1C3YA

Thp12-carrier protein from yellow meal worm
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THP12 CARRIER PROTEIN
publication title A new class of hexahelical insect proteins revealed as putative carriers of small hydrophobic ligands.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Antifreeze protein
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1c3yA00
2GTEA 4FQTA 1DQEA 4INWA 3D73A 4JD9A 2QEVA 3D74A 3OGNA 1ORGA 1OW4A 1OOFA 3NHTA 1TWOA 3FE6A 2QEBA 3FE8A 3K1EA 3S0DA 3Q8IA 3B86A 2ERBA 3DY9A 1QWVA 2QEHA 1OOGA 3S0GA 3L47A 2QEOA 2WCKA 4INXA 2FJYA 3D75A 3S0AA 1C3YA 3CDNA 2JPOA 3CZ2A 3D78A 2WC5A 3BFBA 3PJIA 2L2CA 3BFHA 3L4AA 5DICA 5EL2A 3L4LA 1XFRA 3D77A 1TUJA 3S0FA 3CZ1A 3BFAA 1OOHA 4F7FA 4PT1A 3VB1A 3B6XA 3RZSA 3S0EA 1P28A 2KPHA 3R1PA 1C3ZA 2H8VA 2WCMA 3BJHA 2WC6A 3CZ0A 2P71A 2QDIA 1OOIX 3NGVA 2PQLA 3D76A 4OZDA 3N7HA 3S0BA 2P70A 3R1VA 1LS8A 3V2LA 3B88A 2WCJA 3NHIA 3R72A 1T14A 3R1OA 3B7AA 1GM0A 3QMEA 3DZTA 2WCLA 2WCHA 3B87A 3DXLA 3CABA 3DYEA 3FE9A 3CYZA
chains in the Genus database with same CATH superfamily
4L9MA 2LMTA 4GFTA 1QVIZ 1IIOA 2KI4B 1DJGA 4WRIA 1F70A 1C7WA 5HYDA 1FI5A 2NZ0A 3VRNA 1J1DA 4GUKA 2HQWA 1K94A 1N0YA 3PLFB 1RECA 1CTRA 1K8UA 2IS9A 2LE9B 4BY5A 2LUXA 3PATA 4HRHA 4D1EA 3CR2A 2PASA 1K9PA 2E30A 4UPGA 1OMVA 3FE8A 2K7OA 2BE4A 3BYAA 3WXAA 5I2QA 1D1OA 2I2RE 3B86A 3EVUA 2WOSA 2AUCA 1BR1B 3IQOA 2L51A 4MRYA 3LLEA 1AK8A 2ERBA 1BU3A 1JF0A 1GJYA 1XFWO 4JQ0D 2LVKA 1SL7A 1QIWA 3DY9A 1YUUA 1BG1A 1W7JB 2F8PA 4PE0A 3AAJA 1SCVA 2L4IA 2MJWB 2RGIA 1S36A 3IF7A 3O4YA 1GGWA 1OOGA 3NSLA 3WHUB 3S0GA 4M2OA 3LK0A 2QEOA 2Y1NA 1QIVA 4INXA 1AVSA 1MXEA 2L98A 3TS5C 3D75A 5JJGA 2B1UA 2LP3A 1OE9B 3CDNA 2KOTA 1QJTA 1KWOB 1YVLA 3OBVA 1Y6WA 4JKTA 3FIAA 4PE4A 2M3WA 5EL2A 2M7LA 1DJWA 2V53A 1V1GA 2L2EA 4NDDA 1G8IA 3PSRA 1BF5A 4GBAA 1FF1A 3TS5B 2WC8A 1B8CA 1DT7B 1M46A 2I94A 3BFAA 2K2AA 1W7IB 1IWQA 1CLMA 2NCPA 4I5JA 5DKRA 4CLNA 1DJZA 1IKUA 1RTP1 3RZSA 3S0EA 2BNXA 3EK8A 1IG5A 1TN4A 5F6TA 1P28A 1CLLA 1GGZA 2AAOA 5FI2A 5I2OA 2K61A 2MHHA 3VRPA 1MUXA 3CR4X 1B7TY 2NCOA 2KAXA 2M1KB 1DEKA 1QV0A 3AKAA 4OV2A 5I2LA 1K96A 1CLBA 1Y1XA 3BXKA 4YGCB 2QDIA 3TDIA 1TCOB 3F45A 2KFFA 3SIAA 2KI6D 5D3OA 3C1VA 2CTNA 1YURA 2Y4QA 2M9GA 1ALWA 2M1UA 4YGDB 2JTTA 4WQ3A 2ZRSA 3SG6A 3BUOB 3IQQA 1LS8A 3O4XA 2JU0A 3O78A 3B88A 2MAZA 3TDZA 1J1EA 4HSZA 5IBWA 4TNCA 4I5KA 5BPJA 2KLDA 2FJUB 3NHIA 4FQOA 1ZACA 1QTXA 2M29A 3SS4A 1GM0A 1SK6D 3QMEA 3SS5A 1BLQA 1J7OA 1OOJA 1CFFA 4QJ5B 2M0RA 5K89A 4DCKA 2WCLA 3FS7A 1JFKA 2WCHA 1CKKA 3SG7A 3DXLA 5CSFA 5I94A 2MA2A 3RM1A 3CYZA 2GTEA 3AKBA 2Q4UA 3PM2A 1OMDA 5FI6A 2ISDA 3BQ3A 2BECA 4INWA 1UUSA 2ZNEA 3D73A 4JD9A 3D74A 3PALA 1OQPA 4DRWA 2KHNA 1CM4A 1CFDA 4A4CA 4YI8A 3CLNA 1AUIB 2BCAA 2KAVA 1EG4A 1SMGA 1MR8A 1R6PA 1B7TZ 2LHIA 2M49B 3I5FC 2KYFA 1OSAA 4OCIA 4QJ4B 3OB1B 1DGVA 3DF0A 2QEBA 1XFYO 4PE7A 3S0DA 2L5XB 3KHEA 1XFVO 2K2FA 1IJ5A 1B47A 1QLKA 3DVMA 1K93D 2BKIB 4YRUA 1U5IB 1SSEB 2K60A 2NLNA 4AQJA 1CFPA 1G33A 4ORCB 1KK8B 2BBMA 2HETA 2D8NA 1MQ1A 3D10A 3HX4A 1H8BA 2COLB 1DJYA 1GQMA 2L0PA 4CPVA 2KAYA 1J7RA 4ORBB 1QASA 1AJ5A 2MLEC 3BOWA 2WCBA 1XVJA 3I5GB 2WCKA 1QS7A 1K95A 1TOPA 5D69A 2F33A 2JC2A 1C3YA 3A4UB 1DGUA 2JNXA 3UO9A 1DVIA 2PMYA 1IQ3A 3I5HC 2WC5A 3BFBA 3EVVA 1WRLA 1KSMA 1NWDA 2L2CA 3E3RA 3KPXA 1PRWA 4GGNA 1KCYA 1NIWA 1B8RA 1PSBA 4OVNF 3L4LA 4I5NB 4R1EA 3SJSA 3GK4X 1CFCA 2PYQA 4C0JA 1BR4B 1MHOA 2PSRA 1BMOA 3D0YA 3S0FA 1B4CA 4PCWA 3GK1A 1SR6C 3CZ1A 1MF8B 2CBLA 2E6WA 2VRGA 1IQ5A 1OOHA 4YGAA 1X02A 2ZKMX 1FW4A 3I5HB 1KFXL 1UHHA 3B6XA 3PFVA 1JWDA 1L7ZA 1S1EA 1S6IA 2BBNA 5CSJA 1EJ3A 1J55A 3EKHA 2JZIA 2KBIA 1WLZA 1C3ZA 4GAOA 4USLA 5GQQC 1ZFSA 2Y5IA 3BOWB 3BJHA 2M97A 1SR6B 4PE1A 1S5GZ 1NCXA 2WC6A 1BJFA 2KLEA 1KQMC 2LVIA 3JTDC 4AOMA 3CR5X 1M45A 1YX7A 2JXCA 1KFUS 2BE6A 1LVCD 2P71A 1QX2A 3NGVA 1CDLA 3UNWA 1TNXA 2CT9A 3FWCA 3D76A 2KNEA 2KYCA 2EC6C 2H2KA 2KI6C 3OP0A 2JNFA 1QX7A 4ICBA 1NYAA 1XO5A 1JF2A 2QPTA 4IJ7A 4WQ2A 5HKZA 1E8AA 1KQMB 1WRZA 3N7HA 4XJKA 2P70A 2JULA 3JTDB 3S0BA 5HL1A 1BT6A 3NSOA 1EG3A 1NPQA 2BCBA 2G2BA 1UHIA 1WDCC 4ETOA 2OPOA 1SL8A 1UWOA 1W9ZA 1TNQA 2JT0A 1UURA 1V1FA 3R72A 1DJIA 1BODA 4MZKA 4JPZB 3BUXB 2CXJA 2PRUA 3MSEB 5AANA 3TUYC 2K8MB 4ZCVA 2F2PA 2F3ZA 1F4QA 5DKQA 1CMGA 3ZWHA 3EKJA 1N2DA 3VGOA 5PALA 1ODBA 3FE9A 1TTXA 1YX8A 1KFXS 5HKWA 1CM1A 1J7QA 1XK4A 1YRUB 3QRXA 4FQTA 5KSZA 2KQ6A 1DJXA 3NSIA 3GOFA 2QEVA 2HPSA 4HRGA 4PHMA 4N5XA 2HF5A 1OOFA 1SY9A 3NHTA 1CDMA 1TWOA 1BOCA 4PALA 2A4JA 3VROA 2GGZA 5FI7A 4QJ3B 5JOLA 2BKHB 1NCZA 1NX2A 4CFQA 4NDBA 5CPVA 3Q8IA 4DUQA 2KDHA 2LVJA 2LLSA 2GGMA 1UHKA 3EK4A 1NP8A 1WLMA 2LM5A 4ORAB 1A4PA 1SW8A 4ZCUA 2DOQA 1SNLA 1ZMZA 2OS8C 4GGFA 2QEHA 2JXLA 3CGAA 1YUTA 3TDUA 1DELA 2WCFA 1ZUZA 1AP4A 3I5IC 2LAPA 1DF0A 2LLUA 4YGEB 5AFPA 1LXFC 2P6BB 2JT8A 2FJYA 1QV1A 1LKJA 2M8UA 1DMOA 1TNWA 4MSPA 4MLWA 1CDNA 2JPOA 1Y1AA 1A29A 1A75A 1MWNA 1S5GY 2OS8B 2YGUA 3CZ2A 4OR9B 1JBAA 3PJIA 1G4YR 1SYMA 2AMIA 5D7FA 5HKYA 3BFHA 1F8HA 2KFHA 1XFRA 3D77A 1L2OC 4GNKB 1RJVA 4CFRA 1KFUL 3LK1A 3PN7C 3I5FB 2F2OA 3DD4A 4F7FA 5CSIA 1HQVA 2LV7A 3VB1A 4C0LA 1F4OA 3DVJA 4MBEA 1CMFA 1WY9A 1K90D 2KPHA 3KEVA 3R1PA 1L2OB 2Y1MA 1NX3A 4Q04A 2H8VA 1JFJA 1ALVA 2TN4A 1QXPA 2KSPA 3PN7B 1HT9A 3EK7A 2H61A 2BCXA 4M2PA 4CIDA 5HLOA 4A4BA 2WNDA 3DVKA 3CZ0A 2JT3A 1OOIX 2KFGA 2L5YA 1KSOA 2PALA 5DKNA 1K9UA 3DF0B 2BAPA 2R2IA 2MRDA 1K2HA 2PQLA 4P5OE 1OZOA 1AHRA 1S6CA 1TCFA 2GV5A 3NXAA 3SG4A 1DJHA 2JTZA 2LMVA 3KO0A 2LCPA 1Q80A 1S3PA 2EGDA 1JC2A 3R1VA 1M31A 2FCDA 1AJ4A 2H61C 3OHMB 1YUSA 2WCJA 3M0WA 3CWGA 1UHNA 1T14A 3IVTA 3R1OA 2FCEA 2LANA 3RLZA 1MXLC 1OMRA 5AXIA 2NXQA 3A8RA 1KK7Y 1WRKA 1LA3A 3HCMA 3ICBA 2QACA 3DZTA 2LUCA 1S26D 4I5LB 4BY4A 1Z4HA 4C0KA 1PSRA 3PM8A 1SKTA 4MZLA 3KF9A 3B87A 1H4BA 5CSNA 2LHLA 4GPLB 1NX0A 4DIRA 2WCEA 5J3XA 4YGBB 5B8IB 3SG3A 1QATA 2SCPA 1KWOC 2MLFC 5KTYA 1UP5A 1DQEA 1B8LA 4YBHB 2LC5A 3D0YB 1NSHA 2K7BA 3TZ1A 1FI6A 2LNKA 2BL0C 4MEWA 1S6JA 1RFJA 3OGNA 1IH0A 1K9KA 5FYXA 3CS1A 1ORGA 4XYNA 1OW4A 1C7VA 1UHJA 3FE6A 3VRRA 2WORA 1PVBA 1B1GA 2EC6B 1NUBA 1F55A 2ZFDA 5I8NA 4FTGA 2K7CA 4P2YB 1RK9A 3K1EA 1CDPA 2BL0B 3ZNIA 1WDCB 3JVTC 3SG2A 3O2PA 2KGBC 1TRFA 2LLTA 3SG5A 1EH2A 1IJ6A 4NDCA 2O5GA 1NX1A 1JUOA 5G08A 1F54A 1QWVA 2PVBA 1TIZA 1CNPA 2L50A 3TUYB 4MN0A 3L47A 3GK2A 3JVTB 1CB1A 4XJKB 1QX5B 2M7NA 3S0AA 4PHNA 4DS7A 1Y1UA 4N1FA 5ER5A 4E68A 1KK7Z 1SCMC 3CTNA 3D78A 1XFUO 3BUMB 3O6BA 1XFXO 4JWQA 3LCPC 1SPYA 3L4AA 5DICA 1PALA 3SS3A 1M39A 1XK4C 3AAKA 4HREE 1TUJA 4M2QA 1SBJA 1FPWA 2ZRTA 1SRAA 3K21A 2ZNDA 4IL1A 5ER4X 4NQGA 1FBVA 2CNPA 2I7AA 1SCMB 2KBMA 1QVIY 1XA5A 1IGVA 2SASA 1A2XA 4PT1A 3EG5B 3BUNB 3VRQA 1XFZO 2JWWA 2HQ8A 1DC1A 4PDZA 2K0JA 4MVFA 1TUZA 2JRFA 5HLVA 3NSKA 2FOTA 1PULA 4MRXA 2JPTA 1F71A 2WCMA 1YVHA 3LL8B 2Q91A 1SL9A 5KU1A 4PHJA 5AERA 2ZN9A 3WNXB 1YRTB 3WHTB 1U5IA 1EL4A 2F3YA 1R2UA 3OX5A 4KYNA 2ZN8A 4AQIA 1TNPA 3CZTX 3FWBA 4PHKA 4YI9A 2EHBA 3BUWB 1QLSA 4GGFC 1Y0VH 1C07A 3I5IB 1DTLA 3SIBA 1LINA 3H4SE 2JOJA 1A03A 1IRJA 1PVAA 1YTZC 1NCYA 2I18A 1RWYA 4OZDA 1OZSA 2KGRA 1YR5A 1XYDA 1RROA 2L4HA 2LMUA 4U8DA 1LA0A 1B9AA 3OB2B 3V2LA 2CCMA 2LP2A 1ZOTB 2K7DA 4OKHA 2KQYA 2OTGC 3OX6A 2O60A 3DVEA 1KK8C 1J7PA 3B7AA 1N65A 1JSAA 4MZJA 1KQVA 2LVVA 5AEQA 2MBXA 3EVRA 1DF0B 4F0ZB 2KI4C 1PK0D 3I5GC 1M63B 2G9BA 2JQ6A 1A75B 1EXRA 2OTGB 5TNCA 4N1GA 1Z2CB 3CABA 3DYEA 1VRKA
chains in the Genus database with same CATH topology
2GTEA 4FQTA 1DQEA 4INWA 3D73A 4JD9A 2QEVA 3D74A 3OGNA 1ORGA 1OW4A 1OOFA 3NHTA 1TWOA 3FE6A 2QEBA 3FE8A 3K1EA 3S0DA 3Q8IA 3B86A 2ERBA 3DY9A 1QWVA 2QEHA 1OOGA 3S0GA 3L47A 2QEOA 2WCKA 4INXA 2FJYA 3D75A 3S0AA 1C3YA 3CDNA 2JPOA 3CZ2A 3D78A 2WC5A 3BFBA 3PJIA 2L2CA 3BFHA 3L4AA 5DICA 5EL2A 3L4LA 1XFRA 3D77A 1TUJA 3S0FA 3CZ1A 3BFAA 1OOHA 4F7FA 4PT1A 3VB1A 3B6XA 3RZSA 3S0EA 1P28A 2KPHA 3R1PA 1C3ZA 2H8VA 2WCMA 3BJHA 2WC6A 3CZ0A 2P71A 2QDIA 1OOIX 3NGVA 2PQLA 3D76A 4OZDA 3N7HA 3S0BA 2P70A 3R1VA 1LS8A 3V2LA 3B88A 2WCJA 3NHIA 3R72A 1T14A 3R1OA 3B7AA 1GM0A 3QMEA 3DZTA 2WCLA 2WCHA 3B87A 3DXLA 3CABA 3DYEA 3FE9A 3CYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTE A;  4FQT A;  1DQE A;  4INW A;  3D73 A;  4JD9 A;  2QEV A;  3D74 A;  3OGN A;  1ORG A;  1OW4 A;  1OOF A;  3NHT A;  1TWO A;  3FE6 A;  2QEB A;  3FE8 A;  3K1E A;  3S0D A;  3Q8I A;  3B86 A;  2ERB A;  3DY9 A;  1QWV A;  2QEH A;  1OOG A;  3S0G A;  3L47 A;  2QEO A;  2WCK A;  4INX A;  2FJY A;  3D75 A;  3S0A A;  1C3Y A;  3CDN A;  2JPO A;  3CZ2 A;  3D78 A;  2WC5 A;  3BFB A;  3PJI A;  2L2C A;  3BFH A;  3L4A A;  5DIC A;  5EL2 A;  3L4L A;  1XFR A;  3D77 A;  1TUJ A;  3S0F A;  3CZ1 A;  3BFA A;  1OOH A;  4F7F A;  4PT1 A;  3VB1 A;  3B6X A;  3RZS A;  3S0E A;  1P28 A;  2KPH A;  3R1P A;  1C3Z A;  2H8V A;  2WCM A;  3BJH A;  2WC6 A;  3CZ0 A;  2P71 A;  2QDI A;  1OOI X;  3NGV A;  2PQL A;  3D76 A;  4OZD A;  3N7H A;  3S0B A;  2P70 A;  3R1V A;  1LS8 A;  3V2L A;  3B88 A;  2WCJ A;  3NHI A;  3R72 A;  1T14 A;  3R1O A;  3B7A A;  1GM0 A;  3QME A;  3DZT A;  2WCL A;  2WCH A;  3B87 A;  3DXL A;  3CAB A;  3DYE A;  3FE9 A;  3CYZ A; 
#chains in the Genus database with same CATH topology
 4L9M A;  2LMT A;  4GFT A;  1QVI Z;  1IIO A;  2KI4 B;  1DJG A;  4WRI A;  1F70 A;  1C7W A;  5HYD A;  1FI5 A;  2NZ0 A;  3VRN A;  1J1D A;  4GUK A;  2HQW A;  1K94 A;  1N0Y A;  3PLF B;  1REC A;  1CTR A;  1K8U A;  2IS9 A;  2LE9 B;  4BY5 A;  2LUX A;  3PAT A;  4HRH A;  4D1E A;  3CR2 A;  2PAS A;  1K9P A;  2E30 A;  4UPG A;  1OMV A;  3FE8 A;  2K7O A;  2BE4 A;  3BYA A;  3WXA A;  5I2Q A;  1D1O A;  2I2R E;  3B86 A;  3EVU A;  2WOS A;  2AUC A;  1BR1 B;  3IQO A;  2L51 A;  4MRY A;  3LLE A;  1AK8 A;  2ERB A;  1BU3 A;  1JF0 A;  1GJY A;  1XFW O;  4JQ0 D;  2LVK A;  1SL7 A;  1QIW A;  3DY9 A;  1YUU A;  1BG1 A;  1W7J B;  2F8P A;  4PE0 A;  3AAJ A;  1SCV A;  2L4I A;  2MJW B;  2RGI A;  1S36 A;  3IF7 A;  3O4Y A;  1GGW A;  1OOG A;  3NSL A;  3WHU B;  3S0G A;  4M2O A;  3LK0 A;  2QEO A;  2Y1N A;  1QIV A;  4INX A;  1AVS A;  1MXE A;  2L98 A;  3TS5 C;  3D75 A;  5JJG A;  2B1U A;  2LP3 A;  1OE9 B;  3CDN A;  2KOT A;  1QJT A;  1KWO B;  1YVL A;  3OBV A;  1Y6W A;  4JKT A;  3FIA A;  4PE4 A;  2M3W A;  5EL2 A;  2M7L A;  1DJW A;  2V53 A;  1V1G A;  2L2E A;  4NDD A;  1G8I A;  3PSR A;  1BF5 A;  4GBA A;  1FF1 A;  3TS5 B;  2WC8 A;  1B8C A;  1DT7 B;  1M46 A;  2I94 A;  3BFA A;  2K2A A;  1W7I B;  1IWQ A;  1CLM A;  2NCP A;  4I5J A;  5DKR A;  4CLN A;  1DJZ A;  1IKU A;  1RTP 1;  3RZS A;  3S0E A;  2BNX A;  3EK8 A;  1IG5 A;  1TN4 A;  5F6T A;  1P28 A;  1CLL A;  1GGZ A;  2AAO A;  5FI2 A;  5I2O A;  2K61 A;  2MHH A;  3VRP A;  1MUX A;  3CR4 X;  1B7T Y;  2NCO A;  2KAX A;  2M1K B;  1DEK A;  1QV0 A;  3AKA A;  4OV2 A;  5I2L A;  1K96 A;  1CLB A;  1Y1X A;  3BXK A;  4YGC B;  2QDI A;  3TDI A;  1TCO B;  3F45 A;  2KFF A;  3SIA A;  2KI6 D;  5D3O A;  3C1V A;  2CTN A;  1YUR A;  2Y4Q A;  2M9G A;  1ALW A;  2M1U A;  4YGD B;  2JTT A;  4WQ3 A;  2ZRS A;  3SG6 A;  3BUO B;  3IQQ A;  1LS8 A;  3O4X A;  2JU0 A;  3O78 A;  3B88 A;  2MAZ A;  3TDZ A;  1J1E A;  4HSZ A;  5IBW A;  4TNC A;  4I5K A;  5BPJ A;  2KLD A;  2FJU B;  3NHI A;  4FQO A;  1ZAC A;  1QTX A;  2M29 A;  3SS4 A;  1GM0 A;  1SK6 D;  3QME A;  3SS5 A;  1BLQ A;  1J7O A;  1OOJ A;  1CFF A;  4QJ5 B;  2M0R A;  5K89 A;  4DCK A;  2WCL A;  3FS7 A;  1JFK A;  2WCH A;  1CKK A;  3SG7 A;  3DXL A;  5CSF A;  5I94 A;  2MA2 A;  3RM1 A;  3CYZ A;  2GTE A;  3AKB A;  2Q4U A;  3PM2 A;  1OMD A;  5FI6 A;  2ISD A;  3BQ3 A;  2BEC A;  4INW A;  1UUS A;  2ZNE A;  3D73 A;  4JD9 A;  3D74 A;  3PAL A;  1OQP A;  4DRW A;  2KHN A;  1CM4 A;  1CFD A;  4A4C A;  4YI8 A;  3CLN A;  1AUI B;  2BCA A;  2KAV A;  1EG4 A;  1SMG A;  1MR8 A;  1R6P A;  1B7T Z;  2LHI A;  2M49 B;  3I5F C;  2KYF A;  1OSA A;  4OCI A;  4QJ4 B;  3OB1 B;  1DGV A;  3DF0 A;  2QEB A;  1XFY O;  4PE7 A;  3S0D A;  2L5X B;  3KHE A;  1XFV O;  2K2F A;  1IJ5 A;  1B47 A;  1QLK A;  3DVM A;  1K93 D;  2BKI B;  4YRU A;  1U5I B;  1SSE B;  2K60 A;  2NLN A;  4AQJ A;  1CFP A;  1G33 A;  4ORC B;  1KK8 B;  2BBM A;  2HET A;  2D8N A;  1MQ1 A;  3D10 A;  3HX4 A;  1H8B A;  2COL B;  1DJY A;  1GQM A;  2L0P A;  4CPV A;  2KAY A;  1J7R A;  4ORB B;  1QAS A;  1AJ5 A;  2MLE C;  3BOW A;  2WCB A;  1XVJ A;  3I5G B;  2WCK A;  1QS7 A;  1K95 A;  1TOP A;  5D69 A;  2F33 A;  2JC2 A;  1C3Y A;  3A4U B;  1DGU A;  2JNX A;  3UO9 A;  1DVI A;  2PMY A;  1IQ3 A;  3I5H C;  2WC5 A;  3BFB A;  3EVV A;  1WRL A;  1KSM A;  1NWD A;  2L2C A;  3E3R A;  3KPX A;  1PRW A;  4GGN A;  1KCY A;  1NIW A;  1B8R A;  1PSB A;  4OVN F;  3L4L A;  4I5N B;  4R1E A;  3SJS A;  3GK4 X;  1CFC A;  2PYQ A;  4C0J A;  1BR4 B;  1MHO A;  2PSR A;  1BMO A;  3D0Y A;  3S0F A;  1B4C A;  4PCW A;  3GK1 A;  1SR6 C;  3CZ1 A;  1MF8 B;  2CBL A;  2E6W A;  2VRG A;  1IQ5 A;  1OOH A;  4YGA A;  1X02 A;  2ZKM X;  1FW4 A;  3I5H B;  1KFX L;  1UHH A;  3B6X A;  3PFV A;  1JWD A;  1L7Z A;  1S1E A;  1S6I A;  2BBN A;  5CSJ A;  1EJ3 A;  1J55 A;  3EKH A;  2JZI A;  2KBI A;  1WLZ A;  1C3Z A;  4GAO A;  4USL A;  5GQQ C;  1ZFS A;  2Y5I A;  3BOW B;  3BJH A;  2M97 A;  1SR6 B;  4PE1 A;  1S5G Z;  1NCX A;  2WC6 A;  1BJF A;  2KLE A;  1KQM C;  2LVI A;  3JTD C;  4AOM A;  3CR5 X;  1M45 A;  1YX7 A;  2JXC A;  1KFU S;  2BE6 A;  1LVC D;  2P71 A;  1QX2 A;  3NGV A;  1CDL A;  3UNW A;  1TNX A;  2CT9 A;  3FWC A;  3D76 A;  2KNE A;  2KYC A;  2EC6 C;  2H2K A;  2KI6 C;  3OP0 A;  2JNF A;  1QX7 A;  4ICB A;  1NYA A;  1XO5 A;  1JF2 A;  2QPT A;  4IJ7 A;  4WQ2 A;  5HKZ A;  1E8A A;  1KQM B;  1WRZ A;  3N7H A;  4XJK A;  2P70 A;  2JUL A;  3JTD B;  3S0B A;  5HL1 A;  1BT6 A;  3NSO A;  1EG3 A;  1NPQ A;  2BCB A;  2G2B A;  1UHI A;  1WDC C;  4ETO A;  2OPO A;  1SL8 A;  1UWO A;  1W9Z A;  1TNQ A;  2JT0 A;  1UUR A;  1V1F A;  3R72 A;  1DJI A;  1BOD A;  4MZK A;  4JPZ B;  3BUX B;  2CXJ A;  2PRU A;  3MSE B;  5AAN A;  3TUY C;  2K8M B;  4ZCV A;  2F2P A;  2F3Z A;  1F4Q A;  5DKQ A;  1CMG A;  3ZWH A;  3EKJ A;  1N2D A;  3VGO A;  5PAL A;  1ODB A;  3FE9 A;  1TTX A;  1YX8 A;  1KFX S;  5HKW A;  1CM1 A;  1J7Q A;  1XK4 A;  1YRU B;  3QRX A;  4FQT A;  5KSZ A;  2KQ6 A;  1DJX A;  3NSI A;  3GOF A;  2QEV A;  2HPS A;  4HRG A;  4PHM A;  4N5X A;  2HF5 A;  1OOF A;  1SY9 A;  3NHT A;  1CDM A;  1TWO A;  1BOC A;  4PAL A;  2A4J A;  3VRO A;  2GGZ A;  5FI7 A;  4QJ3 B;  5JOL A;  2BKH B;  1NCZ A;  1NX2 A;  4CFQ A;  4NDB A;  5CPV A;  3Q8I A;  4DUQ A;  2KDH A;  2LVJ A;  2LLS A;  2GGM A;  1UHK A;  3EK4 A;  1NP8 A;  1WLM A;  2LM5 A;  4ORA B;  1A4P A;  1SW8 A;  4ZCU A;  2DOQ A;  1SNL A;  1ZMZ A;  2OS8 C;  4GGF A;  2QEH A;  2JXL A;  3CGA A;  1YUT A;  3TDU A;  1DEL A;  2WCF A;  1ZUZ A;  1AP4 A;  3I5I C;  2LAP A;  1DF0 A;  2LLU A;  4YGE B;  5AFP A;  1LXF C;  2P6B B;  2JT8 A;  2FJY A;  1QV1 A;  1LKJ A;  2M8U A;  1DMO A;  1TNW A;  4MSP A;  4MLW A;  1CDN A;  2JPO A;  1Y1A A;  1A29 A;  1A75 A;  1MWN A;  1S5G Y;  2OS8 B;  2YGU A;  3CZ2 A;  4OR9 B;  1JBA A;  3PJI A;  1G4Y R;  1SYM A;  2AMI A;  5D7F A;  5HKY A;  3BFH A;  1F8H A;  2KFH A;  1XFR A;  3D77 A;  1L2O C;  4GNK B;  1RJV A;  4CFR A;  1KFU L;  3LK1 A;  3PN7 C;  3I5F B;  2F2O A;  3DD4 A;  4F7F A;  5CSI A;  1HQV A;  2LV7 A;  3VB1 A;  4C0L A;  1F4O A;  3DVJ A;  4MBE A;  1CMF A;  1WY9 A;  1K90 D;  2KPH A;  3KEV A;  3R1P A;  1L2O B;  2Y1M A;  1NX3 A;  4Q04 A;  2H8V A;  1JFJ A;  1ALV A;  2TN4 A;  1QXP A;  2KSP A;  3PN7 B;  1HT9 A;  3EK7 A;  2H61 A;  2BCX A;  4M2P A;  4CID A;  5HLO A;  4A4B A;  2WND A;  3DVK A;  3CZ0 A;  2JT3 A;  1OOI X;  2KFG A;  2L5Y A;  1KSO A;  2PAL A;  5DKN A;  1K9U A;  3DF0 B;  2BAP A;  2R2I A;  2MRD A;  1K2H A;  2PQL A;  4P5O E;  1OZO A;  1AHR A;  1S6C A;  1TCF A;  2GV5 A;  3NXA A;  3SG4 A;  1DJH A;  2JTZ A;  2LMV A;  3KO0 A;  2LCP A;  1Q80 A;  1S3P A;  2EGD A;  1JC2 A;  3R1V A;  1M31 A;  2FCD A;  1AJ4 A;  2H61 C;  3OHM B;  1YUS A;  2WCJ A;  3M0W A;  3CWG A;  1UHN A;  1T14 A;  3IVT A;  3R1O A;  2FCE A;  2LAN A;  3RLZ A;  1MXL C;  1OMR A;  5AXI A;  2NXQ A;  3A8R A;  1KK7 Y;  1WRK A;  1LA3 A;  3HCM A;  3ICB A;  2QAC A;  3DZT A;  2LUC A;  1S26 D;  4I5L B;  4BY4 A;  1Z4H A;  4C0K A;  1PSR A;  3PM8 A;  1SKT A;  4MZL A;  3KF9 A;  3B87 A;  1H4B A;  5CSN A;  2LHL A;  4GPL B;  1NX0 A;  4DIR A;  2WCE A;  5J3X A;  4YGB B;  5B8I B;  3SG3 A;  1QAT A;  2SCP A;  1KWO C;  2MLF C;  5KTY A;  1UP5 A;  1DQE A;  1B8L A;  4YBH B;  2LC5 A;  3D0Y B;  1NSH A;  2K7B A;  3TZ1 A;  1FI6 A;  2LNK A;  2BL0 C;  4MEW A;  1S6J A;  1RFJ A;  3OGN A;  1IH0 A;  1K9K A;  5FYX A;  3CS1 A;  1ORG A;  4XYN A;  1OW4 A;  1C7V A;  1UHJ A;  3FE6 A;  3VRR A;  2WOR A;  1PVB A;  1B1G A;  2EC6 B;  1NUB A;  1F55 A;  2ZFD A;  5I8N A;  4FTG A;  2K7C A;  4P2Y B;  1RK9 A;  3K1E A;  1CDP A;  2BL0 B;  3ZNI A;  1WDC B;  3JVT C;  3SG2 A;  3O2P A;  2KGB C;  1TRF A;  2LLT A;  3SG5 A;  1EH2 A;  1IJ6 A;  4NDC A;  2O5G A;  1NX1 A;  1JUO A;  5G08 A;  1F54 A;  1QWV A;  2PVB A;  1TIZ A;  1CNP A;  2L50 A;  3TUY B;  4MN0 A;  3L47 A;  3GK2 A;  3JVT B;  1CB1 A;  4XJK B;  1QX5 B;  2M7N A;  3S0A A;  4PHN A;  4DS7 A;  1Y1U A;  4N1F A;  5ER5 A;  4E68 A;  1KK7 Z;  1SCM C;  3CTN A;  3D78 A;  1XFU O;  3BUM B;  3O6B A;  1XFX O;  4JWQ A;  3LCP C;  1SPY A;  3L4A A;  5DIC A;  1PAL A;  3SS3 A;  1M39 A;  1XK4 C;  3AAK A;  4HRE E;  1TUJ A;  4M2Q A;  1SBJ A;  1FPW A;  2ZRT A;  1SRA A;  3K21 A;  2ZND A;  4IL1 A;  5ER4 X;  4NQG A;  1FBV A;  2CNP A;  2I7A A;  1SCM B;  2KBM A;  1QVI Y;  1XA5 A;  1IGV A;  2SAS A;  1A2X A;  4PT1 A;  3EG5 B;  3BUN B;  3VRQ A;  1XFZ O;  2JWW A;  2HQ8 A;  1DC1 A;  4PDZ A;  2K0J A;  4MVF A;  1TUZ A;  2JRF A;  5HLV A;  3NSK A;  2FOT A;  1PUL A;  4MRX A;  2JPT A;  1F71 A;  2WCM A;  1YVH A;  3LL8 B;  2Q91 A;  1SL9 A;  5KU1 A;  4PHJ A;  5AER A;  2ZN9 A;  3WNX B;  1YRT B;  3WHT B;  1U5I A;  1EL4 A;  2F3Y A;  1R2U A;  3OX5 A;  4KYN A;  2ZN8 A;  4AQI A;  1TNP A;  3CZT X;  3FWB A;  4PHK A;  4YI9 A;  2EHB A;  3BUW B;  1QLS A;  4GGF C;  1Y0V H;  1C07 A;  3I5I B;  1DTL A;  3SIB A;  1LIN A;  3H4S E;  2JOJ A;  1A03 A;  1IRJ A;  1PVA A;  1YTZ C;  1NCY A;  2I18 A;  1RWY A;  4OZD A;  1OZS A;  2KGR A;  1YR5 A;  1XYD A;  1RRO A;  2L4H A;  2LMU A;  4U8D A;  1LA0 A;  1B9A A;  3OB2 B;  3V2L A;  2CCM A;  2LP2 A;  1ZOT B;  2K7D A;  4OKH A;  2KQY A;  2OTG C;  3OX6 A;  2O60 A;  3DVE A;  1KK8 C;  1J7P A;  3B7A A;  1N65 A;  1JSA A;  4MZJ A;  1KQV A;  2LVV A;  5AEQ A;  2MBX A;  3EVR A;  1DF0 B;  4F0Z B;  2KI4 C;  1PK0 D;  3I5G C;  1M63 B;  2G9B A;  2JQ6 A;  1A75 B;  1EXR A;  2OTG B;  5TNC A;  4N1G A;  1Z2C B;  3CAB A;  3DYE A;  1VRK A; 
#chains in the Genus database with same CATH homology
 2GTE A;  4FQT A;  1DQE A;  4INW A;  3D73 A;  4JD9 A;  2QEV A;  3D74 A;  3OGN A;  1ORG A;  1OW4 A;  1OOF A;  3NHT A;  1TWO A;  3FE6 A;  2QEB A;  3FE8 A;  3K1E A;  3S0D A;  3Q8I A;  3B86 A;  2ERB A;  3DY9 A;  1QWV A;  2QEH A;  1OOG A;  3S0G A;  3L47 A;  2QEO A;  2WCK A;  4INX A;  2FJY A;  3D75 A;  3S0A A;  1C3Y A;  3CDN A;  2JPO A;  3CZ2 A;  3D78 A;  2WC5 A;  3BFB A;  3PJI A;  2L2C A;  3BFH A;  3L4A A;  5DIC A;  5EL2 A;  3L4L A;  1XFR A;  3D77 A;  1TUJ A;  3S0F A;  3CZ1 A;  3BFA A;  1OOH A;  4F7F A;  4PT1 A;  3VB1 A;  3B6X A;  3RZS A;  3S0E A;  1P28 A;  2KPH A;  3R1P A;  1C3Z A;  2H8V A;  2WCM A;  3BJH A;  2WC6 A;  3CZ0 A;  2P71 A;  2QDI A;  1OOI X;  3NGV A;  2PQL A;  3D76 A;  4OZD A;  3N7H A;  3S0B A;  2P70 A;  3R1V A;  1LS8 A;  3V2L A;  3B88 A;  2WCJ A;  3NHI A;  3R72 A;  1T14 A;  3R1O A;  3B7A A;  1GM0 A;  3QME A;  3DZT A;  2WCL A;  2WCH A;  3B87 A;  3DXL A;  3CAB A;  3DYE A;  3FE9 A;  3CYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...