3TZ1A

Crystal structure of the ca2+-saturated c-terminal domain of akazara scallop troponin c in complex with a troponin i fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LDERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETDTDGSGTVDYEEFKCLMMSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ca2+-saturated C-terminal domain of scallop troponin C in complex with a troponin I fragment
pubmed doi rcsb
molecule keywords Troponin C
source organism Chlamys nipponensis akazara
molecule tags Contractile protein
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tz1A00
1NX3A 2R2IA 4L9MA 1DJHA 2PSRA 3TS5C 1ZMZA 1K93D 1E8AA 2JULA 4A4BA 1NIWA 1SY9A 3PM8A 3EK8A 1BG1A 5I2LA 3IQQA 5JJGA 4DUQA 1EXRA 1S6JA 2FCDA 1DT7B 2K8MB 2LM5A 1OSAA 4PHKA 1K9PA 2HF5A 2I7AA 2WCFA 3IF7A 4PE0A 1BU3A 4YI9A 2PMYA 1CB1A 1ZOTB 3M0WA 2CBLA 1KWOC 1AK8A 2MRDA 3A4UB 2BCAA 2BL0C 2LV7A 3AKBA 1RK9A 1J55A 2LUCA 3FWBA 1CDPA 1XFXO 1DGVA 4Q04A 3SG2A 1YURA 4MZLA 3SG7A 3FS7A 3H4SE 3O6BA 1M31A 2KDHA 1DJGA 3LCPC 1MXEA 2M7NA 2RGIA 4PALA 2L4HA 1XYDA 1CFCA 3VRRA 1JWDA 1EG3A 1SRAA 1SYMA 1SCMB 1J1EA 1JF2A 4GNKB 1AVSA 1B8RA 1OMDA 1MXLC 1UHHA 3EVRA 5CPVA 5D69A 2KAVA 2M97A 4E68A 1MUXA 2LC5A 5CSJA 5F6TA 1RJVA 4N1GA 1YUUA 1M45A 1IJ5A 1QXPA 2I2RE 2KHNA 1HQVA 2LVJA 3EVUA 3FIAA 3I5IC 3BUOB 3OP0A 1CFPA 3CR4X 1DJZA 1YX8A 4JQ0D 1PALA 3OB2B 1F70A 2LE9B 1PSRA 2JU0A 1CM1A 1XK4A 1QX2A 1LA0A 2KYFA 3KF9A 1CDMA 3NSIA 1YRTB 1R2UA 1B9AA 3VGOA 1KCYA 1PVAA 2KAXA 2BKHB 1HT9A 1B4CA 3NSOA 1C7VA 2BBNA 1XA5A 3TZ1A 4U8DA 1YUSA 2JWWA 2PASA 2WCBA 1QTXA 5G08A 1ALWA 3WXAA 1NCXA 4HRGA 4MRXA 2LAPA 4PHNA 2KQYA 5ER5A 3SG4A 3PN7C 3PALA 2EGDA 1Y1UA 2LHLA 3OB1B 2V53A 2IS9A 2L50A 1DJIA 2SCPA 1WY9A 1TTXA 3LK0A 1B7TZ 2PALA 3C1VA 2CTNA 2LLSA 1QV1A 2SASA 1TOPA 5DKRA 4XJKA 1N65A 1TRFA 3BUNB 1XFVO 3NSKA 1CNPA 3SIAA 2JQ6A 3CLNA 1KQMC 5HKWA 2F2PA 2JXLA 4MZKA 2AUCA 2MBXA 4WQ2A 5AERA 1CDLA 2ZN9A 1U5IB 1UWOA 2OS8B 3WNXB 1S26D 4YBHB 4MEWA 1AJ5A 1M39A 3TDZA 1DJYA 2B1UA 3LLEA 2JOJA 1JFKA 2KGBC 2Y4QA 4NDBA 1BODA 2LUXA 1H8BA 3SG5A 2L0PA 2M7LA 1CFFA 3GOFA 4QJ5B 1N0YA 4YRUA 2Y1NA 2MLEC 4JPZB 2L5XB 3DF0B 1DJXA 1UHNA 2JTZA 1JFJA 1BOCA 1G8IA 1OZOA 4R1EA 1KK8C 2E30A 1R6PA 2EC6C 2A4JA 5KTYA 2LVKA 3ZWHA 4A4CA 2Q4UA 1XFWO 2FOTA 2BCXA 5HKYA 1K94A 2NCPA 1OQPA 2LVIA 3I5FB 5DKQA 1NX2A 1J7OA 3I5GB 2KOTA 1A75B 1XVJA 1SK6D 1WLMA 2K0JA 1JBAA 4I5NB 1X02A 2LVVA 1PSBA 5HYDA 2P6BB 1DF0A 2LMTA 1GGZA 3KHEA 1OOJA 3MSEB 4CIDA 3TUYC 5I2OA 3KEVA 1A03A 3O4YA 1N2DA 1XK4C 1SR6C 1JF0A 3JTDB 4YGAA 1LINA 2QACA 1A2XA 2GGMA 4C0JA 2M1KB 1XFUO 1L2OB 1XO5A 3VROA 2O60A 4HREE 1B8LA 4P2YB 5I8NA 1QIWA 1RECA 1AUIB 2KI4B 4NDDA 1J7RA 4PE4A 4GAOA 1RROA 4ZCVA 2KAYA 1AHRA 2D8NA 2O5GA 1VRKA 1OE9B 1WLZA 1LKJA 2F3ZA 2OTGB 1KK7Y 1CTRA 1IJ6A 1SL9A 1W7JB 1ALVA 1D1OA 1OMVA 5CSIA 1K8UA 2JT3A 2KFGA 4GPLB 3EVVA 1K9UA 5I2QA 1M46A 3BOWB 1TNPA 1AP4A 1Y1XA 1S36A 3TS5B 4MVFA 3PATA 1KSMA 1KQVA 2KFFA 3AAKA 1ZFSA 2M9GA 2M0RA 4GFTA 1CM4A 4N1FA 3VRQA 4JWQA 3WHTB 4DRWA 1EG4A 1IH0A 3IQOA 3SG6A 1EJ3A 1K90D 1NYAA 1QLSA 2TN4A 2Q91A 2M8UA 4CPVA 1JC2A 2KSPA 3TDUA 1PK0D 1UHJA 1SNLA 3OHMB 4M2OA 1FI5A 1KWOB 3EK7A 4AQJA 5AXIA 1F4QA 3O2PA 4WRIA 2BL0B 1SL7A 3CR5X 2H61A 2KQ6A 2WOSA 1FBVA 4MN0A 4FQOA 1FPWA 3JVTC 3KO0A 4OKHA 2LMUA 4OVNF 3AAJA 5AANA 1WDCC 1M63B 3GK4X 1NCZA 5CSNA 1BLQA 3I5HC 2L98A 1LA3A 1V1FA 1SBJA 4GGFA 4N5XA 2K7OA 5HLVA 5KU1A 2HETA 3BXKA 2MAZA 1UUSA 2F33A 4YGEB 4GBAA 1XFZO 4HRHA 2ZKMX 1PRWA 3LL8B 2OPOA 1MQ1A 1WRLA 2JZIA 1F4OA 2M29A 2L2EA 4OCIA 1OMRA 2JC2A 1BR4B 1TCOB 2CCMA 5AFPA 1YVLA 4GUKA 2NXQA 3I5IB 1CLLA 1S6IA 1NX0A 4PHJA 1F54A 1YR5A 4NQGA 1Q80A 3D0YB 3HX4A 4DIRA 1S1EA 2G2BA 2DOQA 1NPQA 4FTGA 5GQQC 2WNDA 2LANA 3OX5A 1UHKA 2BKIB 4ETOA 1V1GA 5J3XA 1SW8A 1YUTA 2KI6D 1CLBA 2NCOA 1G33A 1CKKA 1NCYA 3ICBA 1WRZA 3D10A 2F2OA 4UPGA 2LNKA 4NDCA 3EK4A 2AMIA 4MZJA 1ODBA 1U5IA 4ORCB 2BECA 1UP5A 2ISDA 4ORBB 4AQIA 1QX7A 3DVMA 1MWNA 4C0LA 1IKUA 1JSAA 2L4IA 3NSLA 2LP3A 2BBMA 1PULA 3OX6A 3PN7B 4XYNA 4YGBB 2H2KA 1QS7A 3A8RA 1GGWA 2FJUB 1YVHA 2WC8A 5CSFA 2KYCA 5JOLA 1NSHA 1A29A 3PFVA 1FI6A 3DF0A 1SCMC 4OV2A 2BCBA 1B47A 1SMGA 1FW4A 1RWYA 3EKHA 1AJ4A 1KFUS 3CR2A 2QPTA 4QJ4B 1IG5A 2JRFA 2MHHA 1B1GA 1KK7Z 2L51A 1BMOA 3BYAA 1IGVA 1F8HA 4I5JA 4PHMA 1IQ5A 2JNFA 2KFHA 1TNXA 1CFDA 1DJWA 1KQMB 1A75A 1G4YR 1YRUB 3CWGA 3CTNA 1GJYA 2F8PA 4YI8A 3GK2A 1OZSA 3HCMA 1FF1A 2LMVA 5AEQA 5IBWA 2H61C 2E6WA 1NX1A 2K2AA 2CXJA 4I5LB 1QASA 2LHIA 3DVJA 4HSZA 3DVKA 2ZNEA 4DCKA 1SCVA 1KSOA 1RTP1 2ZRSA 2LCPA 2GV5A 2COLB 3PSRA 2MJWB 1A4PA 1DGUA 1WRKA 4GGFC 1Y0VH 2ZFDA 4CLNA 3RM1A 2G9BA 1BT6A 1KK8B 2JTTA 4ICBA 4PDZA 2EC6B 1BJFA 3QRXA 3PLFB 1F71A 1CLMA 2JNXA 3CGAA 5TNCA 1RFJA 1UURA 4DS7A 1J7PA 1BR1B 2KNEA 2AAOA 4YGCB 1KFXL 4I5KA 1KFXS 4F0ZB 1ZUZA 5ER4X 1EH2A 1ZACA 1K9KA 1IWQA 2M1UA 2WCEA 2I18A 1IRJA 1S5GZ 3TUYB 2BE6A 4CFRA 2MLFC 1K2HA 2LLUA 3F45A 3CS1A 1SR6B 3BOWA 2MA2A 5BPJA 2CT9A 5B8IB 4ZCUA 1BF5A 3LK1A 3O78A 1QLKA 4MSPA 2BE4A 1DMOA 5FYXA 2FCEA 1F55A 3VRNA 3BUWB 1DVIA 2KBIA 2Y5IA 5K89A 1CMGA 4BY5A 1TNWA 2WORA 3GK1A 2JT0A 4QJ3B 1YX7A 2JT8A 2OS8C 3BUXB 3E3RA 1K96A 1L7ZA 3WHUB 2HPSA 4PE7A 1XFYO 1SKTA 1JUOA 1S5GY 3NXAA 4M2PA 1H4BA 1PVBA 4GGNA 3FWCA 4TNCA 4ORAB 1DTLA 1CMFA 1YTZC 1C07A 1TIZA 3DVEA 1MF8B 1TCFA 2HQ8A 3BUMB 4XJKB 2CNPA 2K61A 2ZN8A 5D7FA 5KSZA 2EHBA 4D1EA 1TN4A 1LVCD 4USLA 3TDIA 5HKZA 3I5FC 1QV0A 3KPXA 2KI6C 1NWDA 4C0KA 3SIBA 4AOMA 2JPTA 3I5GC 1SPYA 2M49B 2PRUA 2GGZA 1W7IB 2M3WA 1QJTA 4YGDB 1C7WA 1K95A 2Y1MA 4M2QA 2F3YA 5PALA 1LXFC 1CDNA 1MHOA 1GQMA 2K7CA 4WQ3A 3AKAA 3RLZA 3JTDC 5DKNA 2VRGA 2K7BA 4MRYA 2HQWA 3D0YA 3ZNIA 1QVIZ 1Y6WA 1L2OC 1NUBA 2K2FA 2KGRA 3JVTB 2I94A 3BQ3A 1TNQA 2NLNA 3SG3A 4PE1A 1SL8A 1WDCB 1EL4A 2KI4C 3I5HB 3K21A 1J7QA 3VRPA 1S3PA 1MR8A 2JXCA 2ZRTA 1B7TY 4MLWA 3EKJA 2LP2A 1J1DA 1QATA 1QIVA 1S6CA 4MBEA 1KFUL 2KBMA 3DD4A 1NP8A 3SJSA 2OTGC 4OR9B 3CZTX 4CFQA 1Y1AA 5HLOA 4IL1A 1DF0B 2K7DA 2PVBA 4BY4A 4P5OE 1QX5B 1IQ3A 1B8CA 1UHIA 2LLTA 4PCWA 2ZNDA 1QVIY 2NZ0A
chains in the Genus database with same CATH superfamily
1NX3A 2QEVA 2R2IA 4L9MA 1DJHA 2PSRA 3TS5C 1ZMZA 1K93D 1E8AA 2JULA 4JD9A 4A4BA 1NIWA 1SY9A 3PM8A 3EK8A 1BG1A 5I2LA 3IQQA 5JJGA 4DUQA 1EXRA 1S6JA 2FCDA 1DT7B 2K8MB 2LM5A 1OSAA 4PHKA 1K9PA 2HF5A 2I7AA 2WCFA 3IF7A 4PE0A 1BU3A 2QEOA 4YI9A 2PMYA 1CB1A 1ZOTB 3M0WA 2CBLA 1KWOC 2P71A 2MRDA 3A4UB 1AK8A 2BCAA 2BL0C 3BFBA 2LV7A 3AKBA 1RK9A 1J55A 2LUCA 3FWBA 1CDPA 1XFXO 1DGVA 4Q04A 3SG2A 1YURA 4MZLA 2L2CA 3SG7A 3FS7A 3H4SE 3O6BA 1M31A 2KDHA 1DJGA 3LCPC 1MXEA 2M7NA 2RGIA 4PALA 2L4HA 1XYDA 3OBVA 4INWA 3VRRA 3L4AA 1EG3A 1SRAA 1SYMA 1CFCA 1OW4A 1SCMB 1DEKA 1J1EA 3NGVA 1JF2A 4GNKB 1AVSA 1B8RA 1OMDA 1MXLC 1UHHA 3EVRA 5CPVA 5D69A 2KAVA 2M97A 2PQLA 3S0DA 4E68A 1MUXA 2LC5A 5CSJA 5F6TA 1RJVA 4N1GA 1YUUA 1M45A 1IJ5A 1QXPA 2I2RE 2KHNA 1HQVA 2LVJA 3EVUA 3FIAA 3I5IC 1OOFA 3BUOB 3OP0A 1CFPA 3CR4X 1DJZA 1YX8A 4JQ0D 1PALA 5FI7A 3OB2B 1F70A 2LE9B 1PSRA 3B88A 2JU0A 1CM1A 2GTEA 1XK4A 1QX2A 1LA0A 2KYFA 3KF9A 1CDMA 3NSIA 3BFHA 1YRTB 1R2UA 1B9AA 3VGOA 1KCYA 1PVAA 2KAXA 2JPOA 2BKHB 1HT9A 1B4CA 3NSOA 1C7VA 2BAPA 2BBNA 1XA5A 3TZ1A 4U8DA 1YUSA 2JWWA 2PASA 2WCBA 1QTXA 5G08A 1ALWA 3WXAA 1NCXA 2KLEA 4HRGA 1DC1A 3FE6A 4MRXA 2LAPA 4OZDA 4PHNA 2KQYA 5ER5A 3SG4A 3PN7C 3PALA 2EGDA 1Y1UA 2LHLA 3OB1B 2V53A 2IS9A 1OOGA 2L50A 1DJIA 2SCPA 1WY9A 2WCLA 1TTXA 3LK0A 1B7TZ 2PALA 3C1VA 4PT1A 2CTNA 2LLSA 1QV1A 2SASA 1TOPA 2QEHA 5DKRA 2WCJA 4XJKA 1N65A 1TRFA 1DQEA 3BUNB 1XFVO 3NSKA 1CNPA 3SIAA 2JQ6A 3CLNA 1KQMC 5HKWA 2F2PA 2JXLA 4MZKA 2AUCA 2MBXA 4WQ2A 5AERA 1CDLA 2ZN9A 1U5IB 1UWOA 3DY9A 2OS8B 3WNXB 1S26D 4YBHB 1TUJA 4MEWA 1AJ5A 1M39A 3TDZA 1DJYA 2B1UA 3LLEA 2JOJA 1JFKA 2KGBC 2Y4QA 4NDBA 1BODA 2LUXA 1H8BA 3SG5A 2L0PA 2M7LA 1CFFA 3GOFA 4QJ5B 3R72A 1N0YA 4YRUA 2Y1NA 2MLEC 4JPZB 3S0AA 2L5XB 3DF0B 1DJXA 1UHNA 2JTZA 3SS3A 1JFJA 3R1OA 1BOCA 1G8IA 1OZOA 4R1EA 1KK8C 2E30A 1R6PA 3D77A 2EC6C 2H8VA 2A4JA 5KTYA 1C3ZA 2LVKA 3ZWHA 4A4CA 2Q4UA 1XFWO 2FOTA 2BCXA 5HKYA 1K94A 2NCPA 1OQPA 2LVIA 3I5FB 5DKQA 1NX2A 1J7OA 3I5GB 2KOTA 1A75B 1XVJA 1SK6D 1WLMA 2K0JA 1JBAA 4I5NB 1X02A 2LVVA 1PSBA 5I94A 5HYDA 2P6BB 1DF0A 2LMTA 1GGZA 3KHEA 1OOJA 3MSEB 4CIDA 3TUYC 5I2OA 3KEVA 1A03A 3O4YA 1N2DA 1XK4C 1LS8A 1JF0A 1SR6C 3JTDB 3BJHA 1LINA 4YGAA 2QACA 1A2XA 5DICA 2GGMA 4C0JA 2M1KB 2YGUA 1XFUO 3B7AA 1L2OB 1XO5A 3VROA 2O60A 4HREE 1B8LA 4P2YB 5I8NA 1QIWA 1RECA 1AUIB 5EL2A 2KI4B 4NDDA 1J7RA 2ERBA 4PE4A 4GAOA 4IJ7A 1RROA 4ZCVA 2KAYA 1Z4HA 1AHRA 2WC6A 2D8NA 2O5GA 1VRKA 2WCMA 1Z2CB 1OE9B 1WLZA 1LKJA 2F3ZA 2OTGB 1KK7Y 1CTRA 1IJ6A 1SL9A 3B87A 1W7JB 1ALVA 1D1OA 1OMVA 5CSIA 1K8UA 2JT3A 2KFGA 4GPLB 3EVVA 3BFAA 1K9UA 5I2QA 1M46A 3BOWB 1TNPA 1AP4A 1Y1XA 1S36A 3TS5B 3SS4A 4MVFA 3PATA 1KSMA 1KQVA 2KFFA 3AAKA 3FE8A 1ZFSA 2KPHA 2M0RA 2M9GA 3D74A 4GFTA 1CM4A 4N1FA 3S0GA 3VRQA 4JWQA 3WHTB 4DRWA 1EG4A 1IH0A 3IQOA 3SG6A 1EJ3A 1K90D 1NYAA 1QLSA 2TN4A 2Q91A 2M8UA 4CPVA 1JC2A 2KSPA 3TDUA 1PK0D 1UHJA 1SNLA 3OHMB 4M2OA 1DELA 1FI5A 1KWOB 3EK7A 4AQJA 5AXIA 1F4QA 3O2PA 2WCKA 4WRIA 2BL0B 1SL7A 3CR5X 2H61A 2KQ6A 2WOSA 3EG5B 1FBVA 4MN0A 4F7FA 4FQOA 1FPWA 3JVTC 3KO0A 1TWOA 4OKHA 2LMUA 4OVNF 3AAJA 5AANA 1WDCC 1M63B 3GK4X 1NCZA 5CSNA 1OOIX 1BLQA 3I5HC 2L98A 1LA3A 1V1FA 1P28A 1SBJA 4GGFA 4N5XA 2K7OA 5HLVA 5KU1A 2HETA 3BXKA 2MAZA 1UUSA 2F33A 4YGEB 4GBAA 1XFZO 4HRHA 2ZKMX 1PRWA 3LL8B 2OPOA 1MQ1A 1WRLA 2JZIA 1F4OA 2M29A 2L2EA 4OCIA 1OMRA 2JC2A 1BR4B 1TCOB 2CCMA 3S0BA 5AFPA 5FI2A 1YVLA 2P70A 4GUKA 2NXQA 3I5IB 1CLLA 1S6IA 2WCHA 3L47A 1NX0A 4PHJA 1F54A 1YR5A 4NQGA 1Q80A 3D0YB 3HX4A 4DIRA 1S1EA 2G2BA 4JKTA 1QWVA 2DOQA 2KLDA 3R1PA 1NPQA 4FTGA 5GQQC 2WNDA 2LANA 1OOHA 3OX5A 1UHKA 2BKIB 3CZ1A 4ETOA 3SS5A 3B6XA 4KYNA 4FQTA 1V1GA 5J3XA 1SW8A 1YUTA 2KI6D 1CLBA 2NCOA 1G33A 1CKKA 1NCYA 3ICBA 1WRZA 3D10A 2F2OA 4UPGA 2LNKA 4NDCA 3EK4A 2AMIA 4MZJA 1ODBA 1U5IA 3O4XA 4ORCB 2BECA 1UP5A 2ISDA 4ORBB 4AQIA 1QX7A 3DVMA 1MWNA 3NHIA 4C0LA 1IKUA 3N7HA 1JSAA 2L4IA 3NSLA 2LP3A 2BBMA 1PULA 3OX6A 3PN7B 4XYNA 4YGBB 2H2KA 1QS7A 3A8RA 5FI6A 1C3YA 2FJUB 1GGWA 1W9ZA 1YVHA 2WC8A 5CSFA 2KYCA 5JOLA 3QMEA 1NSHA 3CABA 1A29A 3PFVA 1FI6A 3DF0A 1SCMC 4OV2A 2BCBA 1B47A 1SMGA 1FW4A 1RWYA 3EKHA 1AJ4A 1KFUS 3CR2A 1T14A 2QPTA 3K1EA 4QJ4B 1IG5A 2JRFA 2MHHA 3DZTA 1B1GA 1JWDA 1KK7Z 2L51A 3D75A 1BMOA 3BYAA 1IGVA 3PM2A 5D3OA 1F8HA 4I5JA 4PHMA 1IQ5A 2JNFA 2KFHA 1TNXA 1CFDA 1DJWA 1KQMB 1A75A 1G4YR 1YRUB 3CWGA 3D78A 3CTNA 1GJYA 2F8PA 4YI8A 3GK2A 1OZSA 3HCMA 1FF1A 2LMVA 5AEQA 5IBWA 2H61C 3CYZA 2E6WA 1NX1A 2K2AA 2CXJA 4I5LB 1QASA 2LHIA 3DVJA 4HSZA 3DVKA 2ZNEA 4DCKA 1SCVA 3CZ2A 1KSOA 1RTP1 2ZRSA 2LCPA 2GV5A 2COLB 3PSRA 2MJWB 1A4PA 1DGUA 1WRKA 4GGFC 1Y0VH 2FJYA 2ZFDA 4CLNA 3RM1A 2G9BA 1BT6A 1KK8B 2JTTA 4ICBA 4PDZA 1TUZA 2EC6B 1BJFA 3IVTA 3PLFB 2QDIA 3QRXA 5HL1A 1F71A 1CLMA 2JNXA 3CGAA 5TNCA 1GM0A 1RFJA 1UURA 4DS7A 1J7PA 3S0EA 1BR1B 2KNEA 4INXA 2AAOA 4YGCB 1KFXL 4I5KA 1KFXS 4F0ZB 1XFRA 1ZUZA 5ER4X 3L4LA 1EH2A 1ZACA 1K9KA 1IWQA 2M1UA 2WCEA 3R1VA 2I18A 1IRJA 1S5GZ 3TUYB 2BE6A 4CFRA 3Q8IA 2MLFC 1K2HA 2LLUA 3D76A 3CS1A 1SR6B 3F45A 3BOWA 2MA2A 5BPJA 2CT9A 5B8IB 3FE9A 4ZCUA 1BF5A 3LK1A 2WC5A 3O78A 1QLKA 4MSPA 2BE4A 1DMOA 5FYXA 1SSEB 2FCEA 3S0FA 3CZ0A 1F55A 3VRNA 3BUWB 1DVIA 2KBIA 2Y5IA 5K89A 1CMGA 3PJIA 4BY5A 1TNWA 2WORA 3GK1A 2JT0A 4QJ3B 1YX7A 2JT8A 2OS8C 3BUXB 3E3RA 1K96A 1L7ZA 3WHUB 2HPSA 4PE7A 1XFYO 1SKTA 1IIOA 1JUOA 1S5GY 3NXAA 4M2PA 1H4BA 1PVBA 4GGNA 3FWCA 4TNCA 4ORAB 1DTLA 3OGNA 1CMFA 1YTZC 1C07A 2BNXA 1TIZA 3UO9A 3DVEA 1MF8B 1TCFA 3B86A 3RZSA 2HQ8A 3BUMB 4XJKB 2CNPA 2K61A 2PYQA 2ZN8A 5D7FA 5KSZA 2EHBA 4D1EA 1TN4A 1LVCD 4USLA 3UNWA 3TDIA 3V2LA 3DYEA 5HKZA 3I5FC 1QV0A 3KPXA 2KI6C 1NWDA 4C0KA 3SIBA 4AOMA 2JPTA 3I5GC 1SPYA 2M49B 2PRUA 2GGZA 1W7IB 2M3WA 1QJTA 4YGDB 1C7WA 1K95A 3NHTA 2Y1MA 3DXLA 2F3YA 4M2QA 5PALA 1LXFC 1CDNA 1MHOA 1GQMA 2K7CA 4WQ3A 3AKAA 3RLZA 3JTDC 5DKNA 2VRGA 2K7BA 4MRYA 2HQWA 3D0YA 3D73A 3ZNIA 1QVIZ 1Y6WA 1L2OC 1NUBA 2K2FA 2KGRA 3JVTB 2I94A 3BQ3A 1TNQA 2QEBA 2L5YA 2NLNA 3SG3A 3CDNA 4PE1A 3VB1A 1SL8A 1WDCB 1EL4A 2KI4C 3I5HB 1ORGA 3K21A 1J7QA 3VRPA 1S3PA 1MR8A 2JXCA 2ZRTA 1B7TY 4MLWA 3EKJA 2LP2A 1J1DA 1QATA 1QIVA 1S6CA 4MBEA 1KFUL 2KBMA 3DD4A 1NP8A 3SJSA 2OTGC 4OR9B 3CZTX 4CFQA 1Y1AA 5HLOA 4IL1A 1DF0B 2K7DA 2PVBA 4BY4A 4P5OE 1QX5B 1IQ3A 1B8CA 1UHIA 2LLTA 4PCWA 2ZNDA 1QVIY 2K60A 2NZ0A
chains in the Genus database with same CATH topology
1NX3A 2R2IA 4L9MA 1DJHA 2PSRA 3TS5C 1ZMZA 1K93D 1E8AA 2JULA 4A4BA 1NIWA 1SY9A 3PM8A 3EK8A 1BG1A 5I2LA 3IQQA 5JJGA 4DUQA 1EXRA 1S6JA 2FCDA 1DT7B 2K8MB 2LM5A 1OSAA 4PHKA 1K9PA 2HF5A 2I7AA 2WCFA 3IF7A 4PE0A 1BU3A 4YI9A 2PMYA 1CB1A 1ZOTB 3M0WA 2CBLA 1KWOC 1AK8A 2MRDA 3A4UB 2BCAA 2BL0C 2LV7A 3AKBA 1RK9A 1J55A 2LUCA 3FWBA 1CDPA 1XFXO 1DGVA 4Q04A 3SG2A 1YURA 4MZLA 3SG7A 3FS7A 3H4SE 3O6BA 1M31A 2KDHA 1DJGA 3LCPC 1MXEA 2M7NA 2RGIA 4PALA 2L4HA 1XYDA 1CFCA 3VRRA 1JWDA 1EG3A 1SRAA 1SYMA 1SCMB 1J1EA 1JF2A 4GNKB 1AVSA 1B8RA 1OMDA 1MXLC 1UHHA 3EVRA 5CPVA 5D69A 2KAVA 2M97A 4E68A 1MUXA 2LC5A 5CSJA 5F6TA 1RJVA 4N1GA 1YUUA 1M45A 1IJ5A 1QXPA 2I2RE 2KHNA 1HQVA 2LVJA 3EVUA 3FIAA 3I5IC 3BUOB 3OP0A 1CFPA 3CR4X 1DJZA 1YX8A 4JQ0D 1PALA 3OB2B 1F70A 2LE9B 1PSRA 2JU0A 1CM1A 1XK4A 1QX2A 1LA0A 2KYFA 3KF9A 1CDMA 3NSIA 1YRTB 1R2UA 1B9AA 3VGOA 1KCYA 1PVAA 2KAXA 2BKHB 1HT9A 1B4CA 3NSOA 1C7VA 2BBNA 1XA5A 3TZ1A 4U8DA 1YUSA 2JWWA 2PASA 2WCBA 1QTXA 5G08A 1ALWA 3WXAA 1NCXA 4HRGA 4MRXA 2LAPA 4PHNA 2KQYA 5ER5A 3SG4A 3PN7C 3PALA 2EGDA 1Y1UA 2LHLA 3OB1B 2V53A 2IS9A 2L50A 1DJIA 2SCPA 1WY9A 1TTXA 3LK0A 1B7TZ 2PALA 3C1VA 2CTNA 2LLSA 1QV1A 2SASA 1TOPA 5DKRA 4XJKA 1N65A 1TRFA 3BUNB 1XFVO 3NSKA 1CNPA 3SIAA 2JQ6A 3CLNA 1KQMC 5HKWA 2F2PA 2JXLA 4MZKA 2AUCA 2MBXA 4WQ2A 5AERA 1CDLA 2ZN9A 1U5IB 1UWOA 2OS8B 3WNXB 1S26D 4YBHB 4MEWA 1AJ5A 1M39A 3TDZA 1DJYA 2B1UA 3LLEA 2JOJA 1JFKA 2KGBC 2Y4QA 4NDBA 1BODA 2LUXA 1H8BA 3SG5A 2L0PA 2M7LA 1CFFA 3GOFA 4QJ5B 1N0YA 4YRUA 2Y1NA 2MLEC 4JPZB 2L5XB 3DF0B 1DJXA 1UHNA 2JTZA 1JFJA 1BOCA 1G8IA 1OZOA 4R1EA 1KK8C 2E30A 1R6PA 2EC6C 2A4JA 5KTYA 2LVKA 3ZWHA 4A4CA 2Q4UA 1XFWO 2FOTA 2BCXA 5HKYA 1K94A 2NCPA 1OQPA 2LVIA 3I5FB 5DKQA 1NX2A 1J7OA 3I5GB 2KOTA 1A75B 1XVJA 1SK6D 1WLMA 2K0JA 1JBAA 4I5NB 1X02A 2LVVA 1PSBA 5HYDA 2P6BB 1DF0A 2LMTA 1GGZA 3KHEA 1OOJA 3MSEB 4CIDA 3TUYC 5I2OA 3KEVA 1A03A 3O4YA 1N2DA 1XK4C 1SR6C 1JF0A 3JTDB 4YGAA 1LINA 2QACA 1A2XA 2GGMA 4C0JA 2M1KB 1XFUO 1L2OB 1XO5A 3VROA 2O60A 4HREE 1B8LA 4P2YB 5I8NA 1QIWA 1RECA 1AUIB 2KI4B 4NDDA 1J7RA 4PE4A 4GAOA 1RROA 4ZCVA 2KAYA 1AHRA 2D8NA 2O5GA 1VRKA 1OE9B 1WLZA 1LKJA 2F3ZA 2OTGB 1KK7Y 1CTRA 1IJ6A 1SL9A 1W7JB 1ALVA 1D1OA 1OMVA 5CSIA 1K8UA 2JT3A 2KFGA 4GPLB 3EVVA 1K9UA 5I2QA 1M46A 3BOWB 1TNPA 1AP4A 1Y1XA 1S36A 3TS5B 4MVFA 3PATA 1KSMA 1KQVA 2KFFA 3AAKA 1ZFSA 2M9GA 2M0RA 4GFTA 1CM4A 4N1FA 3VRQA 4JWQA 3WHTB 4DRWA 1EG4A 1IH0A 3IQOA 3SG6A 1EJ3A 1K90D 1NYAA 1QLSA 2TN4A 2Q91A 2M8UA 4CPVA 1JC2A 2KSPA 3TDUA 1PK0D 1UHJA 1SNLA 3OHMB 4M2OA 1FI5A 1KWOB 3EK7A 4AQJA 5AXIA 1F4QA 3O2PA 4WRIA 2BL0B 1SL7A 3CR5X 2H61A 2KQ6A 2WOSA 1FBVA 4MN0A 4FQOA 1FPWA 3JVTC 3KO0A 4OKHA 2LMUA 4OVNF 3AAJA 5AANA 1WDCC 1M63B 3GK4X 1NCZA 5CSNA 1BLQA 3I5HC 2L98A 1LA3A 1V1FA 1SBJA 4GGFA 4N5XA 2K7OA 5HLVA 5KU1A 2HETA 3BXKA 2MAZA 1UUSA 2F33A 4YGEB 4GBAA 1XFZO 4HRHA 2ZKMX 1PRWA 3LL8B 2OPOA 1MQ1A 1WRLA 2JZIA 1F4OA 2M29A 2L2EA 4OCIA 1OMRA 2JC2A 1BR4B 1TCOB 2CCMA 5AFPA 1YVLA 4GUKA 2NXQA 3I5IB 1CLLA 1S6IA 1NX0A 4PHJA 1F54A 1YR5A 4NQGA 1Q80A 3D0YB 3HX4A 4DIRA 1S1EA 2G2BA 2DOQA 1NPQA 4FTGA 5GQQC 2WNDA 2LANA 3OX5A 1UHKA 2BKIB 4ETOA 1V1GA 5J3XA 1SW8A 1YUTA 2KI6D 1CLBA 2NCOA 1G33A 1CKKA 1NCYA 3ICBA 1WRZA 3D10A 2F2OA 4UPGA 2LNKA 4NDCA 3EK4A 2AMIA 4MZJA 1ODBA 1U5IA 4ORCB 2BECA 1UP5A 2ISDA 4ORBB 4AQIA 1QX7A 3DVMA 1MWNA 4C0LA 1IKUA 1JSAA 2L4IA 3NSLA 2LP3A 2BBMA 1PULA 3OX6A 3PN7B 4XYNA 4YGBB 2H2KA 1QS7A 3A8RA 1GGWA 2FJUB 1YVHA 2WC8A 5CSFA 2KYCA 5JOLA 1NSHA 1A29A 3PFVA 1FI6A 3DF0A 1SCMC 4OV2A 2BCBA 1B47A 1SMGA 1FW4A 1RWYA 3EKHA 1AJ4A 1KFUS 3CR2A 2QPTA 4QJ4B 1IG5A 2JRFA 2MHHA 1B1GA 1KK7Z 2L51A 1BMOA 3BYAA 1IGVA 1F8HA 4I5JA 4PHMA 1IQ5A 2JNFA 2KFHA 1TNXA 1CFDA 1DJWA 1KQMB 1A75A 1G4YR 1YRUB 3CWGA 3CTNA 1GJYA 2F8PA 4YI8A 3GK2A 1OZSA 3HCMA 1FF1A 2LMVA 5AEQA 5IBWA 2H61C 2E6WA 1NX1A 2K2AA 2CXJA 4I5LB 1QASA 2LHIA 3DVJA 4HSZA 3DVKA 2ZNEA 4DCKA 1SCVA 1KSOA 1RTP1 2ZRSA 2LCPA 2GV5A 2COLB 3PSRA 2MJWB 1A4PA 1DGUA 1WRKA 4GGFC 1Y0VH 2ZFDA 4CLNA 3RM1A 2G9BA 1BT6A 1KK8B 2JTTA 4ICBA 4PDZA 2EC6B 1BJFA 3QRXA 3PLFB 1F71A 1CLMA 2JNXA 3CGAA 5TNCA 1RFJA 1UURA 4DS7A 1J7PA 1BR1B 2KNEA 2AAOA 4YGCB 1KFXL 4I5KA 1KFXS 4F0ZB 1ZUZA 5ER4X 1EH2A 1ZACA 1K9KA 1IWQA 2M1UA 2WCEA 2I18A 1IRJA 1S5GZ 3TUYB 2BE6A 4CFRA 2MLFC 1K2HA 2LLUA 3F45A 3CS1A 1SR6B 3BOWA 2MA2A 5BPJA 2CT9A 5B8IB 4ZCUA 1BF5A 3LK1A 3O78A 1QLKA 4MSPA 2BE4A 1DMOA 5FYXA 2FCEA 1F55A 3VRNA 3BUWB 1DVIA 2KBIA 2Y5IA 5K89A 1CMGA 4BY5A 1TNWA 2WORA 3GK1A 2JT0A 4QJ3B 1YX7A 2JT8A 2OS8C 3BUXB 3E3RA 1K96A 1L7ZA 3WHUB 2HPSA 4PE7A 1XFYO 1SKTA 1JUOA 1S5GY 3NXAA 4M2PA 1H4BA 1PVBA 4GGNA 3FWCA 4TNCA 4ORAB 1DTLA 1CMFA 1YTZC 1C07A 1TIZA 3DVEA 1MF8B 1TCFA 2HQ8A 3BUMB 4XJKB 2CNPA 2K61A 2ZN8A 5D7FA 5KSZA 2EHBA 4D1EA 1TN4A 1LVCD 4USLA 3TDIA 5HKZA 3I5FC 1QV0A 3KPXA 2KI6C 1NWDA 4C0KA 3SIBA 4AOMA 2JPTA 3I5GC 1SPYA 2M49B 2PRUA 2GGZA 1W7IB 2M3WA 1QJTA 4YGDB 1C7WA 1K95A 2Y1MA 4M2QA 2F3YA 5PALA 1LXFC 1CDNA 1MHOA 1GQMA 2K7CA 4WQ3A 3AKAA 3RLZA 3JTDC 5DKNA 2VRGA 2K7BA 4MRYA 2HQWA 3D0YA 3ZNIA 1QVIZ 1Y6WA 1L2OC 1NUBA 2K2FA 2KGRA 3JVTB 2I94A 3BQ3A 1TNQA 2NLNA 3SG3A 4PE1A 1SL8A 1WDCB 1EL4A 2KI4C 3I5HB 3K21A 1J7QA 3VRPA 1S3PA 1MR8A 2JXCA 2ZRTA 1B7TY 4MLWA 3EKJA 2LP2A 1J1DA 1QATA 1QIVA 1S6CA 4MBEA 1KFUL 2KBMA 3DD4A 1NP8A 3SJSA 2OTGC 4OR9B 3CZTX 4CFQA 1Y1AA 5HLOA 4IL1A 1DF0B 2K7DA 2PVBA 4BY4A 4P5OE 1QX5B 1IQ3A 1B8CA 1UHIA 2LLTA 4PCWA 2ZNDA 1QVIY 2NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX3 A;  2R2I A;  4L9M A;  1DJH A;  2PSR A;  3TS5 C;  1ZMZ A;  1K93 D;  1E8A A;  2JUL A;  4A4B A;  1NIW A;  1SY9 A;  3PM8 A;  3EK8 A;  1BG1 A;  5I2L A;  3IQQ A;  5JJG A;  4DUQ A;  1EXR A;  1S6J A;  2FCD A;  1DT7 B;  2K8M B;  2LM5 A;  1OSA A;  4PHK A;  1K9P A;  2HF5 A;  2I7A A;  2WCF A;  3IF7 A;  4PE0 A;  1BU3 A;  4YI9 A;  2PMY A;  1CB1 A;  1ZOT B;  3M0W A;  2CBL A;  1KWO C;  1AK8 A;  2MRD A;  3A4U B;  2BCA A;  2BL0 C;  2LV7 A;  3AKB A;  1RK9 A;  1J55 A;  2LUC A;  3FWB A;  1CDP A;  1XFX O;  1DGV A;  4Q04 A;  3SG2 A;  1YUR A;  4MZL A;  3SG7 A;  3FS7 A;  3H4S E;  3O6B A;  1M31 A;  2KDH A;  1DJG A;  3LCP C;  1MXE A;  2M7N A;  2RGI A;  4PAL A;  2L4H A;  1XYD A;  1CFC A;  3VRR A;  1JWD A;  1EG3 A;  1SRA A;  1SYM A;  1SCM B;  1J1E A;  1JF2 A;  4GNK B;  1AVS A;  1B8R A;  1OMD A;  1MXL C;  1UHH A;  3EVR A;  5CPV A;  5D69 A;  2KAV A;  2M97 A;  4E68 A;  1MUX A;  2LC5 A;  5CSJ A;  5F6T A;  1RJV A;  4N1G A;  1YUU A;  1M45 A;  1IJ5 A;  1QXP A;  2I2R E;  2KHN A;  1HQV A;  2LVJ A;  3EVU A;  3FIA A;  3I5I C;  3BUO B;  3OP0 A;  1CFP A;  3CR4 X;  1DJZ A;  1YX8 A;  4JQ0 D;  1PAL A;  3OB2 B;  1F70 A;  2LE9 B;  1PSR A;  2JU0 A;  1CM1 A;  1XK4 A;  1QX2 A;  1LA0 A;  2KYF A;  3KF9 A;  1CDM A;  3NSI A;  1YRT B;  1R2U A;  1B9A A;  3VGO A;  1KCY A;  1PVA A;  2KAX A;  2BKH B;  1HT9 A;  1B4C A;  3NSO A;  1C7V A;  2BBN A;  1XA5 A;  3TZ1 A;  4U8D A;  1YUS A;  2JWW A;  2PAS A;  2WCB A;  1QTX A;  5G08 A;  1ALW A;  3WXA A;  1NCX A;  4HRG A;  4MRX A;  2LAP A;  4PHN A;  2KQY A;  5ER5 A;  3SG4 A;  3PN7 C;  3PAL A;  2EGD A;  1Y1U A;  2LHL A;  3OB1 B;  2V53 A;  2IS9 A;  2L50 A;  1DJI A;  2SCP A;  1WY9 A;  1TTX A;  3LK0 A;  1B7T Z;  2PAL A;  3C1V A;  2CTN A;  2LLS A;  1QV1 A;  2SAS A;  1TOP A;  5DKR A;  4XJK A;  1N65 A;  1TRF A;  3BUN B;  1XFV O;  3NSK A;  1CNP A;  3SIA A;  2JQ6 A;  3CLN A;  1KQM C;  5HKW A;  2F2P A;  2JXL A;  4MZK A;  2AUC A;  2MBX A;  4WQ2 A;  5AER A;  1CDL A;  2ZN9 A;  1U5I B;  1UWO A;  2OS8 B;  3WNX B;  1S26 D;  4YBH B;  4MEW A;  1AJ5 A;  1M39 A;  3TDZ A;  1DJY A;  2B1U A;  3LLE A;  2JOJ A;  1JFK A;  2KGB C;  2Y4Q A;  4NDB A;  1BOD A;  2LUX A;  1H8B A;  3SG5 A;  2L0P A;  2M7L A;  1CFF A;  3GOF A;  4QJ5 B;  1N0Y A;  4YRU A;  2Y1N A;  2MLE C;  4JPZ B;  2L5X B;  3DF0 B;  1DJX A;  1UHN A;  2JTZ A;  1JFJ A;  1BOC A;  1G8I A;  1OZO A;  4R1E A;  1KK8 C;  2E30 A;  1R6P A;  2EC6 C;  2A4J A;  5KTY A;  2LVK A;  3ZWH A;  4A4C A;  2Q4U A;  1XFW O;  2FOT A;  2BCX A;  5HKY A;  1K94 A;  2NCP A;  1OQP A;  2LVI A;  3I5F B;  5DKQ A;  1NX2 A;  1J7O A;  3I5G B;  2KOT A;  1A75 B;  1XVJ A;  1SK6 D;  1WLM A;  2K0J A;  1JBA A;  4I5N B;  1X02 A;  2LVV A;  1PSB A;  5HYD A;  2P6B B;  1DF0 A;  2LMT A;  1GGZ A;  3KHE A;  1OOJ A;  3MSE B;  4CID A;  3TUY C;  5I2O A;  3KEV A;  1A03 A;  3O4Y A;  1N2D A;  1XK4 C;  1SR6 C;  1JF0 A;  3JTD B;  4YGA A;  1LIN A;  2QAC A;  1A2X A;  2GGM A;  4C0J A;  2M1K B;  1XFU O;  1L2O B;  1XO5 A;  3VRO A;  2O60 A;  4HRE E;  1B8L A;  4P2Y B;  5I8N A;  1QIW A;  1REC A;  1AUI B;  2KI4 B;  4NDD A;  1J7R A;  4PE4 A;  4GAO A;  1RRO A;  4ZCV A;  2KAY A;  1AHR A;  2D8N A;  2O5G A;  1VRK A;  1OE9 B;  1WLZ A;  1LKJ A;  2F3Z A;  2OTG B;  1KK7 Y;  1CTR A;  1IJ6 A;  1SL9 A;  1W7J B;  1ALV A;  1D1O A;  1OMV A;  5CSI A;  1K8U A;  2JT3 A;  2KFG A;  4GPL B;  3EVV A;  1K9U A;  5I2Q A;  1M46 A;  3BOW B;  1TNP A;  1AP4 A;  1Y1X A;  1S36 A;  3TS5 B;  4MVF A;  3PAT A;  1KSM A;  1KQV A;  2KFF A;  3AAK A;  1ZFS A;  2M9G A;  2M0R A;  4GFT A;  1CM4 A;  4N1F A;  3VRQ A;  4JWQ A;  3WHT B;  4DRW A;  1EG4 A;  1IH0 A;  3IQO A;  3SG6 A;  1EJ3 A;  1K90 D;  1NYA A;  1QLS A;  2TN4 A;  2Q91 A;  2M8U A;  4CPV A;  1JC2 A;  2KSP A;  3TDU A;  1PK0 D;  1UHJ A;  1SNL A;  3OHM B;  4M2O A;  1FI5 A;  1KWO B;  3EK7 A;  4AQJ A;  5AXI A;  1F4Q A;  3O2P A;  4WRI A;  2BL0 B;  1SL7 A;  3CR5 X;  2H61 A;  2KQ6 A;  2WOS A;  1FBV A;  4MN0 A;  4FQO A;  1FPW A;  3JVT C;  3KO0 A;  4OKH A;  2LMU A;  4OVN F;  3AAJ A;  5AAN A;  1WDC C;  1M63 B;  3GK4 X;  1NCZ A;  5CSN A;  1BLQ A;  3I5H C;  2L98 A;  1LA3 A;  1V1F A;  1SBJ A;  4GGF A;  4N5X A;  2K7O A;  5HLV A;  5KU1 A;  2HET A;  3BXK A;  2MAZ A;  1UUS A;  2F33 A;  4YGE B;  4GBA A;  1XFZ O;  4HRH A;  2ZKM X;  1PRW A;  3LL8 B;  2OPO A;  1MQ1 A;  1WRL A;  2JZI A;  1F4O A;  2M29 A;  2L2E A;  4OCI A;  1OMR A;  2JC2 A;  1BR4 B;  1TCO B;  2CCM A;  5AFP A;  1YVL A;  4GUK A;  2NXQ A;  3I5I B;  1CLL A;  1S6I A;  1NX0 A;  4PHJ A;  1F54 A;  1YR5 A;  4NQG A;  1Q80 A;  3D0Y B;  3HX4 A;  4DIR A;  1S1E A;  2G2B A;  2DOQ A;  1NPQ A;  4FTG A;  5GQQ C;  2WND A;  2LAN A;  3OX5 A;  1UHK A;  2BKI B;  4ETO A;  1V1G A;  5J3X A;  1SW8 A;  1YUT A;  2KI6 D;  1CLB A;  2NCO A;  1G33 A;  1CKK A;  1NCY A;  3ICB A;  1WRZ A;  3D10 A;  2F2O A;  4UPG A;  2LNK A;  4NDC A;  3EK4 A;  2AMI A;  4MZJ A;  1ODB A;  1U5I A;  4ORC B;  2BEC A;  1UP5 A;  2ISD A;  4ORB B;  4AQI A;  1QX7 A;  3DVM A;  1MWN A;  4C0L A;  1IKU A;  1JSA A;  2L4I A;  3NSL A;  2LP3 A;  2BBM A;  1PUL A;  3OX6 A;  3PN7 B;  4XYN A;  4YGB B;  2H2K A;  1QS7 A;  3A8R A;  1GGW A;  2FJU B;  1YVH A;  2WC8 A;  5CSF A;  2KYC A;  5JOL A;  1NSH A;  1A29 A;  3PFV A;  1FI6 A;  3DF0 A;  1SCM C;  4OV2 A;  2BCB A;  1B47 A;  1SMG A;  1FW4 A;  1RWY A;  3EKH A;  1AJ4 A;  1KFU S;  3CR2 A;  2QPT A;  4QJ4 B;  1IG5 A;  2JRF A;  2MHH A;  1B1G A;  1KK7 Z;  2L51 A;  1BMO A;  3BYA A;  1IGV A;  1F8H A;  4I5J A;  4PHM A;  1IQ5 A;  2JNF A;  2KFH A;  1TNX A;  1CFD A;  1DJW A;  1KQM B;  1A75 A;  1G4Y R;  1YRU B;  3CWG A;  3CTN A;  1GJY A;  2F8P A;  4YI8 A;  3GK2 A;  1OZS A;  3HCM A;  1FF1 A;  2LMV A;  5AEQ A;  5IBW A;  2H61 C;  2E6W A;  1NX1 A;  2K2A A;  2CXJ A;  4I5L B;  1QAS A;  2LHI A;  3DVJ A;  4HSZ A;  3DVK A;  2ZNE A;  4DCK A;  1SCV A;  1KSO A;  1RTP 1;  2ZRS A;  2LCP A;  2GV5 A;  2COL B;  3PSR A;  2MJW B;  1A4P A;  1DGU A;  1WRK A;  4GGF C;  1Y0V H;  2ZFD A;  4CLN A;  3RM1 A;  2G9B A;  1BT6 A;  1KK8 B;  2JTT A;  4ICB A;  4PDZ A;  2EC6 B;  1BJF A;  3QRX A;  3PLF B;  1F71 A;  1CLM A;  2JNX A;  3CGA A;  5TNC A;  1RFJ A;  1UUR A;  4DS7 A;  1J7P A;  1BR1 B;  2KNE A;  2AAO A;  4YGC B;  1KFX L;  4I5K A;  1KFX S;  4F0Z B;  1ZUZ A;  5ER4 X;  1EH2 A;  1ZAC A;  1K9K A;  1IWQ A;  2M1U A;  2WCE A;  2I18 A;  1IRJ A;  1S5G Z;  3TUY B;  2BE6 A;  4CFR A;  2MLF C;  1K2H A;  2LLU A;  3F45 A;  3CS1 A;  1SR6 B;  3BOW A;  2MA2 A;  5BPJ A;  2CT9 A;  5B8I B;  4ZCU A;  1BF5 A;  3LK1 A;  3O78 A;  1QLK A;  4MSP A;  2BE4 A;  1DMO A;  5FYX A;  2FCE A;  1F55 A;  3VRN A;  3BUW B;  1DVI A;  2KBI A;  2Y5I A;  5K89 A;  1CMG A;  4BY5 A;  1TNW A;  2WOR A;  3GK1 A;  2JT0 A;  4QJ3 B;  1YX7 A;  2JT8 A;  2OS8 C;  3BUX B;  3E3R A;  1K96 A;  1L7Z A;  3WHU B;  2HPS A;  4PE7 A;  1XFY O;  1SKT A;  1JUO A;  1S5G Y;  3NXA A;  4M2P A;  1H4B A;  1PVB A;  4GGN A;  3FWC A;  4TNC A;  4ORA B;  1DTL A;  1CMF A;  1YTZ C;  1C07 A;  1TIZ A;  3DVE A;  1MF8 B;  1TCF A;  2HQ8 A;  3BUM B;  4XJK B;  2CNP A;  2K61 A;  2ZN8 A;  5D7F A;  5KSZ A;  2EHB A;  4D1E A;  1TN4 A;  1LVC D;  4USL A;  3TDI A;  5HKZ A;  3I5F C;  1QV0 A;  3KPX A;  2KI6 C;  1NWD A;  4C0K A;  3SIB A;  4AOM A;  2JPT A;  3I5G C;  1SPY A;  2M49 B;  2PRU A;  2GGZ A;  1W7I B;  2M3W A;  1QJT A;  4YGD B;  1C7W A;  1K95 A;  2Y1M A;  4M2Q A;  2F3Y A;  5PAL A;  1LXF C;  1CDN A;  1MHO A;  1GQM A;  2K7C A;  4WQ3 A;  3AKA A;  3RLZ A;  3JTD C;  5DKN A;  2VRG A;  2K7B A;  4MRY A;  2HQW A;  3D0Y A;  3ZNI A;  1QVI Z;  1Y6W A;  1L2O C;  1NUB A;  2K2F A;  2KGR A;  3JVT B;  2I94 A;  3BQ3 A;  1TNQ A;  2NLN A;  3SG3 A;  4PE1 A;  1SL8 A;  1WDC B;  1EL4 A;  2KI4 C;  3I5H B;  3K21 A;  1J7Q A;  3VRP A;  1S3P A;  1MR8 A;  2JXC A;  2ZRT A;  1B7T Y;  4MLW A;  3EKJ A;  2LP2 A;  1J1D A;  1QAT A;  1QIV A;  1S6C A;  4MBE A;  1KFU L;  2KBM A;  3DD4 A;  1NP8 A;  3SJS A;  2OTG C;  4OR9 B;  3CZT X;  4CFQ A;  1Y1A A;  5HLO A;  4IL1 A;  1DF0 B;  2K7D A;  2PVB A;  4BY4 A;  4P5O E;  1QX5 B;  1IQ3 A;  1B8C A;  1UHI A;  2LLT A;  4PCW A;  2ZND A;  1QVI Y;  2NZ0 A; 
#chains in the Genus database with same CATH topology
 1NX3 A;  2QEV A;  2R2I A;  4L9M A;  1DJH A;  2PSR A;  3TS5 C;  1ZMZ A;  1K93 D;  1E8A A;  2JUL A;  4JD9 A;  4A4B A;  1NIW A;  1SY9 A;  3PM8 A;  3EK8 A;  1BG1 A;  5I2L A;  3IQQ A;  5JJG A;  4DUQ A;  1EXR A;  1S6J A;  2FCD A;  1DT7 B;  2K8M B;  2LM5 A;  1OSA A;  4PHK A;  1K9P A;  2HF5 A;  2I7A A;  2WCF A;  3IF7 A;  4PE0 A;  1BU3 A;  2QEO A;  4YI9 A;  2PMY A;  1CB1 A;  1ZOT B;  3M0W A;  2CBL A;  1KWO C;  2P71 A;  2MRD A;  3A4U B;  1AK8 A;  2BCA A;  2BL0 C;  3BFB A;  2LV7 A;  3AKB A;  1RK9 A;  1J55 A;  2LUC A;  3FWB A;  1CDP A;  1XFX O;  1DGV A;  4Q04 A;  3SG2 A;  1YUR A;  4MZL A;  2L2C A;  3SG7 A;  3FS7 A;  3H4S E;  3O6B A;  1M31 A;  2KDH A;  1DJG A;  3LCP C;  1MXE A;  2M7N A;  2RGI A;  4PAL A;  2L4H A;  1XYD A;  3OBV A;  4INW A;  3VRR A;  3L4A A;  1EG3 A;  1SRA A;  1SYM A;  1CFC A;  1OW4 A;  1SCM B;  1DEK A;  1J1E A;  3NGV A;  1JF2 A;  4GNK B;  1AVS A;  1B8R A;  1OMD A;  1MXL C;  1UHH A;  3EVR A;  5CPV A;  5D69 A;  2KAV A;  2M97 A;  2PQL A;  3S0D A;  4E68 A;  1MUX A;  2LC5 A;  5CSJ A;  5F6T A;  1RJV A;  4N1G A;  1YUU A;  1M45 A;  1IJ5 A;  1QXP A;  2I2R E;  2KHN A;  1HQV A;  2LVJ A;  3EVU A;  3FIA A;  3I5I C;  1OOF A;  3BUO B;  3OP0 A;  1CFP A;  3CR4 X;  1DJZ A;  1YX8 A;  4JQ0 D;  1PAL A;  5FI7 A;  3OB2 B;  1F70 A;  2LE9 B;  1PSR A;  3B88 A;  2JU0 A;  1CM1 A;  2GTE A;  1XK4 A;  1QX2 A;  1LA0 A;  2KYF A;  3KF9 A;  1CDM A;  3NSI A;  3BFH A;  1YRT B;  1R2U A;  1B9A A;  3VGO A;  1KCY A;  1PVA A;  2KAX A;  2JPO A;  2BKH B;  1HT9 A;  1B4C A;  3NSO A;  1C7V A;  2BAP A;  2BBN A;  1XA5 A;  3TZ1 A;  4U8D A;  1YUS A;  2JWW A;  2PAS A;  2WCB A;  1QTX A;  5G08 A;  1ALW A;  3WXA A;  1NCX A;  2KLE A;  4HRG A;  1DC1 A;  3FE6 A;  4MRX A;  2LAP A;  4OZD A;  4PHN A;  2KQY A;  5ER5 A;  3SG4 A;  3PN7 C;  3PAL A;  2EGD A;  1Y1U A;  2LHL A;  3OB1 B;  2V53 A;  2IS9 A;  1OOG A;  2L50 A;  1DJI A;  2SCP A;  1WY9 A;  2WCL A;  1TTX A;  3LK0 A;  1B7T Z;  2PAL A;  3C1V A;  4PT1 A;  2CTN A;  2LLS A;  1QV1 A;  2SAS A;  1TOP A;  2QEH A;  5DKR A;  2WCJ A;  4XJK A;  1N65 A;  1TRF A;  1DQE A;  3BUN B;  1XFV O;  3NSK A;  1CNP A;  3SIA A;  2JQ6 A;  3CLN A;  1KQM C;  5HKW A;  2F2P A;  2JXL A;  4MZK A;  2AUC A;  2MBX A;  4WQ2 A;  5AER A;  1CDL A;  2ZN9 A;  1U5I B;  1UWO A;  3DY9 A;  2OS8 B;  3WNX B;  1S26 D;  4YBH B;  1TUJ A;  4MEW A;  1AJ5 A;  1M39 A;  3TDZ A;  1DJY A;  2B1U A;  3LLE A;  2JOJ A;  1JFK A;  2KGB C;  2Y4Q A;  4NDB A;  1BOD A;  2LUX A;  1H8B A;  3SG5 A;  2L0P A;  2M7L A;  1CFF A;  3GOF A;  4QJ5 B;  3R72 A;  1N0Y A;  4YRU A;  2Y1N A;  2MLE C;  4JPZ B;  3S0A A;  2L5X B;  3DF0 B;  1DJX A;  1UHN A;  2JTZ A;  3SS3 A;  1JFJ A;  3R1O A;  1BOC A;  1G8I A;  1OZO A;  4R1E A;  1KK8 C;  2E30 A;  1R6P A;  3D77 A;  2EC6 C;  2H8V A;  2A4J A;  5KTY A;  1C3Z A;  2LVK A;  3ZWH A;  4A4C A;  2Q4U A;  1XFW O;  2FOT A;  2BCX A;  5HKY A;  1K94 A;  2NCP A;  1OQP A;  2LVI A;  3I5F B;  5DKQ A;  1NX2 A;  1J7O A;  3I5G B;  2KOT A;  1A75 B;  1XVJ A;  1SK6 D;  1WLM A;  2K0J A;  1JBA A;  4I5N B;  1X02 A;  2LVV A;  1PSB A;  5I94 A;  5HYD A;  2P6B B;  1DF0 A;  2LMT A;  1GGZ A;  3KHE A;  1OOJ A;  3MSE B;  4CID A;  3TUY C;  5I2O A;  3KEV A;  1A03 A;  3O4Y A;  1N2D A;  1XK4 C;  1LS8 A;  1JF0 A;  1SR6 C;  3JTD B;  3BJH A;  1LIN A;  4YGA A;  2QAC A;  1A2X A;  5DIC A;  2GGM A;  4C0J A;  2M1K B;  2YGU A;  1XFU O;  3B7A A;  1L2O B;  1XO5 A;  3VRO A;  2O60 A;  4HRE E;  1B8L A;  4P2Y B;  5I8N A;  1QIW A;  1REC A;  1AUI B;  5EL2 A;  2KI4 B;  4NDD A;  1J7R A;  2ERB A;  4PE4 A;  4GAO A;  4IJ7 A;  1RRO A;  4ZCV A;  2KAY A;  1Z4H A;  1AHR A;  2WC6 A;  2D8N A;  2O5G A;  1VRK A;  2WCM A;  1Z2C B;  1OE9 B;  1WLZ A;  1LKJ A;  2F3Z A;  2OTG B;  1KK7 Y;  1CTR A;  1IJ6 A;  1SL9 A;  3B87 A;  1W7J B;  1ALV A;  1D1O A;  1OMV A;  5CSI A;  1K8U A;  2JT3 A;  2KFG A;  4GPL B;  3EVV A;  3BFA A;  1K9U A;  5I2Q A;  1M46 A;  3BOW B;  1TNP A;  1AP4 A;  1Y1X A;  1S36 A;  3TS5 B;  3SS4 A;  4MVF A;  3PAT A;  1KSM A;  1KQV A;  2KFF A;  3AAK A;  3FE8 A;  1ZFS A;  2KPH A;  2M0R A;  2M9G A;  3D74 A;  4GFT A;  1CM4 A;  4N1F A;  3S0G A;  3VRQ A;  4JWQ A;  3WHT B;  4DRW A;  1EG4 A;  1IH0 A;  3IQO A;  3SG6 A;  1EJ3 A;  1K90 D;  1NYA A;  1QLS A;  2TN4 A;  2Q91 A;  2M8U A;  4CPV A;  1JC2 A;  2KSP A;  3TDU A;  1PK0 D;  1UHJ A;  1SNL A;  3OHM B;  4M2O A;  1DEL A;  1FI5 A;  1KWO B;  3EK7 A;  4AQJ A;  5AXI A;  1F4Q A;  3O2P A;  2WCK A;  4WRI A;  2BL0 B;  1SL7 A;  3CR5 X;  2H61 A;  2KQ6 A;  2WOS A;  3EG5 B;  1FBV A;  4MN0 A;  4F7F A;  4FQO A;  1FPW A;  3JVT C;  3KO0 A;  1TWO A;  4OKH A;  2LMU A;  4OVN F;  3AAJ A;  5AAN A;  1WDC C;  1M63 B;  3GK4 X;  1NCZ A;  5CSN A;  1OOI X;  1BLQ A;  3I5H C;  2L98 A;  1LA3 A;  1V1F A;  1P28 A;  1SBJ A;  4GGF A;  4N5X A;  2K7O A;  5HLV A;  5KU1 A;  2HET A;  3BXK A;  2MAZ A;  1UUS A;  2F33 A;  4YGE B;  4GBA A;  1XFZ O;  4HRH A;  2ZKM X;  1PRW A;  3LL8 B;  2OPO A;  1MQ1 A;  1WRL A;  2JZI A;  1F4O A;  2M29 A;  2L2E A;  4OCI A;  1OMR A;  2JC2 A;  1BR4 B;  1TCO B;  2CCM A;  3S0B A;  5AFP A;  5FI2 A;  1YVL A;  2P70 A;  4GUK A;  2NXQ A;  3I5I B;  1CLL A;  1S6I A;  2WCH A;  3L47 A;  1NX0 A;  4PHJ A;  1F54 A;  1YR5 A;  4NQG A;  1Q80 A;  3D0Y B;  3HX4 A;  4DIR A;  1S1E A;  2G2B A;  4JKT A;  1QWV A;  2DOQ A;  2KLD A;  3R1P A;  1NPQ A;  4FTG A;  5GQQ C;  2WND A;  2LAN A;  1OOH A;  3OX5 A;  1UHK A;  2BKI B;  3CZ1 A;  4ETO A;  3SS5 A;  3B6X A;  4KYN A;  4FQT A;  1V1G A;  5J3X A;  1SW8 A;  1YUT A;  2KI6 D;  1CLB A;  2NCO A;  1G33 A;  1CKK A;  1NCY A;  3ICB A;  1WRZ A;  3D10 A;  2F2O A;  4UPG A;  2LNK A;  4NDC A;  3EK4 A;  2AMI A;  4MZJ A;  1ODB A;  1U5I A;  3O4X A;  4ORC B;  2BEC A;  1UP5 A;  2ISD A;  4ORB B;  4AQI A;  1QX7 A;  3DVM A;  1MWN A;  3NHI A;  4C0L A;  1IKU A;  3N7H A;  1JSA A;  2L4I A;  3NSL A;  2LP3 A;  2BBM A;  1PUL A;  3OX6 A;  3PN7 B;  4XYN A;  4YGB B;  2H2K A;  1QS7 A;  3A8R A;  5FI6 A;  1C3Y A;  2FJU B;  1GGW A;  1W9Z A;  1YVH A;  2WC8 A;  5CSF A;  2KYC A;  5JOL A;  3QME A;  1NSH A;  3CAB A;  1A29 A;  3PFV A;  1FI6 A;  3DF0 A;  1SCM C;  4OV2 A;  2BCB A;  1B47 A;  1SMG A;  1FW4 A;  1RWY A;  3EKH A;  1AJ4 A;  1KFU S;  3CR2 A;  1T14 A;  2QPT A;  3K1E A;  4QJ4 B;  1IG5 A;  2JRF A;  2MHH A;  3DZT A;  1B1G A;  1JWD A;  1KK7 Z;  2L51 A;  3D75 A;  1BMO A;  3BYA A;  1IGV A;  3PM2 A;  5D3O A;  1F8H A;  4I5J A;  4PHM A;  1IQ5 A;  2JNF A;  2KFH A;  1TNX A;  1CFD A;  1DJW A;  1KQM B;  1A75 A;  1G4Y R;  1YRU B;  3CWG A;  3D78 A;  3CTN A;  1GJY A;  2F8P A;  4YI8 A;  3GK2 A;  1OZS A;  3HCM A;  1FF1 A;  2LMV A;  5AEQ A;  5IBW A;  2H61 C;  3CYZ A;  2E6W A;  1NX1 A;  2K2A A;  2CXJ A;  4I5L B;  1QAS A;  2LHI A;  3DVJ A;  4HSZ A;  3DVK A;  2ZNE A;  4DCK A;  1SCV A;  3CZ2 A;  1KSO A;  1RTP 1;  2ZRS A;  2LCP A;  2GV5 A;  2COL B;  3PSR A;  2MJW B;  1A4P A;  1DGU A;  1WRK A;  4GGF C;  1Y0V H;  2FJY A;  2ZFD A;  4CLN A;  3RM1 A;  2G9B A;  1BT6 A;  1KK8 B;  2JTT A;  4ICB A;  4PDZ A;  1TUZ A;  2EC6 B;  1BJF A;  3IVT A;  3PLF B;  2QDI A;  3QRX A;  5HL1 A;  1F71 A;  1CLM A;  2JNX A;  3CGA A;  5TNC A;  1GM0 A;  1RFJ A;  1UUR A;  4DS7 A;  1J7P A;  3S0E A;  1BR1 B;  2KNE A;  4INX A;  2AAO A;  4YGC B;  1KFX L;  4I5K A;  1KFX S;  4F0Z B;  1XFR A;  1ZUZ A;  5ER4 X;  3L4L A;  1EH2 A;  1ZAC A;  1K9K A;  1IWQ A;  2M1U A;  2WCE A;  3R1V A;  2I18 A;  1IRJ A;  1S5G Z;  3TUY B;  2BE6 A;  4CFR A;  3Q8I A;  2MLF C;  1K2H A;  2LLU A;  3D76 A;  3CS1 A;  1SR6 B;  3F45 A;  3BOW A;  2MA2 A;  5BPJ A;  2CT9 A;  5B8I B;  3FE9 A;  4ZCU A;  1BF5 A;  3LK1 A;  2WC5 A;  3O78 A;  1QLK A;  4MSP A;  2BE4 A;  1DMO A;  5FYX A;  1SSE B;  2FCE A;  3S0F A;  3CZ0 A;  1F55 A;  3VRN A;  3BUW B;  1DVI A;  2KBI A;  2Y5I A;  5K89 A;  1CMG A;  3PJI A;  4BY5 A;  1TNW A;  2WOR A;  3GK1 A;  2JT0 A;  4QJ3 B;  1YX7 A;  2JT8 A;  2OS8 C;  3BUX B;  3E3R A;  1K96 A;  1L7Z A;  3WHU B;  2HPS A;  4PE7 A;  1XFY O;  1SKT A;  1IIO A;  1JUO A;  1S5G Y;  3NXA A;  4M2P A;  1H4B A;  1PVB A;  4GGN A;  3FWC A;  4TNC A;  4ORA B;  1DTL A;  3OGN A;  1CMF A;  1YTZ C;  1C07 A;  2BNX A;  1TIZ A;  3UO9 A;  3DVE A;  1MF8 B;  1TCF A;  3B86 A;  3RZS A;  2HQ8 A;  3BUM B;  4XJK B;  2CNP A;  2K61 A;  2PYQ A;  2ZN8 A;  5D7F A;  5KSZ A;  2EHB A;  4D1E A;  1TN4 A;  1LVC D;  4USL A;  3UNW A;  3TDI A;  3V2L A;  3DYE A;  5HKZ A;  3I5F C;  1QV0 A;  3KPX A;  2KI6 C;  1NWD A;  4C0K A;  3SIB A;  4AOM A;  2JPT A;  3I5G C;  1SPY A;  2M49 B;  2PRU A;  2GGZ A;  1W7I B;  2M3W A;  1QJT A;  4YGD B;  1C7W A;  1K95 A;  3NHT A;  2Y1M A;  3DXL A;  2F3Y A;  4M2Q A;  5PAL A;  1LXF C;  1CDN A;  1MHO A;  1GQM A;  2K7C A;  4WQ3 A;  3AKA A;  3RLZ A;  3JTD C;  5DKN A;  2VRG A;  2K7B A;  4MRY A;  2HQW A;  3D0Y A;  3D73 A;  3ZNI A;  1QVI Z;  1Y6W A;  1L2O C;  1NUB A;  2K2F A;  2KGR A;  3JVT B;  2I94 A;  3BQ3 A;  1TNQ A;  2QEB A;  2L5Y A;  2NLN A;  3SG3 A;  3CDN A;  4PE1 A;  3VB1 A;  1SL8 A;  1WDC B;  1EL4 A;  2KI4 C;  3I5H B;  1ORG A;  3K21 A;  1J7Q A;  3VRP A;  1S3P A;  1MR8 A;  2JXC A;  2ZRT A;  1B7T Y;  4MLW A;  3EKJ A;  2LP2 A;  1J1D A;  1QAT A;  1QIV A;  1S6C A;  4MBE A;  1KFU L;  2KBM A;  3DD4 A;  1NP8 A;  3SJS A;  2OTG C;  4OR9 B;  3CZT X;  4CFQ A;  1Y1A A;  5HLO A;  4IL1 A;  1DF0 B;  2K7D A;  2PVB A;  4BY4 A;  4P5O E;  1QX5 B;  1IQ3 A;  1B8C A;  1UHI A;  2LLT A;  4PCW A;  2ZND A;  1QVI Y;  2K60 A;  2NZ0 A; 
#chains in the Genus database with same CATH homology
 1NX3 A;  2R2I A;  4L9M A;  1DJH A;  2PSR A;  3TS5 C;  1ZMZ A;  1K93 D;  1E8A A;  2JUL A;  4A4B A;  1NIW A;  1SY9 A;  3PM8 A;  3EK8 A;  1BG1 A;  5I2L A;  3IQQ A;  5JJG A;  4DUQ A;  1EXR A;  1S6J A;  2FCD A;  1DT7 B;  2K8M B;  2LM5 A;  1OSA A;  4PHK A;  1K9P A;  2HF5 A;  2I7A A;  2WCF A;  3IF7 A;  4PE0 A;  1BU3 A;  4YI9 A;  2PMY A;  1CB1 A;  1ZOT B;  3M0W A;  2CBL A;  1KWO C;  1AK8 A;  2MRD A;  3A4U B;  2BCA A;  2BL0 C;  2LV7 A;  3AKB A;  1RK9 A;  1J55 A;  2LUC A;  3FWB A;  1CDP A;  1XFX O;  1DGV A;  4Q04 A;  3SG2 A;  1YUR A;  4MZL A;  3SG7 A;  3FS7 A;  3H4S E;  3O6B A;  1M31 A;  2KDH A;  1DJG A;  3LCP C;  1MXE A;  2M7N A;  2RGI A;  4PAL A;  2L4H A;  1XYD A;  1CFC A;  3VRR A;  1JWD A;  1EG3 A;  1SRA A;  1SYM A;  1SCM B;  1J1E A;  1JF2 A;  4GNK B;  1AVS A;  1B8R A;  1OMD A;  1MXL C;  1UHH A;  3EVR A;  5CPV A;  5D69 A;  2KAV A;  2M97 A;  4E68 A;  1MUX A;  2LC5 A;  5CSJ A;  5F6T A;  1RJV A;  4N1G A;  1YUU A;  1M45 A;  1IJ5 A;  1QXP A;  2I2R E;  2KHN A;  1HQV A;  2LVJ A;  3EVU A;  3FIA A;  3I5I C;  3BUO B;  3OP0 A;  1CFP A;  3CR4 X;  1DJZ A;  1YX8 A;  4JQ0 D;  1PAL A;  3OB2 B;  1F70 A;  2LE9 B;  1PSR A;  2JU0 A;  1CM1 A;  1XK4 A;  1QX2 A;  1LA0 A;  2KYF A;  3KF9 A;  1CDM A;  3NSI A;  1YRT B;  1R2U A;  1B9A A;  3VGO A;  1KCY A;  1PVA A;  2KAX A;  2BKH B;  1HT9 A;  1B4C A;  3NSO A;  1C7V A;  2BBN A;  1XA5 A;  3TZ1 A;  4U8D A;  1YUS A;  2JWW A;  2PAS A;  2WCB A;  1QTX A;  5G08 A;  1ALW A;  3WXA A;  1NCX A;  4HRG A;  4MRX A;  2LAP A;  4PHN A;  2KQY A;  5ER5 A;  3SG4 A;  3PN7 C;  3PAL A;  2EGD A;  1Y1U A;  2LHL A;  3OB1 B;  2V53 A;  2IS9 A;  2L50 A;  1DJI A;  2SCP A;  1WY9 A;  1TTX A;  3LK0 A;  1B7T Z;  2PAL A;  3C1V A;  2CTN A;  2LLS A;  1QV1 A;  2SAS A;  1TOP A;  5DKR A;  4XJK A;  1N65 A;  1TRF A;  3BUN B;  1XFV O;  3NSK A;  1CNP A;  3SIA A;  2JQ6 A;  3CLN A;  1KQM C;  5HKW A;  2F2P A;  2JXL A;  4MZK A;  2AUC A;  2MBX A;  4WQ2 A;  5AER A;  1CDL A;  2ZN9 A;  1U5I B;  1UWO A;  2OS8 B;  3WNX B;  1S26 D;  4YBH B;  4MEW A;  1AJ5 A;  1M39 A;  3TDZ A;  1DJY A;  2B1U A;  3LLE A;  2JOJ A;  1JFK A;  2KGB C;  2Y4Q A;  4NDB A;  1BOD A;  2LUX A;  1H8B A;  3SG5 A;  2L0P A;  2M7L A;  1CFF A;  3GOF A;  4QJ5 B;  1N0Y A;  4YRU A;  2Y1N A;  2MLE C;  4JPZ B;  2L5X B;  3DF0 B;  1DJX A;  1UHN A;  2JTZ A;  1JFJ A;  1BOC A;  1G8I A;  1OZO A;  4R1E A;  1KK8 C;  2E30 A;  1R6P A;  2EC6 C;  2A4J A;  5KTY A;  2LVK A;  3ZWH A;  4A4C A;  2Q4U A;  1XFW O;  2FOT A;  2BCX A;  5HKY A;  1K94 A;  2NCP A;  1OQP A;  2LVI A;  3I5F B;  5DKQ A;  1NX2 A;  1J7O A;  3I5G B;  2KOT A;  1A75 B;  1XVJ A;  1SK6 D;  1WLM A;  2K0J A;  1JBA A;  4I5N B;  1X02 A;  2LVV A;  1PSB A;  5HYD A;  2P6B B;  1DF0 A;  2LMT A;  1GGZ A;  3KHE A;  1OOJ A;  3MSE B;  4CID A;  3TUY C;  5I2O A;  3KEV A;  1A03 A;  3O4Y A;  1N2D A;  1XK4 C;  1SR6 C;  1JF0 A;  3JTD B;  4YGA A;  1LIN A;  2QAC A;  1A2X A;  2GGM A;  4C0J A;  2M1K B;  1XFU O;  1L2O B;  1XO5 A;  3VRO A;  2O60 A;  4HRE E;  1B8L A;  4P2Y B;  5I8N A;  1QIW A;  1REC A;  1AUI B;  2KI4 B;  4NDD A;  1J7R A;  4PE4 A;  4GAO A;  1RRO A;  4ZCV A;  2KAY A;  1AHR A;  2D8N A;  2O5G A;  1VRK A;  1OE9 B;  1WLZ A;  1LKJ A;  2F3Z A;  2OTG B;  1KK7 Y;  1CTR A;  1IJ6 A;  1SL9 A;  1W7J B;  1ALV A;  1D1O A;  1OMV A;  5CSI A;  1K8U A;  2JT3 A;  2KFG A;  4GPL B;  3EVV A;  1K9U A;  5I2Q A;  1M46 A;  3BOW B;  1TNP A;  1AP4 A;  1Y1X A;  1S36 A;  3TS5 B;  4MVF A;  3PAT A;  1KSM A;  1KQV A;  2KFF A;  3AAK A;  1ZFS A;  2M9G A;  2M0R A;  4GFT A;  1CM4 A;  4N1F A;  3VRQ A;  4JWQ A;  3WHT B;  4DRW A;  1EG4 A;  1IH0 A;  3IQO A;  3SG6 A;  1EJ3 A;  1K90 D;  1NYA A;  1QLS A;  2TN4 A;  2Q91 A;  2M8U A;  4CPV A;  1JC2 A;  2KSP A;  3TDU A;  1PK0 D;  1UHJ A;  1SNL A;  3OHM B;  4M2O A;  1FI5 A;  1KWO B;  3EK7 A;  4AQJ A;  5AXI A;  1F4Q A;  3O2P A;  4WRI A;  2BL0 B;  1SL7 A;  3CR5 X;  2H61 A;  2KQ6 A;  2WOS A;  1FBV A;  4MN0 A;  4FQO A;  1FPW A;  3JVT C;  3KO0 A;  4OKH A;  2LMU A;  4OVN F;  3AAJ A;  5AAN A;  1WDC C;  1M63 B;  3GK4 X;  1NCZ A;  5CSN A;  1BLQ A;  3I5H C;  2L98 A;  1LA3 A;  1V1F A;  1SBJ A;  4GGF A;  4N5X A;  2K7O A;  5HLV A;  5KU1 A;  2HET A;  3BXK A;  2MAZ A;  1UUS A;  2F33 A;  4YGE B;  4GBA A;  1XFZ O;  4HRH A;  2ZKM X;  1PRW A;  3LL8 B;  2OPO A;  1MQ1 A;  1WRL A;  2JZI A;  1F4O A;  2M29 A;  2L2E A;  4OCI A;  1OMR A;  2JC2 A;  1BR4 B;  1TCO B;  2CCM A;  5AFP A;  1YVL A;  4GUK A;  2NXQ A;  3I5I B;  1CLL A;  1S6I A;  1NX0 A;  4PHJ A;  1F54 A;  1YR5 A;  4NQG A;  1Q80 A;  3D0Y B;  3HX4 A;  4DIR A;  1S1E A;  2G2B A;  2DOQ A;  1NPQ A;  4FTG A;  5GQQ C;  2WND A;  2LAN A;  3OX5 A;  1UHK A;  2BKI B;  4ETO A;  1V1G A;  5J3X A;  1SW8 A;  1YUT A;  2KI6 D;  1CLB A;  2NCO A;  1G33 A;  1CKK A;  1NCY A;  3ICB A;  1WRZ A;  3D10 A;  2F2O A;  4UPG A;  2LNK A;  4NDC A;  3EK4 A;  2AMI A;  4MZJ A;  1ODB A;  1U5I A;  4ORC B;  2BEC A;  1UP5 A;  2ISD A;  4ORB B;  4AQI A;  1QX7 A;  3DVM A;  1MWN A;  4C0L A;  1IKU A;  1JSA A;  2L4I A;  3NSL A;  2LP3 A;  2BBM A;  1PUL A;  3OX6 A;  3PN7 B;  4XYN A;  4YGB B;  2H2K A;  1QS7 A;  3A8R A;  1GGW A;  2FJU B;  1YVH A;  2WC8 A;  5CSF A;  2KYC A;  5JOL A;  1NSH A;  1A29 A;  3PFV A;  1FI6 A;  3DF0 A;  1SCM C;  4OV2 A;  2BCB A;  1B47 A;  1SMG A;  1FW4 A;  1RWY A;  3EKH A;  1AJ4 A;  1KFU S;  3CR2 A;  2QPT A;  4QJ4 B;  1IG5 A;  2JRF A;  2MHH A;  1B1G A;  1KK7 Z;  2L51 A;  1BMO A;  3BYA A;  1IGV A;  1F8H A;  4I5J A;  4PHM A;  1IQ5 A;  2JNF A;  2KFH A;  1TNX A;  1CFD A;  1DJW A;  1KQM B;  1A75 A;  1G4Y R;  1YRU B;  3CWG A;  3CTN A;  1GJY A;  2F8P A;  4YI8 A;  3GK2 A;  1OZS A;  3HCM A;  1FF1 A;  2LMV A;  5AEQ A;  5IBW A;  2H61 C;  2E6W A;  1NX1 A;  2K2A A;  2CXJ A;  4I5L B;  1QAS A;  2LHI A;  3DVJ A;  4HSZ A;  3DVK A;  2ZNE A;  4DCK A;  1SCV A;  1KSO A;  1RTP 1;  2ZRS A;  2LCP A;  2GV5 A;  2COL B;  3PSR A;  2MJW B;  1A4P A;  1DGU A;  1WRK A;  4GGF C;  1Y0V H;  2ZFD A;  4CLN A;  3RM1 A;  2G9B A;  1BT6 A;  1KK8 B;  2JTT A;  4ICB A;  4PDZ A;  2EC6 B;  1BJF A;  3QRX A;  3PLF B;  1F71 A;  1CLM A;  2JNX A;  3CGA A;  5TNC A;  1RFJ A;  1UUR A;  4DS7 A;  1J7P A;  1BR1 B;  2KNE A;  2AAO A;  4YGC B;  1KFX L;  4I5K A;  1KFX S;  4F0Z B;  1ZUZ A;  5ER4 X;  1EH2 A;  1ZAC A;  1K9K A;  1IWQ A;  2M1U A;  2WCE A;  2I18 A;  1IRJ A;  1S5G Z;  3TUY B;  2BE6 A;  4CFR A;  2MLF C;  1K2H A;  2LLU A;  3F45 A;  3CS1 A;  1SR6 B;  3BOW A;  2MA2 A;  5BPJ A;  2CT9 A;  5B8I B;  4ZCU A;  1BF5 A;  3LK1 A;  3O78 A;  1QLK A;  4MSP A;  2BE4 A;  1DMO A;  5FYX A;  2FCE A;  1F55 A;  3VRN A;  3BUW B;  1DVI A;  2KBI A;  2Y5I A;  5K89 A;  1CMG A;  4BY5 A;  1TNW A;  2WOR A;  3GK1 A;  2JT0 A;  4QJ3 B;  1YX7 A;  2JT8 A;  2OS8 C;  3BUX B;  3E3R A;  1K96 A;  1L7Z A;  3WHU B;  2HPS A;  4PE7 A;  1XFY O;  1SKT A;  1JUO A;  1S5G Y;  3NXA A;  4M2P A;  1H4B A;  1PVB A;  4GGN A;  3FWC A;  4TNC A;  4ORA B;  1DTL A;  1CMF A;  1YTZ C;  1C07 A;  1TIZ A;  3DVE A;  1MF8 B;  1TCF A;  2HQ8 A;  3BUM B;  4XJK B;  2CNP A;  2K61 A;  2ZN8 A;  5D7F A;  5KSZ A;  2EHB A;  4D1E A;  1TN4 A;  1LVC D;  4USL A;  3TDI A;  5HKZ A;  3I5F C;  1QV0 A;  3KPX A;  2KI6 C;  1NWD A;  4C0K A;  3SIB A;  4AOM A;  2JPT A;  3I5G C;  1SPY A;  2M49 B;  2PRU A;  2GGZ A;  1W7I B;  2M3W A;  1QJT A;  4YGD B;  1C7W A;  1K95 A;  2Y1M A;  4M2Q A;  2F3Y A;  5PAL A;  1LXF C;  1CDN A;  1MHO A;  1GQM A;  2K7C A;  4WQ3 A;  3AKA A;  3RLZ A;  3JTD C;  5DKN A;  2VRG A;  2K7B A;  4MRY A;  2HQW A;  3D0Y A;  3ZNI A;  1QVI Z;  1Y6W A;  1L2O C;  1NUB A;  2K2F A;  2KGR A;  3JVT B;  2I94 A;  3BQ3 A;  1TNQ A;  2NLN A;  3SG3 A;  4PE1 A;  1SL8 A;  1WDC B;  1EL4 A;  2KI4 C;  3I5H B;  3K21 A;  1J7Q A;  3VRP A;  1S3P A;  1MR8 A;  2JXC A;  2ZRT A;  1B7T Y;  4MLW A;  3EKJ A;  2LP2 A;  1J1D A;  1QAT A;  1QIV A;  1S6C A;  4MBE A;  1KFU L;  2KBM A;  3DD4 A;  1NP8 A;  3SJS A;  2OTG C;  4OR9 B;  3CZT X;  4CFQ A;  1Y1A A;  5HLO A;  4IL1 A;  1DF0 B;  2K7D A;  2PVB A;  4BY4 A;  4P5O E;  1QX5 B;  1IQ3 A;  1B8C A;  1UHI A;  2LLT A;  4PCW A;  2ZND A;  1QVI Y;  2NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...