3TZ1A

Crystal structure of the ca2+-saturated c-terminal domain of akazara scallop troponin c in complex with a troponin i fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LDERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETDTDGSGTVDYEEFKCLMMSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C
publication title Structure of the Ca2+-saturated C-terminal domain of scallop troponin C in complex with a troponin I fragment
pubmed doi rcsb
source organism Chlamys nipponensis akazara
molecule tags Contractile protein
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tz1A00
3NSKA 2I7AA 3SG2A 1UWOA 1S36A 5D7FA 1H8BA 1KWOC 1AJ5A 1J1DA 2GV5A 1QV1A 3FWCA 1UHNA 2JRFA 4N5XA 2OTGB 2CNPA 2LMUA 1DJYA 3O78A 1DVIA 2BBNA 1BT6A 2OTGC 3BQ3A 1SL9A 5AEQA 2AMIA 3E3RA 4N1FA 1N2DA 1SR6B 1CFDA 1MR8A 2F33A 4MLWA 2EGDA 1JSAA 2EHBA 2K0JA 2NXQA 1K95A 1XVJA 3I5FB 1YTZC 1SR6C 3TDUA 2EC6B 2CBLA 1JUOA 3WHTB 2LVKA 1NCXA 2K2FA 3I5FC 1S26D 4GFTA 1A4PA 4NDBA 2I2RE 2KSPA 3A4UB 5CSFA 4C0LA 5KSZA 1QLSA 5KU1A 1BG1A 2HPSA 1XO5A 3VRNA 4GBAA 1S1EA 2K8MB 1S5GY 1RTP1 2HQWA 1DF0A 1NSHA 1ALVA 1IKUA 1BJFA 2JNFA 2K7DA 1DJWA 1K9UA 1KFUS 1C07A 1W7JB 2LUXA 4CIDA 3VRQA 1QVIY 1DMOA 3CLNA 3RM1A 3CZTX 1SYMA 3TDZA 1QIVA 3KO0A 5TNCA 1F70A 4I5KA 1F4QA 1SBJA 3LL8B 1Q80A 2KQ6A 3DD4A 2Y4QA 3DF0B 3EKHA 4XJKB 5F6TA 4WQ2A 2K7BA 1SKTA 4PE4A 2MJWB 2QACA 3IQQA 3VRRA 3GK1A 3OB2B 2AUCA 1TTXA 1WRZA 1NIWA 2LANA 3LK0A 2M29A 1BR1B 1YX8A 1JFJA 1YURA 2TN4A 1ZOTB 4OV2A 2O5GA 4P5OE 2BCXA 2FJUB 3TS5C 1WLMA 4MBEA 1YUUA 2JTZA 1UUSA 4MRYA 4YGDB 4ETOA 1JBAA 3M0WA 1B47A 5HYDA 1KCYA 1DGVA 1L7ZA 1CLMA 1UHKA 2F3ZA 1BU3A 1IQ3A 2LUCA 4BY4A 1B1GA 2WORA 2ZNDA 1TNQA 3AKBA 2PVBA 3EVVA 1QX5B 1F54A 2MLEC 1A03A 2KDHA 2PALA 4MN0A 2M1UA 1DJGA 1UHHA 2WCFA 3EK7A 3TDIA 1MUXA 3GK4X 3BOWB 1NUBA 1OZSA 1CTRA 3JVTB 1M31A 1RROA 2JZIA 3O2PA 1EJ3A 4Q04A 4C0KA 4YGBB 5IBWA 1XFXO 3BUWB 3JVTC 1XK4A 2WC8A 1QX2A 4A4CA 2R2IA 1MF8B 3SG7A 2MHHA 1A75A 1MWNA 2NLNA 3D0YA 1EH2A 1YVHA 2H61A 2BKHB 1EG4A 1FPWA 1ZMZA 4QJ4B 2HETA 1PVBA 2H2KA 1F8HA 1CMGA 1CDPA 2HF5A 2Q91A 1QATA 2NCOA 1SL7A 3LLEA 2KHNA 4AQJA 2L4IA 1M63B 5FYXA 1IG5A 1NCYA 3CR4X 4AQIA 2BKIB 1DGUA 3OB1B 3CGAA 2JULA 2MRDA 1QX7A 1E8AA 1CFPA 3LK1A 1DT7B 1G4YR 1CDLA 4MVFA 1PVAA 4OVNF 3TZ1A 1KWOB 3PLFB 1S6CA 2LMTA 3WHUB 1SCMC 5AXIA 2ZFDA 1UHJA 3I5GC 5HKWA 1BMOA 1ALWA 2NCPA 2PSRA 1DJIA 1NPQA 1C7WA 1RK9A 2MBXA 4CLNA 2KYCA 1CDNA 2WOSA 3BUOB 3CS1A 4I5NB 4PCWA 1ZACA 1KQVA 1PALA 1V1GA 2OPOA 1KFXL 4PE1A 1UP5A 1YUSA 2BCBA 1KFXS 2WCBA 2LP3A 1AK8A 2F2PA 2L98A 4C0JA 1IJ6A 2D8NA 1QS7A 4GPLB 5CSIA 1BLQA 2LVIA 3OP0A 3OX6A 4CFRA 2LMVA 2FCDA 2JT0A 1EL4A 4M2OA 1QTXA 1X02A 4GGFA 1QIWA 1B8LA 1AVSA 1KFUL 1TRFA 1Y1AA 1CLLA 2GGZA 1GJYA 5I2QA 4YGCB 3PN7B 1NYAA 1S6JA 4MZKA 3VROA 2F8PA 2PMYA 2LV7A 1BF5A 2M0RA 1J1EA 2WNDA 1WDCB 2G9BA 1UURA 5HKZA 3PN7C 1TCFA 4I5LB 2KI4B 1EXRA 1LXFC 2KYFA 2LAPA 3QRXA 5PALA 1Y0VH 1ZUZA 1QXPA 4A4BA 4DUQA 3D10A 1NX1A 4OR9B 2FOTA 1WDCC 1S5GZ 4NDDA 2PRUA 2KI4C 3VGOA 3VRPA 4XJKA 2L50A 3KEVA 1TCOB 1OSAA 2M97A 1CLBA 3I5HB 2Y1NA 1M39A 2LC5A 1QVIZ 2KAYA 1A29A 3FWBA 1JF2A 1B8CA 3TS5B 1DF0B 3I5HC 1B9AA 1RJVA 4I5JA 1QJTA 3PFVA 1N65A 1FI6A 1DJXA 1SPYA 4L9MA 1AHRA 1BOCA 1KQMC 1OOJA 1RWYA 1TNPA 1Y6WA 5I2LA 3JTDB 1WRKA 2A4JA 1EG3A 2LVVA 1AUIB 3NSOA 1C7VA 1FF1A 1YR5A 2E30A 5J3XA 1OMRA 3JTDC 3SG4A 4YBHB 4D1EA 3EK4A 5GQQC 2LLTA 1Y1XA 2BECA 2GGMA 2BE4A 2CTNA 3BOWA 3AAKA 4F0ZB 3MSEB 1MXEA 1K90D 3GK2A 4MZJA 4PDZA 1BR4B 2M8UA 2KNEA 2KFGA 1XA5A 2L2EA 1B8RA 5JJGA 1WLZA 4BY5A 1J55A 1AP4A 1M46A 4USLA 2JQ6A 1CDMA 4GAOA 1RFJA 3NXAA 2SASA 1SL8A 1K9KA 3SG6A 1SCVA 1B7TY 1J7QA 2ZRTA 1TNWA 1U5IA 1R6PA 1MXLC 2LNKA 5B8IB 4PALA 1NX3A 1HT9A 3NSLA 3CR5X 4NDCA 1YVLA 1CFCA 1GGWA 2JU0A 3PATA 1XFYO 2VRGA 2M3WA 2KGBC 3O6BA 1QLKA 2M49B 3WNXB 1W7IB 1FI5A 2LCPA 1K2HA 5HLVA 1A2XA 1B7TZ 2BBMA 1F4OA 1YRTB 2JC2A 2OS8C 1OE9B 2HQ8A 1XFVO 1QASA 3BUMB 4HRGA 3KHEA 4AOMA 1LVCD 2QPTA 3PSRA 3SG5A 2PASA 2KAXA 4PE7A 1SCMB 1KK7Y 1G33A 1K9PA 3AAJA 1A75B 1XK4C 1YRUB 3I5GB 1NWDA 4ICBA 4YI8A 2JOJA 2JXCA 3BYAA 3RLZA 3F45A 5I8NA 1SMGA 5D69A 1K96A 4HSZA 3FS7A 1MHOA 1IJ5A 1NCZA 1VRKA 2JXLA 3BUXB 2KFHA 4YI9A 2DOQA 2H61C 5I2OA 1KK7Z 1XFZO 4HREE 3DVMA 2L0PA 2KAVA 4IL1A 5DKRA 2LE9B 2LLUA 2Y1MA 2LLSA 5AERA 2KBMA 3SJSA 4YGEB 1IH0A 1ZFSA 2LHLA 1N0YA 2B1UA 1OMDA 2K61A 1H4BA 1TIZA 2L5XB 1PSBA 3CR2A 3SG3A 4GGNA 3KPXA 2MAZA 1TN4A 2ZN8A 5ER5A 1S6IA 4PE0A 4ZCVA 4GUKA 1PULA 2BL0B 4CPVA 2KI6D 2FCEA 2BCAA 1CKKA 5AFPA 2KI6C 2WCEA 1LA0A 4OKHA 1G8IA 1R2UA 1J7OA 2MLFC 2BL0C 1TOPA 4MSPA 5HKYA 3IF7A 5CPVA 4QJ3B 5G08A 4E68A 2E6WA 5JOLA 3EVUA 3ICBA 3SIBA 1SY9A 4CFQA 1JF0A 4M2PA 4OCIA 1TNXA 2LM5A 3DF0A 2COLB 1IWQA 3OX5A 2EC6C 1M45A 3DVEA 3O4YA 4PHJA 2K2AA 2K7OA 2LP2A 1SW8A 3EKJA 4ZCUA 2JWWA 4R1EA 2Y5IA 1XFWO 1B4CA 3BXKA 4JQ0D 1SNLA 4DS7A 5KTYA 1KQMB 3DVKA 4GGFC 3CWGA 4MRXA 1WY9A 1CFFA 2JT8A 2JNXA 4FQOA 3HCMA 1K8UA 3CTNA 1YX7A 1FW4A 2CXJA 3FIAA 4DIRA 3A8RA 1PRWA 2F3YA 3AKAA 5BPJA 1F71A 1QV0A 3IQOA 1CMFA 3TUYB 1YUTA 1OQPA 4ORCB 5HLOA 2JT3A 4QJ5B 3PALA 1AJ4A 1DJZA 2KOTA 2KFFA 3K21A 3TUYC 3ZNIA 2JTTA 4P2YB 1HQVA 3C1VA 2I18A 2LVJA 1BODA 2F2OA 1Y1UA 1LA3A 1LINA 1NP8A 3EVRA 3DVJA 4XYNA 5AANA 5ER4X 1NX2A 1CM1A 4JWQA 4YRUA 1CNPA 1V1FA 2I94A 2L4HA 1IQ5A 1RECA 2JPTA 2KBIA 2RGIA 4HRHA 1S3PA 4DCKA 1SK6D 1K93D 1L2OB 1DJHA 1OZOA 2LHIA 3PM8A 4JPZB 2AAOA 4DRWA 3H4SE 4YGAA 1CM4A 4N1GA 1L2OC 1OMVA 2M1KB 1F55A 3NSIA 2Q4UA 3ZWHA 1MQ1A 2M9GA 5DKQA 2ZRSA 2K7CA 1DTLA 1KSMA 2BE6A 2OS8B 2O60A 3LCPC 2V53A 1ODBA 1FBVA 4PHKA 4WQ3A 1J7RA 4FTGA 1PSRA 2CCMA 3OHMB 1KSOA 2ZN9A 1GQMA 5K89A 1XFUO 2SCPA 2ZKMX 4WRIA 1J7PA 1XYDA 1UHIA 4PHNA 2ISDA 1WRLA 1U5IB 2L51A 1D1OA 5CSJA 3D0YB 1CB1A 1KK8B 2NZ0A 4NQGA 4GNKB 4M2QA 2MA2A 3WXAA 2KGRA 4ORBB 1SRAA 3I5IB 3GOFA 4MZLA 4PHMA 1KK8C 2ZNEA 3SIAA 2P6BB 1JC2A 5CSNA 2M7NA 3KF9A 3I5IC 1GGZA 4ORAB 2M7LA 3BUNB 2G2BA 2KQYA 1IRJA 1IGVA 4U8DA 1LKJA 4UPGA 3EK8A 4TNCA 2IS9A 1PK0D 2CT9A 1JWDA 1JFKA 5DKNA 1NX0A 1K94A 4MEWA 3HX4A
chains in the Genus database with same CATH superfamily
3NSKA 2KLDA 2GTEA 2I7AA 3SG2A 4JKTA 1UWOA 1S36A 5D7FA 1H8BA 1KWOC 1AJ5A 1J1DA 2GV5A 1QV1A 3FWCA 1TUZA 1UHNA 2JRFA 4N5XA 2OTGB 2CNPA 3B87A 3R1PA 2LMUA 1DJYA 3O78A 1DVIA 2BBNA 1BT6A 2OTGC 1ORGA 1SL9A 3BQ3A 4INXA 5AEQA 2AMIA 3E3RA 4N1FA 1N2DA 1SR6B 1IIOA 1CFDA 1MR8A 2F33A 4MLWA 2EGDA 1JSAA 2EHBA 2K0JA 2NXQA 1K95A 1XVJA 3I5FB 1DC1A 3CZ2A 1YTZC 1SR6C 3TDUA 2EC6B 2CBLA 1JUOA 3WHTB 2LVKA 1NCXA 2K2FA 3I5FC 1S26D 4GFTA 1A4PA 4NDBA 2I2RE 2KSPA 3A4UB 5CSFA 4C0LA 5KSZA 1QLSA 5KU1A 1BG1A 2HPSA 1XO5A 3VRNA 4GBAA 1S1EA 2K8MB 1S5GY 1RTP1 2HQWA 1DF0A 1NSHA 2PQLA 1ALVA 1IKUA 5D3OA 1BJFA 2JNFA 2K7DA 3SS4A 1DJWA 1K9UA 1KFUS 1C07A 1W7JB 2LUXA 3R1VA 3VRQA 4CIDA 1QVIY 1DMOA 3CLNA 3RM1A 3CZTX 1SYMA 3TDZA 1QIVA 3KO0A 5TNCA 1F70A 4I5KA 1F4QA 1SBJA 3LL8B 1Q80A 2KQ6A 3DD4A 5FI7A 2Y4QA 3CYZA 3DF0B 3D76A 3EKHA 4XJKB 5F6TA 4WQ2A 2K7BA 1SKTA 4PE4A 2MJWB 2QACA 3IQQA 3VRRA 3GK1A 3OB2B 2AUCA 1TTXA 1WRZA 1NIWA 2LANA 3LK0A 2M29A 1BR1B 1YX8A 2QEHA 1JFJA 1YURA 2TN4A 1ZOTB 4OV2A 2O5GA 4P5OE 2BCXA 2FJUB 3B86A 3TS5C 2YGUA 1WLMA 4MBEA 1YUUA 2JTZA 1UUSA 4MRYA 4YGDB 4ETOA 1JBAA 2H8VA 3M0WA 1B47A 5HYDA 2FJYA 1KCYA 1DGVA 1L7ZA 1CLMA 1UHKA 2F3ZA 1BU3A 2L5YA 2LUCA 4BY4A 1IQ3A 1B1GA 2WORA 2ZNDA 1TNQA 3AKBA 2PVBA 3EVVA 1GM0A 1QX5B 1F54A 2MLEC 1A03A 2KDHA 2PALA 4MN0A 2M1UA 2WCLA 1DJGA 1UHHA 2WCFA 3EK7A 3TDIA 1MUXA 3GK4X 3BOWB 1NUBA 1OZSA 3B88A 1CTRA 3JVTB 1M31A 2QDIA 1RROA 2JZIA 3CDNA 1EJ3A 3O2PA 4Q04A 4C0KA 4YGBB 5IBWA 1XFXO 3BUWB 3JVTC 5HL1A 1XK4A 2WC8A 2P70A 1QX2A 4A4CA 3L47A 2R2IA 1MF8B 3SG7A 2MHHA 1A75A 1MWNA 2NLNA 3D0YA 1EH2A 3V2LA 1QWVA 1YVHA 2H61A 2BKHB 1EG4A 1FPWA 1ZMZA 4QJ4B 2HETA 1PVBA 2H2KA 1F8HA 1CMGA 1CDPA 2HF5A 2Q91A 1QATA 2NCOA 3NGVA 1SL7A 3LLEA 2KHNA 4AQJA 3S0DA 2L4IA 1M63B 5FYXA 1C3YA 1IG5A 1NCYA 3CR4X 4AQIA 2BKIB 1DGUA 3OB1B 3CGAA 2JULA 2MRDA 1QX7A 3D78A 1E8AA 1CFPA 3LK1A 1DT7B 1G4YR 3EG5B 1CDLA 4MVFA 1PVAA 4OVNF 3TZ1A 1KWOB 3CABA 1S6CA 3PLFB 2LMTA 3WHUB 1SCMC 4INWA 5AXIA 2ZFDA 1UHJA 3I5GC 5HKWA 1BMOA 1ALWA 2NCPA 2PSRA 3OBVA 1DJIA 1NPQA 1C7WA 1RK9A 1Z4HA 2MBXA 2KYCA 4CLNA 1CDNA 2WOSA 3BUOB 3CS1A 4I5NB 4PCWA 1ZACA 3SS3A 1PALA 1V1GA 1KQVA 2OPOA 1KFXL 2ERBA 4PE1A 1UP5A 1YUSA 2BCBA 2WCHA 1KFXS 2WCBA 2LP3A 3BFBA 1AK8A 2F2PA 3FE6A 2L98A 3VB1A 1IJ6A 2D8NA 4C0JA 2KPHA 1QS7A 4GPLB 3NHIA 5CSIA 1BLQA 2LVIA 3OP0A 3OX6A 4CFRA 2LMVA 1TWOA 3B7AA 2FCDA 2JT0A 1EL4A 4M2OA 1QTXA 1X02A 4GGFA 1QIWA 4KYNA 1B8LA 1AVSA 1KFUL 1TRFA 1Y1AA 1CLLA 2GGZA 1GJYA 3R72A 5I2QA 4YGCB 3PN7B 1NYAA 1S6JA 4MZKA 3VROA 2F8PA 2PMYA 3CZ0A 2LV7A 1BF5A 2KLEA 1J1EA 2M0RA 2WNDA 1WDCB 2G9BA 1UURA 3BFHA 3PN7C 1TCFA 4I5LB 5HKZA 2KI4B 1EXRA 1LXFC 2KYFA 2LAPA 3QRXA 5PALA 1Y0VH 1ZUZA 1QXPA 3SS5A 4A4BA 3D10A 1NX1A 4OR9B 4DUQA 2FOTA 1WDCC 1S5GZ 4NDDA 3S0GA 2PRUA 2KI4C 3VGOA 3VRPA 4XJKA 2L50A 3KEVA 1TCOB 1OSAA 2M97A 1CLBA 3I5HB 2Y1NA 1M39A 2LC5A 1QVIZ 2KAYA 1A29A 1Z2CB 3FWBA 1JF2A 1B8CA 1TUJA 3TS5B 1DF0B 3I5HC 1B9AA 1RJVA 4I5JA 1QJTA 3PFVA 1N65A 1W9ZA 1FI6A 1DJXA 1SPYA 4L9MA 1AHRA 1BOCA 1SSEB 1KQMC 1OOJA 1RWYA 1TNPA 1Y6WA 5I2LA 3UNWA 3JTDB 1WRKA 2A4JA 1EG3A 2LVVA 1AUIB 3NSOA 1C7VA 1FF1A 1YR5A 2E30A 3DYEA 3PM2A 5J3XA 1OMRA 3JTDC 3SG4A 4YBHB 4D1EA 3EK4A 2QEVA 5GQQC 2LLTA 1Y1XA 2BECA 2GGMA 2BE4A 2CTNA 3BOWA 3AAKA 4F0ZB 3MSEB 1MXEA 1K90D 3GK2A 3D73A 4MZJA 4PDZA 1BR4B 2M8UA 2KNEA 2KFGA 1XA5A 2L2EA 1B8RA 5JJGA 3DY9A 1WLZA 4BY5A 1J55A 2QEBA 1AP4A 1M46A 4USLA 2JQ6A 1CDMA 4GAOA 1RFJA 3NXAA 2SASA 1SL8A 1K9KA 1OOIX 3SG6A 1SCVA 1B7TY 3OGNA 1OW4A 1J7QA 2ZRTA 1TNWA 3QMEA 1U5IA 1R6PA 1MXLC 2LNKA 5B8IB 4PALA 1NX3A 1HT9A 3NSLA 3CR5X 4NDCA 1YVLA 1CFCA 1GGWA 2JU0A 3PATA 1XFYO 2VRGA 2M3WA 2KGBC 3D74A 3O6BA 1QLKA 2M49B 3WNXB 1W7IB 2BNXA 2LCPA 1FI5A 5HLVA 1A2XA 1K2HA 1B7TZ 2BBMA 1F4OA 4OZDA 1YRTB 2JC2A 2OS8C 1OE9B 2HQ8A 1XFVO 1QASA 3BUMB 4HRGA 3KHEA 4AOMA 1LVCD 2QPTA 3PSRA 4FQTA 2PASA 3SG5A 2KAXA 4PE7A 1SCMB 1KK7Y 1G33A 1K9PA 3AAJA 3BFAA 3S0BA 1A75B 1XK4C 1YRUB 3I5GB 1NWDA 4ICBA 4YI8A 2JOJA 2JXCA 3BYAA 3RLZA 1T14A 3F45A 5I8NA 1SMGA 5D69A 1K96A 4HSZA 1DQEA 3FS7A 4IJ7A 1MHOA 1IJ5A 1NCZA 1VRKA 2JXLA 3BUXB 2KFHA 4YI9A 2DOQA 2H61C 3S0EA 3N7HA 5DICA 5I2OA 1KK7Z 1XFZO 4HREE 3DVMA 2L0PA 2KAVA 4IL1A 5DKRA 2LE9B 2LLUA 2Y1MA 2LLSA 2JPOA 5AERA 3DZTA 1OOGA 2KBMA 3SJSA 4YGEB 3UO9A 1IH0A 1ZFSA 2LHLA 1N0YA 2B1UA 1OMDA 2K61A 3L4LA 1H4BA 1TIZA 2L5XB 1PSBA 3CR2A 3SG3A 4GGNA 3KPXA 2MAZA 1TN4A 2WCJA 2ZN8A 5ER5A 3S0AA 1S6IA 4PE0A 4ZCVA 3RZSA 3O4XA 4GUKA 2WCMA 1PULA 2BL0B 4CPVA 2KI6D 2FCEA 2BCAA 4PT1A 1CKKA 5AFPA 2KI6C 2WCEA 1LA0A 1OOFA 1G8IA 1R2UA 4OKHA 1J7OA 2MLFC 2BL0C 1TOPA 4MSPA 5HKYA 3IF7A 1DELA 3PJIA 5CPVA 3NHTA 4QJ3B 5G08A 4E68A 2E6WA 5JOLA 3EVUA 1P28A 3ICBA 3SIBA 2BAPA 1SY9A 4CFQA 1JF0A 4M2PA 4OCIA 1TNXA 2LM5A 3DF0A 2COLB 1IWQA 3OX5A 2EC6C 1M45A 3DVEA 3O4YA 4PHJA 1XFRA 2K2AA 2K7OA 3R1OA 2LP2A 1SW8A 3EKJA 4ZCUA 2JWWA 4R1EA 2Y5IA 1XFWO 1B4CA 3BXKA 3CZ1A 1C3ZA 1SNLA 4JQ0D 4DS7A 5KTYA 1KQMB 3DVKA 4GGFC 3CWGA 4MRXA 1WY9A 1CFFA 2JT8A 2JNXA 4FQOA 3HCMA 1K8UA 3CTNA 1YX7A 1FW4A 2CXJA 3FIAA 2P71A 3A8RA 4DIRA 1PRWA 2F3YA 3AKAA 5BPJA 1F71A 1QV0A 3IQOA 1CMFA 3TUYB 1YUTA 1OQPA 4ORCB 5HLOA 2JT3A 4QJ5B 3B6XA 3PALA 1AJ4A 1DJZA 3S0FA 2KOTA 2KFFA 3K21A 3TUYC 3ZNIA 2JTTA 2QEOA 4P2YB 2WC6A 1HQVA 3C1VA 2I18A 2LVJA 1BODA 2F2OA 1Y1UA 1LA3A 1LINA 1NP8A 3EVRA 5FI6A 3DVJA 4XYNA 5AANA 3L4AA 5ER4X 1NX2A 1CM1A 4JWQA 4YRUA 1CNPA 1V1FA 2I94A 2L4HA 1IQ5A 4JD9A 1RECA 2JPTA 2KBIA 2RGIA 4HRHA 3Q8IA 1S3PA 4DCKA 1SK6D 2L2CA 1K93D 2WC5A 3K1EA 3FE8A 1L2OB 1DJHA 1OZOA 2LHIA 3PM8A 4JPZB 2AAOA 3D75A 2WCKA 4DRWA 3H4SE 3IVTA 1CM4A 4N1GA 4YGAA 1L2OC 1OMVA 2M1KB 1F55A 3NSIA 2Q4UA 3ZWHA 1MQ1A 2M9GA 5DKQA 2ZRSA 2K7CA 1DTLA 3D77A 1KSMA 2BE6A 2OS8B 2O60A 3LCPC 2V53A 1ODBA 1FBVA 4PHKA 4WQ3A 1J7RA 4FTGA 5I94A 1PSRA 2CCMA 5FI2A 3OHMB 1KSOA 2ZN9A 1GQMA 5K89A 1XFUO 2SCPA 2ZKMX 2K60A 4WRIA 1J7PA 1XYDA 1UHIA 4PHNA 2ISDA 1WRLA 1U5IB 1OOHA 2L51A 3FE9A 5CSJA 1D1OA 3D0YB 1CB1A 1KK8B 2NZ0A 4NQGA 4GNKB 4M2QA 2MA2A 3WXAA 2KGRA 4ORBB 1SRAA 3I5IB 3GOFA 4MZLA 4PHMA 1KK8C 2ZNEA 3DXLA 3SIAA 2P6BB 1JC2A 5CSNA 2M7NA 3KF9A 3I5IC 1GGZA 4ORAB 2M7LA 4F7FA 3BUNB 5EL2A 2G2BA 2KQYA 1IRJA 1IGVA 2PYQA 1LKJA 4U8DA 3EK8A 4UPGA 4TNCA 1LS8A 2IS9A 1PK0D 3BJHA 2CT9A 1JWDA 1DEKA 1JFKA 5DKNA 1NX0A 1K94A 4MEWA 3HX4A
chains in the Genus database with same CATH topology
3NSKA 2I7AA 3SG2A 1UWOA 1S36A 5D7FA 1H8BA 1KWOC 1AJ5A 1J1DA 2GV5A 1QV1A 3FWCA 1UHNA 2JRFA 4N5XA 2OTGB 2CNPA 2LMUA 1DJYA 3O78A 1DVIA 2BBNA 1BT6A 2OTGC 3BQ3A 1SL9A 5AEQA 2AMIA 3E3RA 4N1FA 1N2DA 1SR6B 1CFDA 1MR8A 2F33A 4MLWA 2EGDA 1JSAA 2EHBA 2K0JA 2NXQA 1K95A 1XVJA 3I5FB 1YTZC 1SR6C 3TDUA 2EC6B 2CBLA 1JUOA 3WHTB 2LVKA 1NCXA 2K2FA 3I5FC 1S26D 4GFTA 1A4PA 4NDBA 2I2RE 2KSPA 3A4UB 5CSFA 4C0LA 5KSZA 1QLSA 5KU1A 1BG1A 2HPSA 1XO5A 3VRNA 4GBAA 1S1EA 2K8MB 1S5GY 1RTP1 2HQWA 1DF0A 1NSHA 1ALVA 1IKUA 1BJFA 2JNFA 2K7DA 1DJWA 1K9UA 1KFUS 1C07A 1W7JB 2LUXA 4CIDA 3VRQA 1QVIY 1DMOA 3CLNA 3RM1A 3CZTX 1SYMA 3TDZA 1QIVA 3KO0A 5TNCA 1F70A 4I5KA 1F4QA 1SBJA 3LL8B 1Q80A 2KQ6A 3DD4A 2Y4QA 3DF0B 3EKHA 4XJKB 5F6TA 4WQ2A 2K7BA 1SKTA 4PE4A 2MJWB 2QACA 3IQQA 3VRRA 3GK1A 3OB2B 2AUCA 1TTXA 1WRZA 1NIWA 2LANA 3LK0A 2M29A 1BR1B 1YX8A 1JFJA 1YURA 2TN4A 1ZOTB 4OV2A 2O5GA 4P5OE 2BCXA 2FJUB 3TS5C 1WLMA 4MBEA 1YUUA 2JTZA 1UUSA 4MRYA 4YGDB 4ETOA 1JBAA 3M0WA 1B47A 5HYDA 1KCYA 1DGVA 1L7ZA 1CLMA 1UHKA 2F3ZA 1BU3A 1IQ3A 2LUCA 4BY4A 1B1GA 2WORA 2ZNDA 1TNQA 3AKBA 2PVBA 3EVVA 1QX5B 1F54A 2MLEC 1A03A 2KDHA 2PALA 4MN0A 2M1UA 1DJGA 1UHHA 2WCFA 3EK7A 3TDIA 1MUXA 3GK4X 3BOWB 1NUBA 1OZSA 1CTRA 3JVTB 1M31A 1RROA 2JZIA 3O2PA 1EJ3A 4Q04A 4C0KA 4YGBB 5IBWA 1XFXO 3BUWB 3JVTC 1XK4A 2WC8A 1QX2A 4A4CA 2R2IA 1MF8B 3SG7A 2MHHA 1A75A 1MWNA 2NLNA 3D0YA 1EH2A 1YVHA 2H61A 2BKHB 1EG4A 1FPWA 1ZMZA 4QJ4B 2HETA 1PVBA 2H2KA 1F8HA 1CMGA 1CDPA 2HF5A 2Q91A 1QATA 2NCOA 1SL7A 3LLEA 2KHNA 4AQJA 2L4IA 1M63B 5FYXA 1IG5A 1NCYA 3CR4X 4AQIA 2BKIB 1DGUA 3OB1B 3CGAA 2JULA 2MRDA 1QX7A 1E8AA 1CFPA 3LK1A 1DT7B 1G4YR 1CDLA 4MVFA 1PVAA 4OVNF 3TZ1A 1KWOB 3PLFB 1S6CA 2LMTA 3WHUB 1SCMC 5AXIA 2ZFDA 1UHJA 3I5GC 5HKWA 1BMOA 1ALWA 2NCPA 2PSRA 1DJIA 1NPQA 1C7WA 1RK9A 2MBXA 4CLNA 2KYCA 1CDNA 2WOSA 3BUOB 3CS1A 4I5NB 4PCWA 1ZACA 1KQVA 1PALA 1V1GA 2OPOA 1KFXL 4PE1A 1UP5A 1YUSA 2BCBA 1KFXS 2WCBA 2LP3A 1AK8A 2F2PA 2L98A 4C0JA 1IJ6A 2D8NA 1QS7A 4GPLB 5CSIA 1BLQA 2LVIA 3OP0A 3OX6A 4CFRA 2LMVA 2FCDA 2JT0A 1EL4A 4M2OA 1QTXA 1X02A 4GGFA 1QIWA 1B8LA 1AVSA 1KFUL 1TRFA 1Y1AA 1CLLA 2GGZA 1GJYA 5I2QA 4YGCB 3PN7B 1NYAA 1S6JA 4MZKA 3VROA 2F8PA 2PMYA 2LV7A 1BF5A 2M0RA 1J1EA 2WNDA 1WDCB 2G9BA 1UURA 5HKZA 3PN7C 1TCFA 4I5LB 2KI4B 1EXRA 1LXFC 2KYFA 2LAPA 3QRXA 5PALA 1Y0VH 1ZUZA 1QXPA 4A4BA 4DUQA 3D10A 1NX1A 4OR9B 2FOTA 1WDCC 1S5GZ 4NDDA 2PRUA 2KI4C 3VGOA 3VRPA 4XJKA 2L50A 3KEVA 1TCOB 1OSAA 2M97A 1CLBA 3I5HB 2Y1NA 1M39A 2LC5A 1QVIZ 2KAYA 1A29A 3FWBA 1JF2A 1B8CA 3TS5B 1DF0B 3I5HC 1B9AA 1RJVA 4I5JA 1QJTA 3PFVA 1N65A 1FI6A 1DJXA 1SPYA 4L9MA 1AHRA 1BOCA 1KQMC 1OOJA 1RWYA 1TNPA 1Y6WA 5I2LA 3JTDB 1WRKA 2A4JA 1EG3A 2LVVA 1AUIB 3NSOA 1C7VA 1FF1A 1YR5A 2E30A 5J3XA 1OMRA 3JTDC 3SG4A 4YBHB 4D1EA 3EK4A 5GQQC 2LLTA 1Y1XA 2BECA 2GGMA 2BE4A 2CTNA 3BOWA 3AAKA 4F0ZB 3MSEB 1MXEA 1K90D 3GK2A 4MZJA 4PDZA 1BR4B 2M8UA 2KNEA 2KFGA 1XA5A 2L2EA 1B8RA 5JJGA 1WLZA 4BY5A 1J55A 1AP4A 1M46A 4USLA 2JQ6A 1CDMA 4GAOA 1RFJA 3NXAA 2SASA 1SL8A 1K9KA 3SG6A 1SCVA 1B7TY 1J7QA 2ZRTA 1TNWA 1U5IA 1R6PA 1MXLC 2LNKA 5B8IB 4PALA 1NX3A 1HT9A 3NSLA 3CR5X 4NDCA 1YVLA 1CFCA 1GGWA 2JU0A 3PATA 1XFYO 2VRGA 2M3WA 2KGBC 3O6BA 1QLKA 2M49B 3WNXB 1W7IB 1FI5A 2LCPA 1K2HA 5HLVA 1A2XA 1B7TZ 2BBMA 1F4OA 1YRTB 2JC2A 2OS8C 1OE9B 2HQ8A 1XFVO 1QASA 3BUMB 4HRGA 3KHEA 4AOMA 1LVCD 2QPTA 3PSRA 3SG5A 2PASA 2KAXA 4PE7A 1SCMB 1KK7Y 1G33A 1K9PA 3AAJA 1A75B 1XK4C 1YRUB 3I5GB 1NWDA 4ICBA 4YI8A 2JOJA 2JXCA 3BYAA 3RLZA 3F45A 5I8NA 1SMGA 5D69A 1K96A 4HSZA 3FS7A 1MHOA 1IJ5A 1NCZA 1VRKA 2JXLA 3BUXB 2KFHA 4YI9A 2DOQA 2H61C 5I2OA 1KK7Z 1XFZO 4HREE 3DVMA 2L0PA 2KAVA 4IL1A 5DKRA 2LE9B 2LLUA 2Y1MA 2LLSA 5AERA 2KBMA 3SJSA 4YGEB 1IH0A 1ZFSA 2LHLA 1N0YA 2B1UA 1OMDA 2K61A 1H4BA 1TIZA 2L5XB 1PSBA 3CR2A 3SG3A 4GGNA 3KPXA 2MAZA 1TN4A 2ZN8A 5ER5A 1S6IA 4PE0A 4ZCVA 4GUKA 1PULA 2BL0B 4CPVA 2KI6D 2FCEA 2BCAA 1CKKA 5AFPA 2KI6C 2WCEA 1LA0A 4OKHA 1G8IA 1R2UA 1J7OA 2MLFC 2BL0C 1TOPA 4MSPA 5HKYA 3IF7A 5CPVA 4QJ3B 5G08A 4E68A 2E6WA 5JOLA 3EVUA 3ICBA 3SIBA 1SY9A 4CFQA 1JF0A 4M2PA 4OCIA 1TNXA 2LM5A 3DF0A 2COLB 1IWQA 3OX5A 2EC6C 1M45A 3DVEA 3O4YA 4PHJA 2K2AA 2K7OA 2LP2A 1SW8A 3EKJA 4ZCUA 2JWWA 4R1EA 2Y5IA 1XFWO 1B4CA 3BXKA 4JQ0D 1SNLA 4DS7A 5KTYA 1KQMB 3DVKA 4GGFC 3CWGA 4MRXA 1WY9A 1CFFA 2JT8A 2JNXA 4FQOA 3HCMA 1K8UA 3CTNA 1YX7A 1FW4A 2CXJA 3FIAA 4DIRA 3A8RA 1PRWA 2F3YA 3AKAA 5BPJA 1F71A 1QV0A 3IQOA 1CMFA 3TUYB 1YUTA 1OQPA 4ORCB 5HLOA 2JT3A 4QJ5B 3PALA 1AJ4A 1DJZA 2KOTA 2KFFA 3K21A 3TUYC 3ZNIA 2JTTA 4P2YB 1HQVA 3C1VA 2I18A 2LVJA 1BODA 2F2OA 1Y1UA 1LA3A 1LINA 1NP8A 3EVRA 3DVJA 4XYNA 5AANA 5ER4X 1NX2A 1CM1A 4JWQA 4YRUA 1CNPA 1V1FA 2I94A 2L4HA 1IQ5A 1RECA 2JPTA 2KBIA 2RGIA 4HRHA 1S3PA 4DCKA 1SK6D 1K93D 1L2OB 1DJHA 1OZOA 2LHIA 3PM8A 4JPZB 2AAOA 4DRWA 3H4SE 4YGAA 1CM4A 4N1GA 1L2OC 1OMVA 2M1KB 1F55A 3NSIA 2Q4UA 3ZWHA 1MQ1A 2M9GA 5DKQA 2ZRSA 2K7CA 1DTLA 1KSMA 2BE6A 2OS8B 2O60A 3LCPC 2V53A 1ODBA 1FBVA 4PHKA 4WQ3A 1J7RA 4FTGA 1PSRA 2CCMA 3OHMB 1KSOA 2ZN9A 1GQMA 5K89A 1XFUO 2SCPA 2ZKMX 4WRIA 1J7PA 1XYDA 1UHIA 4PHNA 2ISDA 1WRLA 1U5IB 2L51A 1D1OA 5CSJA 3D0YB 1CB1A 1KK8B 2NZ0A 4NQGA 4GNKB 4M2QA 2MA2A 3WXAA 2KGRA 4ORBB 1SRAA 3I5IB 3GOFA 4MZLA 4PHMA 1KK8C 2ZNEA 3SIAA 2P6BB 1JC2A 5CSNA 2M7NA 3KF9A 3I5IC 1GGZA 4ORAB 2M7LA 3BUNB 2G2BA 2KQYA 1IRJA 1IGVA 4U8DA 1LKJA 4UPGA 3EK8A 4TNCA 2IS9A 1PK0D 2CT9A 1JWDA 1JFKA 5DKNA 1NX0A 1K94A 4MEWA 3HX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSK A;  2I7A A;  3SG2 A;  1UWO A;  1S36 A;  5D7F A;  1H8B A;  1KWO C;  1AJ5 A;  1J1D A;  2GV5 A;  1QV1 A;  3FWC A;  1UHN A;  2JRF A;  4N5X A;  2OTG B;  2CNP A;  2LMU A;  1DJY A;  3O78 A;  1DVI A;  2BBN A;  1BT6 A;  2OTG C;  3BQ3 A;  1SL9 A;  5AEQ A;  2AMI A;  3E3R A;  4N1F A;  1N2D A;  1SR6 B;  1CFD A;  1MR8 A;  2F33 A;  4MLW A;  2EGD A;  1JSA A;  2EHB A;  2K0J A;  2NXQ A;  1K95 A;  1XVJ A;  3I5F B;  1YTZ C;  1SR6 C;  3TDU A;  2EC6 B;  2CBL A;  1JUO A;  3WHT B;  2LVK A;  1NCX A;  2K2F A;  3I5F C;  1S26 D;  4GFT A;  1A4P A;  4NDB A;  2I2R E;  2KSP A;  3A4U B;  5CSF A;  4C0L A;  5KSZ A;  1QLS A;  5KU1 A;  1BG1 A;  2HPS A;  1XO5 A;  3VRN A;  4GBA A;  1S1E A;  2K8M B;  1S5G Y;  1RTP 1;  2HQW A;  1DF0 A;  1NSH A;  1ALV A;  1IKU A;  1BJF A;  2JNF A;  2K7D A;  1DJW A;  1K9U A;  1KFU S;  1C07 A;  1W7J B;  2LUX A;  4CID A;  3VRQ A;  1QVI Y;  1DMO A;  3CLN A;  3RM1 A;  3CZT X;  1SYM A;  3TDZ A;  1QIV A;  3KO0 A;  5TNC A;  1F70 A;  4I5K A;  1F4Q A;  1SBJ A;  3LL8 B;  1Q80 A;  2KQ6 A;  3DD4 A;  2Y4Q A;  3DF0 B;  3EKH A;  4XJK B;  5F6T A;  4WQ2 A;  2K7B A;  1SKT A;  4PE4 A;  2MJW B;  2QAC A;  3IQQ A;  3VRR A;  3GK1 A;  3OB2 B;  2AUC A;  1TTX A;  1WRZ A;  1NIW A;  2LAN A;  3LK0 A;  2M29 A;  1BR1 B;  1YX8 A;  1JFJ A;  1YUR A;  2TN4 A;  1ZOT B;  4OV2 A;  2O5G A;  4P5O E;  2BCX A;  2FJU B;  3TS5 C;  1WLM A;  4MBE A;  1YUU A;  2JTZ A;  1UUS A;  4MRY A;  4YGD B;  4ETO A;  1JBA A;  3M0W A;  1B47 A;  5HYD A;  1KCY A;  1DGV A;  1L7Z A;  1CLM A;  1UHK A;  2F3Z A;  1BU3 A;  1IQ3 A;  2LUC A;  4BY4 A;  1B1G A;  2WOR A;  2ZND A;  1TNQ A;  3AKB A;  2PVB A;  3EVV A;  1QX5 B;  1F54 A;  2MLE C;  1A03 A;  2KDH A;  2PAL A;  4MN0 A;  2M1U A;  1DJG A;  1UHH A;  2WCF A;  3EK7 A;  3TDI A;  1MUX A;  3GK4 X;  3BOW B;  1NUB A;  1OZS A;  1CTR A;  3JVT B;  1M31 A;  1RRO A;  2JZI A;  3O2P A;  1EJ3 A;  4Q04 A;  4C0K A;  4YGB B;  5IBW A;  1XFX O;  3BUW B;  3JVT C;  1XK4 A;  2WC8 A;  1QX2 A;  4A4C A;  2R2I A;  1MF8 B;  3SG7 A;  2MHH A;  1A75 A;  1MWN A;  2NLN A;  3D0Y A;  1EH2 A;  1YVH A;  2H61 A;  2BKH B;  1EG4 A;  1FPW A;  1ZMZ A;  4QJ4 B;  2HET A;  1PVB A;  2H2K A;  1F8H A;  1CMG A;  1CDP A;  2HF5 A;  2Q91 A;  1QAT A;  2NCO A;  1SL7 A;  3LLE A;  2KHN A;  4AQJ A;  2L4I A;  1M63 B;  5FYX A;  1IG5 A;  1NCY A;  3CR4 X;  4AQI A;  2BKI B;  1DGU A;  3OB1 B;  3CGA A;  2JUL A;  2MRD A;  1QX7 A;  1E8A A;  1CFP A;  3LK1 A;  1DT7 B;  1G4Y R;  1CDL A;  4MVF A;  1PVA A;  4OVN F;  3TZ1 A;  1KWO B;  3PLF B;  1S6C A;  2LMT A;  3WHU B;  1SCM C;  5AXI A;  2ZFD A;  1UHJ A;  3I5G C;  5HKW A;  1BMO A;  1ALW A;  2NCP A;  2PSR A;  1DJI A;  1NPQ A;  1C7W A;  1RK9 A;  2MBX A;  4CLN A;  2KYC A;  1CDN A;  2WOS A;  3BUO B;  3CS1 A;  4I5N B;  4PCW A;  1ZAC A;  1KQV A;  1PAL A;  1V1G A;  2OPO A;  1KFX L;  4PE1 A;  1UP5 A;  1YUS A;  2BCB A;  1KFX S;  2WCB A;  2LP3 A;  1AK8 A;  2F2P A;  2L98 A;  4C0J A;  1IJ6 A;  2D8N A;  1QS7 A;  4GPL B;  5CSI A;  1BLQ A;  2LVI A;  3OP0 A;  3OX6 A;  4CFR A;  2LMV A;  2FCD A;  2JT0 A;  1EL4 A;  4M2O A;  1QTX A;  1X02 A;  4GGF A;  1QIW A;  1B8L A;  1AVS A;  1KFU L;  1TRF A;  1Y1A A;  1CLL A;  2GGZ A;  1GJY A;  5I2Q A;  4YGC B;  3PN7 B;  1NYA A;  1S6J A;  4MZK A;  3VRO A;  2F8P A;  2PMY A;  2LV7 A;  1BF5 A;  2M0R A;  1J1E A;  2WND A;  1WDC B;  2G9B A;  1UUR A;  5HKZ A;  3PN7 C;  1TCF A;  4I5L B;  2KI4 B;  1EXR A;  1LXF C;  2KYF A;  2LAP A;  3QRX A;  5PAL A;  1Y0V H;  1ZUZ A;  1QXP A;  4A4B A;  4DUQ A;  3D10 A;  1NX1 A;  4OR9 B;  2FOT A;  1WDC C;  1S5G Z;  4NDD A;  2PRU A;  2KI4 C;  3VGO A;  3VRP A;  4XJK A;  2L50 A;  3KEV A;  1TCO B;  1OSA A;  2M97 A;  1CLB A;  3I5H B;  2Y1N A;  1M39 A;  2LC5 A;  1QVI Z;  2KAY A;  1A29 A;  3FWB A;  1JF2 A;  1B8C A;  3TS5 B;  1DF0 B;  3I5H C;  1B9A A;  1RJV A;  4I5J A;  1QJT A;  3PFV A;  1N65 A;  1FI6 A;  1DJX A;  1SPY A;  4L9M A;  1AHR A;  1BOC A;  1KQM C;  1OOJ A;  1RWY A;  1TNP A;  1Y6W A;  5I2L A;  3JTD B;  1WRK A;  2A4J A;  1EG3 A;  2LVV A;  1AUI B;  3NSO A;  1C7V A;  1FF1 A;  1YR5 A;  2E30 A;  5J3X A;  1OMR A;  3JTD C;  3SG4 A;  4YBH B;  4D1E A;  3EK4 A;  5GQQ C;  2LLT A;  1Y1X A;  2BEC A;  2GGM A;  2BE4 A;  2CTN A;  3BOW A;  3AAK A;  4F0Z B;  3MSE B;  1MXE A;  1K90 D;  3GK2 A;  4MZJ A;  4PDZ A;  1BR4 B;  2M8U A;  2KNE A;  2KFG A;  1XA5 A;  2L2E A;  1B8R A;  5JJG A;  1WLZ A;  4BY5 A;  1J55 A;  1AP4 A;  1M46 A;  4USL A;  2JQ6 A;  1CDM A;  4GAO A;  1RFJ A;  3NXA A;  2SAS A;  1SL8 A;  1K9K A;  3SG6 A;  1SCV A;  1B7T Y;  1J7Q A;  2ZRT A;  1TNW A;  1U5I A;  1R6P A;  1MXL C;  2LNK A;  5B8I B;  4PAL A;  1NX3 A;  1HT9 A;  3NSL A;  3CR5 X;  4NDC A;  1YVL A;  1CFC A;  1GGW A;  2JU0 A;  3PAT A;  1XFY O;  2VRG A;  2M3W A;  2KGB C;  3O6B A;  1QLK A;  2M49 B;  3WNX B;  1W7I B;  1FI5 A;  2LCP A;  1K2H A;  5HLV A;  1A2X A;  1B7T Z;  2BBM A;  1F4O A;  1YRT B;  2JC2 A;  2OS8 C;  1OE9 B;  2HQ8 A;  1XFV O;  1QAS A;  3BUM B;  4HRG A;  3KHE A;  4AOM A;  1LVC D;  2QPT A;  3PSR A;  3SG5 A;  2PAS A;  2KAX A;  4PE7 A;  1SCM B;  1KK7 Y;  1G33 A;  1K9P A;  3AAJ A;  1A75 B;  1XK4 C;  1YRU B;  3I5G B;  1NWD A;  4ICB A;  4YI8 A;  2JOJ A;  2JXC A;  3BYA A;  3RLZ A;  3F45 A;  5I8N A;  1SMG A;  5D69 A;  1K96 A;  4HSZ A;  3FS7 A;  1MHO A;  1IJ5 A;  1NCZ A;  1VRK A;  2JXL A;  3BUX B;  2KFH A;  4YI9 A;  2DOQ A;  2H61 C;  5I2O A;  1KK7 Z;  1XFZ O;  4HRE E;  3DVM A;  2L0P A;  2KAV A;  4IL1 A;  5DKR A;  2LE9 B;  2LLU A;  2Y1M A;  2LLS A;  5AER A;  2KBM A;  3SJS A;  4YGE B;  1IH0 A;  1ZFS A;  2LHL A;  1N0Y A;  2B1U A;  1OMD A;  2K61 A;  1H4B A;  1TIZ A;  2L5X B;  1PSB A;  3CR2 A;  3SG3 A;  4GGN A;  3KPX A;  2MAZ A;  1TN4 A;  2ZN8 A;  5ER5 A;  1S6I A;  4PE0 A;  4ZCV A;  4GUK A;  1PUL A;  2BL0 B;  4CPV A;  2KI6 D;  2FCE A;  2BCA A;  1CKK A;  5AFP A;  2KI6 C;  2WCE A;  1LA0 A;  4OKH A;  1G8I A;  1R2U A;  1J7O A;  2MLF C;  2BL0 C;  1TOP A;  4MSP A;  5HKY A;  3IF7 A;  5CPV A;  4QJ3 B;  5G08 A;  4E68 A;  2E6W A;  5JOL A;  3EVU A;  3ICB A;  3SIB A;  1SY9 A;  4CFQ A;  1JF0 A;  4M2P A;  4OCI A;  1TNX A;  2LM5 A;  3DF0 A;  2COL B;  1IWQ A;  3OX5 A;  2EC6 C;  1M45 A;  3DVE A;  3O4Y A;  4PHJ A;  2K2A A;  2K7O A;  2LP2 A;  1SW8 A;  3EKJ A;  4ZCU A;  2JWW A;  4R1E A;  2Y5I A;  1XFW O;  1B4C A;  3BXK A;  4JQ0 D;  1SNL A;  4DS7 A;  5KTY A;  1KQM B;  3DVK A;  4GGF C;  3CWG A;  4MRX A;  1WY9 A;  1CFF A;  2JT8 A;  2JNX A;  4FQO A;  3HCM A;  1K8U A;  3CTN A;  1YX7 A;  1FW4 A;  2CXJ A;  3FIA A;  4DIR A;  3A8R A;  1PRW A;  2F3Y A;  3AKA A;  5BPJ A;  1F71 A;  1QV0 A;  3IQO A;  1CMF A;  3TUY B;  1YUT A;  1OQP A;  4ORC B;  5HLO A;  2JT3 A;  4QJ5 B;  3PAL A;  1AJ4 A;  1DJZ A;  2KOT A;  2KFF A;  3K21 A;  3TUY C;  3ZNI A;  2JTT A;  4P2Y B;  1HQV A;  3C1V A;  2I18 A;  2LVJ A;  1BOD A;  2F2O A;  1Y1U A;  1LA3 A;  1LIN A;  1NP8 A;  3EVR A;  3DVJ A;  4XYN A;  5AAN A;  5ER4 X;  1NX2 A;  1CM1 A;  4JWQ A;  4YRU A;  1CNP A;  1V1F A;  2I94 A;  2L4H A;  1IQ5 A;  1REC A;  2JPT A;  2KBI A;  2RGI A;  4HRH A;  1S3P A;  4DCK A;  1SK6 D;  1K93 D;  1L2O B;  1DJH A;  1OZO A;  2LHI A;  3PM8 A;  4JPZ B;  2AAO A;  4DRW A;  3H4S E;  4YGA A;  1CM4 A;  4N1G A;  1L2O C;  1OMV A;  2M1K B;  1F55 A;  3NSI A;  2Q4U A;  3ZWH A;  1MQ1 A;  2M9G A;  5DKQ A;  2ZRS A;  2K7C A;  1DTL A;  1KSM A;  2BE6 A;  2OS8 B;  2O60 A;  3LCP C;  2V53 A;  1ODB A;  1FBV A;  4PHK A;  4WQ3 A;  1J7R A;  4FTG A;  1PSR A;  2CCM A;  3OHM B;  1KSO A;  2ZN9 A;  1GQM A;  5K89 A;  1XFU O;  2SCP A;  2ZKM X;  4WRI A;  1J7P A;  1XYD A;  1UHI A;  4PHN A;  2ISD A;  1WRL A;  1U5I B;  2L51 A;  1D1O A;  5CSJ A;  3D0Y B;  1CB1 A;  1KK8 B;  2NZ0 A;  4NQG A;  4GNK B;  4M2Q A;  2MA2 A;  3WXA A;  2KGR A;  4ORB B;  1SRA A;  3I5I B;  3GOF A;  4MZL A;  4PHM A;  1KK8 C;  2ZNE A;  3SIA A;  2P6B B;  1JC2 A;  5CSN A;  2M7N A;  3KF9 A;  3I5I C;  1GGZ A;  4ORA B;  2M7L A;  3BUN B;  2G2B A;  2KQY A;  1IRJ A;  1IGV A;  4U8D A;  1LKJ A;  4UPG A;  3EK8 A;  4TNC A;  2IS9 A;  1PK0 D;  2CT9 A;  1JWD A;  1JFK A;  5DKN A;  1NX0 A;  1K94 A;  4MEW A;  3HX4 A; 
#chains in the Genus database with same CATH topology
 3NSK A;  2KLD A;  2GTE A;  2I7A A;  3SG2 A;  4JKT A;  1UWO A;  1S36 A;  5D7F A;  1H8B A;  1KWO C;  1AJ5 A;  1J1D A;  2GV5 A;  1QV1 A;  3FWC A;  1TUZ A;  1UHN A;  2JRF A;  4N5X A;  2OTG B;  2CNP A;  3B87 A;  3R1P A;  2LMU A;  1DJY A;  3O78 A;  1DVI A;  2BBN A;  1BT6 A;  2OTG C;  1ORG A;  1SL9 A;  3BQ3 A;  4INX A;  5AEQ A;  2AMI A;  3E3R A;  4N1F A;  1N2D A;  1SR6 B;  1IIO A;  1CFD A;  1MR8 A;  2F33 A;  4MLW A;  2EGD A;  1JSA A;  2EHB A;  2K0J A;  2NXQ A;  1K95 A;  1XVJ A;  3I5F B;  1DC1 A;  3CZ2 A;  1YTZ C;  1SR6 C;  3TDU A;  2EC6 B;  2CBL A;  1JUO A;  3WHT B;  2LVK A;  1NCX A;  2K2F A;  3I5F C;  1S26 D;  4GFT A;  1A4P A;  4NDB A;  2I2R E;  2KSP A;  3A4U B;  5CSF A;  4C0L A;  5KSZ A;  1QLS A;  5KU1 A;  1BG1 A;  2HPS A;  1XO5 A;  3VRN A;  4GBA A;  1S1E A;  2K8M B;  1S5G Y;  1RTP 1;  2HQW A;  1DF0 A;  1NSH A;  2PQL A;  1ALV A;  1IKU A;  5D3O A;  1BJF A;  2JNF A;  2K7D A;  3SS4 A;  1DJW A;  1K9U A;  1KFU S;  1C07 A;  1W7J B;  2LUX A;  3R1V A;  3VRQ A;  4CID A;  1QVI Y;  1DMO A;  3CLN A;  3RM1 A;  3CZT X;  1SYM A;  3TDZ A;  1QIV A;  3KO0 A;  5TNC A;  1F70 A;  4I5K A;  1F4Q A;  1SBJ A;  3LL8 B;  1Q80 A;  2KQ6 A;  3DD4 A;  5FI7 A;  2Y4Q A;  3CYZ A;  3DF0 B;  3D76 A;  3EKH A;  4XJK B;  5F6T A;  4WQ2 A;  2K7B A;  1SKT A;  4PE4 A;  2MJW B;  2QAC A;  3IQQ A;  3VRR A;  3GK1 A;  3OB2 B;  2AUC A;  1TTX A;  1WRZ A;  1NIW A;  2LAN A;  3LK0 A;  2M29 A;  1BR1 B;  1YX8 A;  2QEH A;  1JFJ A;  1YUR A;  2TN4 A;  1ZOT B;  4OV2 A;  2O5G A;  4P5O E;  2BCX A;  2FJU B;  3B86 A;  3TS5 C;  2YGU A;  1WLM A;  4MBE A;  1YUU A;  2JTZ A;  1UUS A;  4MRY A;  4YGD B;  4ETO A;  1JBA A;  2H8V A;  3M0W A;  1B47 A;  5HYD A;  2FJY A;  1KCY A;  1DGV A;  1L7Z A;  1CLM A;  1UHK A;  2F3Z A;  1BU3 A;  2L5Y A;  2LUC A;  4BY4 A;  1IQ3 A;  1B1G A;  2WOR A;  2ZND A;  1TNQ A;  3AKB A;  2PVB A;  3EVV A;  1GM0 A;  1QX5 B;  1F54 A;  2MLE C;  1A03 A;  2KDH A;  2PAL A;  4MN0 A;  2M1U A;  2WCL A;  1DJG A;  1UHH A;  2WCF A;  3EK7 A;  3TDI A;  1MUX A;  3GK4 X;  3BOW B;  1NUB A;  1OZS A;  3B88 A;  1CTR A;  3JVT B;  1M31 A;  2QDI A;  1RRO A;  2JZI A;  3CDN A;  1EJ3 A;  3O2P A;  4Q04 A;  4C0K A;  4YGB B;  5IBW A;  1XFX O;  3BUW B;  3JVT C;  5HL1 A;  1XK4 A;  2WC8 A;  2P70 A;  1QX2 A;  4A4C A;  3L47 A;  2R2I A;  1MF8 B;  3SG7 A;  2MHH A;  1A75 A;  1MWN A;  2NLN A;  3D0Y A;  1EH2 A;  3V2L A;  1QWV A;  1YVH A;  2H61 A;  2BKH B;  1EG4 A;  1FPW A;  1ZMZ A;  4QJ4 B;  2HET A;  1PVB A;  2H2K A;  1F8H A;  1CMG A;  1CDP A;  2HF5 A;  2Q91 A;  1QAT A;  2NCO A;  3NGV A;  1SL7 A;  3LLE A;  2KHN A;  4AQJ A;  3S0D A;  2L4I A;  1M63 B;  5FYX A;  1C3Y A;  1IG5 A;  1NCY A;  3CR4 X;  4AQI A;  2BKI B;  1DGU A;  3OB1 B;  3CGA A;  2JUL A;  2MRD A;  1QX7 A;  3D78 A;  1E8A A;  1CFP A;  3LK1 A;  1DT7 B;  1G4Y R;  3EG5 B;  1CDL A;  4MVF A;  1PVA A;  4OVN F;  3TZ1 A;  1KWO B;  3CAB A;  1S6C A;  3PLF B;  2LMT A;  3WHU B;  1SCM C;  4INW A;  5AXI A;  2ZFD A;  1UHJ A;  3I5G C;  5HKW A;  1BMO A;  1ALW A;  2NCP A;  2PSR A;  3OBV A;  1DJI A;  1NPQ A;  1C7W A;  1RK9 A;  1Z4H A;  2MBX A;  2KYC A;  4CLN A;  1CDN A;  2WOS A;  3BUO B;  3CS1 A;  4I5N B;  4PCW A;  1ZAC A;  3SS3 A;  1PAL A;  1V1G A;  1KQV A;  2OPO A;  1KFX L;  2ERB A;  4PE1 A;  1UP5 A;  1YUS A;  2BCB A;  2WCH A;  1KFX S;  2WCB A;  2LP3 A;  3BFB A;  1AK8 A;  2F2P A;  3FE6 A;  2L98 A;  3VB1 A;  1IJ6 A;  2D8N A;  4C0J A;  2KPH A;  1QS7 A;  4GPL B;  3NHI A;  5CSI A;  1BLQ A;  2LVI A;  3OP0 A;  3OX6 A;  4CFR A;  2LMV A;  1TWO A;  3B7A A;  2FCD A;  2JT0 A;  1EL4 A;  4M2O A;  1QTX A;  1X02 A;  4GGF A;  1QIW A;  4KYN A;  1B8L A;  1AVS A;  1KFU L;  1TRF A;  1Y1A A;  1CLL A;  2GGZ A;  1GJY A;  3R72 A;  5I2Q A;  4YGC B;  3PN7 B;  1NYA A;  1S6J A;  4MZK A;  3VRO A;  2F8P A;  2PMY A;  3CZ0 A;  2LV7 A;  1BF5 A;  2KLE A;  1J1E A;  2M0R A;  2WND A;  1WDC B;  2G9B A;  1UUR A;  3BFH A;  3PN7 C;  1TCF A;  4I5L B;  5HKZ A;  2KI4 B;  1EXR A;  1LXF C;  2KYF A;  2LAP A;  3QRX A;  5PAL A;  1Y0V H;  1ZUZ A;  1QXP A;  3SS5 A;  4A4B A;  3D10 A;  1NX1 A;  4OR9 B;  4DUQ A;  2FOT A;  1WDC C;  1S5G Z;  4NDD A;  3S0G A;  2PRU A;  2KI4 C;  3VGO A;  3VRP A;  4XJK A;  2L50 A;  3KEV A;  1TCO B;  1OSA A;  2M97 A;  1CLB A;  3I5H B;  2Y1N A;  1M39 A;  2LC5 A;  1QVI Z;  2KAY A;  1A29 A;  1Z2C B;  3FWB A;  1JF2 A;  1B8C A;  1TUJ A;  3TS5 B;  1DF0 B;  3I5H C;  1B9A A;  1RJV A;  4I5J A;  1QJT A;  3PFV A;  1N65 A;  1W9Z A;  1FI6 A;  1DJX A;  1SPY A;  4L9M A;  1AHR A;  1BOC A;  1SSE B;  1KQM C;  1OOJ A;  1RWY A;  1TNP A;  1Y6W A;  5I2L A;  3UNW A;  3JTD B;  1WRK A;  2A4J A;  1EG3 A;  2LVV A;  1AUI B;  3NSO A;  1C7V A;  1FF1 A;  1YR5 A;  2E30 A;  3DYE A;  3PM2 A;  5J3X A;  1OMR A;  3JTD C;  3SG4 A;  4YBH B;  4D1E A;  3EK4 A;  2QEV A;  5GQQ C;  2LLT A;  1Y1X A;  2BEC A;  2GGM A;  2BE4 A;  2CTN A;  3BOW A;  3AAK A;  4F0Z B;  3MSE B;  1MXE A;  1K90 D;  3GK2 A;  3D73 A;  4MZJ A;  4PDZ A;  1BR4 B;  2M8U A;  2KNE A;  2KFG A;  1XA5 A;  2L2E A;  1B8R A;  5JJG A;  3DY9 A;  1WLZ A;  4BY5 A;  1J55 A;  2QEB A;  1AP4 A;  1M46 A;  4USL A;  2JQ6 A;  1CDM A;  4GAO A;  1RFJ A;  3NXA A;  2SAS A;  1SL8 A;  1K9K A;  1OOI X;  3SG6 A;  1SCV A;  1B7T Y;  3OGN A;  1OW4 A;  1J7Q A;  2ZRT A;  1TNW A;  3QME A;  1U5I A;  1R6P A;  1MXL C;  2LNK A;  5B8I B;  4PAL A;  1NX3 A;  1HT9 A;  3NSL A;  3CR5 X;  4NDC A;  1YVL A;  1CFC A;  1GGW A;  2JU0 A;  3PAT A;  1XFY O;  2VRG A;  2M3W A;  2KGB C;  3D74 A;  3O6B A;  1QLK A;  2M49 B;  3WNX B;  1W7I B;  2BNX A;  2LCP A;  1FI5 A;  5HLV A;  1A2X A;  1K2H A;  1B7T Z;  2BBM A;  1F4O A;  4OZD A;  1YRT B;  2JC2 A;  2OS8 C;  1OE9 B;  2HQ8 A;  1XFV O;  1QAS A;  3BUM B;  4HRG A;  3KHE A;  4AOM A;  1LVC D;  2QPT A;  3PSR A;  4FQT A;  2PAS A;  3SG5 A;  2KAX A;  4PE7 A;  1SCM B;  1KK7 Y;  1G33 A;  1K9P A;  3AAJ A;  3BFA A;  3S0B A;  1A75 B;  1XK4 C;  1YRU B;  3I5G B;  1NWD A;  4ICB A;  4YI8 A;  2JOJ A;  2JXC A;  3BYA A;  3RLZ A;  1T14 A;  3F45 A;  5I8N A;  1SMG A;  5D69 A;  1K96 A;  4HSZ A;  1DQE A;  3FS7 A;  4IJ7 A;  1MHO A;  1IJ5 A;  1NCZ A;  1VRK A;  2JXL A;  3BUX B;  2KFH A;  4YI9 A;  2DOQ A;  2H61 C;  3S0E A;  3N7H A;  5DIC A;  5I2O A;  1KK7 Z;  1XFZ O;  4HRE E;  3DVM A;  2L0P A;  2KAV A;  4IL1 A;  5DKR A;  2LE9 B;  2LLU A;  2Y1M A;  2LLS A;  2JPO A;  5AER A;  3DZT A;  1OOG A;  2KBM A;  3SJS A;  4YGE B;  3UO9 A;  1IH0 A;  1ZFS A;  2LHL A;  1N0Y A;  2B1U A;  1OMD A;  2K61 A;  3L4L A;  1H4B A;  1TIZ A;  2L5X B;  1PSB A;  3CR2 A;  3SG3 A;  4GGN A;  3KPX A;  2MAZ A;  1TN4 A;  2WCJ A;  2ZN8 A;  5ER5 A;  3S0A A;  1S6I A;  4PE0 A;  4ZCV A;  3RZS A;  3O4X A;  4GUK A;  2WCM A;  1PUL A;  2BL0 B;  4CPV A;  2KI6 D;  2FCE A;  2BCA A;  4PT1 A;  1CKK A;  5AFP A;  2KI6 C;  2WCE A;  1LA0 A;  1OOF A;  1G8I A;  1R2U A;  4OKH A;  1J7O A;  2MLF C;  2BL0 C;  1TOP A;  4MSP A;  5HKY A;  3IF7 A;  1DEL A;  3PJI A;  5CPV A;  3NHT A;  4QJ3 B;  5G08 A;  4E68 A;  2E6W A;  5JOL A;  3EVU A;  1P28 A;  3ICB A;  3SIB A;  2BAP A;  1SY9 A;  4CFQ A;  1JF0 A;  4M2P A;  4OCI A;  1TNX A;  2LM5 A;  3DF0 A;  2COL B;  1IWQ A;  3OX5 A;  2EC6 C;  1M45 A;  3DVE A;  3O4Y A;  4PHJ A;  1XFR A;  2K2A A;  2K7O A;  3R1O A;  2LP2 A;  1SW8 A;  3EKJ A;  4ZCU A;  2JWW A;  4R1E A;  2Y5I A;  1XFW O;  1B4C A;  3BXK A;  3CZ1 A;  1C3Z A;  1SNL A;  4JQ0 D;  4DS7 A;  5KTY A;  1KQM B;  3DVK A;  4GGF C;  3CWG A;  4MRX A;  1WY9 A;  1CFF A;  2JT8 A;  2JNX A;  4FQO A;  3HCM A;  1K8U A;  3CTN A;  1YX7 A;  1FW4 A;  2CXJ A;  3FIA A;  2P71 A;  3A8R A;  4DIR A;  1PRW A;  2F3Y A;  3AKA A;  5BPJ A;  1F71 A;  1QV0 A;  3IQO A;  1CMF A;  3TUY B;  1YUT A;  1OQP A;  4ORC B;  5HLO A;  2JT3 A;  4QJ5 B;  3B6X A;  3PAL A;  1AJ4 A;  1DJZ A;  3S0F A;  2KOT A;  2KFF A;  3K21 A;  3TUY C;  3ZNI A;  2JTT A;  2QEO A;  4P2Y B;  2WC6 A;  1HQV A;  3C1V A;  2I18 A;  2LVJ A;  1BOD A;  2F2O A;  1Y1U A;  1LA3 A;  1LIN A;  1NP8 A;  3EVR A;  5FI6 A;  3DVJ A;  4XYN A;  5AAN A;  3L4A A;  5ER4 X;  1NX2 A;  1CM1 A;  4JWQ A;  4YRU A;  1CNP A;  1V1F A;  2I94 A;  2L4H A;  1IQ5 A;  4JD9 A;  1REC A;  2JPT A;  2KBI A;  2RGI A;  4HRH A;  3Q8I A;  1S3P A;  4DCK A;  1SK6 D;  2L2C A;  1K93 D;  2WC5 A;  3K1E A;  3FE8 A;  1L2O B;  1DJH A;  1OZO A;  2LHI A;  3PM8 A;  4JPZ B;  2AAO A;  3D75 A;  2WCK A;  4DRW A;  3H4S E;  3IVT A;  1CM4 A;  4N1G A;  4YGA A;  1L2O C;  1OMV A;  2M1K B;  1F55 A;  3NSI A;  2Q4U A;  3ZWH A;  1MQ1 A;  2M9G A;  5DKQ A;  2ZRS A;  2K7C A;  1DTL A;  3D77 A;  1KSM A;  2BE6 A;  2OS8 B;  2O60 A;  3LCP C;  2V53 A;  1ODB A;  1FBV A;  4PHK A;  4WQ3 A;  1J7R A;  4FTG A;  5I94 A;  1PSR A;  2CCM A;  5FI2 A;  3OHM B;  1KSO A;  2ZN9 A;  1GQM A;  5K89 A;  1XFU O;  2SCP A;  2ZKM X;  2K60 A;  4WRI A;  1J7P A;  1XYD A;  1UHI A;  4PHN A;  2ISD A;  1WRL A;  1U5I B;  1OOH A;  2L51 A;  3FE9 A;  5CSJ A;  1D1O A;  3D0Y B;  1CB1 A;  1KK8 B;  2NZ0 A;  4NQG A;  4GNK B;  4M2Q A;  2MA2 A;  3WXA A;  2KGR A;  4ORB B;  1SRA A;  3I5I B;  3GOF A;  4MZL A;  4PHM A;  1KK8 C;  2ZNE A;  3DXL A;  3SIA A;  2P6B B;  1JC2 A;  5CSN A;  2M7N A;  3KF9 A;  3I5I C;  1GGZ A;  4ORA B;  2M7L A;  4F7F A;  3BUN B;  5EL2 A;  2G2B A;  2KQY A;  1IRJ A;  1IGV A;  2PYQ A;  1LKJ A;  4U8D A;  3EK8 A;  4UPG A;  4TNC A;  1LS8 A;  2IS9 A;  1PK0 D;  3BJH A;  2CT9 A;  1JWD A;  1DEK A;  1JFK A;  5DKN A;  1NX0 A;  1K94 A;  4MEW A;  3HX4 A; 
#chains in the Genus database with same CATH homology
 3NSK A;  2I7A A;  3SG2 A;  1UWO A;  1S36 A;  5D7F A;  1H8B A;  1KWO C;  1AJ5 A;  1J1D A;  2GV5 A;  1QV1 A;  3FWC A;  1UHN A;  2JRF A;  4N5X A;  2OTG B;  2CNP A;  2LMU A;  1DJY A;  3O78 A;  1DVI A;  2BBN A;  1BT6 A;  2OTG C;  3BQ3 A;  1SL9 A;  5AEQ A;  2AMI A;  3E3R A;  4N1F A;  1N2D A;  1SR6 B;  1CFD A;  1MR8 A;  2F33 A;  4MLW A;  2EGD A;  1JSA A;  2EHB A;  2K0J A;  2NXQ A;  1K95 A;  1XVJ A;  3I5F B;  1YTZ C;  1SR6 C;  3TDU A;  2EC6 B;  2CBL A;  1JUO A;  3WHT B;  2LVK A;  1NCX A;  2K2F A;  3I5F C;  1S26 D;  4GFT A;  1A4P A;  4NDB A;  2I2R E;  2KSP A;  3A4U B;  5CSF A;  4C0L A;  5KSZ A;  1QLS A;  5KU1 A;  1BG1 A;  2HPS A;  1XO5 A;  3VRN A;  4GBA A;  1S1E A;  2K8M B;  1S5G Y;  1RTP 1;  2HQW A;  1DF0 A;  1NSH A;  1ALV A;  1IKU A;  1BJF A;  2JNF A;  2K7D A;  1DJW A;  1K9U A;  1KFU S;  1C07 A;  1W7J B;  2LUX A;  4CID A;  3VRQ A;  1QVI Y;  1DMO A;  3CLN A;  3RM1 A;  3CZT X;  1SYM A;  3TDZ A;  1QIV A;  3KO0 A;  5TNC A;  1F70 A;  4I5K A;  1F4Q A;  1SBJ A;  3LL8 B;  1Q80 A;  2KQ6 A;  3DD4 A;  2Y4Q A;  3DF0 B;  3EKH A;  4XJK B;  5F6T A;  4WQ2 A;  2K7B A;  1SKT A;  4PE4 A;  2MJW B;  2QAC A;  3IQQ A;  3VRR A;  3GK1 A;  3OB2 B;  2AUC A;  1TTX A;  1WRZ A;  1NIW A;  2LAN A;  3LK0 A;  2M29 A;  1BR1 B;  1YX8 A;  1JFJ A;  1YUR A;  2TN4 A;  1ZOT B;  4OV2 A;  2O5G A;  4P5O E;  2BCX A;  2FJU B;  3TS5 C;  1WLM A;  4MBE A;  1YUU A;  2JTZ A;  1UUS A;  4MRY A;  4YGD B;  4ETO A;  1JBA A;  3M0W A;  1B47 A;  5HYD A;  1KCY A;  1DGV A;  1L7Z A;  1CLM A;  1UHK A;  2F3Z A;  1BU3 A;  1IQ3 A;  2LUC A;  4BY4 A;  1B1G A;  2WOR A;  2ZND A;  1TNQ A;  3AKB A;  2PVB A;  3EVV A;  1QX5 B;  1F54 A;  2MLE C;  1A03 A;  2KDH A;  2PAL A;  4MN0 A;  2M1U A;  1DJG A;  1UHH A;  2WCF A;  3EK7 A;  3TDI A;  1MUX A;  3GK4 X;  3BOW B;  1NUB A;  1OZS A;  1CTR A;  3JVT B;  1M31 A;  1RRO A;  2JZI A;  3O2P A;  1EJ3 A;  4Q04 A;  4C0K A;  4YGB B;  5IBW A;  1XFX O;  3BUW B;  3JVT C;  1XK4 A;  2WC8 A;  1QX2 A;  4A4C A;  2R2I A;  1MF8 B;  3SG7 A;  2MHH A;  1A75 A;  1MWN A;  2NLN A;  3D0Y A;  1EH2 A;  1YVH A;  2H61 A;  2BKH B;  1EG4 A;  1FPW A;  1ZMZ A;  4QJ4 B;  2HET A;  1PVB A;  2H2K A;  1F8H A;  1CMG A;  1CDP A;  2HF5 A;  2Q91 A;  1QAT A;  2NCO A;  1SL7 A;  3LLE A;  2KHN A;  4AQJ A;  2L4I A;  1M63 B;  5FYX A;  1IG5 A;  1NCY A;  3CR4 X;  4AQI A;  2BKI B;  1DGU A;  3OB1 B;  3CGA A;  2JUL A;  2MRD A;  1QX7 A;  1E8A A;  1CFP A;  3LK1 A;  1DT7 B;  1G4Y R;  1CDL A;  4MVF A;  1PVA A;  4OVN F;  3TZ1 A;  1KWO B;  3PLF B;  1S6C A;  2LMT A;  3WHU B;  1SCM C;  5AXI A;  2ZFD A;  1UHJ A;  3I5G C;  5HKW A;  1BMO A;  1ALW A;  2NCP A;  2PSR A;  1DJI A;  1NPQ A;  1C7W A;  1RK9 A;  2MBX A;  4CLN A;  2KYC A;  1CDN A;  2WOS A;  3BUO B;  3CS1 A;  4I5N B;  4PCW A;  1ZAC A;  1KQV A;  1PAL A;  1V1G A;  2OPO A;  1KFX L;  4PE1 A;  1UP5 A;  1YUS A;  2BCB A;  1KFX S;  2WCB A;  2LP3 A;  1AK8 A;  2F2P A;  2L98 A;  4C0J A;  1IJ6 A;  2D8N A;  1QS7 A;  4GPL B;  5CSI A;  1BLQ A;  2LVI A;  3OP0 A;  3OX6 A;  4CFR A;  2LMV A;  2FCD A;  2JT0 A;  1EL4 A;  4M2O A;  1QTX A;  1X02 A;  4GGF A;  1QIW A;  1B8L A;  1AVS A;  1KFU L;  1TRF A;  1Y1A A;  1CLL A;  2GGZ A;  1GJY A;  5I2Q A;  4YGC B;  3PN7 B;  1NYA A;  1S6J A;  4MZK A;  3VRO A;  2F8P A;  2PMY A;  2LV7 A;  1BF5 A;  2M0R A;  1J1E A;  2WND A;  1WDC B;  2G9B A;  1UUR A;  5HKZ A;  3PN7 C;  1TCF A;  4I5L B;  2KI4 B;  1EXR A;  1LXF C;  2KYF A;  2LAP A;  3QRX A;  5PAL A;  1Y0V H;  1ZUZ A;  1QXP A;  4A4B A;  4DUQ A;  3D10 A;  1NX1 A;  4OR9 B;  2FOT A;  1WDC C;  1S5G Z;  4NDD A;  2PRU A;  2KI4 C;  3VGO A;  3VRP A;  4XJK A;  2L50 A;  3KEV A;  1TCO B;  1OSA A;  2M97 A;  1CLB A;  3I5H B;  2Y1N A;  1M39 A;  2LC5 A;  1QVI Z;  2KAY A;  1A29 A;  3FWB A;  1JF2 A;  1B8C A;  3TS5 B;  1DF0 B;  3I5H C;  1B9A A;  1RJV A;  4I5J A;  1QJT A;  3PFV A;  1N65 A;  1FI6 A;  1DJX A;  1SPY A;  4L9M A;  1AHR A;  1BOC A;  1KQM C;  1OOJ A;  1RWY A;  1TNP A;  1Y6W A;  5I2L A;  3JTD B;  1WRK A;  2A4J A;  1EG3 A;  2LVV A;  1AUI B;  3NSO A;  1C7V A;  1FF1 A;  1YR5 A;  2E30 A;  5J3X A;  1OMR A;  3JTD C;  3SG4 A;  4YBH B;  4D1E A;  3EK4 A;  5GQQ C;  2LLT A;  1Y1X A;  2BEC A;  2GGM A;  2BE4 A;  2CTN A;  3BOW A;  3AAK A;  4F0Z B;  3MSE B;  1MXE A;  1K90 D;  3GK2 A;  4MZJ A;  4PDZ A;  1BR4 B;  2M8U A;  2KNE A;  2KFG A;  1XA5 A;  2L2E A;  1B8R A;  5JJG A;  1WLZ A;  4BY5 A;  1J55 A;  1AP4 A;  1M46 A;  4USL A;  2JQ6 A;  1CDM A;  4GAO A;  1RFJ A;  3NXA A;  2SAS A;  1SL8 A;  1K9K A;  3SG6 A;  1SCV A;  1B7T Y;  1J7Q A;  2ZRT A;  1TNW A;  1U5I A;  1R6P A;  1MXL C;  2LNK A;  5B8I B;  4PAL A;  1NX3 A;  1HT9 A;  3NSL A;  3CR5 X;  4NDC A;  1YVL A;  1CFC A;  1GGW A;  2JU0 A;  3PAT A;  1XFY O;  2VRG A;  2M3W A;  2KGB C;  3O6B A;  1QLK A;  2M49 B;  3WNX B;  1W7I B;  1FI5 A;  2LCP A;  1K2H A;  5HLV A;  1A2X A;  1B7T Z;  2BBM A;  1F4O A;  1YRT B;  2JC2 A;  2OS8 C;  1OE9 B;  2HQ8 A;  1XFV O;  1QAS A;  3BUM B;  4HRG A;  3KHE A;  4AOM A;  1LVC D;  2QPT A;  3PSR A;  3SG5 A;  2PAS A;  2KAX A;  4PE7 A;  1SCM B;  1KK7 Y;  1G33 A;  1K9P A;  3AAJ A;  1A75 B;  1XK4 C;  1YRU B;  3I5G B;  1NWD A;  4ICB A;  4YI8 A;  2JOJ A;  2JXC A;  3BYA A;  3RLZ A;  3F45 A;  5I8N A;  1SMG A;  5D69 A;  1K96 A;  4HSZ A;  3FS7 A;  1MHO A;  1IJ5 A;  1NCZ A;  1VRK A;  2JXL A;  3BUX B;  2KFH A;  4YI9 A;  2DOQ A;  2H61 C;  5I2O A;  1KK7 Z;  1XFZ O;  4HRE E;  3DVM A;  2L0P A;  2KAV A;  4IL1 A;  5DKR A;  2LE9 B;  2LLU A;  2Y1M A;  2LLS A;  5AER A;  2KBM A;  3SJS A;  4YGE B;  1IH0 A;  1ZFS A;  2LHL A;  1N0Y A;  2B1U A;  1OMD A;  2K61 A;  1H4B A;  1TIZ A;  2L5X B;  1PSB A;  3CR2 A;  3SG3 A;  4GGN A;  3KPX A;  2MAZ A;  1TN4 A;  2ZN8 A;  5ER5 A;  1S6I A;  4PE0 A;  4ZCV A;  4GUK A;  1PUL A;  2BL0 B;  4CPV A;  2KI6 D;  2FCE A;  2BCA A;  1CKK A;  5AFP A;  2KI6 C;  2WCE A;  1LA0 A;  4OKH A;  1G8I A;  1R2U A;  1J7O A;  2MLF C;  2BL0 C;  1TOP A;  4MSP A;  5HKY A;  3IF7 A;  5CPV A;  4QJ3 B;  5G08 A;  4E68 A;  2E6W A;  5JOL A;  3EVU A;  3ICB A;  3SIB A;  1SY9 A;  4CFQ A;  1JF0 A;  4M2P A;  4OCI A;  1TNX A;  2LM5 A;  3DF0 A;  2COL B;  1IWQ A;  3OX5 A;  2EC6 C;  1M45 A;  3DVE A;  3O4Y A;  4PHJ A;  2K2A A;  2K7O A;  2LP2 A;  1SW8 A;  3EKJ A;  4ZCU A;  2JWW A;  4R1E A;  2Y5I A;  1XFW O;  1B4C A;  3BXK A;  4JQ0 D;  1SNL A;  4DS7 A;  5KTY A;  1KQM B;  3DVK A;  4GGF C;  3CWG A;  4MRX A;  1WY9 A;  1CFF A;  2JT8 A;  2JNX A;  4FQO A;  3HCM A;  1K8U A;  3CTN A;  1YX7 A;  1FW4 A;  2CXJ A;  3FIA A;  4DIR A;  3A8R A;  1PRW A;  2F3Y A;  3AKA A;  5BPJ A;  1F71 A;  1QV0 A;  3IQO A;  1CMF A;  3TUY B;  1YUT A;  1OQP A;  4ORC B;  5HLO A;  2JT3 A;  4QJ5 B;  3PAL A;  1AJ4 A;  1DJZ A;  2KOT A;  2KFF A;  3K21 A;  3TUY C;  3ZNI A;  2JTT A;  4P2Y B;  1HQV A;  3C1V A;  2I18 A;  2LVJ A;  1BOD A;  2F2O A;  1Y1U A;  1LA3 A;  1LIN A;  1NP8 A;  3EVR A;  3DVJ A;  4XYN A;  5AAN A;  5ER4 X;  1NX2 A;  1CM1 A;  4JWQ A;  4YRU A;  1CNP A;  1V1F A;  2I94 A;  2L4H A;  1IQ5 A;  1REC A;  2JPT A;  2KBI A;  2RGI A;  4HRH A;  1S3P A;  4DCK A;  1SK6 D;  1K93 D;  1L2O B;  1DJH A;  1OZO A;  2LHI A;  3PM8 A;  4JPZ B;  2AAO A;  4DRW A;  3H4S E;  4YGA A;  1CM4 A;  4N1G A;  1L2O C;  1OMV A;  2M1K B;  1F55 A;  3NSI A;  2Q4U A;  3ZWH A;  1MQ1 A;  2M9G A;  5DKQ A;  2ZRS A;  2K7C A;  1DTL A;  1KSM A;  2BE6 A;  2OS8 B;  2O60 A;  3LCP C;  2V53 A;  1ODB A;  1FBV A;  4PHK A;  4WQ3 A;  1J7R A;  4FTG A;  1PSR A;  2CCM A;  3OHM B;  1KSO A;  2ZN9 A;  1GQM A;  5K89 A;  1XFU O;  2SCP A;  2ZKM X;  4WRI A;  1J7P A;  1XYD A;  1UHI A;  4PHN A;  2ISD A;  1WRL A;  1U5I B;  2L51 A;  1D1O A;  5CSJ A;  3D0Y B;  1CB1 A;  1KK8 B;  2NZ0 A;  4NQG A;  4GNK B;  4M2Q A;  2MA2 A;  3WXA A;  2KGR A;  4ORB B;  1SRA A;  3I5I B;  3GOF A;  4MZL A;  4PHM A;  1KK8 C;  2ZNE A;  3SIA A;  2P6B B;  1JC2 A;  5CSN A;  2M7N A;  3KF9 A;  3I5I C;  1GGZ A;  4ORA B;  2M7L A;  3BUN B;  2G2B A;  2KQY A;  1IRJ A;  1IGV A;  4U8D A;  1LKJ A;  4UPG A;  3EK8 A;  4TNC A;  2IS9 A;  1PK0 D;  2CT9 A;  1JWD A;  1JFK A;  5DKN A;  1NX0 A;  1K94 A;  4MEW A;  3HX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...