3TZ1A

Crystal structure of the ca2+-saturated c-terminal domain of akazara scallop troponin c in complex with a troponin i fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LDERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETDTDGSGTVDYEEFKCLMMSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ca2+-saturated C-terminal domain of scallop troponin C in complex with a troponin I fragment
pubmed doi rcsb
source organism Chlamys nipponensis akazara
molecule tags Contractile protein
molecule keywords Troponin C
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tz1A00
1G33A 2LE9B 2OTGB 3SG7A 4PALA 2CBLA 1NX2A 1RROA 5JOLA 1DGVA 1KK8B 4DCKA 2KI4C 3EK4A 5CSNA 2Q4UA 1DF0A 2WOSA 3BOWB 3EK8A 2NCOA 4PE0A 4BY5A 3O6BA 3VRQA 5K89A 2SCPA 4PE7A 4P5OE 1F54A 1CMGA 1PVAA 4YI8A 1NX1A 1MUXA 2M3WA 2WCBA 1BG1A 1XFZO 3SG5A 1PK0D 2KQ6A 3TS5C 1YUTA 2H2KA 3VGOA 1RWYA 1A2XA 2BBNA 2KI6D 3PM8A 1B9AA 3DVKA 1BOCA 1YUSA 3BUMB 1QASA 3NSLA 2MRDA 3JTDB 4M2PA 4FQOA 1J7OA 1SPYA 1KQMC 4CLNA 1OE9B 3JVTB 1SRAA 1NSHA 1NYAA 2KAVA 3IQOA 5IBWA 2K61A 1R6PA 4NDDA 1SBJA 1AK8A 2R2IA 2KBIA 1H8BA 1XFUO 1DJGA 2M1UA 1XFYO 2LUCA 5GQQC 1XFWO 4OV2A 1M63B 2CXJA 1MR8A 2LVJA 4MEWA 1TCOB 2M97A 4C0KA 4R1EA 3TUYC 2LMVA 1NUBA 4BY4A 5KU1A 1B7TY 3QRXA 3OHMB 1NIWA 4QJ5B 2KOTA 1CLBA 3PATA 1UHHA 1J7QA 3BUOB 2D8NA 4YI9A 3SG2A 2JOJA 3C1VA 1LVCD 1ZACA 1RJVA 2WNDA 3O4YA 2ZRTA 2PMYA 1KK7Z 2Y1NA 3EKJA 3OX6A 1B8LA 1SR6B 3E3RA 1DVIA 1KFXS 1WLZA 1EL4A 1S6IA 1DMOA 1J7PA 4WRIA 1LA0A 5AXIA 2WCFA 1AP4A 1S5GY 1EG3A 2KNEA 1AHRA 3DF0A 4GGNA 1TNQA 3BUXB 1QX2A 3DVJA 1XK4C 2K7DA 2B1UA 1K95A 2FOTA 1OZOA 3BUNB 4MVFA 4I5JA 3K21A 4TNCA 1N65A 2JT3A 3CTNA 3GK4X 1WRZA 1MXEA 2LHIA 2JZIA 1KSOA 2MJWB 1IJ5A 3LL8B 1L2OC 2Q91A 1KSMA 3LK0A 3AAKA 4PHMA 1F70A 1FI6A 1AVSA 1RK9A 3I5GC 4ORBB 4XJKA 3GK1A 4GGFA 1CFFA 2ZNDA 1XFXO 1NCYA 2K7BA 1QLKA 4HRGA 1VRKA 1TNXA 1F71A 2BKIB 3KHEA 1ALWA 4AQJA 2BBMA 1JF0A 2JNXA 1M31A 2LP3A 4OCIA 2PVBA 5DKRA 2KGRA 1J1EA 1N2DA 1YVHA 3DVMA 3A4UB 2M8UA 3GK2A 1KFUS 1MQ1A 2PSRA 5DKQA 1Y1XA 5KSZA 1OMDA 1CFCA 2F3YA 2JT8A 3FWBA 4DUQA 1DJYA 2KYFA 3OP0A 1M46A 1KWOC 2TN4A 5ER4X 3PLFB 1XYDA 1B7TZ 3SG6A 3TDZA 3HX4A 2LC5A 3ZWHA 1X02A 1TOPA 4L9MA 1SCMC 3ICBA 1FBVA 1W7IB 3WHUB 1PALA 1S36A 1A75A 3LLEA 4PE4A 3CZTX 3HCMA 5HKZA 1C7VA 1E8AA 1EJ3A 2HETA 3I5HC 2KI6C 1XO5A 2ZNEA 1ODBA 2BL0C 4AQIA 1PSBA 2WORA 1N0YA 1TNWA 1F8HA 4N1FA 1UURA 1QV1A 4N5XA 2H61A 1S26D 1WDCB 2P6BB 2LV7A 3GOFA 1K94A 5CSFA 2EC6B 4MRXA 4ICBA 3PN7C 1LXFC 2A4JA 1K8UA 2LLUA 3NSOA 4YGBB 4QJ3B 2Y1MA 3O78A 4HREE 3SIAA 3I5FC 3I5IB 5PALA 4WQ3A 4D1EA 4GUKA 1WY9A 2ZRSA 1YR5A 3EKHA 2I2RE 2LLTA 4PDZA 4GNKB 1V1FA 1Y1AA 2L4IA 3CGAA 3BXKA 1U5IB 1C7WA 3LCPC 3EVRA 2JQ6A 3DF0B 2K7CA 2MBXA 2K2FA 1TRFA 1SK6D 1FW4A 1LA3A 1EG4A 5I8NA 1NCXA 2NCPA 1PVBA 1QLSA 4I5KA 3RLZA 1SL8A 2L51A 2OTGC 1IGVA 1MHOA 2ZN9A 5BPJA 2KAXA 2BECA 2BCXA 2L50A 1V1GA 1UHJA 2BE6A 2KI4B 2H61C 3EVUA 2LVKA 3FWCA 1PRWA 2K0JA 2F33A 2LMTA 4C0LA 4IL1A 4USLA 2CT9A 1HT9A 4MN0A 2LLSA 1G4YR 2FCDA 1KFUL 1EH2A 1LKJA 2HQWA 1CDMA 2AUCA 3TS5B 1DGUA 3VRNA 1CTRA 1J7RA 4PHJA 1J55A 3CWGA 1JBAA 3F45A 4HRHA 1K2HA 1MWNA 2QACA 3EK7A 4ETOA 2L0PA 2E30A 4M2QA 1XA5A 1KQMB 1K9UA 2IS9A 2NLNA 2OS8B 2LP2A 1PSRA 1HQVA 5ER5A 2JXLA 2MA2A 1DJHA 1OSAA 1KK7Y 4OR9B 1JC2A 1TN4A 3CLNA 1OQPA 3SG4A 1AUIB 3MSEB 3VRRA 3NSIA 4YRUA 2F2OA 1RFJA 2PRUA 3VROA 1IH0A 3VRPA 2O60A 2LUXA 2JTZA 1YVLA 5FYXA 5HYDA 3DD4A 2BKHB 3BYAA 1SL7A 1Y6WA 3CS1A 4MZLA 5JJGA 1DT7B 1CB1A 5AFPA 1DJZA 1NX3A 2NZ0A 2JULA 2HPSA 3H4SE 1GQMA 1Q80A 4PCWA 1IJ6A 4A4CA 1BODA 4MZJA 2FJUB 1UHIA 1GJYA 2LVVA 3TDIA 3RM1A 1Y0VH 1QJTA 1U5IA 4MLWA 2M7LA 4MSPA 4DRWA 4NDBA 3CR5X 2HF5A 5I2OA 1DF0B 3BOWA 2QPTA 4GBAA 4N1GA 4FTGA 2CNPA 1ZOTB 4YGCB 1KK8C 1UUSA 4F0ZB 1NP8A 2GGMA 1ALVA 1BU3A 1M45A 2KSPA 1NCZA 2MLEC 4CIDA 1DJIA 3O2PA 4M2OA 2M29A 1QATA 1DJXA 4MRYA 2BCAA 1XFVO 2M1KB 1G8IA 2K7OA 2LAPA 1S1EA 4C0JA 5HLOA 2G2BA 4OKHA 5KTYA 1MF8B 4GAOA 1K93D 3TDUA 4Q04A 2EHBA 2LVIA 1B47A 3JTDC 1CLMA 1GGZA 3D10A 1MXLC 4GPLB 2JXCA 1QIVA 3JVTC 2KQYA 1GGWA 2KBMA 2KFFA 2MLFC 1B1GA 1SYMA 3I5GB 3SJSA 1SNLA 1BT6A 1CDLA 2KYCA 3KO0A 1CM4A 2ZN8A 5AERA 3BUWB 5CSIA 3DVEA 2KHNA 2LMUA 1ZMZA 1UWOA 4GFTA 1C07A 3FIAA 2I94A 2KAYA 3ZNIA 1JFJA 2M7NA 4JPZB 1QV0A 4P2YB 3TUYB 1UHKA 2PALA 2EGDA 2MAZA 3KEVA 4JQ0D 1S6CA 2K8MB 1FF1A 1TNPA 2AMIA 3WHTB 1L7ZA 1KQVA 1TCFA 1SY9A 2BE4A 1JWDA 1KWOB 2JPTA 1EXRA 2WCEA 2F2PA 2O5GA 4CPVA 1WRKA 2M9GA 1NPQA 3CR2A 1IWQA 2COLB 1WLMA 4I5LB 4PHKA 1TIZA 1SL9A 5D69A 3TZ1A 1JUOA 2L5XB 2ZFDA 4CFQA 3FS7A 1SR6C 1SCVA 1FPWA 1S5GZ 1SMGA 1JSAA 2L98A 1DTLA 3I5HB 4QJ4B 3OX5A 2HQ8A 2NXQA 2BCBA 3OB2B 5I2QA 1QX5B 1YX7A 3AKAA 1YRTB 2JNFA 2MHHA 1YURA 2JT0A 2ZKMX 5AANA 2LHLA 3M0WA 1QX7A 1CFPA 1XVJA 1BJFA 1JF2A 3KF9A 3D0YA 4ZCUA 4A4BA 4ZCVA 1NWDA 2KGBC 1UHNA 4YGEB 1PULA 2FCEA 1K9KA 4YBHB 4YGAA 1OMVA 1F4OA 2GGZA 2M49B 4OVNF 1OMRA 1L2OB 1UP5A 1KCYA 3CR4X 2LANA 1RTP1 1A75B 1CNPA 4DIRA 2L2EA 1J1DA 2RGIA 3SG3A 1S3PA 4MBEA 5CSJA 2DOQA 1KFXL 1CM1A 5I2LA 4CFRA 1NX0A 1CDNA 5TNCA 4AOMA 1YTZC 2V53A 3KPXA 1R2UA 2G9BA 3AAJA 4E68A 2M0RA 3EVVA 4MZKA 1IQ5A 1CFDA 2PASA 1CMFA 1D1OA 2JRFA 1B8CA 4JWQA 2JTTA 1RECA 1K90D 4WQ2A 4I5NB 3PALA 1W7JB 2KFGA 4XYNA 5HKWA 1IKUA 5HLVA 3IF7A 2I18A 1B4CA 1QXPA 2LM5A 1IRJA 1QS7A 1CKKA 2F8PA 1M39A 5D7FA 2JWWA 5G08A 1ZUZA 1A4PA 1OOJA 1CDPA 3OB1B 1SCMB 4XJKB 5DKNA 4UPGA 5F6TA 3BQ3A 1BR4B 1YRUB 2L4HA 5J3XA 1LINA 1OZSA 2GV5A 2KFHA 2LCPA 2Y4QA 2VRGA 1K9PA 4ORCB 1FI5A 2JC2A 5CPVA 2ISDA 2BL0B 3A8RA 1YX8A 5B8IB 1BR1B 3NXAA 1BF5A 1QVIZ 1IQ3A 1B8RA 1SW8A 3SIBA 1A03A 1AJ5A 2OS8C 3PSRA 1BLQA 1SKTA 4PHNA 1WDCC 4ORAB 4GGFC 3PFVA 1IG5A 1JFKA 2CTNA 5AEQA 2EC6C 2Y5IA 3NSKA 1F4QA 3PN7B 1ZFSA 2I7AA 2LNKA 3WNXB 1F55A 1TTXA 1K96A 1YUUA 2JU0A 3WXAA 2SASA 3I5FB 2WC8A 3IQQA 3I5IC 1QTXA 1QIWA 1BMOA 2F3ZA 4HSZA 2CCMA 4YGDB 4DS7A 4U8DA 2AAOA 1A29A 2OPOA 4PE1A 1WRLA 1CLLA 1S6JA 4NDCA 2KDHA 3D0YB 3LK1A 1AJ4A 1XK4A 3AKBA 1H4BA 1DJWA 2K2AA 5HKYA 1QVIY 1Y1UA 2E6WA 4NQGA
chains in the Genus database with same CATH superfamily
1G33A 2LE9B 2OTGB 3SG7A 4PALA 2CBLA 3UNWA 1NX2A 1RROA 5JOLA 1DGVA 1KK8B 1SSEB 4DCKA 2KI4C 2WCJA 3EK4A 5CSNA 2Q4UA 1DF0A 2WOSA 3BOWB 3EK8A 2NCOA 4PE0A 4BY5A 3S0BA 3O6BA 3VRQA 5K89A 2KLDA 2SCPA 4PE7A 3DZTA 4P5OE 1F54A 1CMGA 1PVAA 4YI8A 1NX1A 1MUXA 2M3WA 2WCBA 1BG1A 1XFZO 3SG5A 1PK0D 2KQ6A 3BJHA 3TS5C 1YUTA 2H2KA 3VGOA 1RWYA 1A2XA 2BBNA 2KI6D 3PM8A 1B9AA 3DVKA 1BOCA 1YUSA 3BUMB 1QASA 3NSLA 2MRDA 3JTDB 3RZSA 4M2PA 4FQOA 1J7OA 1SPYA 2KPHA 1KQMC 4CLNA 1OE9B 3JVTB 1SRAA 1NSHA 4JKTA 1NYAA 2KAVA 3IQOA 5IBWA 2K61A 1R6PA 3B87A 4NDDA 1SBJA 1AK8A 2R2IA 2KBIA 1H8BA 1XFUO 1DJGA 2M1UA 1XFYO 2LUCA 5GQQC 1XFWO 4OV2A 1M63B 2CXJA 3OBVA 1MR8A 2LVJA 4MEWA 1TCOB 2M97A 4C0KA 4R1EA 3TUYC 1ORGA 3S0GA 2LMVA 1NUBA 4BY4A 3FE8A 4KYNA 5KU1A 1B7TY 3CABA 3QRXA 3OHMB 1NIWA 5I94A 4QJ5B 2KOTA 3Q8IA 1CLBA 3PATA 1UHHA 3DYEA 3BUOB 1J7QA 1OW4A 2D8NA 4YI9A 3SG2A 2JOJA 3C1VA 1LVCD 1ZACA 1RJVA 2WNDA 3O4YA 2ZRTA 2PMYA 1KK7Z 1W9ZA 2Y1NA 3EKJA 3OX6A 1B8LA 1SR6B 3E3RA 1DVIA 1KFXS 1WLZA 1EL4A 1S6IA 1DMOA 1J7PA 4WRIA 1LA0A 5AXIA 2WCFA 1AP4A 1S5GY 1EG3A 2KNEA 1AHRA 2L5YA 1T14A 3DF0A 4GGNA 1TNQA 3BUXB 1QX2A 3DVJA 1XK4C 2K7DA 2B1UA 1K95A 2FOTA 1OZOA 3BUNB 4MVFA 2BAPA 4I5JA 3K21A 4TNCA 1N65A 3UO9A 2JT3A 3CTNA 1Z2CB 3GK4X 1WRZA 1MXEA 2LHIA 2JZIA 1KSOA 2MJWB 3VB1A 1IJ5A 3BFBA 3LL8B 1L2OC 2Q91A 1KSMA 3LK0A 3AAKA 4PHMA 3DXLA 2QEVA 4INXA 1AVSA 1F70A 1RK9A 1FI6A 3I5GC 2WC5A 4ORBB 4XJKA 3GK1A 4GGFA 1CFFA 2QDIA 3EG5B 2ZNDA 1XFXO 1NCYA 2K7BA 3NHIA 1QLKA 4HRGA 1VRKA 1TNXA 1F71A 2BKIB 3KHEA 1ALWA 3BFHA 2BBMA 4AQJA 1JF0A 2JNXA 1M31A 2LP3A 4OCIA 2PVBA 5DKRA 2KGRA 1J1EA 1N2DA 1YVHA 3DVMA 3A4UB 2M8UA 3GK2A 1KFUS 1MQ1A 2PSRA 3L47A 1Y1XA 2PYQA 1OMDA 3O4XA 5DKQA 2F3YA 2JT8A 3FWBA 4DUQA 1CFCA 1DJYA 2KYFA 3OP0A 1M46A 1KWOC 1OOIX 2TN4A 5ER4X 3PLFB 1XYDA 1B7TZ 3SG6A 3TDZA 3HX4A 2LC5A 3ZWHA 1X02A 1TOPA 4L9MA 1SCMC 3ICBA 1FBVA 1W7IB 3WHUB 1PALA 2BNXA 1S36A 1A75A 3K1EA 3LLEA 4PE4A 3CZTX 3HCMA 5HKZA 1C7VA 1E8AA 1EJ3A 2HETA 3I5HC 2KI6C 1Z4HA 1XO5A 2ZNEA 1ODBA 2BL0C 2WC6A 4AQIA 1PSBA 2WORA 5HL1A 1N0YA 1LS8A 1TNWA 1F8HA 3D74A 4N1FA 1UURA 1DQEA 1QV1A 3N7HA 2H61A 1S26D 1WDCB 2P6BB 3OGNA 2LV7A 3GOFA 4N5XA 3S0EA 1K94A 5CSFA 3DY9A 2EC6B 4MRXA 4ICBA 3PN7C 1LXFC 2A4JA 1K8UA 2LLUA 3NSOA 4YGBB 4QJ3B 2Y1MA 3O78A 4HREE 3SIAA 3I5FC 3I5IB 5PALA 4FQTA 4WQ3A 4D1EA 4GUKA 1WY9A 2ZRSA 1YR5A 3EKHA 2I2RE 2LLTA 4PDZA 1C3ZA 4GNKB 1V1FA 1Y1AA 2L4IA 1DEKA 2QEHA 3CGAA 3BXKA 1U5IB 1C7WA 3LCPC 3D73A 2JQ6A 3DF0B 3EVRA 2K7CA 3D78A 2MBXA 2K2FA 3S0AA 1TRFA 1SK6D 1FW4A 1LA3A 1EG4A 2K60A 5I8NA 4PT1A 1NCXA 5KSZA 2NCPA 1PVBA 1QLSA 4I5KA 3RLZA 1SL8A 2GTEA 2L51A 1IGVA 1MHOA 2OTGC 2ZN9A 3PM2A 2KAXA 2BECA 2BCXA 2L50A 1V1GA 1UHJA 2BE6A 2KI4B 2H61C 3EVUA 2LVKA 3FWCA 3L4AA 1PRWA 2K0JA 4F7FA 2F33A 2QEOA 2LMTA 4C0LA 4IL1A 4USLA 2CT9A 1HT9A 4MN0A 3D76A 2LLSA 1G4YR 2FCDA 1KFUL 3B6XA 1EH2A 1LKJA 2AUCA 1CDMA 2HQWA 3TS5B 1DGUA 3R1OA 3VRNA 1CTRA 1J7RA 4PHJA 1J55A 3CWGA 1JBAA 3F45A 4HRHA 1K2HA 1MWNA 2QACA 3EK7A 4ETOA 2KLEA 2L0PA 2E30A 4M2QA 1XA5A 1KQMB 1K9UA 2IS9A 2NLNA 2OS8B 2LP2A 1PSRA 1HQVA 5ER5A 1TUZA 2JXLA 2MA2A 1DJHA 1OSAA 1KK7Y 2H8VA 4OR9B 1JC2A 1TN4A 3CLNA 2WCLA 1OQPA 3SG4A 1AUIB 3R72A 3MSEB 3VRRA 3NSIA 3CZ0A 2F2OA 4YRUA 1RFJA 2PRUA 3VROA 1IH0A 3VRPA 2O60A 2LUXA 2JTZA 1YVLA 5FYXA 5HYDA 3DD4A 3S0FA 2BKHB 3BYAA 2L2CA 3B7AA 1SL7A 1Y6WA 3CS1A 4MZLA 5JJGA 1TWOA 1DT7B 1CB1A 5AFPA 1DJZA 1NX3A 2NZ0A 2JULA 2HPSA 3H4SE 1GQMA 1Q80A 4PCWA 1IJ6A 4A4CA 3QMEA 1BODA 4MZJA 2FJUB 1UHIA 1GJYA 2JPOA 2LVVA 3TDIA 3RM1A 4INWA 3L4LA 1Y0VH 1QJTA 1U5IA 4MLWA 5BPJA 2M7LA 4MSPA 3SS4A 4DRWA 4NDBA 3CR5X 2HF5A 5I2OA 1DF0B 3BOWA 2QPTA 4GBAA 4N1GA 4FTGA 2CNPA 1ZOTB 4YGCB 1KK8C 1UUSA 4F0ZB 1NP8A 2GGMA 1ALVA 1BU3A 1M45A 2FJYA 1NCZA 2KSPA 2MLEC 4CIDA 1DJIA 3O2PA 4M2OA 2M29A 1QATA 1DJXA 4MRYA 2BCAA 1XFVO 2M1KB 1G8IA 3S0DA 2K7OA 2LAPA 1S1EA 4C0JA 5HLOA 2G2BA 4OKHA 5KTYA 1MF8B 4GAOA 1K93D 3TDUA 4Q04A 2EHBA 2LVIA 1B47A 5D3OA 3CZ1A 3JTDC 2PQLA 1CLMA 1DELA 3IVTA 1GGZA 3D10A 1MXLC 4GPLB 2JXCA 1QIVA 3JVTC 2KQYA 2P70A 1GGWA 2KBMA 2KFFA 2MLFC 1B1GA 1SYMA 3I5GB 3SJSA 1SNLA 1BT6A 1CDLA 2KYCA 3KO0A 1CM4A 2ZN8A 5AERA 1DC1A 5FI7A 3BUWB 5CSIA 3DVEA 2KHNA 2LMUA 1ZMZA 1UWOA 3CZ2A 4GFTA 1C07A 3FIAA 2I94A 3D77A 1C3YA 2KAYA 3ZNIA 3B86A 2M7NA 1JFJA 4JPZB 1QV0A 4P2YB 3TUYB 1UHKA 2PALA 5EL2A 2EGDA 2MAZA 3CDNA 3KEVA 4JQ0D 1S6CA 2K8MB 1FF1A 1TNPA 2AMIA 3WHTB 1L7ZA 1KQVA 1TCFA 1SY9A 2BE4A 1JWDA 1QWVA 1KWOB 2JPTA 1EXRA 2WCEA 2F2PA 2P71A 2O5GA 4CPVA 1WRKA 1OOFA 2M9GA 1NPQA 3BFAA 1IWQA 2COLB 3CR2A 1WLMA 4I5LB 4PHKA 1TIZA 1SL9A 3FE9A 2ERBA 5D69A 3TZ1A 1JUOA 2L5XB 2ZFDA 3PJIA 4CFQA 3FS7A 1SR6C 1SCVA 1FPWA 1S5GZ 1SMGA 3SS5A 1JSAA 3NGVA 4IJ7A 2L98A 1DTLA 3I5HB 1TUJA 4QJ4B 5FI2A 3OX5A 2HQ8A 2NXQA 2BCBA 3OB2B 5I2QA 1QX5B 1YX7A 3AKAA 1YRTB 2JNFA 2MHHA 1YURA 2JT0A 2ZKMX 5AANA 2LHLA 3M0WA 1QX7A 1CFPA 1OOGA 1BJFA 1JF2A 1XVJA 3D0YA 2WCHA 3KF9A 1OOHA 2YGUA 4ZCUA 4A4BA 4ZCVA 1NWDA 2KGBC 1UHNA 2QEBA 4YGEB 1PULA 2FCEA 1K9KA 4YBHB 4YGAA 1OMVA 1F4OA 2GGZA 2M49B 4OVNF 1OMRA 1L2OB 1UP5A 1KCYA 3CR4X 2LANA 1RTP1 1A75B 1CNPA 4DIRA 2L2EA 3R1VA 1J1DA 2RGIA 3SG3A 1S3PA 4MBEA 5CSJA 2DOQA 1KFXL 1CM1A 5I2LA 4CFRA 1NX0A 1CDNA 5TNCA 4AOMA 1YTZC 2V53A 3KPXA 1R2UA 2G9BA 3AAJA 5DICA 4E68A 2M0RA 3EVVA 4MZKA 1IQ5A 1CFDA 2PASA 1CMFA 1D1OA 2JRFA 1B8CA 4JWQA 2JTTA 1RECA 1K90D 4WQ2A 4I5NB 3PALA 1W7JB 2KFGA 4XYNA 5HKWA 1IKUA 5HLVA 3IF7A 2I18A 1B4CA 1QXPA 2LM5A 4OZDA 1IRJA 1QS7A 1CKKA 2F8PA 1M39A 5D7FA 2JWWA 4JD9A 5G08A 1ZUZA 1A4PA 1OOJA 1CDPA 3OB1B 1SCMB 2WCMA 4XJKB 5DKNA 5F6TA 4UPGA 3BQ3A 1BR4B 1YRUB 2L4HA 5J3XA 1LINA 1OZSA 2GV5A 2KFHA 2LCPA 3SS3A 2Y4QA 2VRGA 1K9PA 4ORCB 1FI5A 2JC2A 5CPVA 2ISDA 2BL0B 3A8RA 1GM0A 1XFRA 1YX8A 5B8IB 1BR1B 3FE6A 3NXAA 1QVIZ 3V2LA 1B8RA 1SW8A 3SIBA 1BF5A 1A03A 1IQ3A 1AJ5A 2OS8C 3PSRA 1BLQA 1SKTA 3R1PA 4PHNA 1WDCC 4ORAB 4GGFC 3PFVA 1IG5A 1JFKA 2WCKA 2CTNA 5AEQA 2EC6C 2Y5IA 3NSKA 1F4QA 3PN7B 1ZFSA 2I7AA 2LNKA 3WNXB 1F55A 1TTXA 1K96A 1YUUA 2JU0A 1P28A 3WXAA 2SASA 3I5FB 2WC8A 3IQQA 3I5IC 1QTXA 1QIWA 1BMOA 2F3ZA 4HSZA 2CCMA 4YGDB 4DS7A 4U8DA 2AAOA 1A29A 2OPOA 4PE1A 1WRLA 5FI6A 1CLLA 1S6JA 3NHTA 1IIOA 4NDCA 2KDHA 3CYZA 3D0YB 3LK1A 1AJ4A 3B88A 1XK4A 3AKBA 1H4BA 1DJWA 2K2AA 5HKYA 1QVIY 1Y1UA 2E6WA 4NQGA 3D75A
chains in the Genus database with same CATH topology
1G33A 2LE9B 2OTGB 3SG7A 4PALA 2CBLA 1NX2A 1RROA 5JOLA 1DGVA 1KK8B 4DCKA 2KI4C 3EK4A 5CSNA 2Q4UA 1DF0A 2WOSA 3BOWB 3EK8A 2NCOA 4PE0A 4BY5A 3O6BA 3VRQA 5K89A 2SCPA 4PE7A 4P5OE 1F54A 1CMGA 1PVAA 4YI8A 1NX1A 1MUXA 2M3WA 2WCBA 1BG1A 1XFZO 3SG5A 1PK0D 2KQ6A 3TS5C 1YUTA 2H2KA 3VGOA 1RWYA 1A2XA 2BBNA 2KI6D 3PM8A 1B9AA 3DVKA 1BOCA 1YUSA 3BUMB 1QASA 3NSLA 2MRDA 3JTDB 4M2PA 4FQOA 1J7OA 1SPYA 1KQMC 4CLNA 1OE9B 3JVTB 1SRAA 1NSHA 1NYAA 2KAVA 3IQOA 5IBWA 2K61A 1R6PA 4NDDA 1SBJA 1AK8A 2R2IA 2KBIA 1H8BA 1XFUO 1DJGA 2M1UA 1XFYO 2LUCA 5GQQC 1XFWO 4OV2A 1M63B 2CXJA 1MR8A 2LVJA 4MEWA 1TCOB 2M97A 4C0KA 4R1EA 3TUYC 2LMVA 1NUBA 4BY4A 5KU1A 1B7TY 3QRXA 3OHMB 1NIWA 4QJ5B 2KOTA 1CLBA 3PATA 1UHHA 1J7QA 3BUOB 2D8NA 4YI9A 3SG2A 2JOJA 3C1VA 1LVCD 1ZACA 1RJVA 2WNDA 3O4YA 2ZRTA 2PMYA 1KK7Z 2Y1NA 3EKJA 3OX6A 1B8LA 1SR6B 3E3RA 1DVIA 1KFXS 1WLZA 1EL4A 1S6IA 1DMOA 1J7PA 4WRIA 1LA0A 5AXIA 2WCFA 1AP4A 1S5GY 1EG3A 2KNEA 1AHRA 3DF0A 4GGNA 1TNQA 3BUXB 1QX2A 3DVJA 1XK4C 2K7DA 2B1UA 1K95A 2FOTA 1OZOA 3BUNB 4MVFA 4I5JA 3K21A 4TNCA 1N65A 2JT3A 3CTNA 3GK4X 1WRZA 1MXEA 2LHIA 2JZIA 1KSOA 2MJWB 1IJ5A 3LL8B 1L2OC 2Q91A 1KSMA 3LK0A 3AAKA 4PHMA 1F70A 1FI6A 1AVSA 1RK9A 3I5GC 4ORBB 4XJKA 3GK1A 4GGFA 1CFFA 2ZNDA 1XFXO 1NCYA 2K7BA 1QLKA 4HRGA 1VRKA 1TNXA 1F71A 2BKIB 3KHEA 1ALWA 4AQJA 2BBMA 1JF0A 2JNXA 1M31A 2LP3A 4OCIA 2PVBA 5DKRA 2KGRA 1J1EA 1N2DA 1YVHA 3DVMA 3A4UB 2M8UA 3GK2A 1KFUS 1MQ1A 2PSRA 5DKQA 1Y1XA 5KSZA 1OMDA 1CFCA 2F3YA 2JT8A 3FWBA 4DUQA 1DJYA 2KYFA 3OP0A 1M46A 1KWOC 2TN4A 5ER4X 3PLFB 1XYDA 1B7TZ 3SG6A 3TDZA 3HX4A 2LC5A 3ZWHA 1X02A 1TOPA 4L9MA 1SCMC 3ICBA 1FBVA 1W7IB 3WHUB 1PALA 1S36A 1A75A 3LLEA 4PE4A 3CZTX 3HCMA 5HKZA 1C7VA 1E8AA 1EJ3A 2HETA 3I5HC 2KI6C 1XO5A 2ZNEA 1ODBA 2BL0C 4AQIA 1PSBA 2WORA 1N0YA 1TNWA 1F8HA 4N1FA 1UURA 1QV1A 4N5XA 2H61A 1S26D 1WDCB 2P6BB 2LV7A 3GOFA 1K94A 5CSFA 2EC6B 4MRXA 4ICBA 3PN7C 1LXFC 2A4JA 1K8UA 2LLUA 3NSOA 4YGBB 4QJ3B 2Y1MA 3O78A 4HREE 3SIAA 3I5FC 3I5IB 5PALA 4WQ3A 4D1EA 4GUKA 1WY9A 2ZRSA 1YR5A 3EKHA 2I2RE 2LLTA 4PDZA 4GNKB 1V1FA 1Y1AA 2L4IA 3CGAA 3BXKA 1U5IB 1C7WA 3LCPC 3EVRA 2JQ6A 3DF0B 2K7CA 2MBXA 2K2FA 1TRFA 1SK6D 1FW4A 1LA3A 1EG4A 5I8NA 1NCXA 2NCPA 1PVBA 1QLSA 4I5KA 3RLZA 1SL8A 2L51A 2OTGC 1IGVA 1MHOA 2ZN9A 5BPJA 2KAXA 2BECA 2BCXA 2L50A 1V1GA 1UHJA 2BE6A 2KI4B 2H61C 3EVUA 2LVKA 3FWCA 1PRWA 2K0JA 2F33A 2LMTA 4C0LA 4IL1A 4USLA 2CT9A 1HT9A 4MN0A 2LLSA 1G4YR 2FCDA 1KFUL 1EH2A 1LKJA 2HQWA 1CDMA 2AUCA 3TS5B 1DGUA 3VRNA 1CTRA 1J7RA 4PHJA 1J55A 3CWGA 1JBAA 3F45A 4HRHA 1K2HA 1MWNA 2QACA 3EK7A 4ETOA 2L0PA 2E30A 4M2QA 1XA5A 1KQMB 1K9UA 2IS9A 2NLNA 2OS8B 2LP2A 1PSRA 1HQVA 5ER5A 2JXLA 2MA2A 1DJHA 1OSAA 1KK7Y 4OR9B 1JC2A 1TN4A 3CLNA 1OQPA 3SG4A 1AUIB 3MSEB 3VRRA 3NSIA 4YRUA 2F2OA 1RFJA 2PRUA 3VROA 1IH0A 3VRPA 2O60A 2LUXA 2JTZA 1YVLA 5FYXA 5HYDA 3DD4A 2BKHB 3BYAA 1SL7A 1Y6WA 3CS1A 4MZLA 5JJGA 1DT7B 1CB1A 5AFPA 1DJZA 1NX3A 2NZ0A 2JULA 2HPSA 3H4SE 1GQMA 1Q80A 4PCWA 1IJ6A 4A4CA 1BODA 4MZJA 2FJUB 1UHIA 1GJYA 2LVVA 3TDIA 3RM1A 1Y0VH 1QJTA 1U5IA 4MLWA 2M7LA 4MSPA 4DRWA 4NDBA 3CR5X 2HF5A 5I2OA 1DF0B 3BOWA 2QPTA 4GBAA 4N1GA 4FTGA 2CNPA 1ZOTB 4YGCB 1KK8C 1UUSA 4F0ZB 1NP8A 2GGMA 1ALVA 1BU3A 1M45A 2KSPA 1NCZA 2MLEC 4CIDA 1DJIA 3O2PA 4M2OA 2M29A 1QATA 1DJXA 4MRYA 2BCAA 1XFVO 2M1KB 1G8IA 2K7OA 2LAPA 1S1EA 4C0JA 5HLOA 2G2BA 4OKHA 5KTYA 1MF8B 4GAOA 1K93D 3TDUA 4Q04A 2EHBA 2LVIA 1B47A 3JTDC 1CLMA 1GGZA 3D10A 1MXLC 4GPLB 2JXCA 1QIVA 3JVTC 2KQYA 1GGWA 2KBMA 2KFFA 2MLFC 1B1GA 1SYMA 3I5GB 3SJSA 1SNLA 1BT6A 1CDLA 2KYCA 3KO0A 1CM4A 2ZN8A 5AERA 3BUWB 5CSIA 3DVEA 2KHNA 2LMUA 1ZMZA 1UWOA 4GFTA 1C07A 3FIAA 2I94A 2KAYA 3ZNIA 1JFJA 2M7NA 4JPZB 1QV0A 4P2YB 3TUYB 1UHKA 2PALA 2EGDA 2MAZA 3KEVA 4JQ0D 1S6CA 2K8MB 1FF1A 1TNPA 2AMIA 3WHTB 1L7ZA 1KQVA 1TCFA 1SY9A 2BE4A 1JWDA 1KWOB 2JPTA 1EXRA 2WCEA 2F2PA 2O5GA 4CPVA 1WRKA 2M9GA 1NPQA 3CR2A 1IWQA 2COLB 1WLMA 4I5LB 4PHKA 1TIZA 1SL9A 5D69A 3TZ1A 1JUOA 2L5XB 2ZFDA 4CFQA 3FS7A 1SR6C 1SCVA 1FPWA 1S5GZ 1SMGA 1JSAA 2L98A 1DTLA 3I5HB 4QJ4B 3OX5A 2HQ8A 2NXQA 2BCBA 3OB2B 5I2QA 1QX5B 1YX7A 3AKAA 1YRTB 2JNFA 2MHHA 1YURA 2JT0A 2ZKMX 5AANA 2LHLA 3M0WA 1QX7A 1CFPA 1XVJA 1BJFA 1JF2A 3KF9A 3D0YA 4ZCUA 4A4BA 4ZCVA 1NWDA 2KGBC 1UHNA 4YGEB 1PULA 2FCEA 1K9KA 4YBHB 4YGAA 1OMVA 1F4OA 2GGZA 2M49B 4OVNF 1OMRA 1L2OB 1UP5A 1KCYA 3CR4X 2LANA 1RTP1 1A75B 1CNPA 4DIRA 2L2EA 1J1DA 2RGIA 3SG3A 1S3PA 4MBEA 5CSJA 2DOQA 1KFXL 1CM1A 5I2LA 4CFRA 1NX0A 1CDNA 5TNCA 4AOMA 1YTZC 2V53A 3KPXA 1R2UA 2G9BA 3AAJA 4E68A 2M0RA 3EVVA 4MZKA 1IQ5A 1CFDA 2PASA 1CMFA 1D1OA 2JRFA 1B8CA 4JWQA 2JTTA 1RECA 1K90D 4WQ2A 4I5NB 3PALA 1W7JB 2KFGA 4XYNA 5HKWA 1IKUA 5HLVA 3IF7A 2I18A 1B4CA 1QXPA 2LM5A 1IRJA 1QS7A 1CKKA 2F8PA 1M39A 5D7FA 2JWWA 5G08A 1ZUZA 1A4PA 1OOJA 1CDPA 3OB1B 1SCMB 4XJKB 5DKNA 4UPGA 5F6TA 3BQ3A 1BR4B 1YRUB 2L4HA 5J3XA 1LINA 1OZSA 2GV5A 2KFHA 2LCPA 2Y4QA 2VRGA 1K9PA 4ORCB 1FI5A 2JC2A 5CPVA 2ISDA 2BL0B 3A8RA 1YX8A 5B8IB 1BR1B 3NXAA 1BF5A 1QVIZ 1IQ3A 1B8RA 1SW8A 3SIBA 1A03A 1AJ5A 2OS8C 3PSRA 1BLQA 1SKTA 4PHNA 1WDCC 4ORAB 4GGFC 3PFVA 1IG5A 1JFKA 2CTNA 5AEQA 2EC6C 2Y5IA 3NSKA 1F4QA 3PN7B 1ZFSA 2I7AA 2LNKA 3WNXB 1F55A 1TTXA 1K96A 1YUUA 2JU0A 3WXAA 2SASA 3I5FB 2WC8A 3IQQA 3I5IC 1QTXA 1QIWA 1BMOA 2F3ZA 4HSZA 2CCMA 4YGDB 4DS7A 4U8DA 2AAOA 1A29A 2OPOA 4PE1A 1WRLA 1CLLA 1S6JA 4NDCA 2KDHA 3D0YB 3LK1A 1AJ4A 1XK4A 3AKBA 1H4BA 1DJWA 2K2AA 5HKYA 1QVIY 1Y1UA 2E6WA 4NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G33 A;  2LE9 B;  2OTG B;  3SG7 A;  4PAL A;  2CBL A;  1NX2 A;  1RRO A;  5JOL A;  1DGV A;  1KK8 B;  4DCK A;  2KI4 C;  3EK4 A;  5CSN A;  2Q4U A;  1DF0 A;  2WOS A;  3BOW B;  3EK8 A;  2NCO A;  4PE0 A;  4BY5 A;  3O6B A;  3VRQ A;  5K89 A;  2SCP A;  4PE7 A;  4P5O E;  1F54 A;  1CMG A;  1PVA A;  4YI8 A;  1NX1 A;  1MUX A;  2M3W A;  2WCB A;  1BG1 A;  1XFZ O;  3SG5 A;  1PK0 D;  2KQ6 A;  3TS5 C;  1YUT A;  2H2K A;  3VGO A;  1RWY A;  1A2X A;  2BBN A;  2KI6 D;  3PM8 A;  1B9A A;  3DVK A;  1BOC A;  1YUS A;  3BUM B;  1QAS A;  3NSL A;  2MRD A;  3JTD B;  4M2P A;  4FQO A;  1J7O A;  1SPY A;  1KQM C;  4CLN A;  1OE9 B;  3JVT B;  1SRA A;  1NSH A;  1NYA A;  2KAV A;  3IQO A;  5IBW A;  2K61 A;  1R6P A;  4NDD A;  1SBJ A;  1AK8 A;  2R2I A;  2KBI A;  1H8B A;  1XFU O;  1DJG A;  2M1U A;  1XFY O;  2LUC A;  5GQQ C;  1XFW O;  4OV2 A;  1M63 B;  2CXJ A;  1MR8 A;  2LVJ A;  4MEW A;  1TCO B;  2M97 A;  4C0K A;  4R1E A;  3TUY C;  2LMV A;  1NUB A;  4BY4 A;  5KU1 A;  1B7T Y;  3QRX A;  3OHM B;  1NIW A;  4QJ5 B;  2KOT A;  1CLB A;  3PAT A;  1UHH A;  1J7Q A;  3BUO B;  2D8N A;  4YI9 A;  3SG2 A;  2JOJ A;  3C1V A;  1LVC D;  1ZAC A;  1RJV A;  2WND A;  3O4Y A;  2ZRT A;  2PMY A;  1KK7 Z;  2Y1N A;  3EKJ A;  3OX6 A;  1B8L A;  1SR6 B;  3E3R A;  1DVI A;  1KFX S;  1WLZ A;  1EL4 A;  1S6I A;  1DMO A;  1J7P A;  4WRI A;  1LA0 A;  5AXI A;  2WCF A;  1AP4 A;  1S5G Y;  1EG3 A;  2KNE A;  1AHR A;  3DF0 A;  4GGN A;  1TNQ A;  3BUX B;  1QX2 A;  3DVJ A;  1XK4 C;  2K7D A;  2B1U A;  1K95 A;  2FOT A;  1OZO A;  3BUN B;  4MVF A;  4I5J A;  3K21 A;  4TNC A;  1N65 A;  2JT3 A;  3CTN A;  3GK4 X;  1WRZ A;  1MXE A;  2LHI A;  2JZI A;  1KSO A;  2MJW B;  1IJ5 A;  3LL8 B;  1L2O C;  2Q91 A;  1KSM A;  3LK0 A;  3AAK A;  4PHM A;  1F70 A;  1FI6 A;  1AVS A;  1RK9 A;  3I5G C;  4ORB B;  4XJK A;  3GK1 A;  4GGF A;  1CFF A;  2ZND A;  1XFX O;  1NCY A;  2K7B A;  1QLK A;  4HRG A;  1VRK A;  1TNX A;  1F71 A;  2BKI B;  3KHE A;  1ALW A;  4AQJ A;  2BBM A;  1JF0 A;  2JNX A;  1M31 A;  2LP3 A;  4OCI A;  2PVB A;  5DKR A;  2KGR A;  1J1E A;  1N2D A;  1YVH A;  3DVM A;  3A4U B;  2M8U A;  3GK2 A;  1KFU S;  1MQ1 A;  2PSR A;  5DKQ A;  1Y1X A;  5KSZ A;  1OMD A;  1CFC A;  2F3Y A;  2JT8 A;  3FWB A;  4DUQ A;  1DJY A;  2KYF A;  3OP0 A;  1M46 A;  1KWO C;  2TN4 A;  5ER4 X;  3PLF B;  1XYD A;  1B7T Z;  3SG6 A;  3TDZ A;  3HX4 A;  2LC5 A;  3ZWH A;  1X02 A;  1TOP A;  4L9M A;  1SCM C;  3ICB A;  1FBV A;  1W7I B;  3WHU B;  1PAL A;  1S36 A;  1A75 A;  3LLE A;  4PE4 A;  3CZT X;  3HCM A;  5HKZ A;  1C7V A;  1E8A A;  1EJ3 A;  2HET A;  3I5H C;  2KI6 C;  1XO5 A;  2ZNE A;  1ODB A;  2BL0 C;  4AQI A;  1PSB A;  2WOR A;  1N0Y A;  1TNW A;  1F8H A;  4N1F A;  1UUR A;  1QV1 A;  4N5X A;  2H61 A;  1S26 D;  1WDC B;  2P6B B;  2LV7 A;  3GOF A;  1K94 A;  5CSF A;  2EC6 B;  4MRX A;  4ICB A;  3PN7 C;  1LXF C;  2A4J A;  1K8U A;  2LLU A;  3NSO A;  4YGB B;  4QJ3 B;  2Y1M A;  3O78 A;  4HRE E;  3SIA A;  3I5F C;  3I5I B;  5PAL A;  4WQ3 A;  4D1E A;  4GUK A;  1WY9 A;  2ZRS A;  1YR5 A;  3EKH A;  2I2R E;  2LLT A;  4PDZ A;  4GNK B;  1V1F A;  1Y1A A;  2L4I A;  3CGA A;  3BXK A;  1U5I B;  1C7W A;  3LCP C;  3EVR A;  2JQ6 A;  3DF0 B;  2K7C A;  2MBX A;  2K2F A;  1TRF A;  1SK6 D;  1FW4 A;  1LA3 A;  1EG4 A;  5I8N A;  1NCX A;  2NCP A;  1PVB A;  1QLS A;  4I5K A;  3RLZ A;  1SL8 A;  2L51 A;  2OTG C;  1IGV A;  1MHO A;  2ZN9 A;  5BPJ A;  2KAX A;  2BEC A;  2BCX A;  2L50 A;  1V1G A;  1UHJ A;  2BE6 A;  2KI4 B;  2H61 C;  3EVU A;  2LVK A;  3FWC A;  1PRW A;  2K0J A;  2F33 A;  2LMT A;  4C0L A;  4IL1 A;  4USL A;  2CT9 A;  1HT9 A;  4MN0 A;  2LLS A;  1G4Y R;  2FCD A;  1KFU L;  1EH2 A;  1LKJ A;  2HQW A;  1CDM A;  2AUC A;  3TS5 B;  1DGU A;  3VRN A;  1CTR A;  1J7R A;  4PHJ A;  1J55 A;  3CWG A;  1JBA A;  3F45 A;  4HRH A;  1K2H A;  1MWN A;  2QAC A;  3EK7 A;  4ETO A;  2L0P A;  2E30 A;  4M2Q A;  1XA5 A;  1KQM B;  1K9U A;  2IS9 A;  2NLN A;  2OS8 B;  2LP2 A;  1PSR A;  1HQV A;  5ER5 A;  2JXL A;  2MA2 A;  1DJH A;  1OSA A;  1KK7 Y;  4OR9 B;  1JC2 A;  1TN4 A;  3CLN A;  1OQP A;  3SG4 A;  1AUI B;  3MSE B;  3VRR A;  3NSI A;  4YRU A;  2F2O A;  1RFJ A;  2PRU A;  3VRO A;  1IH0 A;  3VRP A;  2O60 A;  2LUX A;  2JTZ A;  1YVL A;  5FYX A;  5HYD A;  3DD4 A;  2BKH B;  3BYA A;  1SL7 A;  1Y6W A;  3CS1 A;  4MZL A;  5JJG A;  1DT7 B;  1CB1 A;  5AFP A;  1DJZ A;  1NX3 A;  2NZ0 A;  2JUL A;  2HPS A;  3H4S E;  1GQM A;  1Q80 A;  4PCW A;  1IJ6 A;  4A4C A;  1BOD A;  4MZJ A;  2FJU B;  1UHI A;  1GJY A;  2LVV A;  3TDI A;  3RM1 A;  1Y0V H;  1QJT A;  1U5I A;  4MLW A;  2M7L A;  4MSP A;  4DRW A;  4NDB A;  3CR5 X;  2HF5 A;  5I2O A;  1DF0 B;  3BOW A;  2QPT A;  4GBA A;  4N1G A;  4FTG A;  2CNP A;  1ZOT B;  4YGC B;  1KK8 C;  1UUS A;  4F0Z B;  1NP8 A;  2GGM A;  1ALV A;  1BU3 A;  1M45 A;  2KSP A;  1NCZ A;  2MLE C;  4CID A;  1DJI A;  3O2P A;  4M2O A;  2M29 A;  1QAT A;  1DJX A;  4MRY A;  2BCA A;  1XFV O;  2M1K B;  1G8I A;  2K7O A;  2LAP A;  1S1E A;  4C0J A;  5HLO A;  2G2B A;  4OKH A;  5KTY A;  1MF8 B;  4GAO A;  1K93 D;  3TDU A;  4Q04 A;  2EHB A;  2LVI A;  1B47 A;  3JTD C;  1CLM A;  1GGZ A;  3D10 A;  1MXL C;  4GPL B;  2JXC A;  1QIV A;  3JVT C;  2KQY A;  1GGW A;  2KBM A;  2KFF A;  2MLF C;  1B1G A;  1SYM A;  3I5G B;  3SJS A;  1SNL A;  1BT6 A;  1CDL A;  2KYC A;  3KO0 A;  1CM4 A;  2ZN8 A;  5AER A;  3BUW B;  5CSI A;  3DVE A;  2KHN A;  2LMU A;  1ZMZ A;  1UWO A;  4GFT A;  1C07 A;  3FIA A;  2I94 A;  2KAY A;  3ZNI A;  1JFJ A;  2M7N A;  4JPZ B;  1QV0 A;  4P2Y B;  3TUY B;  1UHK A;  2PAL A;  2EGD A;  2MAZ A;  3KEV A;  4JQ0 D;  1S6C A;  2K8M B;  1FF1 A;  1TNP A;  2AMI A;  3WHT B;  1L7Z A;  1KQV A;  1TCF A;  1SY9 A;  2BE4 A;  1JWD A;  1KWO B;  2JPT A;  1EXR A;  2WCE A;  2F2P A;  2O5G A;  4CPV A;  1WRK A;  2M9G A;  1NPQ A;  3CR2 A;  1IWQ A;  2COL B;  1WLM A;  4I5L B;  4PHK A;  1TIZ A;  1SL9 A;  5D69 A;  3TZ1 A;  1JUO A;  2L5X B;  2ZFD A;  4CFQ A;  3FS7 A;  1SR6 C;  1SCV A;  1FPW A;  1S5G Z;  1SMG A;  1JSA A;  2L98 A;  1DTL A;  3I5H B;  4QJ4 B;  3OX5 A;  2HQ8 A;  2NXQ A;  2BCB A;  3OB2 B;  5I2Q A;  1QX5 B;  1YX7 A;  3AKA A;  1YRT B;  2JNF A;  2MHH A;  1YUR A;  2JT0 A;  2ZKM X;  5AAN A;  2LHL A;  3M0W A;  1QX7 A;  1CFP A;  1XVJ A;  1BJF A;  1JF2 A;  3KF9 A;  3D0Y A;  4ZCU A;  4A4B A;  4ZCV A;  1NWD A;  2KGB C;  1UHN A;  4YGE B;  1PUL A;  2FCE A;  1K9K A;  4YBH B;  4YGA A;  1OMV A;  1F4O A;  2GGZ A;  2M49 B;  4OVN F;  1OMR A;  1L2O B;  1UP5 A;  1KCY A;  3CR4 X;  2LAN A;  1RTP 1;  1A75 B;  1CNP A;  4DIR A;  2L2E A;  1J1D A;  2RGI A;  3SG3 A;  1S3P A;  4MBE A;  5CSJ A;  2DOQ A;  1KFX L;  1CM1 A;  5I2L A;  4CFR A;  1NX0 A;  1CDN A;  5TNC A;  4AOM A;  1YTZ C;  2V53 A;  3KPX A;  1R2U A;  2G9B A;  3AAJ A;  4E68 A;  2M0R A;  3EVV A;  4MZK A;  1IQ5 A;  1CFD A;  2PAS A;  1CMF A;  1D1O A;  2JRF A;  1B8C A;  4JWQ A;  2JTT A;  1REC A;  1K90 D;  4WQ2 A;  4I5N B;  3PAL A;  1W7J B;  2KFG A;  4XYN A;  5HKW A;  1IKU A;  5HLV A;  3IF7 A;  2I18 A;  1B4C A;  1QXP A;  2LM5 A;  1IRJ A;  1QS7 A;  1CKK A;  2F8P A;  1M39 A;  5D7F A;  2JWW A;  5G08 A;  1ZUZ A;  1A4P A;  1OOJ A;  1CDP A;  3OB1 B;  1SCM B;  4XJK B;  5DKN A;  4UPG A;  5F6T A;  3BQ3 A;  1BR4 B;  1YRU B;  2L4H A;  5J3X A;  1LIN A;  1OZS A;  2GV5 A;  2KFH A;  2LCP A;  2Y4Q A;  2VRG A;  1K9P A;  4ORC B;  1FI5 A;  2JC2 A;  5CPV A;  2ISD A;  2BL0 B;  3A8R A;  1YX8 A;  5B8I B;  1BR1 B;  3NXA A;  1BF5 A;  1QVI Z;  1IQ3 A;  1B8R A;  1SW8 A;  3SIB A;  1A03 A;  1AJ5 A;  2OS8 C;  3PSR A;  1BLQ A;  1SKT A;  4PHN A;  1WDC C;  4ORA B;  4GGF C;  3PFV A;  1IG5 A;  1JFK A;  2CTN A;  5AEQ A;  2EC6 C;  2Y5I A;  3NSK A;  1F4Q A;  3PN7 B;  1ZFS A;  2I7A A;  2LNK A;  3WNX B;  1F55 A;  1TTX A;  1K96 A;  1YUU A;  2JU0 A;  3WXA A;  2SAS A;  3I5F B;  2WC8 A;  3IQQ A;  3I5I C;  1QTX A;  1QIW A;  1BMO A;  2F3Z A;  4HSZ A;  2CCM A;  4YGD B;  4DS7 A;  4U8D A;  2AAO A;  1A29 A;  2OPO A;  4PE1 A;  1WRL A;  1CLL A;  1S6J A;  4NDC A;  2KDH A;  3D0Y B;  3LK1 A;  1AJ4 A;  1XK4 A;  3AKB A;  1H4B A;  1DJW A;  2K2A A;  5HKY A;  1QVI Y;  1Y1U A;  2E6W A;  4NQG A; 
#chains in the Genus database with same CATH topology
 1G33 A;  2LE9 B;  2OTG B;  3SG7 A;  4PAL A;  2CBL A;  3UNW A;  1NX2 A;  1RRO A;  5JOL A;  1DGV A;  1KK8 B;  1SSE B;  4DCK A;  2KI4 C;  2WCJ A;  3EK4 A;  5CSN A;  2Q4U A;  1DF0 A;  2WOS A;  3BOW B;  3EK8 A;  2NCO A;  4PE0 A;  4BY5 A;  3S0B A;  3O6B A;  3VRQ A;  5K89 A;  2KLD A;  2SCP A;  4PE7 A;  3DZT A;  4P5O E;  1F54 A;  1CMG A;  1PVA A;  4YI8 A;  1NX1 A;  1MUX A;  2M3W A;  2WCB A;  1BG1 A;  1XFZ O;  3SG5 A;  1PK0 D;  2KQ6 A;  3BJH A;  3TS5 C;  1YUT A;  2H2K A;  3VGO A;  1RWY A;  1A2X A;  2BBN A;  2KI6 D;  3PM8 A;  1B9A A;  3DVK A;  1BOC A;  1YUS A;  3BUM B;  1QAS A;  3NSL A;  2MRD A;  3JTD B;  3RZS A;  4M2P A;  4FQO A;  1J7O A;  1SPY A;  2KPH A;  1KQM C;  4CLN A;  1OE9 B;  3JVT B;  1SRA A;  1NSH A;  4JKT A;  1NYA A;  2KAV A;  3IQO A;  5IBW A;  2K61 A;  1R6P A;  3B87 A;  4NDD A;  1SBJ A;  1AK8 A;  2R2I A;  2KBI A;  1H8B A;  1XFU O;  1DJG A;  2M1U A;  1XFY O;  2LUC A;  5GQQ C;  1XFW O;  4OV2 A;  1M63 B;  2CXJ A;  3OBV A;  1MR8 A;  2LVJ A;  4MEW A;  1TCO B;  2M97 A;  4C0K A;  4R1E A;  3TUY C;  1ORG A;  3S0G A;  2LMV A;  1NUB A;  4BY4 A;  3FE8 A;  4KYN A;  5KU1 A;  1B7T Y;  3CAB A;  3QRX A;  3OHM B;  1NIW A;  5I94 A;  4QJ5 B;  2KOT A;  3Q8I A;  1CLB A;  3PAT A;  1UHH A;  3DYE A;  3BUO B;  1J7Q A;  1OW4 A;  2D8N A;  4YI9 A;  3SG2 A;  2JOJ A;  3C1V A;  1LVC D;  1ZAC A;  1RJV A;  2WND A;  3O4Y A;  2ZRT A;  2PMY A;  1KK7 Z;  1W9Z A;  2Y1N A;  3EKJ A;  3OX6 A;  1B8L A;  1SR6 B;  3E3R A;  1DVI A;  1KFX S;  1WLZ A;  1EL4 A;  1S6I A;  1DMO A;  1J7P A;  4WRI A;  1LA0 A;  5AXI A;  2WCF A;  1AP4 A;  1S5G Y;  1EG3 A;  2KNE A;  1AHR A;  2L5Y A;  1T14 A;  3DF0 A;  4GGN A;  1TNQ A;  3BUX B;  1QX2 A;  3DVJ A;  1XK4 C;  2K7D A;  2B1U A;  1K95 A;  2FOT A;  1OZO A;  3BUN B;  4MVF A;  2BAP A;  4I5J A;  3K21 A;  4TNC A;  1N65 A;  3UO9 A;  2JT3 A;  3CTN A;  1Z2C B;  3GK4 X;  1WRZ A;  1MXE A;  2LHI A;  2JZI A;  1KSO A;  2MJW B;  3VB1 A;  1IJ5 A;  3BFB A;  3LL8 B;  1L2O C;  2Q91 A;  1KSM A;  3LK0 A;  3AAK A;  4PHM A;  3DXL A;  2QEV A;  4INX A;  1AVS A;  1F70 A;  1RK9 A;  1FI6 A;  3I5G C;  2WC5 A;  4ORB B;  4XJK A;  3GK1 A;  4GGF A;  1CFF A;  2QDI A;  3EG5 B;  2ZND A;  1XFX O;  1NCY A;  2K7B A;  3NHI A;  1QLK A;  4HRG A;  1VRK A;  1TNX A;  1F71 A;  2BKI B;  3KHE A;  1ALW A;  3BFH A;  2BBM A;  4AQJ A;  1JF0 A;  2JNX A;  1M31 A;  2LP3 A;  4OCI A;  2PVB A;  5DKR A;  2KGR A;  1J1E A;  1N2D A;  1YVH A;  3DVM A;  3A4U B;  2M8U A;  3GK2 A;  1KFU S;  1MQ1 A;  2PSR A;  3L47 A;  1Y1X A;  2PYQ A;  1OMD A;  3O4X A;  5DKQ A;  2F3Y A;  2JT8 A;  3FWB A;  4DUQ A;  1CFC A;  1DJY A;  2KYF A;  3OP0 A;  1M46 A;  1KWO C;  1OOI X;  2TN4 A;  5ER4 X;  3PLF B;  1XYD A;  1B7T Z;  3SG6 A;  3TDZ A;  3HX4 A;  2LC5 A;  3ZWH A;  1X02 A;  1TOP A;  4L9M A;  1SCM C;  3ICB A;  1FBV A;  1W7I B;  3WHU B;  1PAL A;  2BNX A;  1S36 A;  1A75 A;  3K1E A;  3LLE A;  4PE4 A;  3CZT X;  3HCM A;  5HKZ A;  1C7V A;  1E8A A;  1EJ3 A;  2HET A;  3I5H C;  2KI6 C;  1Z4H A;  1XO5 A;  2ZNE A;  1ODB A;  2BL0 C;  2WC6 A;  4AQI A;  1PSB A;  2WOR A;  5HL1 A;  1N0Y A;  1LS8 A;  1TNW A;  1F8H A;  3D74 A;  4N1F A;  1UUR A;  1DQE A;  1QV1 A;  3N7H A;  2H61 A;  1S26 D;  1WDC B;  2P6B B;  3OGN A;  2LV7 A;  3GOF A;  4N5X A;  3S0E A;  1K94 A;  5CSF A;  3DY9 A;  2EC6 B;  4MRX A;  4ICB A;  3PN7 C;  1LXF C;  2A4J A;  1K8U A;  2LLU A;  3NSO A;  4YGB B;  4QJ3 B;  2Y1M A;  3O78 A;  4HRE E;  3SIA A;  3I5F C;  3I5I B;  5PAL A;  4FQT A;  4WQ3 A;  4D1E A;  4GUK A;  1WY9 A;  2ZRS A;  1YR5 A;  3EKH A;  2I2R E;  2LLT A;  4PDZ A;  1C3Z A;  4GNK B;  1V1F A;  1Y1A A;  2L4I A;  1DEK A;  2QEH A;  3CGA A;  3BXK A;  1U5I B;  1C7W A;  3LCP C;  3D73 A;  2JQ6 A;  3DF0 B;  3EVR A;  2K7C A;  3D78 A;  2MBX A;  2K2F A;  3S0A A;  1TRF A;  1SK6 D;  1FW4 A;  1LA3 A;  1EG4 A;  2K60 A;  5I8N A;  4PT1 A;  1NCX A;  5KSZ A;  2NCP A;  1PVB A;  1QLS A;  4I5K A;  3RLZ A;  1SL8 A;  2GTE A;  2L51 A;  1IGV A;  1MHO A;  2OTG C;  2ZN9 A;  3PM2 A;  2KAX A;  2BEC A;  2BCX A;  2L50 A;  1V1G A;  1UHJ A;  2BE6 A;  2KI4 B;  2H61 C;  3EVU A;  2LVK A;  3FWC A;  3L4A A;  1PRW A;  2K0J A;  4F7F A;  2F33 A;  2QEO A;  2LMT A;  4C0L A;  4IL1 A;  4USL A;  2CT9 A;  1HT9 A;  4MN0 A;  3D76 A;  2LLS A;  1G4Y R;  2FCD A;  1KFU L;  3B6X A;  1EH2 A;  1LKJ A;  2AUC A;  1CDM A;  2HQW A;  3TS5 B;  1DGU A;  3R1O A;  3VRN A;  1CTR A;  1J7R A;  4PHJ A;  1J55 A;  3CWG A;  1JBA A;  3F45 A;  4HRH A;  1K2H A;  1MWN A;  2QAC A;  3EK7 A;  4ETO A;  2KLE A;  2L0P A;  2E30 A;  4M2Q A;  1XA5 A;  1KQM B;  1K9U A;  2IS9 A;  2NLN A;  2OS8 B;  2LP2 A;  1PSR A;  1HQV A;  5ER5 A;  1TUZ A;  2JXL A;  2MA2 A;  1DJH A;  1OSA A;  1KK7 Y;  2H8V A;  4OR9 B;  1JC2 A;  1TN4 A;  3CLN A;  2WCL A;  1OQP A;  3SG4 A;  1AUI B;  3R72 A;  3MSE B;  3VRR A;  3NSI A;  3CZ0 A;  2F2O A;  4YRU A;  1RFJ A;  2PRU A;  3VRO A;  1IH0 A;  3VRP A;  2O60 A;  2LUX A;  2JTZ A;  1YVL A;  5FYX A;  5HYD A;  3DD4 A;  3S0F A;  2BKH B;  3BYA A;  2L2C A;  3B7A A;  1SL7 A;  1Y6W A;  3CS1 A;  4MZL A;  5JJG A;  1TWO A;  1DT7 B;  1CB1 A;  5AFP A;  1DJZ A;  1NX3 A;  2NZ0 A;  2JUL A;  2HPS A;  3H4S E;  1GQM A;  1Q80 A;  4PCW A;  1IJ6 A;  4A4C A;  3QME A;  1BOD A;  4MZJ A;  2FJU B;  1UHI A;  1GJY A;  2JPO A;  2LVV A;  3TDI A;  3RM1 A;  4INW A;  3L4L A;  1Y0V H;  1QJT A;  1U5I A;  4MLW A;  5BPJ A;  2M7L A;  4MSP A;  3SS4 A;  4DRW A;  4NDB A;  3CR5 X;  2HF5 A;  5I2O A;  1DF0 B;  3BOW A;  2QPT A;  4GBA A;  4N1G A;  4FTG A;  2CNP A;  1ZOT B;  4YGC B;  1KK8 C;  1UUS A;  4F0Z B;  1NP8 A;  2GGM A;  1ALV A;  1BU3 A;  1M45 A;  2FJY A;  1NCZ A;  2KSP A;  2MLE C;  4CID A;  1DJI A;  3O2P A;  4M2O A;  2M29 A;  1QAT A;  1DJX A;  4MRY A;  2BCA A;  1XFV O;  2M1K B;  1G8I A;  3S0D A;  2K7O A;  2LAP A;  1S1E A;  4C0J A;  5HLO A;  2G2B A;  4OKH A;  5KTY A;  1MF8 B;  4GAO A;  1K93 D;  3TDU A;  4Q04 A;  2EHB A;  2LVI A;  1B47 A;  5D3O A;  3CZ1 A;  3JTD C;  2PQL A;  1CLM A;  1DEL A;  3IVT A;  1GGZ A;  3D10 A;  1MXL C;  4GPL B;  2JXC A;  1QIV A;  3JVT C;  2KQY A;  2P70 A;  1GGW A;  2KBM A;  2KFF A;  2MLF C;  1B1G A;  1SYM A;  3I5G B;  3SJS A;  1SNL A;  1BT6 A;  1CDL A;  2KYC A;  3KO0 A;  1CM4 A;  2ZN8 A;  5AER A;  1DC1 A;  5FI7 A;  3BUW B;  5CSI A;  3DVE A;  2KHN A;  2LMU A;  1ZMZ A;  1UWO A;  3CZ2 A;  4GFT A;  1C07 A;  3FIA A;  2I94 A;  3D77 A;  1C3Y A;  2KAY A;  3ZNI A;  3B86 A;  2M7N A;  1JFJ A;  4JPZ B;  1QV0 A;  4P2Y B;  3TUY B;  1UHK A;  2PAL A;  5EL2 A;  2EGD A;  2MAZ A;  3CDN A;  3KEV A;  4JQ0 D;  1S6C A;  2K8M B;  1FF1 A;  1TNP A;  2AMI A;  3WHT B;  1L7Z A;  1KQV A;  1TCF A;  1SY9 A;  2BE4 A;  1JWD A;  1QWV A;  1KWO B;  2JPT A;  1EXR A;  2WCE A;  2F2P A;  2P71 A;  2O5G A;  4CPV A;  1WRK A;  1OOF A;  2M9G A;  1NPQ A;  3BFA A;  1IWQ A;  2COL B;  3CR2 A;  1WLM A;  4I5L B;  4PHK A;  1TIZ A;  1SL9 A;  3FE9 A;  2ERB A;  5D69 A;  3TZ1 A;  1JUO A;  2L5X B;  2ZFD A;  3PJI A;  4CFQ A;  3FS7 A;  1SR6 C;  1SCV A;  1FPW A;  1S5G Z;  1SMG A;  3SS5 A;  1JSA A;  3NGV A;  4IJ7 A;  2L98 A;  1DTL A;  3I5H B;  1TUJ A;  4QJ4 B;  5FI2 A;  3OX5 A;  2HQ8 A;  2NXQ A;  2BCB A;  3OB2 B;  5I2Q A;  1QX5 B;  1YX7 A;  3AKA A;  1YRT B;  2JNF A;  2MHH A;  1YUR A;  2JT0 A;  2ZKM X;  5AAN A;  2LHL A;  3M0W A;  1QX7 A;  1CFP A;  1OOG A;  1BJF A;  1JF2 A;  1XVJ A;  3D0Y A;  2WCH A;  3KF9 A;  1OOH A;  2YGU A;  4ZCU A;  4A4B A;  4ZCV A;  1NWD A;  2KGB C;  1UHN A;  2QEB A;  4YGE B;  1PUL A;  2FCE A;  1K9K A;  4YBH B;  4YGA A;  1OMV A;  1F4O A;  2GGZ A;  2M49 B;  4OVN F;  1OMR A;  1L2O B;  1UP5 A;  1KCY A;  3CR4 X;  2LAN A;  1RTP 1;  1A75 B;  1CNP A;  4DIR A;  2L2E A;  3R1V A;  1J1D A;  2RGI A;  3SG3 A;  1S3P A;  4MBE A;  5CSJ A;  2DOQ A;  1KFX L;  1CM1 A;  5I2L A;  4CFR A;  1NX0 A;  1CDN A;  5TNC A;  4AOM A;  1YTZ C;  2V53 A;  3KPX A;  1R2U A;  2G9B A;  3AAJ A;  5DIC A;  4E68 A;  2M0R A;  3EVV A;  4MZK A;  1IQ5 A;  1CFD A;  2PAS A;  1CMF A;  1D1O A;  2JRF A;  1B8C A;  4JWQ A;  2JTT A;  1REC A;  1K90 D;  4WQ2 A;  4I5N B;  3PAL A;  1W7J B;  2KFG A;  4XYN A;  5HKW A;  1IKU A;  5HLV A;  3IF7 A;  2I18 A;  1B4C A;  1QXP A;  2LM5 A;  4OZD A;  1IRJ A;  1QS7 A;  1CKK A;  2F8P A;  1M39 A;  5D7F A;  2JWW A;  4JD9 A;  5G08 A;  1ZUZ A;  1A4P A;  1OOJ A;  1CDP A;  3OB1 B;  1SCM B;  2WCM A;  4XJK B;  5DKN A;  5F6T A;  4UPG A;  3BQ3 A;  1BR4 B;  1YRU B;  2L4H A;  5J3X A;  1LIN A;  1OZS A;  2GV5 A;  2KFH A;  2LCP A;  3SS3 A;  2Y4Q A;  2VRG A;  1K9P A;  4ORC B;  1FI5 A;  2JC2 A;  5CPV A;  2ISD A;  2BL0 B;  3A8R A;  1GM0 A;  1XFR A;  1YX8 A;  5B8I B;  1BR1 B;  3FE6 A;  3NXA A;  1QVI Z;  3V2L A;  1B8R A;  1SW8 A;  3SIB A;  1BF5 A;  1A03 A;  1IQ3 A;  1AJ5 A;  2OS8 C;  3PSR A;  1BLQ A;  1SKT A;  3R1P A;  4PHN A;  1WDC C;  4ORA B;  4GGF C;  3PFV A;  1IG5 A;  1JFK A;  2WCK A;  2CTN A;  5AEQ A;  2EC6 C;  2Y5I A;  3NSK A;  1F4Q A;  3PN7 B;  1ZFS A;  2I7A A;  2LNK A;  3WNX B;  1F55 A;  1TTX A;  1K96 A;  1YUU A;  2JU0 A;  1P28 A;  3WXA A;  2SAS A;  3I5F B;  2WC8 A;  3IQQ A;  3I5I C;  1QTX A;  1QIW A;  1BMO A;  2F3Z A;  4HSZ A;  2CCM A;  4YGD B;  4DS7 A;  4U8D A;  2AAO A;  1A29 A;  2OPO A;  4PE1 A;  1WRL A;  5FI6 A;  1CLL A;  1S6J A;  3NHT A;  1IIO A;  4NDC A;  2KDH A;  3CYZ A;  3D0Y B;  3LK1 A;  1AJ4 A;  3B88 A;  1XK4 A;  3AKB A;  1H4B A;  1DJW A;  2K2A A;  5HKY A;  1QVI Y;  1Y1U A;  2E6W A;  4NQG A;  3D75 A; 
#chains in the Genus database with same CATH homology
 1G33 A;  2LE9 B;  2OTG B;  3SG7 A;  4PAL A;  2CBL A;  1NX2 A;  1RRO A;  5JOL A;  1DGV A;  1KK8 B;  4DCK A;  2KI4 C;  3EK4 A;  5CSN A;  2Q4U A;  1DF0 A;  2WOS A;  3BOW B;  3EK8 A;  2NCO A;  4PE0 A;  4BY5 A;  3O6B A;  3VRQ A;  5K89 A;  2SCP A;  4PE7 A;  4P5O E;  1F54 A;  1CMG A;  1PVA A;  4YI8 A;  1NX1 A;  1MUX A;  2M3W A;  2WCB A;  1BG1 A;  1XFZ O;  3SG5 A;  1PK0 D;  2KQ6 A;  3TS5 C;  1YUT A;  2H2K A;  3VGO A;  1RWY A;  1A2X A;  2BBN A;  2KI6 D;  3PM8 A;  1B9A A;  3DVK A;  1BOC A;  1YUS A;  3BUM B;  1QAS A;  3NSL A;  2MRD A;  3JTD B;  4M2P A;  4FQO A;  1J7O A;  1SPY A;  1KQM C;  4CLN A;  1OE9 B;  3JVT B;  1SRA A;  1NSH A;  1NYA A;  2KAV A;  3IQO A;  5IBW A;  2K61 A;  1R6P A;  4NDD A;  1SBJ A;  1AK8 A;  2R2I A;  2KBI A;  1H8B A;  1XFU O;  1DJG A;  2M1U A;  1XFY O;  2LUC A;  5GQQ C;  1XFW O;  4OV2 A;  1M63 B;  2CXJ A;  1MR8 A;  2LVJ A;  4MEW A;  1TCO B;  2M97 A;  4C0K A;  4R1E A;  3TUY C;  2LMV A;  1NUB A;  4BY4 A;  5KU1 A;  1B7T Y;  3QRX A;  3OHM B;  1NIW A;  4QJ5 B;  2KOT A;  1CLB A;  3PAT A;  1UHH A;  1J7Q A;  3BUO B;  2D8N A;  4YI9 A;  3SG2 A;  2JOJ A;  3C1V A;  1LVC D;  1ZAC A;  1RJV A;  2WND A;  3O4Y A;  2ZRT A;  2PMY A;  1KK7 Z;  2Y1N A;  3EKJ A;  3OX6 A;  1B8L A;  1SR6 B;  3E3R A;  1DVI A;  1KFX S;  1WLZ A;  1EL4 A;  1S6I A;  1DMO A;  1J7P A;  4WRI A;  1LA0 A;  5AXI A;  2WCF A;  1AP4 A;  1S5G Y;  1EG3 A;  2KNE A;  1AHR A;  3DF0 A;  4GGN A;  1TNQ A;  3BUX B;  1QX2 A;  3DVJ A;  1XK4 C;  2K7D A;  2B1U A;  1K95 A;  2FOT A;  1OZO A;  3BUN B;  4MVF A;  4I5J A;  3K21 A;  4TNC A;  1N65 A;  2JT3 A;  3CTN A;  3GK4 X;  1WRZ A;  1MXE A;  2LHI A;  2JZI A;  1KSO A;  2MJW B;  1IJ5 A;  3LL8 B;  1L2O C;  2Q91 A;  1KSM A;  3LK0 A;  3AAK A;  4PHM A;  1F70 A;  1FI6 A;  1AVS A;  1RK9 A;  3I5G C;  4ORB B;  4XJK A;  3GK1 A;  4GGF A;  1CFF A;  2ZND A;  1XFX O;  1NCY A;  2K7B A;  1QLK A;  4HRG A;  1VRK A;  1TNX A;  1F71 A;  2BKI B;  3KHE A;  1ALW A;  4AQJ A;  2BBM A;  1JF0 A;  2JNX A;  1M31 A;  2LP3 A;  4OCI A;  2PVB A;  5DKR A;  2KGR A;  1J1E A;  1N2D A;  1YVH A;  3DVM A;  3A4U B;  2M8U A;  3GK2 A;  1KFU S;  1MQ1 A;  2PSR A;  5DKQ A;  1Y1X A;  5KSZ A;  1OMD A;  1CFC A;  2F3Y A;  2JT8 A;  3FWB A;  4DUQ A;  1DJY A;  2KYF A;  3OP0 A;  1M46 A;  1KWO C;  2TN4 A;  5ER4 X;  3PLF B;  1XYD A;  1B7T Z;  3SG6 A;  3TDZ A;  3HX4 A;  2LC5 A;  3ZWH A;  1X02 A;  1TOP A;  4L9M A;  1SCM C;  3ICB A;  1FBV A;  1W7I B;  3WHU B;  1PAL A;  1S36 A;  1A75 A;  3LLE A;  4PE4 A;  3CZT X;  3HCM A;  5HKZ A;  1C7V A;  1E8A A;  1EJ3 A;  2HET A;  3I5H C;  2KI6 C;  1XO5 A;  2ZNE A;  1ODB A;  2BL0 C;  4AQI A;  1PSB A;  2WOR A;  1N0Y A;  1TNW A;  1F8H A;  4N1F A;  1UUR A;  1QV1 A;  4N5X A;  2H61 A;  1S26 D;  1WDC B;  2P6B B;  2LV7 A;  3GOF A;  1K94 A;  5CSF A;  2EC6 B;  4MRX A;  4ICB A;  3PN7 C;  1LXF C;  2A4J A;  1K8U A;  2LLU A;  3NSO A;  4YGB B;  4QJ3 B;  2Y1M A;  3O78 A;  4HRE E;  3SIA A;  3I5F C;  3I5I B;  5PAL A;  4WQ3 A;  4D1E A;  4GUK A;  1WY9 A;  2ZRS A;  1YR5 A;  3EKH A;  2I2R E;  2LLT A;  4PDZ A;  4GNK B;  1V1F A;  1Y1A A;  2L4I A;  3CGA A;  3BXK A;  1U5I B;  1C7W A;  3LCP C;  3EVR A;  2JQ6 A;  3DF0 B;  2K7C A;  2MBX A;  2K2F A;  1TRF A;  1SK6 D;  1FW4 A;  1LA3 A;  1EG4 A;  5I8N A;  1NCX A;  2NCP A;  1PVB A;  1QLS A;  4I5K A;  3RLZ A;  1SL8 A;  2L51 A;  2OTG C;  1IGV A;  1MHO A;  2ZN9 A;  5BPJ A;  2KAX A;  2BEC A;  2BCX A;  2L50 A;  1V1G A;  1UHJ A;  2BE6 A;  2KI4 B;  2H61 C;  3EVU A;  2LVK A;  3FWC A;  1PRW A;  2K0J A;  2F33 A;  2LMT A;  4C0L A;  4IL1 A;  4USL A;  2CT9 A;  1HT9 A;  4MN0 A;  2LLS A;  1G4Y R;  2FCD A;  1KFU L;  1EH2 A;  1LKJ A;  2HQW A;  1CDM A;  2AUC A;  3TS5 B;  1DGU A;  3VRN A;  1CTR A;  1J7R A;  4PHJ A;  1J55 A;  3CWG A;  1JBA A;  3F45 A;  4HRH A;  1K2H A;  1MWN A;  2QAC A;  3EK7 A;  4ETO A;  2L0P A;  2E30 A;  4M2Q A;  1XA5 A;  1KQM B;  1K9U A;  2IS9 A;  2NLN A;  2OS8 B;  2LP2 A;  1PSR A;  1HQV A;  5ER5 A;  2JXL A;  2MA2 A;  1DJH A;  1OSA A;  1KK7 Y;  4OR9 B;  1JC2 A;  1TN4 A;  3CLN A;  1OQP A;  3SG4 A;  1AUI B;  3MSE B;  3VRR A;  3NSI A;  4YRU A;  2F2O A;  1RFJ A;  2PRU A;  3VRO A;  1IH0 A;  3VRP A;  2O60 A;  2LUX A;  2JTZ A;  1YVL A;  5FYX A;  5HYD A;  3DD4 A;  2BKH B;  3BYA A;  1SL7 A;  1Y6W A;  3CS1 A;  4MZL A;  5JJG A;  1DT7 B;  1CB1 A;  5AFP A;  1DJZ A;  1NX3 A;  2NZ0 A;  2JUL A;  2HPS A;  3H4S E;  1GQM A;  1Q80 A;  4PCW A;  1IJ6 A;  4A4C A;  1BOD A;  4MZJ A;  2FJU B;  1UHI A;  1GJY A;  2LVV A;  3TDI A;  3RM1 A;  1Y0V H;  1QJT A;  1U5I A;  4MLW A;  2M7L A;  4MSP A;  4DRW A;  4NDB A;  3CR5 X;  2HF5 A;  5I2O A;  1DF0 B;  3BOW A;  2QPT A;  4GBA A;  4N1G A;  4FTG A;  2CNP A;  1ZOT B;  4YGC B;  1KK8 C;  1UUS A;  4F0Z B;  1NP8 A;  2GGM A;  1ALV A;  1BU3 A;  1M45 A;  2KSP A;  1NCZ A;  2MLE C;  4CID A;  1DJI A;  3O2P A;  4M2O A;  2M29 A;  1QAT A;  1DJX A;  4MRY A;  2BCA A;  1XFV O;  2M1K B;  1G8I A;  2K7O A;  2LAP A;  1S1E A;  4C0J A;  5HLO A;  2G2B A;  4OKH A;  5KTY A;  1MF8 B;  4GAO A;  1K93 D;  3TDU A;  4Q04 A;  2EHB A;  2LVI A;  1B47 A;  3JTD C;  1CLM A;  1GGZ A;  3D10 A;  1MXL C;  4GPL B;  2JXC A;  1QIV A;  3JVT C;  2KQY A;  1GGW A;  2KBM A;  2KFF A;  2MLF C;  1B1G A;  1SYM A;  3I5G B;  3SJS A;  1SNL A;  1BT6 A;  1CDL A;  2KYC A;  3KO0 A;  1CM4 A;  2ZN8 A;  5AER A;  3BUW B;  5CSI A;  3DVE A;  2KHN A;  2LMU A;  1ZMZ A;  1UWO A;  4GFT A;  1C07 A;  3FIA A;  2I94 A;  2KAY A;  3ZNI A;  1JFJ A;  2M7N A;  4JPZ B;  1QV0 A;  4P2Y B;  3TUY B;  1UHK A;  2PAL A;  2EGD A;  2MAZ A;  3KEV A;  4JQ0 D;  1S6C A;  2K8M B;  1FF1 A;  1TNP A;  2AMI A;  3WHT B;  1L7Z A;  1KQV A;  1TCF A;  1SY9 A;  2BE4 A;  1JWD A;  1KWO B;  2JPT A;  1EXR A;  2WCE A;  2F2P A;  2O5G A;  4CPV A;  1WRK A;  2M9G A;  1NPQ A;  3CR2 A;  1IWQ A;  2COL B;  1WLM A;  4I5L B;  4PHK A;  1TIZ A;  1SL9 A;  5D69 A;  3TZ1 A;  1JUO A;  2L5X B;  2ZFD A;  4CFQ A;  3FS7 A;  1SR6 C;  1SCV A;  1FPW A;  1S5G Z;  1SMG A;  1JSA A;  2L98 A;  1DTL A;  3I5H B;  4QJ4 B;  3OX5 A;  2HQ8 A;  2NXQ A;  2BCB A;  3OB2 B;  5I2Q A;  1QX5 B;  1YX7 A;  3AKA A;  1YRT B;  2JNF A;  2MHH A;  1YUR A;  2JT0 A;  2ZKM X;  5AAN A;  2LHL A;  3M0W A;  1QX7 A;  1CFP A;  1XVJ A;  1BJF A;  1JF2 A;  3KF9 A;  3D0Y A;  4ZCU A;  4A4B A;  4ZCV A;  1NWD A;  2KGB C;  1UHN A;  4YGE B;  1PUL A;  2FCE A;  1K9K A;  4YBH B;  4YGA A;  1OMV A;  1F4O A;  2GGZ A;  2M49 B;  4OVN F;  1OMR A;  1L2O B;  1UP5 A;  1KCY A;  3CR4 X;  2LAN A;  1RTP 1;  1A75 B;  1CNP A;  4DIR A;  2L2E A;  1J1D A;  2RGI A;  3SG3 A;  1S3P A;  4MBE A;  5CSJ A;  2DOQ A;  1KFX L;  1CM1 A;  5I2L A;  4CFR A;  1NX0 A;  1CDN A;  5TNC A;  4AOM A;  1YTZ C;  2V53 A;  3KPX A;  1R2U A;  2G9B A;  3AAJ A;  4E68 A;  2M0R A;  3EVV A;  4MZK A;  1IQ5 A;  1CFD A;  2PAS A;  1CMF A;  1D1O A;  2JRF A;  1B8C A;  4JWQ A;  2JTT A;  1REC A;  1K90 D;  4WQ2 A;  4I5N B;  3PAL A;  1W7J B;  2KFG A;  4XYN A;  5HKW A;  1IKU A;  5HLV A;  3IF7 A;  2I18 A;  1B4C A;  1QXP A;  2LM5 A;  1IRJ A;  1QS7 A;  1CKK A;  2F8P A;  1M39 A;  5D7F A;  2JWW A;  5G08 A;  1ZUZ A;  1A4P A;  1OOJ A;  1CDP A;  3OB1 B;  1SCM B;  4XJK B;  5DKN A;  4UPG A;  5F6T A;  3BQ3 A;  1BR4 B;  1YRU B;  2L4H A;  5J3X A;  1LIN A;  1OZS A;  2GV5 A;  2KFH A;  2LCP A;  2Y4Q A;  2VRG A;  1K9P A;  4ORC B;  1FI5 A;  2JC2 A;  5CPV A;  2ISD A;  2BL0 B;  3A8R A;  1YX8 A;  5B8I B;  1BR1 B;  3NXA A;  1BF5 A;  1QVI Z;  1IQ3 A;  1B8R A;  1SW8 A;  3SIB A;  1A03 A;  1AJ5 A;  2OS8 C;  3PSR A;  1BLQ A;  1SKT A;  4PHN A;  1WDC C;  4ORA B;  4GGF C;  3PFV A;  1IG5 A;  1JFK A;  2CTN A;  5AEQ A;  2EC6 C;  2Y5I A;  3NSK A;  1F4Q A;  3PN7 B;  1ZFS A;  2I7A A;  2LNK A;  3WNX B;  1F55 A;  1TTX A;  1K96 A;  1YUU A;  2JU0 A;  3WXA A;  2SAS A;  3I5F B;  2WC8 A;  3IQQ A;  3I5I C;  1QTX A;  1QIW A;  1BMO A;  2F3Z A;  4HSZ A;  2CCM A;  4YGD B;  4DS7 A;  4U8D A;  2AAO A;  1A29 A;  2OPO A;  4PE1 A;  1WRL A;  1CLL A;  1S6J A;  4NDC A;  2KDH A;  3D0Y B;  3LK1 A;  1AJ4 A;  1XK4 A;  3AKB A;  1H4B A;  1DJW A;  2K2A A;  5HKY A;  1QVI Y;  1Y1U A;  2E6W A;  4NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...