A;  4DRW A;  3DVK A;  2KI4 B;  5PAL A;  2GGM A;  1B7T Z;  1HQV A;  3CGA A;  1J7P A;  1G8I A;  3WNX B;  3EK8 A;  3BQ3 A;  3PM8 A;  1SCV A;  2H61 A;  2PMY A;  4E68 A;  1DT7 B;  1CDM A;  1DMO A;  2H2K A;  4UPG A;  1S1E A;  4MEW A;  4MZL A;  1F70 A;  3DF0 A;  4MVF A;  4U8D A;  1KK7 Z;  4NDB A;  1BU3 A;  4CPV A;  5KSZ A;  3SG2 A;  3I5F C;  2F2O A;  1KK8 B;  1MWN A;  2LVI A;  1BR4 B;  3DF0 B;  5CSI A;  1S6J A;  2NLN A;  4WRI A;  4C0J A;  1QV1 A;  1DJG A;  2Y1N A;  4TNC A;  1OMR A;  1PVB A;  1S3P A;  1Y1U A;  2ISD A;  2Y9Y A;  1G33 A;  1IJ6 A;  1VRK A;  3PSR A;  1LA0 A;  3NSI A;  5CSF A;  2M1U A;  2G9B A;  2LAN A;  1N65 A;  1WLZ A;  1ALW A;  1TNW A;  3IQQ A;  4YGB B;  1NX2 A;  5AAN A;  1PSR A;  4ETO A;  1MUX A;  1S6I A;  2DOQ A;  3LL8 B;  1LXF C;  4MZK A;  3PLF B;  2K2A A;  4XYN A;  4MRY A;  1BJF A;  1JBA A;  5I2O A;  1IJ5 A;  5CPV A;  1KCY A;  1F4O A;  1QX5 B;  1YUT A;  4WQ3 A;  3PFV A;  2JU0 A;  3TS5 C;  1OQP A;  4PHJ A;  3CR4 X;  3SG7 A;  3I5G B;  2HET A;  1K96 A;  2R2I A;  1CB1 A;  1F4Q A;  2OPO A;  1DJZ A;  1QIW A;  1WRZ A;  2D8N A;  2VRG A;  3KPX A;  1XFW O;  2Q4U A;  3I5H B;  5KU1 A;  3NSK A;  1UHH A;  1YR5 A;  2K7D A;  2NCP A;  1XFU O;  1JFK A;  4R1E A;  2KI6 C;  1GGW A;  1QLS A;  2LP2 A;  1R6P A;  2CCM A;  2JQ6 A;  1EL4 A;  4DCK A;  1A75 A;  2KBM A;  1BR1 B;  3CWG A;  4C0K A;  2ZKM X;  2FOT A;  3BUM B;  3D10 A;  2BE4 A;  1H4B A;  1A75 B;  3CS1 A;  3TDI A;  2ZFD A;  3JTD B;  1SBJ A;  1FI6 A;  1OOJ A;  3DD4 A;  2LNK A;  3OB2 B;  2MAZ A;  4YBH B;  2LVJ A;  3GK4 X;  2M8U A;  3I5I B;  4ZCV A;  1J55 A;  1K95 A;  3GK1 A;  2M49 B;  3EVR A;  4N1G A;  5GQQ C;  1IQ5 A;  2ZRT A;  2QPT A;  2CTN A;  2GGZ A;  5G08 A;  5HKW A;  1BOD A;  2LC5 A;  4ICB A;  1F55 A;  1K8U A;  2L51 A;  2EHB A;  1OSA A;  1AVS A;  1UUS A;  1B9A A;  2I7A A;  3IF7 A;  2JZI A;  1YTZ C;  3SJS A;  1MQ1 A;  1KWO B;  1IQ3 A;  1TNQ A;  1B8L A;  1CFD A;  1SR6 C;  4PE7 A;  1FF1 A;  2JT0 A;  2QAC A;  1KQM B;  1V1G A;  1TOP A;  1WDC C;  2BE6 A;  2F3Y A;  2KGR A;  1A2X A;  1JFJ A;  1L2O C;  4NDC A;  4I5N B;  4ZCU A;  5TNC A;  1C07 A;  1KFU S;  3VRR A;  2KI4 C;  4P2Y B;  4AQJ A;  3AKA A;  2LHI A;  1DGV A;  1IKU A;  1QLK A;  1QVI Z;  1DJW A;  2L5X B;  3CR5 X;  1YVH A;  3PAL A;  4A4C A;  2M9G A;  1J1D A;  1B4C A;  2NZ0 A;  2H61 C;  4YI8 A;  2LP3 A;  1A4P A;  2K8M B;  1K94 A;  1WRK A;  5HLV A;  1KK8 C;  1WLM A;  1DJY A;  2JWW A;  3EKJ A;  4OV2 A;  1ZMZ A;  3OB1 B;  1SMG A;  2JOJ A;  3AAJ A;  2RGI A;  2K7C A;  2HQW A;  1RRO A;  2AMI A;  5AFP A;  2BKH B;  1U5I A;  3O4Y A;  1CMG A;  4NQG A;  1XFY O;  4C0L A;  1NWD A;  5D69 A;  2EGD A;  4PDZ A;  5HYD A;  1EH2 A;  4AOM A;  2KAY A;  1KFX L;  4GAO A;  1SRA A;  1U5I B;  1TCF A;  1XK4 A;  3TUY B;  1CKK A;  3LCP C;  1PAL A;  2BBM A;  4CFR A;  1SL8 A;  1S5G Y;  3BOW A;  2KFF A;  4N1F A;  4ORA B;  4GBA A;  4QJ3 B;  1OE9 B;  1OMD A;  4FTG A;  2K2F A;  3BOW B;  2CNP A;  2KQ6 A;  1Y6W A;  4USL A;  4DUQ A;  3O6B A;  3CLN A;  2I2R E;  1TNX A;  1KSM A;  1EG3 A;  1M45 A;  4AQI A;  5I2Q A;  1K9K A;  4YGC B;  2BL0 B;  1XFV O;  3AKB A;  2CT9 A;  4L9M A;  3SIB A;  1QIV A;  5HLO A;  4DS7 A;  5I8N A;  4GUK A;  4MLW A;  4OVN F;  1ALV A;  1DF0 B;  3FS7 A;  3LLE A;  1NX1 A;  3C1V A;  3I5H C;  2PAS A;  2L50 A;  1N2D A;  5JOL A;  2Y5I A;  3A4U B;  1UP5 A;  5AER A;  3F45 A;  1CFF A;  2KQY A;  1IWQ A;  2JC2 A;  1S6C A;  1GJY A;  1J7O A;  1IG5 A;  1W7J B;  2HQ8 A;  5D7F A;  2MLE C;  3ZWH A;  2K7B A;  2LV7 A;  2O60 A;  2AUC A;  4HRG A;  3BUN B;  2HPS A;  1ODB A;  2O5G A;  4CFQ A;  1NP8 A;  1Q80 A;  1W7I B;  1K9U A;  3SG5 A;  3JTD C;  2L4H A;  1JSA A;  3BUO B;  1V1F A;  1ZUZ A;  1RWY A;  2PSR A;  2M97 A;  3I5I C;  2B1U A;  1CDN A;  1EXR A;  2L4I A;  1K90 D;  5J3X A;  1SYM A;  2M1K B;  4MN0 A;  2L0P A;  3RM1 A;  2LMV A;  3FIA A;  1NYA A;  5KTY A;  1XVJ A;  5DKR A;  1TCO B;  1YRU B;  5DKN A;  1FPW A;  1BF5 A;  2COL B;  4M2P A;  4HRE E;  1D1O A;  1JC2 A;  2TN4 A;  4MBE A;  1AHR A;  1NIW A;  2OTG C;  3D0Y A;  1B8R A;  1KFX S;  1B1G A;  1OZS A;  4A4B A;  4DIR A;  1KSO A;  3BUW B;  3OP0 A;  1NCX A;  2KAX A;  3IQO A;  3VRO A;  4M2Q A;  1KQM C;  1B8C A;  4PCW A;  3D0Y B;  2ZNE A;  2NCO A;  5AXI A;  3OX6 A;  3NSO A;  2PAL A;  2KDH A;  3TS5 B;  1A29 A;  1YRT B;  1QAT A;  3H4S E;  1IRJ A;  2K7O A;  3EVV A;  4Q04 A;  2KOT A;  2Q91 A;  3OX5 A;  2MLF C;  4QJ5 B;  2EC6 C;  4YI9 A;  2Y1M A;  1S26 D;  2CBL A;  1TRF A;  1ZOT B;  4GNK B;  1WRL A;  1QV0 A;  2KBI A;  3KEV A;  3FWC A;  5DKQ A;  4BY5 A;  1LVC D;  1QTX A;  1NX3 A;  1JF2 A;  1R2U A;  4PE4 A;  3MSE B;  1N0Y A;  2E30 A;  1PSB A;  2F3Z A;  1TN4 A;  2P6B B;  5FYX A;  1E8A A;  1RFJ A;  3SG4 A;  3M0W A;  2A4J A;  1SKT A;  2ZND A;  1OMV A;  1G4Y R;  2LHL A;  1LKJ A;  5B8I B;  5CSN A;  4PE1 A;  1Y1X A;  1AJ4 A;  1Y0V H;  3HCM A;  1RJV A;  3EVU A;  3NXA A;  1A03 A;  3CTN A;  1MXL C;  2JPT A;  3VRQ A;  2KFH A;  3NSL A;  1LA3 A;  3OHM B;  4GFT A;  2L98 A;  1OZO A;  5IBW A;  4MZJ A;  2WND A;  1CM1 A;  1NCZ A;  2LAP A;  2OS8 B;  1TIZ A;  3GOF A;  4JPZ B;  4YGD B;  1XK4 C;  1XYD A;  1UHI A;  1AK8 A;  1PVA A;  1SNL A;  2KHN A;  5K89 A;  2BKI B;  5F6T A;  1YX7 A;  4M2O A;  1SY9 A;  2M7L A;  4PE0 A;  4NDD A;  4OCI A;  4PAL A;  2M7N A;  3JVT B;  1CLL A;  2LLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...