1C3YA

Thp12-carrier protein from yellow meal worm
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords THP12 CARRIER PROTEIN
publication title A new class of hexahelical insect proteins revealed as putative carriers of small hydrophobic ligands.
pubmed doi rcsb
source organism Tenebrio molitor
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1c3yA00
3B7AA 4INXA 2JPOA 2WCMA 3FE6A 3S0BA 2QEBA 3CZ1A 1LS8A 2P70A 3PJIA 3NHTA 3CZ0A 4PT1A 3N7HA 3DY9A 2GTEA 3R1VA 4F7FA 3D75A 2H8VA 3FE9A 3L47A 1ORGA 4OZDA 1OW4A 1OOIX 2WCJA 2P71A 1P28A 1QWVA 3D73A 4JD9A 1T14A 1OOGA 3S0DA 2WCKA 3Q8IA 3D77A 2QDIA 1OOHA 1XFRA 3R1OA 3K1EA 3OGNA 4INWA 3L4AA 2QEOA 2PQLA 3DYEA 3DZTA 3QMEA 4FQTA 3BFBA 3B88A 1TUJA 3VB1A 3B86A 3L4LA 3DXLA 2ERBA 5EL2A 1GM0A 3BJHA 1OOFA 2KPHA 3CDNA 3CZ2A 2WC5A 3R1PA 3NHIA 2WCLA 3R72A 2FJYA 3FE8A 2WCHA 3BFHA 3D78A 1DQEA 2QEHA 1C3YA 1TWOA 3B87A 1C3ZA 3S0AA 2WC6A 3D74A 2QEVA 3B6XA 5DICA 3RZSA 3S0EA 3D76A 3V2LA 2L2CA 3CYZA 3S0GA 3S0FA 3BFAA 3CABA 3NGVA
chains in the Genus database with same CATH superfamily
2LLUA 1PULA 3DF0A 3AAJA 1MQ1A 2AAOA 2K2FA 1R6PA 3PFVA 1JF2A 1J1EA 1V1FA 1CTRA 1PSBA 2HPSA 1KK7Y 2CXJA 1FBVA 4PDZA 1Y1UA 2QEBA 4C0LA 1SR6B 2Q91A 2LMVA 1LINA 1TNWA 2BKHB 3PM8A 3BOWA 2KI6C 3CR2A 3SIBA 3HX4A 3CZ1A 1LS8A 3VRNA 1F71A 1KK8B 3EVRA 1DJIA 2L2EA 3KEVA 4MZJA 3VRQA 3TUYC 1QVIY 1YVLA 2LVJA 3SG6A 4F7FA 1M46A 1PSRA 3A4UB 3QRXA 1QTXA 4CIDA 1IIOA 1A29A 5FI7A 2PASA 1U5IB 1G8IA 1M31A 2KGRA 1TN4A 3OP0A 2Y4QA 4N1GA 3SS4A 2BE4A 1WRKA 1IGVA 2BNXA 2HQWA 2L5XB 1TOPA 1UHJA 1YUSA 2KGBC 3CZTX 3DVMA 1M39A 2WCJA 2LM5A 3GK2A 1KK7Z 2BL0C 1EG4A 2BCXA 2G2BA 4I5LB 4C0KA 2BAPA 4IL1A 1B4CA 1OE9B 1Z2CB 4OKHA 1N0YA 4CFQA 1KCYA 5KSZA 5DKNA 2WCEA 1W7JB 3UNWA 3VRPA 4A4BA 1OOJA 2KOTA 1T14A 1IQ5A 2JNFA 3PN7B 2L4IA 1WRZA 2WCKA 3S0DA 1PVBA 3NXAA 4YGAA 2OS8B 1B8RA 2QACA 1Y1XA 1ALVA 1GQMA 2LLSA 1AK8A 2MRDA 2ZFDA 1XFRA 5GQQC 2MBXA 3R1OA 1XFXO 1A2XA 2F33A 2JZIA 2L98A 3OGNA 1CFFA 2NLNA 1A75B 1XO5A 4HRGA 1K9KA 4INWA 2I18A 3L4AA 1B1GA 5AXIA 2PQLA 1GGWA 4U8DA 4FQTA 2O60A 1TUJA 4YGCB 3VB1A 1S5GY 1OMRA 2OTGB 1IQ3A 1CDPA 5HKYA 2JULA 3IF7A 2JC2A 1AJ5A 3WHUB 1F8HA 1YR5A 1LXFC 2ERBA 1QIVA 1VRKA 3DVJA 3I5HB 5TNCA 3BJHA 3EVUA 1SBJA 1B8LA 4MLWA 1TRFA 5FI2A 5AANA 1CMGA 4OR9B 1LA3A 2PYQA 3R1PA 2K7OA 2WCFA 2WCLA 1NCXA 2KI6D 2BKIB 1JSAA 1EG3A 2HQ8A 2PRUA 2FJYA 1NX3A 2GV5A 2ZRTA 1XFUO 3FE8A 3SG5A 1J7RA 1KSOA 3VRRA 3BUWB 2WCHA 1KQMB 1XFWO 1Y6WA 1LA0A 1DTLA 2JNXA 2I7AA 3CGAA 2Y1MA 4XJKA 3RLZA 1L2OC 1IWQA 1CDMA 1S5GZ 2WORA 2M7NA 1IJ6A 3CR4X 1YUUA 5IBWA 3B87A 2K7BA 1AP4A 2KLDA 3BQ3A 1CKKA 2BECA 2LC5A 3DVEA 1OMVA 1HQVA 3SS3A 1NCYA 3IVTA 4JKTA 3DVKA 5KU1A 3OB1B 4YRUA 1SL9A 3RZSA 3S0EA 1G33A 3WHTB 3NSKA 1IJ5A 5D3OA 1F54A 1KFXL 1BMOA 3BFAA 1CMFA 1BLQA 1H4BA 2LUCA 4E68A 3BUOB 1CFPA 1DF0A 5ER4X 1QXPA 4MZKA 3LCPC 2WCMA 3FE6A 4AQJA 1PK0D 5CSIA 1OQPA 2H61A 2H2KA 1YRUB 1D1OA 1SL7A 4FTGA 1U5IA 3BUNB 2P70A 3I5IC 3PJIA 3CZ0A 2IS9A 2GGMA 1M63B 2CCMA 2FOTA 3TZ1A 2JTTA 2M1KB 2LP3A 2MLFC 1K9PA 1OMDA 2KYCA 3D0YA 1DJHA 1J55A 3CS1A 1ZMZA 3AKAA 4F0ZB 1K90D 2KQYA 2RGIA 5CSJA 1ORGA 1RECA 2FCEA 4ORCB 1DEKA 3EK4A 1B9AA 3FWBA 2M0RA 1NP8A 1SRAA 1BODA 1IH0A 2LCPA 2M1UA 1OOIX 1NCZA 1ZUZA 1K8UA 2F2PA 3VROA 3NSOA 2H61C 1EXRA 1MUXA 1XYDA 4N5XA 3D73A 1KQVA 1TUZA 1QATA 3SIAA 1EJ3A 2LANA 2EC6C 2M3WA 1BOCA 3TS5C 2KFHA 1B8CA 2O5GA 2ISDA 1DC1A 1S6IA 2F2OA 2WC8A 2PVBA 3I5GC 4DUQA 3SG3A 3CR5X 3GK1A 2MLEC 1L7ZA 3D77A 2AMIA 1BF5A 2ZRSA 1NWDA 1QLKA 2KDHA 4BY5A 1WDCC 3K1EA 1KFUL 1DJZA 2LVKA 1CFDA 2LHLA 5D69A 4L9MA 1IRJA 3WXAA 1OZOA 1QX5B 2LE9B 2QEOA 1YURA 2HETA 4IJ7A 2R2IA 1OZSA 2L0PA 1A4PA 1FW4A 1G4YR 2EGDA 1SK6D 1MR8A 3A8RA 3B86A 3JVTC 5BPJA 1NX2A 1J1DA 2K60A 2KAXA 3SS5A 4UPGA 1DJYA 2Y1NA 4ZCVA 1LVCD 1S1EA 2TN4A 2I94A 2ZKMX 3DXLA 5EL2A 2KHNA 4ETOA 1CDNA 1BU3A 1GM0A 4Q04A 2HF5A 2KPHA 2JXLA 2L51A 2QPTA 1UHIA 2PSRA 3CZ2A 4JWQA 1CLLA 1SKTA 4M2OA 3NHIA 3BYAA 5FYXA 1NX0A 1J7PA 1RWYA 1M45A 1W9ZA 3CTNA 1SW8A 5HYDA 1TCOB 4JPZB 1DMOA 2PALA 3TUYB 2JU0A 1AUIB 1QX7A 1DQEA 1N65A 1QIWA 1FI6A 1NSHA 2L5YA 1PRWA 4PE7A 1MHOA 4OVNF 5ER5A 5DKQA 2P6BB 1TWOA 4ICBA 5KTYA 1QV0A 2M29A 3DD4A 1WLMA 3DF0B 1C3ZA 4HSZA 3S0AA 4GGFA 1UHHA 2WC6A 3JTDC 1KWOC 2CT9A 4YI9A 3SG2A 2Q4UA 3D74A 5AFPA 2QEVA 2JT8A 2BL0B 3F45A 3GOFA 4MEWA 3D76A 2L2CA 3CYZA 1DVIA 1DJWA 3OB2B 3TDZA 4DCKA 2YGUA 1DJXA 5HKWA 1DGUA 4GBAA 1YUTA 3NGVA 3B7AA 3EK7A 3SG4A 1RTP1 4DS7A 3IQOA 4ORBB 5PALA 1XA5A 1KFXS 1K9UA 1C7WA 1JFJA 4QJ3B 2KFGA 1DJGA 1S6JA 3FIAA 4GGFC 4AQIA 1PVAA 2KFFA 3NHTA 3TDIA 1CLMA 1UURA 2NZ0A 1SCMC 4P5OE 3N7HA 2A4JA 4PT1A 3DY9A 3FWCA 1DT7B 2GTEA 3R1VA 1TNXA 3D75A 1J7OA 1SYMA 5HKZA 1W7IB 2LLTA 3I5FC 4M2PA 1WY9A 1BJFA 3JTDB 2KNEA 4OZDA 1CM4A 2LUXA 4KYNA 1F70A 1OW4A 3EKHA 1UUSA 4GUKA 1LKJA 5I2LA 5K89A 1JF0A 2P71A 1YVHA 3LK1A 1B7TY 2KI4C 3GK4X 4CLNA 4P2YB 3PM2A 4JD9A 1TCFA 4WRIA 3BXKA 1OSAA 2EHBA 4DRWA 1OOGA 4R1EA 5FI6A 1AJ4A 2KAVA 2K7DA 1Y1AA 1JFKA 3PALA 1CDLA 4YGBB 1L2OB 3LLEA 3OHMB 2LP2A 3WNXB 4WQ2A 1XFYO 4NDDA 5I2OA 5B8IB 3NSIA 1MF8B 1SCVA 4PE4A 1SR6C 4A4CA 3O4YA 4MVFA 2LV7A 1ZOTB 2PMYA 1FPWA 1SL8A 4GAOA 1FF1A 1KK8C 1Y0VH 2JT0A 1E8AA 3KHEA 3DYEA 2KQ6A 1QASA 3DZTA 3QMEA 1C07A 1CNPA 3BFBA 2B1UA 1ALWA 1B7TZ 1YX7A 1FI5A 1KFUS 2ZNEA 3UO9A 5HLOA 2LHIA 1RROA 2LNKA 1ZACA 2JTZA 1UHKA 1ZFSA 2K7CA 5DKRA 4XJKB 2KBIA 1A75A 1TNQA 1KSMA 4GGNA 5I2QA 3VGOA 1UP5A 2BCBA 3CDNA 4YBHB 1PALA 1JUOA 2BBMA 4YI8A 3PATA 1HT9A 3D10A 1SSEB 1UWOA 5J3XA 3I5IB 4MBEA 3R72A 1EH2A 1CFCA 5I94A 2Y5IA 1SY9A 2CBLA 4PALA 1MXLC 1Q80A 3BFHA 3KO0A 3PN7C 5AEQA 3D78A 4CPVA 2QEHA 1TIZA 4GNKB 3O6BA 5CPVA 1TNPA 3SG7A 2OS8C 3CLNA 2ZN9A 2I2RE 2K8MB 1RK9A 1S3PA 1C3YA 1AHRA 3IQQA 2ZNDA 4WQ3A 1CB1A 3OX5A 1DELA 2M8UA 2M97A 1DF0B 1WRLA 4NDBA 4D1EA 2MJWB 1Z4HA 1XK4A 2JOJA 4QJ5B 1K94A 1RFJA 3E3RA 2MHHA 1GGZA 2F8PA 1F4OA 4OCIA 4PHKA 3B6XA 1EL4A 4MZLA 5DICA 5F6TA 2CTNA 3V2LA 4HREE 1IKUA 1NYAA 2OTGC 3CABA 3C1VA 3PSRA 2EC6B 1RJVA 5D7FA 5AERA 1XVJA 1K95A 4INXA 2LMUA 3TS5B 3D0YB 4GFTA 3HCMA 4MN0A 3TDUA 3I5HC 1SMGA 3I5GB 3O78A 2COLB 2JPOA 4DIRA 2MAZA 1MWNA 3S0BA 2LVVA 2JT3A 1WDCB 3H4SE 4I5NB 3EKJA 5HL1A 1XK4C 2L4HA 1QVIZ 4ZCUA 1QS7A 1XFZO 3K21A 3O4XA 1QV1A 1KQMC 2FCDA 1NX1A 4USLA 1YX8A 2H8VA 3JVTB 3ZWHA 4C0JA 5JJGA 2K0JA 3FE9A 3L47A 1WLZA 3BOWB 4I5JA 5CSNA 4MSPA 1SNLA 2BCAA 1BG1A 1X02A 1F4QA 4PHJA 4HRHA 2KSPA 2KLEA 4GPLB 2SCPA 3KPXA 2L50A 2VRGA 3BUMB 2M9GA 4PCWA 1P28A 2F3YA 3PLFB 2KBMA 1J7QA 1NPQA 1QWVA 2M49B 1S6CA 1YRTB 4M2QA 5I8NA 1BT6A 4AOMA 4MRXA 3KF9A 1A03A 3EK8A 3Q8IA 3O2PA 1CM1A 1YTZC 5JOLA 2JXCA 3LK0A 4PHNA 4FQOA 4XYNA 2QDIA 1OOHA 3AKBA 3LL8B 1N2DA 3M0WA 1KWOB 2FJUB 4JQ0D 4TNCA 5G08A 1S36A 2KAYA 1BR4B 3CWGA 4YGEB 1JC2A 1C7VA 1XFVO 4PE0A 2OPOA 3OBVA 2LAPA 2NCOA 2WNDA 2WOSA 3B88A 1NIWA 2E30A 3SJSA 4NDCA 4QJ4B 2E6WA 2K2AA 3AAKA 1H8BA 2LVIA 3L4LA 1GJYA 4MRYA 2ZN8A 3EG5B 1R2UA 2MA2A 4YGDB 1TTXA 1QJTA 1B47A 2K61A 1OOFA 1ODBA 3EVVA 2F3ZA 1K96A 4I5KA 2JPTA 1IG5A 2WC5A 2DOQA 1SPYA 2CNPA 2JRFA 2D8NA 1F55A 2V53A 1AVSA 4NQGA 2BBNA 2BE6A 1S26D 3ZNIA 4PHMA 1SCMB 4ORAB 5HLVA 4BY4A 2JQ6A 3RM1A 3OX6A 1QLSA 3I5FB 2G9BA 1DGVA 2SASA 4PE1A 1K2HA 1BR1B 1UHNA 2NXQA 3BUXB 2AUCA 3FS7A 1K93D 3ICBA 1CLBA 3MSEB 4OV2A 3NSLA 1MXEA 2NCPA 2WCBA 4CFRA 1QX2A 1V1GA 2KI4B 2KYFA 1JBAA 1JWDA 1NUBA 2GGZA 2JWWA 4N1FA 5CSFA 2M7LA 2LMTA 3S0GA 3S0FA
chains in the Genus database with same CATH topology
3B7AA 4INXA 2JPOA 2WCMA 3FE6A 3S0BA 2QEBA 3CZ1A 1LS8A 2P70A 3PJIA 3NHTA 3CZ0A 4PT1A 3N7HA 3DY9A 2GTEA 3R1VA 4F7FA 3D75A 2H8VA 3FE9A 3L47A 1ORGA 4OZDA 1OW4A 1OOIX 2WCJA 2P71A 1P28A 1QWVA 3D73A 4JD9A 1T14A 1OOGA 3S0DA 2WCKA 3Q8IA 3D77A 2QDIA 1OOHA 1XFRA 3R1OA 3K1EA 3OGNA 4INWA 3L4AA 2QEOA 2PQLA 3DYEA 3DZTA 3QMEA 4FQTA 3BFBA 3B88A 1TUJA 3VB1A 3B86A 3L4LA 3DXLA 2ERBA 5EL2A 1GM0A 3BJHA 1OOFA 2KPHA 3CDNA 3CZ2A 2WC5A 3R1PA 3NHIA 2WCLA 3R72A 2FJYA 3FE8A 2WCHA 3BFHA 3D78A 1DQEA 2QEHA 1C3YA 1TWOA 3B87A 1C3ZA 3S0AA 2WC6A 3D74A 2QEVA 3B6XA 5DICA 3RZSA 3S0EA 3D76A 3V2LA 2L2CA 3CYZA 3S0GA 3S0FA 3BFAA 3CABA 3NGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7A A;  4INX A;  2JPO A;  2WCM A;  3FE6 A;  3S0B A;  2QEB A;  3CZ1 A;  1LS8 A;  2P70 A;  3PJI A;  3NHT A;  3CZ0 A;  4PT1 A;  3N7H A;  3DY9 A;  2GTE A;  3R1V A;  4F7F A;  3D75 A;  2H8V A;  3FE9 A;  3L47 A;  1ORG A;  4OZD A;  1OW4 A;  1OOI X;  2WCJ A;  2P71 A;  1P28 A;  1QWV A;  3D73 A;  4JD9 A;  1T14 A;  1OOG A;  3S0D A;  2WCK A;  3Q8I A;  3D77 A;  2QDI A;  1OOH A;  1XFR A;  3R1O A;  3K1E A;  3OGN A;  4INW A;  3L4A A;  2QEO A;  2PQL A;  3DYE A;  3DZT A;  3QME A;  4FQT A;  3BFB A;  3B88 A;  1TUJ A;  3VB1 A;  3B86 A;  3L4L A;  3DXL A;  2ERB A;  5EL2 A;  1GM0 A;  3BJH A;  1OOF A;  2KPH A;  3CDN A;  3CZ2 A;  2WC5 A;  3R1P A;  3NHI A;  2WCL A;  3R72 A;  2FJY A;  3FE8 A;  2WCH A;  3BFH A;  3D78 A;  1DQE A;  2QEH A;  1C3Y A;  1TWO A;  3B87 A;  1C3Z A;  3S0A A;  2WC6 A;  3D74 A;  2QEV A;  3B6X A;  5DIC A;  3RZS A;  3S0E A;  3D76 A;  3V2L A;  2L2C A;  3CYZ A;  3S0G A;  3S0F A;  3BFA A;  3CAB A;  3NGV A; 
#chains in the Genus database with same CATH topology
 2LLU A;  1PUL A;  3DF0 A;  3AAJ A;  1MQ1 A;  2AAO A;  2K2F A;  1R6P A;  3PFV A;  1JF2 A;  1J1E A;  1V1F A;  1CTR A;  1PSB A;  2HPS A;  1KK7 Y;  2CXJ A;  1FBV A;  4PDZ A;  1Y1U A;  2QEB A;  4C0L A;  1SR6 B;  2Q91 A;  2LMV A;  1LIN A;  1TNW A;  2BKH B;  3PM8 A;  3BOW A;  2KI6 C;  3CR2 A;  3SIB A;  3HX4 A;  3CZ1 A;  1LS8 A;  3VRN A;  1F71 A;  1KK8 B;  3EVR A;  1DJI A;  2L2E A;  3KEV A;  4MZJ A;  3VRQ A;  3TUY C;  1QVI Y;  1YVL A;  2LVJ A;  3SG6 A;  4F7F A;  1M46 A;  1PSR A;  3A4U B;  3QRX A;  1QTX A;  4CID A;  1IIO A;  1A29 A;  5FI7 A;  2PAS A;  1U5I B;  1G8I A;  1M31 A;  2KGR A;  1TN4 A;  3OP0 A;  2Y4Q A;  4N1G A;  3SS4 A;  2BE4 A;  1WRK A;  1IGV A;  2BNX A;  2HQW A;  2L5X B;  1TOP A;  1UHJ A;  1YUS A;  2KGB C;  3CZT X;  3DVM A;  1M39 A;  2WCJ A;  2LM5 A;  3GK2 A;  1KK7 Z;  2BL0 C;  1EG4 A;  2BCX A;  2G2B A;  4I5L B;  4C0K A;  2BAP A;  4IL1 A;  1B4C A;  1OE9 B;  1Z2C B;  4OKH A;  1N0Y A;  4CFQ A;  1KCY A;  5KSZ A;  5DKN A;  2WCE A;  1W7J B;  3UNW A;  3VRP A;  4A4B A;  1OOJ A;  2KOT A;  1T14 A;  1IQ5 A;  2JNF A;  3PN7 B;  2L4I A;  1WRZ A;  2WCK A;  3S0D A;  1PVB A;  3NXA A;  4YGA A;  2OS8 B;  1B8R A;  2QAC A;  1Y1X A;  1ALV A;  1GQM A;  2LLS A;  1AK8 A;  2MRD A;  2ZFD A;  1XFR A;  5GQQ C;  2MBX A;  3R1O A;  1XFX O;  1A2X A;  2F33 A;  2JZI A;  2L98 A;  3OGN A;  1CFF A;  2NLN A;  1A75 B;  1XO5 A;  4HRG A;  1K9K A;  4INW A;  2I18 A;  3L4A A;  1B1G A;  5AXI A;  2PQL A;  1GGW A;  4U8D A;  4FQT A;  2O60 A;  1TUJ A;  4YGC B;  3VB1 A;  1S5G Y;  1OMR A;  2OTG B;  1IQ3 A;  1CDP A;  5HKY A;  2JUL A;  3IF7 A;  2JC2 A;  1AJ5 A;  3WHU B;  1F8H A;  1YR5 A;  1LXF C;  2ERB A;  1QIV A;  1VRK A;  3DVJ A;  3I5H B;  5TNC A;  3BJH A;  3EVU A;  1SBJ A;  1B8L A;  4MLW A;  1TRF A;  5FI2 A;  5AAN A;  1CMG A;  4OR9 B;  1LA3 A;  2PYQ A;  3R1P A;  2K7O A;  2WCF A;  2WCL A;  1NCX A;  2KI6 D;  2BKI B;  1JSA A;  1EG3 A;  2HQ8 A;  2PRU A;  2FJY A;  1NX3 A;  2GV5 A;  2ZRT A;  1XFU O;  3FE8 A;  3SG5 A;  1J7R A;  1KSO A;  3VRR A;  3BUW B;  2WCH A;  1KQM B;  1XFW O;  1Y6W A;  1LA0 A;  1DTL A;  2JNX A;  2I7A A;  3CGA A;  2Y1M A;  4XJK A;  3RLZ A;  1L2O C;  1IWQ A;  1CDM A;  1S5G Z;  2WOR A;  2M7N A;  1IJ6 A;  3CR4 X;  1YUU A;  5IBW A;  3B87 A;  2K7B A;  1AP4 A;  2KLD A;  3BQ3 A;  1CKK A;  2BEC A;  2LC5 A;  3DVE A;  1OMV A;  1HQV A;  3SS3 A;  1NCY A;  3IVT A;  4JKT A;  3DVK A;  5KU1 A;  3OB1 B;  4YRU A;  1SL9 A;  3RZS A;  3S0E A;  1G33 A;  3WHT B;  3NSK A;  1IJ5 A;  5D3O A;  1F54 A;  1KFX L;  1BMO A;  3BFA A;  1CMF A;  1BLQ A;  1H4B A;  2LUC A;  4E68 A;  3BUO B;  1CFP A;  1DF0 A;  5ER4 X;  1QXP A;  4MZK A;  3LCP C;  2WCM A;  3FE6 A;  4AQJ A;  1PK0 D;  5CSI A;  1OQP A;  2H61 A;  2H2K A;  1YRU B;  1D1O A;  1SL7 A;  4FTG A;  1U5I A;  3BUN B;  2P70 A;  3I5I C;  3PJI A;  3CZ0 A;  2IS9 A;  2GGM A;  1M63 B;  2CCM A;  2FOT A;  3TZ1 A;  2JTT A;  2M1K B;  2LP3 A;  2MLF C;  1K9P A;  1OMD A;  2KYC A;  3D0Y A;  1DJH A;  1J55 A;  3CS1 A;  1ZMZ A;  3AKA A;  4F0Z B;  1K90 D;  2KQY A;  2RGI A;  5CSJ A;  1ORG A;  1REC A;  2FCE A;  4ORC B;  1DEK A;  3EK4 A;  1B9A A;  3FWB A;  2M0R A;  1NP8 A;  1SRA A;  1BOD A;  1IH0 A;  2LCP A;  2M1U A;  1OOI X;  1NCZ A;  1ZUZ A;  1K8U A;  2F2P A;  3VRO A;  3NSO A;  2H61 C;  1EXR A;  1MUX A;  1XYD A;  4N5X A;  3D73 A;  1KQV A;  1TUZ A;  1QAT A;  3SIA A;  1EJ3 A;  2LAN A;  2EC6 C;  2M3W A;  1BOC A;  3TS5 C;  2KFH A;  1B8C A;  2O5G A;  2ISD A;  1DC1 A;  1S6I A;  2F2O A;  2WC8 A;  2PVB A;  3I5G C;  4DUQ A;  3SG3 A;  3CR5 X;  3GK1 A;  2MLE C;  1L7Z A;  3D77 A;  2AMI A;  1BF5 A;  2ZRS A;  1NWD A;  1QLK A;  2KDH A;  4BY5 A;  1WDC C;  3K1E A;  1KFU L;  1DJZ A;  2LVK A;  1CFD A;  2LHL A;  5D69 A;  4L9M A;  1IRJ A;  3WXA A;  1OZO A;  1QX5 B;  2LE9 B;  2QEO A;  1YUR A;  2HET A;  4IJ7 A;  2R2I A;  1OZS A;  2L0P A;  1A4P A;  1FW4 A;  1G4Y R;  2EGD A;  1SK6 D;  1MR8 A;  3A8R A;  3B86 A;  3JVT C;  5BPJ A;  1NX2 A;  1J1D A;  2K60 A;  2KAX A;  3SS5 A;  4UPG A;  1DJY A;  2Y1N A;  4ZCV A;  1LVC D;  1S1E A;  2TN4 A;  2I94 A;  2ZKM X;  3DXL A;  5EL2 A;  2KHN A;  4ETO A;  1CDN A;  1BU3 A;  1GM0 A;  4Q04 A;  2HF5 A;  2KPH A;  2JXL A;  2L51 A;  2QPT A;  1UHI A;  2PSR A;  3CZ2 A;  4JWQ A;  1CLL A;  1SKT A;  4M2O A;  3NHI A;  3BYA A;  5FYX A;  1NX0 A;  1J7P A;  1RWY A;  1M45 A;  1W9Z A;  3CTN A;  1SW8 A;  5HYD A;  1TCO B;  4JPZ B;  1DMO A;  2PAL A;  3TUY B;  2JU0 A;  1AUI B;  1QX7 A;  1DQE A;  1N65 A;  1QIW A;  1FI6 A;  1NSH A;  2L5Y A;  1PRW A;  4PE7 A;  1MHO A;  4OVN F;  5ER5 A;  5DKQ A;  2P6B B;  1TWO A;  4ICB A;  5KTY A;  1QV0 A;  2M29 A;  3DD4 A;  1WLM A;  3DF0 B;  1C3Z A;  4HSZ A;  3S0A A;  4GGF A;  1UHH A;  2WC6 A;  3JTD C;  1KWO C;  2CT9 A;  4YI9 A;  3SG2 A;  2Q4U A;  3D74 A;  5AFP A;  2QEV A;  2JT8 A;  2BL0 B;  3F45 A;  3GOF A;  4MEW A;  3D76 A;  2L2C A;  3CYZ A;  1DVI A;  1DJW A;  3OB2 B;  3TDZ A;  4DCK A;  2YGU A;  1DJX A;  5HKW A;  1DGU A;  4GBA A;  1YUT A;  3NGV A;  3B7A A;  3EK7 A;  3SG4 A;  1RTP 1;  4DS7 A;  3IQO A;  4ORB B;  5PAL A;  1XA5 A;  1KFX S;  1K9U A;  1C7W A;  1JFJ A;  4QJ3 B;  2KFG A;  1DJG A;  1S6J A;  3FIA A;  4GGF C;  4AQI A;  1PVA A;  2KFF A;  3NHT A;  3TDI A;  1CLM A;  1UUR A;  2NZ0 A;  1SCM C;  4P5O E;  3N7H A;  2A4J A;  4PT1 A;  3DY9 A;  3FWC A;  1DT7 B;  2GTE A;  3R1V A;  1TNX A;  3D75 A;  1J7O A;  1SYM A;  5HKZ A;  1W7I B;  2LLT A;  3I5F C;  4M2P A;  1WY9 A;  1BJF A;  3JTD B;  2KNE A;  4OZD A;  1CM4 A;  2LUX A;  4KYN A;  1F70 A;  1OW4 A;  3EKH A;  1UUS A;  4GUK A;  1LKJ A;  5I2L A;  5K89 A;  1JF0 A;  2P71 A;  1YVH A;  3LK1 A;  1B7T Y;  2KI4 C;  3GK4 X;  4CLN A;  4P2Y B;  3PM2 A;  4JD9 A;  1TCF A;  4WRI A;  3BXK A;  1OSA A;  2EHB A;  4DRW A;  1OOG A;  4R1E A;  5FI6 A;  1AJ4 A;  2KAV A;  2K7D A;  1Y1A A;  1JFK A;  3PAL A;  1CDL A;  4YGB B;  1L2O B;  3LLE A;  3OHM B;  2LP2 A;  3WNX B;  4WQ2 A;  1XFY O;  4NDD A;  5I2O A;  5B8I B;  3NSI A;  1MF8 B;  1SCV A;  4PE4 A;  1SR6 C;  4A4C A;  3O4Y A;  4MVF A;  2LV7 A;  1ZOT B;  2PMY A;  1FPW A;  1SL8 A;  4GAO A;  1FF1 A;  1KK8 C;  1Y0V H;  2JT0 A;  1E8A A;  3KHE A;  3DYE A;  2KQ6 A;  1QAS A;  3DZT A;  3QME A;  1C07 A;  1CNP A;  3BFB A;  2B1U A;  1ALW A;  1B7T Z;  1YX7 A;  1FI5 A;  1KFU S;  2ZNE A;  3UO9 A;  5HLO A;  2LHI A;  1RRO A;  2LNK A;  1ZAC A;  2JTZ A;  1UHK A;  1ZFS A;  2K7C A;  5DKR A;  4XJK B;  2KBI A;  1A75 A;  1TNQ A;  1KSM A;  4GGN A;  5I2Q A;  3VGO A;  1UP5 A;  2BCB A;  3CDN A;  4YBH B;  1PAL A;  1JUO A;  2BBM A;  4YI8 A;  3PAT A;  1HT9 A;  3D10 A;  1SSE B;  1UWO A;  5J3X A;  3I5I B;  4MBE A;  3R72 A;  1EH2 A;  1CFC A;  5I94 A;  2Y5I A;  1SY9 A;  2CBL A;  4PAL A;  1MXL C;  1Q80 A;  3BFH A;  3KO0 A;  3PN7 C;  5AEQ A;  3D78 A;  4CPV A;  2QEH A;  1TIZ A;  4GNK B;  3O6B A;  5CPV A;  1TNP A;  3SG7 A;  2OS8 C;  3CLN A;  2ZN9 A;  2I2R E;  2K8M B;  1RK9 A;  1S3P A;  1C3Y A;  1AHR A;  3IQQ A;  2ZND A;  4WQ3 A;  1CB1 A;  3OX5 A;  1DEL A;  2M8U A;  2M97 A;  1DF0 B;  1WRL A;  4NDB A;  4D1E A;  2MJW B;  1Z4H A;  1XK4 A;  2JOJ A;  4QJ5 B;  1K94 A;  1RFJ A;  3E3R A;  2MHH A;  1GGZ A;  2F8P A;  1F4O A;  4OCI A;  4PHK A;  3B6X A;  1EL4 A;  4MZL A;  5DIC A;  5F6T A;  2CTN A;  3V2L A;  4HRE E;  1IKU A;  1NYA A;  2OTG C;  3CAB A;  3C1V A;  3PSR A;  2EC6 B;  1RJV A;  5D7F A;  5AER A;  1XVJ A;  1K95 A;  4INX A;  2LMU A;  3TS5 B;  3D0Y B;  4GFT A;  3HCM A;  4MN0 A;  3TDU A;  3I5H C;  1SMG A;  3I5G B;  3O78 A;  2COL B;  2JPO A;  4DIR A;  2MAZ A;  1MWN A;  3S0B A;  2LVV A;  2JT3 A;  1WDC B;  3H4S E;  4I5N B;  3EKJ A;  5HL1 A;  1XK4 C;  2L4H A;  1QVI Z;  4ZCU A;  1QS7 A;  1XFZ O;  3K21 A;  3O4X A;  1QV1 A;  1KQM C;  2FCD A;  1NX1 A;  4USL A;  1YX8 A;  2H8V A;  3JVT B;  3ZWH A;  4C0J A;  5JJG A;  2K0J A;  3FE9 A;  3L47 A;  1WLZ A;  3BOW B;  4I5J A;  5CSN A;  4MSP A;  1SNL A;  2BCA A;  1BG1 A;  1X02 A;  1F4Q A;  4PHJ A;  4HRH A;  2KSP A;  2KLE A;  4GPL B;  2SCP A;  3KPX A;  2L50 A;  2VRG A;  3BUM B;  2M9G A;  4PCW A;  1P28 A;  2F3Y A;  3PLF B;  2KBM A;  1J7Q A;  1NPQ A;  1QWV A;  2M49 B;  1S6C A;  1YRT B;  4M2Q A;  5I8N A;  1BT6 A;  4AOM A;  4MRX A;  3KF9 A;  1A03 A;  3EK8 A;  3Q8I A;  3O2P A;  1CM1 A;  1YTZ C;  5JOL A;  2JXC A;  3LK0 A;  4PHN A;  4FQO A;  4XYN A;  2QDI A;  1OOH A;  3AKB A;  3LL8 B;  1N2D A;  3M0W A;  1KWO B;  2FJU B;  4JQ0 D;  4TNC A;  5G08 A;  1S36 A;  2KAY A;  1BR4 B;  3CWG A;  4YGE B;  1JC2 A;  1C7V A;  1XFV O;  4PE0 A;  2OPO A;  3OBV A;  2LAP A;  2NCO A;  2WND A;  2WOS A;  3B88 A;  1NIW A;  2E30 A;  3SJS A;  4NDC A;  4QJ4 B;  2E6W A;  2K2A A;  3AAK A;  1H8B A;  2LVI A;  3L4L A;  1GJY A;  4MRY A;  2ZN8 A;  3EG5 B;  1R2U A;  2MA2 A;  4YGD B;  1TTX A;  1QJT A;  1B47 A;  2K61 A;  1OOF A;  1ODB A;  3EVV A;  2F3Z A;  1K96 A;  4I5K A;  2JPT A;  1IG5 A;  2WC5 A;  2DOQ A;  1SPY A;  2CNP A;  2JRF A;  2D8N A;  1F55 A;  2V53 A;  1AVS A;  4NQG A;  2BBN A;  2BE6 A;  1S26 D;  3ZNI A;  4PHM A;  1SCM B;  4ORA B;  5HLV A;  4BY4 A;  2JQ6 A;  3RM1 A;  3OX6 A;  1QLS A;  3I5F B;  2G9B A;  1DGV A;  2SAS A;  4PE1 A;  1K2H A;  1BR1 B;  1UHN A;  2NXQ A;  3BUX B;  2AUC A;  3FS7 A;  1K93 D;  3ICB A;  1CLB A;  3MSE B;  4OV2 A;  3NSL A;  1MXE A;  2NCP A;  2WCB A;  4CFR A;  1QX2 A;  1V1G A;  2KI4 B;  2KYF A;  1JBA A;  1JWD A;  1NUB A;  2GGZ A;  2JWW A;  4N1F A;  5CSF A;  2M7L A;  2LMT A;  3S0G A;  3S0F A; 
#chains in the Genus database with same CATH homology
 3B7A A;  4INX A;  2JPO A;  2WCM A;  3FE6 A;  3S0B A;  2QEB A;  3CZ1 A;  1LS8 A;  2P70 A;  3PJI A;  3NHT A;  3CZ0 A;  4PT1 A;  3N7H A;  3DY9 A;  2GTE A;  3R1V A;  4F7F A;  3D75 A;  2H8V A;  3FE9 A;  3L47 A;  1ORG A;  4OZD A;  1OW4 A;  1OOI X;  2WCJ A;  2P71 A;  1P28 A;  1QWV A;  3D73 A;  4JD9 A;  1T14 A;  1OOG A;  3S0D A;  2WCK A;  3Q8I A;  3D77 A;  2QDI A;  1OOH A;  1XFR A;  3R1O A;  3K1E A;  3OGN A;  4INW A;  3L4A A;  2QEO A;  2PQL A;  3DYE A;  3DZT A;  3QME A;  4FQT A;  3BFB A;  3B88 A;  1TUJ A;  3VB1 A;  3B86 A;  3L4L A;  3DXL A;  2ERB A;  5EL2 A;  1GM0 A;  3BJH A;  1OOF A;  2KPH A;  3CDN A;  3CZ2 A;  2WC5 A;  3R1P A;  3NHI A;  2WCL A;  3R72 A;  2FJY A;  3FE8 A;  2WCH A;  3BFH A;  3D78 A;  1DQE A;  2QEH A;  1C3Y A;  1TWO A;  3B87 A;  1C3Z A;  3S0A A;  2WC6 A;  3D74 A;  2QEV A;  3B6X A;  5DIC A;  3RZS A;  3S0E A;  3D76 A;  3V2L A;  2L2C A;  3CYZ A;  3S0G A;  3S0F A;  3BFA A;  3CAB A;  3NGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...