3TZ1A

Crystal structure of the ca2+-saturated c-terminal domain of akazara scallop troponin c in complex with a troponin i fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LDERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETDTDGSGTVDYEEFKCLMMSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C
publication title Structure of the Ca2+-saturated C-terminal domain of scallop troponin C in complex with a troponin I fragment
pubmed doi rcsb
source organism Chlamys nipponensis akazara
molecule tags Contractile protein
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tz1A00
1YR5A 1RJVA 4PHKA 5CSIA 2H61A 4FQOA 1YX8A 4GGFA 4MZKA 2CNPA 1SY9A 1S5GZ 2M9GA 2OPOA 3A8RA 4YI9A 1CDNA 1CFDA 2JQ6A 1K95A 1R2UA 1RFJA 1Y0VH 1YVHA 2M8UA 3A4UB 1K9PA 3BUOB 3NSLA 1CM4A 1RTP1 1WY9A 1JC2A 1J1DA 3EVRA 1OMVA 2KFGA 1G8IA 1SW8A 3AKAA 4WRIA 1IH0A 3VRRA 3BOWA 5B8IB 1QLKA 4I5NB 1MUXA 1SCMB 2JTTA 2EC6B 3EVUA 2M97A 2WORA 3PLFB 2NZ0A 1M39A 2I18A 4UPGA 1KK8B 1DF0B 1SR6B 1QX2A 4WQ3A 1MR8A 1SCMC 3SG7A 3DVMA 2EC6C 2K7DA 1FW4A 2LLSA 1DJIA 1B9AA 4N1FA 2LNKA 1KK8C 4GAOA 1SR6C 4OKHA 4YGAA 2HPSA 3BXKA 4OCIA 3IQOA 1F4QA 1QS7A 5TNCA 1JWDA 5HKZA 1C07A 1QVIZ 1H8BA 3AKBA 1K96A 1YUUA 1M63B 2MJWB 2KOTA 4DIRA 4MSPA 2KYFA 2WNDA 1R6PA 3BYAA 3PALA 1DVIA 3SG5A 4C0LA 1LVCD 2MHHA 1XFVO 1NYAA 4C0KA 1JFJA 2JNFA 2L4HA 3I5FB 1DT7B 2ZNDA 1MQ1A 1IGVA 4MBEA 2ZNEA 4NDDA 1SRAA 1MWNA 3IQQA 1D1OA 3I5FC 1BG1A 2FCEA 3BUNB 2O60A 1LINA 4FTGA 1EL4A 2WCBA 3VROA 2LP3A 4MLWA 1AJ4A 2K7OA 3VGOA 1KK7Y 1XFWO 1CFCA 4XYNA 2JU0A 1OQPA 2EGDA 2F2PA 2LHIA 1XFYO 1OZSA 1UHHA 3TDIA 1QIVA 3JVTB 5I8NA 1SYMA 1KQMB 1CDLA 2ZN8A 4NDBA 2K2FA 2KSPA 1UHJA 3JVTC 4I5KA 1KQMC 4YGEB 1S6JA 3WHUB 2ZKMX 2Y1MA 1N2DA 1WDCB 3JTDB 2JT0A 2KGRA 5JOLA 3EVVA 2R2IA 2L98A 4PHJA 4R1EA 1CNPA 3JTDC 1WDCC 3ZWHA 2KQ6A 2LVJA 1OSAA 1BJFA 1F71A 2F3ZA 3OB1B 3LCPC 1DMOA 3RLZA 1M45A 1TCOB 1YUTA 4DRWA 2LVKA 4BY4A 1SK6D 4OV2A 1LA0A 2WOSA 5D7FA 1J7QA 1NP8A 2COLB 3FS7A 2LVVA 1GGZA 2MLEC 1CMGA 3BUMB 1TNWA 2BKHB 4PHMA 2BBNA 2M7LA 3SJSA 2JXCA 1N0YA 1SL8A 3CZTX 2BE4A 3EK4A 3KF9A 1NCYA 1FI5A 1CMFA 2KDHA 1CFFA 1WRKA 5HLOA 5DKRA 5AANA 2CCMA 1MHOA 3DD4A 1WRLA 2QPTA 3OP0A 3PFVA 5I2OA 1KFXL 4QJ3B 4YRUA 3CR4X 4F0ZB 2M0RA 5ER4X 2DOQA 1W7JB 2BECA 1B8LA 4GUKA 4PE0A 1CTRA 1RK9A 2K61A 1J55A 2JPTA 4GPLB 3NSKA 2EHBA 4QJ4B 1DGUA 4JWQA 1Y1AA 3DVEA 1DJGA 1XFXO 1V1GA 2ZRSA 1PSBA 1LXFC 5AXIA 2SASA 3OB2B 3F45A 3SG6A 4AOMA 2GGMA 1UP5A 1XO5A 1A75B 2WCFA 1UHKA 4NDCA 5PALA 5FYXA 1B1GA 3CLNA 1HT9A 5CPVA 4USLA 1MXEA 2FJUB 5JJGA 4M2OA 1KFUS 5CSJA 1G4YR 2MBXA 1YTZC 3O2PA 4DUQA 1C7WA 1SL9A 2I2RE 2L51A 5GQQC 2BE6A 2L4IA 1IQ3A 1OOJA 2M1KB 2P6BB 2M7NA 5CSNA 2H2KA 2KI4B 1F54A 3PM8A 4DCKA 3OX5A 5BPJA 1FPWA 3H4SE 1KK7Z 2KI4C 1NUBA 1PK0D 2LMTA 2V53A 2RGIA 4OR9B 1KSOA 1Y6WA 2Q91A 4HRHA 2HQWA 2CT9A 2LHLA 4N5XA 2JC2A 2LC5A 1PVAA 5DKQA 3LK0A 1EXRA 3CR2A 1KFXS 3MSEB 4CFRA 5AEQA 2LUCA 1YRTB 2KAYA 5DKNA 3DVKA 1K93D 3NXAA 2ZFDA 5HKWA 2F8PA 1SNLA 5KU1A 4QJ5B 2NLNA 2B1UA 1Q80A 3NSIA 4GGNA 3OHMB 4PE1A 2BCXA 4M2QA 5CSFA 2QACA 3HX4A 1OMRA 4PE4A 2GV5A 2OS8C 1JFKA 2IS9A 1NCXA 1UURA 5AFPA 1PVBA 2K0JA 1A2XA 1F4OA 5I2QA 4ORBB 1AK8A 1NX1A 4ZCVA 1NSHA 3FIAA 1B7TY 3EKHA 1DJZA 3TS5C 1AHRA 1SBJA 1WLMA 1C7VA 1A75A 2KI6C 1K2HA 5F6TA 4CLNA 2KNEA 2L50A 1F70A 1XYDA 2NXQA 1EG4A 2JULA 4GFTA 1DF0A 2F3YA 4MEWA 3TDUA 2FOTA 1HQVA 1CLLA 2SCPA 3O4YA 1CDPA 1ZMZA 1CLMA 1M46A 3NSOA 3CTNA 1ZFSA 3C1VA 4YGBB 4OVNF 1TOPA 1IWQA 1YRUB 1PALA 3WNXB 3O6BA 5KSZA 1CM1A 2KQYA 1V1FA 2H61C 3I5GB 1M31A 4D1EA 2LMUA 2JRFA 3IF7A 2KAXA 1J7PA 2LP2A 3CWGA 1YUSA 3I5GC 1U5IB 4YGDB 1TCFA 1ALVA 2CTNA 4HSZA 3GK4X 1DGVA 5ER5A 3KEVA 2Y5IA 3KO0A 2F2OA 4L9MA 1EG3A 2KFFA 3GK2A 1TNPA 4I5JA 4U8DA 1SMGA 1TN4A 5IBWA 4A4CA 1BLQA 4NQGA 1AP4A 2ISDA 3CGAA 2MLFC 5KTYA 1S3PA 1DJHA 1RECA 1BOCA 2LE9B 2JWWA 2PVBA 1E8AA 1S26D 2ZRTA 1XVJA 1IJ5A 2MRDA 4IL1A 1CLBA 5K89A 3VRNA 1GQMA 1CFPA 1W7IB 1BF5A 1UWOA 1VRKA 1UUSA 3ZNIA 2JOJA 3E3RA 1S6IA 2LCPA 4DS7A 2MAZA 1CB1A 1AJ5A 1B8RA 1LKJA 2LANA 3D0YB 1K8UA 4AQIA 3VRQA 5HKYA 1K90D 1FF1A 2KFHA 2WCEA 2E30A 4YBHB 3CR5X 3LK1A 3AAJA 1TRFA 3EK7A 1S36A 5AERA 1IQ5A 1NX0A 1SKTA 2KHNA 2HETA 2KI6D 1RROA 3PN7B 2JT8A 2KYCA 3AAKA 4JQ0D 1DJYA 1K9KA 3I5IB 1QX5B 2Y1NA 2Q4UA 1QX7A 1BU3A 1Y1XA 2AMIA 2K7CA 3PN7C 2M3WA 1IG5A 1QIWA 2M29A 3I5IC 3VRPA 1EH2A 1J7RA 4ORCB 1RWYA 3BUWB 3GK1A 2KAVA 1UHIA 3HCMA 1L7ZA 1NX2A 1B8CA 1Y1UA 2VRGA 3KHEA 3BQ3A 2JT3A 1U5IA 1S1EA 1FI6A 4P5OE 3SIAA 4MZJA 5G08A 3M0WA 1XK4C 2LLUA 1XA5A 1B4CA 4WQ2A 2L2EA 3OX6A 1NCZA 4MRXA 1ZACA 1A4PA 1G33A 2WC8A 1OMDA 1QJTA 2TN4A 1UHNA 4M2PA 1S5GY 4HRGA 2LAPA 4TNCA 1XFUO 2HQ8A 1DJXA 2BCAA 1WRZA 3O78A 4YGCB 1B7TZ 1SPYA 2LVIA 3K21A 3TUYB 4GBAA 2L0PA 2I94A 1ALWA 2LMVA 3DF0B 2JTZA 1OZOA 4PHNA 5HLVA 3TZ1A 4CFQA 2JNXA 1GGWA 3EK8A 2LM5A 2KBMA 4ETOA 3TUYC 4PALA 2OS8B 4MVFA 2OTGB 3EKJA 4ICBA 1QXPA 1DTLA 1TNQA 2K7BA 3D0YA 3KPXA 3GOFA 4YI8A 1FBVA 3TS5B 1QATA 2OTGC 1QV1A 4P2YB 1KQVA 1MF8B 3SG2A 1OE9B 1NX3A 5J3XA 2ZN9A 2NCPA 4XJKB 2PSRA 1CKKA 1KCYA 1JSAA 1JBAA 2KGBC 1AVSA 1QVIY 4HREE 1CDMA 3LL8B 1JF2A 1B47A 4AQJA 1LA3A 1NWDA 3QRXA 3RM1A 3FWCA 5I2LA 4PDZA 1XFZO 4I5LB 1AUIB 2PRUA 1PRWA 2LV7A 2L5XB 4MRYA 4A4BA 4ZCUA 1TIZA 1J1EA 1SL7A 2D8NA 2CXJA 1X02A 1XK4A 4PCWA 1H4BA 1MXLC 2A4JA 3ICBA 1GJYA 2BBMA 4CPVA 1K94A 2CBLA 1JUOA 2PASA 1BT6A 4GGFC 1YX7A 1L2OB 1QTXA 1YURA 3WXAA 1TTXA 1K9UA 4JPZB 1IKUA 2JZIA 3BOWB 2AAOA 3I5HB 1QV0A 1IRJA 1L2OC 2KBIA 4BY5A 4E68A 1PSRA 1F8HA 4MZLA 1TNXA 1IJ6A 3I5HC 1N65A 3SG4A 3LLEA 2LUXA 2I7AA 2HF5A 2M1UA 3BUXB 1A29A 2K2AA 3PSRA 1PULA 1DJWA 1BODA 3D10A 2G2BA 3DF0A 3WHTB 1SCVA 1KFUL 1NIWA 2GGZA 2K8MB 2BCBA 2G9BA 5D69A 1J7OA 1YVLA 1A03A 1QASA 4CIDA 1KWOB 2BKIB 2E6WA 1BR4B 3FWBA 3TDZA 1ODBA 4MN0A 2M49B 1KWOC 1NPQA 2JXLA 4ORAB 4GNKB 2LLTA 1F55A 1S6CA 5HYDA 4N1GA 1KSMA 1QLSA 2FCDA 2AUCA 1ZUZA 4XJKA 2MA2A 2NCOA 1BR1B 2BL0B 4PE7A 2PALA 3DVJA 1WLZA 1EJ3A 3CS1A 3PATA 1BMOA 2O5GA 2PMYA 4Q04A 3SG3A 2BL0C 2Y4QA 2F33A 4C0JA 1JF0A 3SIBA 1ZOTB
chains in the Genus database with same CATH superfamily
1YR5A 1RJVA 4PHKA 1OOHA 5CSIA 2H61A 2QEOA 4FQOA 1YX8A 4GGFA 4MZKA 2CNPA 1SY9A 1S5GZ 2M9GA 2OPOA 3A8RA 3D75A 4YI9A 1P28A 1CDNA 1CFDA 2JQ6A 2WCMA 1K95A 1R2UA 3BFBA 3EG5B 1RFJA 1Y0VH 1YVHA 2M8UA 3A4UB 1K9PA 3B87A 3BUOB 1CM4A 1RTP1 3NSLA 1WY9A 1JC2A 1J1DA 3BFAA 3EVRA 1OMVA 2KFGA 1G8IA 1SW8A 3AKAA 3D74A 4WRIA 3VRRA 3BOWA 3R1VA 5B8IB 1IH0A 1QLKA 4I5NB 1MUXA 1SCMB 2JTTA 3BJHA 2EC6B 3EVUA 3N7HA 2M97A 2WORA 3PLFB 3SS4A 2NZ0A 1M39A 2I18A 4UPGA 1KK8B 2PQLA 1DF0B 1SR6B 1QX2A 4WQ3A 1MR8A 1SCMC 3SG7A 3DVMA 2EC6C 2K7DA 1FW4A 2LLSA 3B7AA 2ERBA 1DJIA 3S0FA 1B9AA 4N1FA 2LNKA 1KK8C 4GAOA 1SR6C 4OKHA 4YGAA 2HPSA 3BXKA 4OCIA 3IQOA 1F4QA 1QS7A 5TNCA 1JWDA 5HKZA 1C07A 1QVIZ 1H8BA 3AKBA 1K96A 1YUUA 1M63B 2MJWB 2KOTA 3CABA 4DIRA 4MSPA 2KYFA 1TUZA 2WNDA 1R6PA 3BYAA 3PALA 1DVIA 3SG5A 4C0LA 1LVCD 2MHHA 1XFVO 1NYAA 4C0KA 1JFJA 2JNFA 2L4HA 3I5FB 1IIOA 2K60A 4KYNA 2ZNDA 1DT7B 4IJ7A 1DEKA 1IGVA 1MQ1A 4MBEA 2ZNEA 1LS8A 3B6XA 4NDDA 1SRAA 1MWNA 3IQQA 1Z2CB 1D1OA 3I5FC 2GTEA 1BG1A 2FCEA 3BUNB 2O60A 1LINA 4JKTA 4FTGA 1EL4A 4CFQA 2WCBA 3VROA 2LP3A 4MLWA 1AJ4A 2K7OA 2PYQA 3VGOA 1KK7Y 1XFWO 1CFCA 3CZ2A 4XYNA 2JU0A 1OQPA 2EGDA 2F2PA 2LHIA 2QEHA 3D76A 1XFYO 1OZSA 1UHHA 3TDIA 2WC6A 1QIVA 3JVTB 5I8NA 1SYMA 1KQMB 1CDLA 2ZN8A 1DELA 3R1OA 4NDBA 2K2FA 2KSPA 1UHJA 3JVTC 4I5KA 1KQMC 4YGEB 1S6JA 5HL1A 3WHUB 2ZKMX 2Y1MA 1N2DA 1WDCB 1DQEA 2JT0A 2KGRA 3JTDB 5JOLA 3EVVA 2R2IA 2L98A 4PHJA 4R1EA 1CNPA 3CZ0A 1WDCC 3JTDC 3ZWHA 2KQ6A 2LVJA 3L47A 1OSAA 1BJFA 1F71A 2F3ZA 3OB1B 4PT1A 3LCPC 1TUJA 1DMOA 3RLZA 4F7FA 1M45A 1TCOB 1YUTA 3UO9A 4DRWA 2LVKA 4BY4A 1SK6D 2WCHA 4OV2A 1LA0A 1OOIX 2WOSA 4JD9A 5D7FA 1J7QA 3R72A 1NP8A 2COLB 3FS7A 2LVVA 1GGZA 2MLEC 1CMGA 3BUMB 3FE8A 1TNWA 2BKHB 4PHMA 2BBNA 2M7LA 3SJSA 2JXCA 1N0YA 1SL8A 3CZTX 2BE4A 3EK4A 3KF9A 1NCYA 1FI5A 3B88A 1CMFA 2BAPA 2KDHA 1CFFA 3NHTA 1WRKA 5HLOA 5DKRA 5AANA 2CCMA 1MHOA 3DD4A 1WRLA 2H8VA 2QPTA 3OP0A 3PFVA 5I2OA 1KFXL 4QJ3B 4YRUA 3CR4X 4F0ZB 2M0RA 5ER4X 4INWA 3S0EA 2DOQA 1QWVA 1W7JB 2BECA 1B8LA 4GUKA 4PE0A 1CTRA 1RK9A 2K61A 1J55A 2JPTA 4GPLB 2KPHA 2EHBA 3NSKA 4QJ4B 1DGUA 2FJYA 4JWQA 1Y1AA 3DVEA 1DJGA 1XFXO 1V1GA 2ZRSA 1PSBA 1LXFC 5AXIA 2SASA 3OB2B 3F45A 4FQTA 3SG6A 4AOMA 2GGMA 1UP5A 1XO5A 1A75B 2WCFA 1UHKA 4NDCA 5PALA 5FYXA 3VB1A 3CLNA 1HT9A 1B1GA 5CPVA 4USLA 1MXEA 2FJUB 5JJGA 4M2OA 2L2CA 1KFUS 5CSJA 1G4YR 2MBXA 1YTZC 3O2PA 4DUQA 1C7WA 2QEBA 1SL9A 2I2RE 2L51A 5GQQC 2BE6A 1C3ZA 2L4IA 1IQ3A 1OOJA 2M1KB 2P6BB 2M7NA 5CSNA 2H2KA 2KI4B 4INXA 1F54A 3PM8A 1DC1A 4DCKA 3OX5A 5BPJA 1FPWA 3H4SE 1KK7Z 2KI4C 1NUBA 1PK0D 2LMTA 2V53A 2RGIA 3L4LA 4OR9B 2BNXA 1KSOA 3SS5A 1Y6WA 2Q91A 4HRHA 2KLEA 2HQWA 2CT9A 2LHLA 4N5XA 2JC2A 2LC5A 1PVAA 5DKQA 3LK0A 1EXRA 2WCKA 3CR2A 1KFXS 1XFRA 3MSEB 4CFRA 5AEQA 2LUCA 1YRTB 2KAYA 2YGUA 5DKNA 3DVKA 1K93D 3NXAA 2ZFDA 5HKWA 2F8PA 1SNLA 5KU1A 4QJ5B 2NLNA 2B1UA 1Q80A 3NSIA 4GGNA 3OHMB 4PE1A 2BCXA 4M2QA 5CSFA 2QACA 3HX4A 1OMRA 4PE4A 2GV5A 2OS8C 1JFKA 2IS9A 1NCXA 1UURA 5AFPA 1PVBA 2K0JA 1A2XA 1F4OA 5I2QA 4ORBB 1AK8A 1NX1A 3RZSA 4ZCVA 1NSHA 3FIAA 1B7TY 3EKHA 1DJZA 3TS5C 1AHRA 3O4XA 1SBJA 1WLMA 1C7VA 1A75A 2KI6C 1K2HA 5FI6A 3PM2A 5F6TA 4CLNA 2KNEA 2L50A 3D78A 1F70A 1XYDA 2NXQA 1EG4A 2JULA 2WC5A 4GFTA 1GM0A 1DF0A 2F3YA 4MEWA 3TDUA 2FOTA 1HQVA 3UNWA 1CLLA 2SCPA 3O4YA 1CDPA 1OW4A 1ZMZA 1CLMA 1M46A 3NSOA 3CTNA 1ZFSA 3C1VA 4YGBB 4OVNF 1TOPA 1IWQA 1OOFA 1PALA 1YRUB 3O6BA 3WNXB 5KSZA 1CM1A 2KQYA 1V1FA 2H61C 3I5GB 1M31A 3CYZA 1TWOA 3CZ1A 3S0DA 4D1EA 2LMUA 2JRFA 3IF7A 2KAXA 1J7PA 2LP2A 3CWGA 1YUSA 3I5GC 1U5IB 2KLDA 4YGDB 1TCFA 1ALVA 2CTNA 3DXLA 3GK4X 1DGVA 4HSZA 5ER5A 5I94A 3KEVA 2Y5IA 1OOGA 3KO0A 2F2OA 4L9MA 1EG3A 2KFFA 3GK2A 2P70A 1TNPA 4I5JA 4U8DA 1SMGA 1TN4A 5IBWA 3L4AA 4A4CA 2WCLA 4NQGA 1AP4A 1BLQA 2ISDA 3CGAA 2MLFC 5KTYA 1S3PA 1DJHA 1RECA 1BOCA 2LE9B 2JWWA 2PVBA 1E8AA 1S26D 3R1PA 2ZRTA 1XVJA 1IJ5A 2MRDA 4IL1A 1CLBA 5K89A 3VRNA 1GQMA 1CFPA 1W7IB 5D3OA 1BF5A 1UWOA 1VRKA 1UUSA 3ZNIA 2JOJA 3E3RA 1S6IA 2LCPA 4DS7A 1Z4HA 2MAZA 1CB1A 1AJ5A 1B8RA 1LKJA 2LANA 3D0YB 1K8UA 4AQIA 3VRQA 3DZTA 1K90D 5HKYA 1FF1A 2KFHA 2WCEA 2E30A 4YBHB 3CR5X 3LK1A 3AAJA 1TRFA 3BFHA 1S36A 3EK7A 5AERA 1IQ5A 1NX0A 1SKTA 2KHNA 2HETA 2KI6D 1RROA 3PN7B 2JT8A 2KYCA 3AAKA 4JQ0D 1DJYA 1C3YA 1K9KA 3I5IB 1QX5B 2Y1NA 3OBVA 2Q4UA 1QX7A 1BU3A 1Y1XA 2AMIA 2K7CA 3PN7C 2M3WA 3DYEA 1IG5A 1QIWA 2M29A 3I5IC 3K1EA 3VRPA 1EH2A 4OZDA 1J7RA 4ORCB 1RWYA 3S0AA 3BUWB 3GK1A 2KAVA 1UHIA 3HCMA 1L7ZA 2P71A 1NX2A 1B8CA 1Y1UA 3V2LA 2VRGA 3KHEA 3Q8IA 3BQ3A 2JT3A 1U5IA 1S1EA 1FI6A 4P5OE 3SIAA 4MZJA 3PJIA 3M0WA 1XK4C 2LLUA 5G08A 5FI7A 1XA5A 1B4CA 4WQ2A 2L2EA 3OX6A 1NCZA 2QDIA 4MRXA 1ZACA 1A4PA 1G33A 3OGNA 2WC8A 1OMDA 1QJTA 2TN4A 1UHNA 4M2PA 1S5GY 4HRGA 2LAPA 4TNCA 1XFUO 2HQ8A 1DJXA 2BCAA 1WRZA 3O78A 4YGCB 1B7TZ 1SPYA 2LVIA 3K21A 3TUYB 4GBAA 3D73A 1T14A 2L0PA 2I94A 2QEVA 1ALWA 1ORGA 2LMVA 2JTZA 1OZOA 3DF0B 3QMEA 4PHNA 5HLVA 3TZ1A 2JNXA 1GGWA 3EK8A 2LM5A 2KBMA 4ETOA 3TUYC 4PALA 2OS8B 3CDNA 3S0GA 4MVFA 2OTGB 3EKJA 3FE9A 4ICBA 1QXPA 1DTLA 1TNQA 2K7BA 3D0YA 3KPXA 3GOFA 4YI8A 1FBVA 3TS5B 1QATA 2OTGC 1QV1A 4P2YB 1KQVA 5FI2A 1MF8B 3D77A 1OE9B 1NX3A 5J3XA 3SG2A 2ZN9A 2NCPA 4XJKB 2PSRA 1CKKA 1KCYA 1JSAA 1JBAA 2KGBC 3DY9A 1AVSA 1QVIY 4HREE 1CDMA 3LL8B 1JF2A 1B47A 1SSEB 4AQJA 1LA3A 1NWDA 3QRXA 3RM1A 3FWCA 5I2LA 4PDZA 1XFZO 4I5LB 1AUIB 2PRUA 1PRWA 2LV7A 2L5XB 4MRYA 4A4BA 4ZCUA 1TIZA 1J1EA 1SL7A 2D8NA 2CXJA 1X02A 1XK4A 4PCWA 1H4BA 1MXLC 2A4JA 3ICBA 1GJYA 2BBMA 4CPVA 1K94A 2CBLA 1JUOA 2PASA 1BT6A 4GGFC 1YX7A 1L2OB 1QTXA 1YURA 3WXAA 1TTXA 1K9UA 4JPZB 1IKUA 2JZIA 3BOWB 3FE6A 2AAOA 3I5HB 1QV0A 1IRJA 1L2OC 2KBIA 2L5YA 4BY5A 4E68A 1PSRA 1F8HA 4MZLA 1TNXA 1IJ6A 3I5HC 1N65A 3SG4A 3LLEA 3S0BA 2LUXA 2I7AA 2HF5A 2M1UA 3BUXB 1A29A 2K2AA 3PSRA 1PULA 1DJWA 1BODA 3D10A 2G2BA 3SS3A 3DF0A 3WHTB 1SCVA 1KFUL 3NHIA 1NIWA 2GGZA 2K8MB 2BCBA 2G9BA 5D69A 1J7OA 1YVLA 1A03A 1QASA 4CIDA 1W9ZA 1KWOB 3IVTA 2BKIB 2E6WA 1BR4B 3FWBA 3TDZA 1ODBA 4MN0A 2M49B 1KWOC 1NPQA 2JXLA 5DICA 4ORAB 4GNKB 2LLTA 3NGVA 1F55A 1S6CA 2WCJA 5HYDA 4N1GA 1KSMA 2JPOA 1QLSA 2FCDA 2AUCA 1ZUZA 4XJKA 2MA2A 2NCOA 1BR1B 2BL0B 4PE7A 2PALA 3DVJA 5EL2A 1WLZA 1EJ3A 3CS1A 3PATA 1BMOA 2O5GA 2PMYA 4Q04A 3SG3A 2BL0C 2Y4QA 2F33A 4C0JA 1JF0A 3SIBA 3B86A 1ZOTB
chains in the Genus database with same CATH topology
1YR5A 1RJVA 4PHKA 5CSIA 2H61A 4FQOA 1YX8A 4GGFA 4MZKA 2CNPA 1SY9A 1S5GZ 2M9GA 2OPOA 3A8RA 4YI9A 1CDNA 1CFDA 2JQ6A 1K95A 1R2UA 1RFJA 1Y0VH 1YVHA 2M8UA 3A4UB 1K9PA 3BUOB 3NSLA 1CM4A 1RTP1 1WY9A 1JC2A 1J1DA 3EVRA 1OMVA 2KFGA 1G8IA 1SW8A 3AKAA 4WRIA 1IH0A 3VRRA 3BOWA 5B8IB 1QLKA 4I5NB 1MUXA 1SCMB 2JTTA 2EC6B 3EVUA 2M97A 2WORA 3PLFB 2NZ0A 1M39A 2I18A 4UPGA 1KK8B 1DF0B 1SR6B 1QX2A 4WQ3A 1MR8A 1SCMC 3SG7A 3DVMA 2EC6C 2K7DA 1FW4A 2LLSA 1DJIA 1B9AA 4N1FA 2LNKA 1KK8C 4GAOA 1SR6C 4OKHA 4YGAA 2HPSA 3BXKA 4OCIA 3IQOA 1F4QA 1QS7A 5TNCA 1JWDA 5HKZA 1C07A 1QVIZ 1H8BA 3AKBA 1K96A 1YUUA 1M63B 2MJWB 2KOTA 4DIRA 4MSPA 2KYFA 2WNDA 1R6PA 3BYAA 3PALA 1DVIA 3SG5A 4C0LA 1LVCD 2MHHA 1XFVO 1NYAA 4C0KA 1JFJA 2JNFA 2L4HA 3I5FB 1DT7B 2ZNDA 1MQ1A 1IGVA 4MBEA 2ZNEA 4NDDA 1SRAA 1MWNA 3IQQA 1D1OA 3I5FC 1BG1A 2FCEA 3BUNB 2O60A 1LINA 4FTGA 1EL4A 2WCBA 3VROA 2LP3A 4MLWA 1AJ4A 2K7OA 3VGOA 1KK7Y 1XFWO 1CFCA 4XYNA 2JU0A 1OQPA 2EGDA 2F2PA 2LHIA 1XFYO 1OZSA 1UHHA 3TDIA 1QIVA 3JVTB 5I8NA 1SYMA 1KQMB 1CDLA 2ZN8A 4NDBA 2K2FA 2KSPA 1UHJA 3JVTC 4I5KA 1KQMC 4YGEB 1S6JA 3WHUB 2ZKMX 2Y1MA 1N2DA 1WDCB 3JTDB 2JT0A 2KGRA 5JOLA 3EVVA 2R2IA 2L98A 4PHJA 4R1EA 1CNPA 3JTDC 1WDCC 3ZWHA 2KQ6A 2LVJA 1OSAA 1BJFA 1F71A 2F3ZA 3OB1B 3LCPC 1DMOA 3RLZA 1M45A 1TCOB 1YUTA 4DRWA 2LVKA 4BY4A 1SK6D 4OV2A 1LA0A 2WOSA 5D7FA 1J7QA 1NP8A 2COLB 3FS7A 2LVVA 1GGZA 2MLEC 1CMGA 3BUMB 1TNWA 2BKHB 4PHMA 2BBNA 2M7LA 3SJSA 2JXCA 1N0YA 1SL8A 3CZTX 2BE4A 3EK4A 3KF9A 1NCYA 1FI5A 1CMFA 2KDHA 1CFFA 1WRKA 5HLOA 5DKRA 5AANA 2CCMA 1MHOA 3DD4A 1WRLA 2QPTA 3OP0A 3PFVA 5I2OA 1KFXL 4QJ3B 4YRUA 3CR4X 4F0ZB 2M0RA 5ER4X 2DOQA 1W7JB 2BECA 1B8LA 4GUKA 4PE0A 1CTRA 1RK9A 2K61A 1J55A 2JPTA 4GPLB 3NSKA 2EHBA 4QJ4B 1DGUA 4JWQA 1Y1AA 3DVEA 1DJGA 1XFXO 1V1GA 2ZRSA 1PSBA 1LXFC 5AXIA 2SASA 3OB2B 3F45A 3SG6A 4AOMA 2GGMA 1UP5A 1XO5A 1A75B 2WCFA 1UHKA 4NDCA 5PALA 5FYXA 1B1GA 3CLNA 1HT9A 5CPVA 4USLA 1MXEA 2FJUB 5JJGA 4M2OA 1KFUS 5CSJA 1G4YR 2MBXA 1YTZC 3O2PA 4DUQA 1C7WA 1SL9A 2I2RE 2L51A 5GQQC 2BE6A 2L4IA 1IQ3A 1OOJA 2M1KB 2P6BB 2M7NA 5CSNA 2H2KA 2KI4B 1F54A 3PM8A 4DCKA 3OX5A 5BPJA 1FPWA 3H4SE 1KK7Z 2KI4C 1NUBA 1PK0D 2LMTA 2V53A 2RGIA 4OR9B 1KSOA 1Y6WA 2Q91A 4HRHA 2HQWA 2CT9A 2LHLA 4N5XA 2JC2A 2LC5A 1PVAA 5DKQA 3LK0A 1EXRA 3CR2A 1KFXS 3MSEB 4CFRA 5AEQA 2LUCA 1YRTB 2KAYA 5DKNA 3DVKA 1K93D 3NXAA 2ZFDA 5HKWA 2F8PA 1SNLA 5KU1A 4QJ5B 2NLNA 2B1UA 1Q80A 3NSIA 4GGNA 3OHMB 4PE1A 2BCXA 4M2QA 5CSFA 2QACA 3HX4A 1OMRA 4PE4A 2GV5A 2OS8C 1JFKA 2IS9A 1NCXA 1UURA 5AFPA 1PVBA 2K0JA 1A2XA 1F4OA 5I2QA 4ORBB 1AK8A 1NX1A 4ZCVA 1NSHA 3FIAA 1B7TY 3EKHA 1DJZA 3TS5C 1AHRA 1SBJA 1WLMA 1C7VA 1A75A 2KI6C 1K2HA 5F6TA 4CLNA 2KNEA 2L50A 1F70A 1XYDA 2NXQA 1EG4A 2JULA 4GFTA 1DF0A 2F3YA 4MEWA 3TDUA 2FOTA 1HQVA 1CLLA 2SCPA 3O4YA 1CDPA 1ZMZA 1CLMA 1M46A 3NSOA 3CTNA 1ZFSA 3C1VA 4YGBB 4OVNF 1TOPA 1IWQA 1YRUB 1PALA 3WNXB 3O6BA 5KSZA 1CM1A 2KQYA 1V1FA 2H61C 3I5GB 1M31A 4D1EA 2LMUA 2JRFA 3IF7A 2KAXA 1J7PA 2LP2A 3CWGA 1YUSA 3I5GC 1U5IB 4YGDB 1TCFA 1ALVA 2CTNA 4HSZA 3GK4X 1DGVA 5ER5A 3KEVA 2Y5IA 3KO0A 2F2OA 4L9MA 1EG3A 2KFFA 3GK2A 1TNPA 4I5JA 4U8DA 1SMGA 1TN4A 5IBWA 4A4CA 1BLQA 4NQGA 1AP4A 2ISDA 3CGAA 2MLFC 5KTYA 1S3PA 1DJHA 1RECA 1BOCA 2LE9B 2JWWA 2PVBA 1E8AA 1S26D 2ZRTA 1XVJA 1IJ5A 2MRDA 4IL1A 1CLBA 5K89A 3VRNA 1GQMA 1CFPA 1W7IB 1BF5A 1UWOA 1VRKA 1UUSA 3ZNIA 2JOJA 3E3RA 1S6IA 2LCPA 4DS7A 2MAZA 1CB1A 1AJ5A 1B8RA 1LKJA 2LANA 3D0YB 1K8UA 4AQIA 3VRQA 5HKYA 1K90D 1FF1A 2KFHA 2WCEA 2E30A 4YBHB 3CR5X 3LK1A 3AAJA 1TRFA 3EK7A 1S36A 5AERA 1IQ5A 1NX0A 1SKTA 2KHNA 2HETA 2KI6D 1RROA 3PN7B 2JT8A 2KYCA 3AAKA 4JQ0D 1DJYA 1K9KA 3I5IB 1QX5B 2Y1NA 2Q4UA 1QX7A 1BU3A 1Y1XA 2AMIA 2K7CA 3PN7C 2M3WA 1IG5A 1QIWA 2M29A 3I5IC 3VRPA 1EH2A 1J7RA 4ORCB 1RWYA 3BUWB 3GK1A 2KAVA 1UHIA 3HCMA 1L7ZA 1NX2A 1B8CA 1Y1UA 2VRGA 3KHEA 3BQ3A 2JT3A 1U5IA 1S1EA 1FI6A 4P5OE 3SIAA 4MZJA 5G08A 3M0WA 1XK4C 2LLUA 1XA5A 1B4CA 4WQ2A 2L2EA 3OX6A 1NCZA 4MRXA 1ZACA 1A4PA 1G33A 2WC8A 1OMDA 1QJTA 2TN4A 1UHNA 4M2PA 1S5GY 4HRGA 2LAPA 4TNCA 1XFUO 2HQ8A 1DJXA 2BCAA 1WRZA 3O78A 4YGCB 1B7TZ 1SPYA 2LVIA 3K21A 3TUYB 4GBAA 2L0PA 2I94A 1ALWA 2LMVA 3DF0B 2JTZA 1OZOA 4PHNA 5HLVA 3TZ1A 4CFQA 2JNXA 1GGWA 3EK8A 2LM5A 2KBMA 4ETOA 3TUYC 4PALA 2OS8B 4MVFA 2OTGB 3EKJA 4ICBA 1QXPA 1DTLA 1TNQA 2K7BA 3D0YA 3KPXA 3GOFA 4YI8A 1FBVA 3TS5B 1QATA 2OTGC 1QV1A 4P2YB 1KQVA 1MF8B 3SG2A 1OE9B 1NX3A 5J3XA 2ZN9A 2NCPA 4XJKB 2PSRA 1CKKA 1KCYA 1JSAA 1JBAA 2KGBC 1AVSA 1QVIY 4HREE 1CDMA 3LL8B 1JF2A 1B47A 4AQJA 1LA3A 1NWDA 3QRXA 3RM1A 3FWCA 5I2LA 4PDZA 1XFZO 4I5LB 1AUIB 2PRUA 1PRWA 2LV7A 2L5XB 4MRYA 4A4BA 4ZCUA 1TIZA 1J1EA 1SL7A 2D8NA 2CXJA 1X02A 1XK4A 4PCWA 1H4BA 1MXLC 2A4JA 3ICBA 1GJYA 2BBMA 4CPVA 1K94A 2CBLA 1JUOA 2PASA 1BT6A 4GGFC 1YX7A 1L2OB 1QTXA 1YURA 3WXAA 1TTXA 1K9UA 4JPZB 1IKUA 2JZIA 3BOWB 2AAOA 3I5HB 1QV0A 1IRJA 1L2OC 2KBIA 4BY5A 4E68A 1PSRA 1F8HA 4MZLA 1TNXA 1IJ6A 3I5HC 1N65A 3SG4A 3LLEA 2LUXA 2I7AA 2HF5A 2M1UA 3BUXB 1A29A 2K2AA 3PSRA 1PULA 1DJWA 1BODA 3D10A 2G2BA 3DF0A 3WHTB 1SCVA 1KFUL 1NIWA 2GGZA 2K8MB 2BCBA 2G9BA 5D69A 1J7OA 1YVLA 1A03A 1QASA 4CIDA 1KWOB 2BKIB 2E6WA 1BR4B 3FWBA 3TDZA 1ODBA 4MN0A 2M49B 1KWOC 1NPQA 2JXLA 4ORAB 4GNKB 2LLTA 1F55A 1S6CA 5HYDA 4N1GA 1KSMA 1QLSA 2FCDA 2AUCA 1ZUZA 4XJKA 2MA2A 2NCOA 1BR1B 2BL0B 4PE7A 2PALA 3DVJA 1WLZA 1EJ3A 3CS1A 3PATA 1BMOA 2O5GA 2PMYA 4Q04A 3SG3A 2BL0C 2Y4QA 2F33A 4C0JA 1JF0A 3SIBA 1ZOTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR5 A;  1RJV A;  4PHK A;  5CSI A;  2H61 A;  4FQO A;  1YX8 A;  4GGF A;  4MZK A;  2CNP A;  1SY9 A;  1S5G Z;  2M9G A;  2OPO A;  3A8R A;  4YI9 A;  1CDN A;  1CFD A;  2JQ6 A;  1K95 A;  1R2U A;  1RFJ A;  1Y0V H;  1YVH A;  2M8U A;  3A4U B;  1K9P A;  3BUO B;  3NSL A;  1CM4 A;  1RTP 1;  1WY9 A;  1JC2 A;  1J1D A;  3EVR A;  1OMV A;  2KFG A;  1G8I A;  1SW8 A;  3AKA A;  4WRI A;  1IH0 A;  3VRR A;  3BOW A;  5B8I B;  1QLK A;  4I5N B;  1MUX A;  1SCM B;  2JTT A;  2EC6 B;  3EVU A;  2M97 A;  2WOR A;  3PLF B;  2NZ0 A;  1M39 A;  2I18 A;  4UPG A;  1KK8 B;  1DF0 B;  1SR6 B;  1QX2 A;  4WQ3 A;  1MR8 A;  1SCM C;  3SG7 A;  3DVM A;  2EC6 C;  2K7D A;  1FW4 A;  2LLS A;  1DJI A;  1B9A A;  4N1F A;  2LNK A;  1KK8 C;  4GAO A;  1SR6 C;  4OKH A;  4YGA A;  2HPS A;  3BXK A;  4OCI A;  3IQO A;  1F4Q A;  1QS7 A;  5TNC A;  1JWD A;  5HKZ A;  1C07 A;  1QVI Z;  1H8B A;  3AKB A;  1K96 A;  1YUU A;  1M63 B;  2MJW B;  2KOT A;  4DIR A;  4MSP A;  2KYF A;  2WND A;  1R6P A;  3BYA A;  3PAL A;  1DVI A;  3SG5 A;  4C0L A;  1LVC D;  2MHH A;  1XFV O;  1NYA A;  4C0K A;  1JFJ A;  2JNF A;  2L4H A;  3I5F B;  1DT7 B;  2ZND A;  1MQ1 A;  1IGV A;  4MBE A;  2ZNE A;  4NDD A;  1SRA A;  1MWN A;  3IQQ A;  1D1O A;  3I5F C;  1BG1 A;  2FCE A;  3BUN B;  2O60 A;  1LIN A;  4FTG A;  1EL4 A;  2WCB A;  3VRO A;  2LP3 A;  4MLW A;  1AJ4 A;  2K7O A;  3VGO A;  1KK7 Y;  1XFW O;  1CFC A;  4XYN A;  2JU0 A;  1OQP A;  2EGD A;  2F2P A;  2LHI A;  1XFY O;  1OZS A;  1UHH A;  3TDI A;  1QIV A;  3JVT B;  5I8N A;  1SYM A;  1KQM B;  1CDL A;  2ZN8 A;  4NDB A;  2K2F A;  2KSP A;  1UHJ A;  3JVT C;  4I5K A;  1KQM C;  4YGE B;  1S6J A;  3WHU B;  2ZKM X;  2Y1M A;  1N2D A;  1WDC B;  3JTD B;  2JT0 A;  2KGR A;  5JOL A;  3EVV A;  2R2I A;  2L98 A;  4PHJ A;  4R1E A;  1CNP A;  3JTD C;  1WDC C;  3ZWH A;  2KQ6 A;  2LVJ A;  1OSA A;  1BJF A;  1F71 A;  2F3Z A;  3OB1 B;  3LCP C;  1DMO A;  3RLZ A;  1M45 A;  1TCO B;  1YUT A;  4DRW A;  2LVK A;  4BY4 A;  1SK6 D;  4OV2 A;  1LA0 A;  2WOS A;  5D7F A;  1J7Q A;  1NP8 A;  2COL B;  3FS7 A;  2LVV A;  1GGZ A;  2MLE C;  1CMG A;  3BUM B;  1TNW A;  2BKH B;  4PHM A;  2BBN A;  2M7L A;  3SJS A;  2JXC A;  1N0Y A;  1SL8 A;  3CZT X;  2BE4 A;  3EK4 A;  3KF9 A;  1NCY A;  1FI5 A;  1CMF A;  2KDH A;  1CFF A;  1WRK A;  5HLO A;  5DKR A;  5AAN A;  2CCM A;  1MHO A;  3DD4 A;  1WRL A;  2QPT A;  3OP0 A;  3PFV A;  5I2O A;  1KFX L;  4QJ3 B;  4YRU A;  3CR4 X;  4F0Z B;  2M0R A;  5ER4 X;  2DOQ A;  1W7J B;  2BEC A;  1B8L A;  4GUK A;  4PE0 A;  1CTR A;  1RK9 A;  2K61 A;  1J55 A;  2JPT A;  4GPL B;  3NSK A;  2EHB A;  4QJ4 B;  1DGU A;  4JWQ A;  1Y1A A;  3DVE A;  1DJG A;  1XFX O;  1V1G A;  2ZRS A;  1PSB A;  1LXF C;  5AXI A;  2SAS A;  3OB2 B;  3F45 A;  3SG6 A;  4AOM A;  2GGM A;  1UP5 A;  1XO5 A;  1A75 B;  2WCF A;  1UHK A;  4NDC A;  5PAL A;  5FYX A;  1B1G A;  3CLN A;  1HT9 A;  5CPV A;  4USL A;  1MXE A;  2FJU B;  5JJG A;  4M2O A;  1KFU S;  5CSJ A;  1G4Y R;  2MBX A;  1YTZ C;  3O2P A;  4DUQ A;  1C7W A;  1SL9 A;  2I2R E;  2L51 A;  5GQQ C;  2BE6 A;  2L4I A;  1IQ3 A;  1OOJ A;  2M1K B;  2P6B B;  2M7N A;  5CSN A;  2H2K A;  2KI4 B;  1F54 A;  3PM8 A;  4DCK A;  3OX5 A;  5BPJ A;  1FPW A;  3H4S E;  1KK7 Z;  2KI4 C;  1NUB A;  1PK0 D;  2LMT A;  2V53 A;  2RGI A;  4OR9 B;  1KSO A;  1Y6W A;  2Q91 A;  4HRH A;  2HQW A;  2CT9 A;  2LHL A;  4N5X A;  2JC2 A;  2LC5 A;  1PVA A;  5DKQ A;  3LK0 A;  1EXR A;  3CR2 A;  1KFX S;  3MSE B;  4CFR A;  5AEQ A;  2LUC A;  1YRT B;  2KAY A;  5DKN A;  3DVK A;  1K93 D;  3NXA A;  2ZFD A;  5HKW A;  2F8P A;  1SNL A;  5KU1 A;  4QJ5 B;  2NLN A;  2B1U A;  1Q80 A;  3NSI A;  4GGN A;  3OHM B;  4PE1 A;  2BCX A;  4M2Q A;  5CSF A;  2QAC A;  3HX4 A;  1OMR A;  4PE4 A;  2GV5 A;  2OS8 C;  1JFK A;  2IS9 A;  1NCX A;  1UUR A;  5AFP A;  1PVB A;  2K0J A;  1A2X A;  1F4O A;  5I2Q A;  4ORB B;  1AK8 A;  1NX1 A;  4ZCV A;  1NSH A;  3FIA A;  1B7T Y;  3EKH A;  1DJZ A;  3TS5 C;  1AHR A;  1SBJ A;  1WLM A;  1C7V A;  1A75 A;  2KI6 C;  1K2H A;  5F6T A;  4CLN A;  2KNE A;  2L50 A;  1F70 A;  1XYD A;  2NXQ A;  1EG4 A;  2JUL A;  4GFT A;  1DF0 A;  2F3Y A;  4MEW A;  3TDU A;  2FOT A;  1HQV A;  1CLL A;  2SCP A;  3O4Y A;  1CDP A;  1ZMZ A;  1CLM A;  1M46 A;  3NSO A;  3CTN A;  1ZFS A;  3C1V A;  4YGB B;  4OVN F;  1TOP A;  1IWQ A;  1YRU B;  1PAL A;  3WNX B;  3O6B A;  5KSZ A;  1CM1 A;  2KQY A;  1V1F A;  2H61 C;  3I5G B;  1M31 A;  4D1E A;  2LMU A;  2JRF A;  3IF7 A;  2KAX A;  1J7P A;  2LP2 A;  3CWG A;  1YUS A;  3I5G C;  1U5I B;  4YGD B;  1TCF A;  1ALV A;  2CTN A;  4HSZ A;  3GK4 X;  1DGV A;  5ER5 A;  3KEV A;  2Y5I A;  3KO0 A;  2F2O A;  4L9M A;  1EG3 A;  2KFF A;  3GK2 A;  1TNP A;  4I5J A;  4U8D A;  1SMG A;  1TN4 A;  5IBW A;  4A4C A;  1BLQ A;  4NQG A;  1AP4 A;  2ISD A;  3CGA A;  2MLF C;  5KTY A;  1S3P A;  1DJH A;  1REC A;  1BOC A;  2LE9 B;  2JWW A;  2PVB A;  1E8A A;  1S26 D;  2ZRT A;  1XVJ A;  1IJ5 A;  2MRD A;  4IL1 A;  1CLB A;  5K89 A;  3VRN A;  1GQM A;  1CFP A;  1W7I B;  1BF5 A;  1UWO A;  1VRK A;  1UUS A;  3ZNI A;  2JOJ A;  3E3R A;  1S6I A;  2LCP A;  4DS7 A;  2MAZ A;  1CB1 A;  1AJ5 A;  1B8R A;  1LKJ A;  2LAN A;  3D0Y B;  1K8U A;  4AQI A;  3VRQ A;  5HKY A;  1K90 D;  1FF1 A;  2KFH A;  2WCE A;  2E30 A;  4YBH B;  3CR5 X;  3LK1 A;  3AAJ A;  1TRF A;  3EK7 A;  1S36 A;  5AER A;  1IQ5 A;  1NX0 A;  1SKT A;  2KHN A;  2HET A;  2KI6 D;  1RRO A;  3PN7 B;  2JT8 A;  2KYC A;  3AAK A;  4JQ0 D;  1DJY A;  1K9K A;  3I5I B;  1QX5 B;  2Y1N A;  2Q4U A;  1QX7 A;  1BU3 A;  1Y1X A;  2AMI A;  2K7C A;  3PN7 C;  2M3W A;  1IG5 A;  1QIW A;  2M29 A;  3I5I C;  3VRP A;  1EH2 A;  1J7R A;  4ORC B;  1RWY A;  3BUW B;  3GK1 A;  2KAV A;  1UHI A;  3HCM A;  1L7Z A;  1NX2 A;  1B8C A;  1Y1U A;  2VRG A;  3KHE A;  3BQ3 A;  2JT3 A;  1U5I A;  1S1E A;  1FI6 A;  4P5O E;  3SIA A;  4MZJ A;  5G08 A;  3M0W A;  1XK4 C;  2LLU A;  1XA5 A;  1B4C A;  4WQ2 A;  2L2E A;  3OX6 A;  1NCZ A;  4MRX A;  1ZAC A;  1A4P A;  1G33 A;  2WC8 A;  1OMD A;  1QJT A;  2TN4 A;  1UHN A;  4M2P A;  1S5G Y;  4HRG A;  2LAP A;  4TNC A;  1XFU O;  2HQ8 A;  1DJX A;  2BCA A;  1WRZ A;  3O78 A;  4YGC B;  1B7T Z;  1SPY A;  2LVI A;  3K21 A;  3TUY B;  4GBA A;  2L0P A;  2I94 A;  1ALW A;  2LMV A;  3DF0 B;  2JTZ A;  1OZO A;  4PHN A;  5HLV A;  3TZ1 A;  4CFQ A;  2JNX A;  1GGW A;  3EK8 A;  2LM5 A;  2KBM A;  4ETO A;  3TUY C;  4PAL A;  2OS8 B;  4MVF A;  2OTG B;  3EKJ A;  4ICB A;  1QXP A;  1DTL A;  1TNQ A;  2K7B A;  3D0Y A;  3KPX A;  3GOF A;  4YI8 A;  1FBV A;  3TS5 B;  1QAT A;  2OTG C;  1QV1 A;  4P2Y B;  1KQV A;  1MF8 B;  3SG2 A;  1OE9 B;  1NX3 A;  5J3X A;  2ZN9 A;  2NCP A;  4XJK B;  2PSR A;  1CKK A;  1KCY A;  1JSA A;  1JBA A;  2KGB C;  1AVS A;  1QVI Y;  4HRE E;  1CDM A;  3LL8 B;  1JF2 A;  1B47 A;  4AQJ A;  1LA3 A;  1NWD A;  3QRX A;  3RM1 A;  3FWC A;  5I2L A;  4PDZ A;  1XFZ O;  4I5L B;  1AUI B;  2PRU A;  1PRW A;  2LV7 A;  2L5X B;  4MRY A;  4A4B A;  4ZCU A;  1TIZ A;  1J1E A;  1SL7 A;  2D8N A;  2CXJ A;  1X02 A;  1XK4 A;  4PCW A;  1H4B A;  1MXL C;  2A4J A;  3ICB A;  1GJY A;  2BBM A;  4CPV A;  1K94 A;  2CBL A;  1JUO A;  2PAS A;  1BT6 A;  4GGF C;  1YX7 A;  1L2O B;  1QTX A;  1YUR A;  3WXA A;  1TTX A;  1K9U A;  4JPZ B;  1IKU A;  2JZI A;  3BOW B;  2AAO A;  3I5H B;  1QV0 A;  1IRJ A;  1L2O C;  2KBI A;  4BY5 A;  4E68 A;  1PSR A;  1F8H A;  4MZL A;  1TNX A;  1IJ6 A;  3I5H C;  1N65 A;  3SG4 A;  3LLE A;  2LUX A;  2I7A A;  2HF5 A;  2M1U A;  3BUX B;  1A29 A;  2K2A A;  3PSR A;  1PUL A;  1DJW A;  1BOD A;  3D10 A;  2G2B A;  3DF0 A;  3WHT B;  1SCV A;  1KFU L;  1NIW A;  2GGZ A;  2K8M B;  2BCB A;  2G9B A;  5D69 A;  1J7O A;  1YVL A;  1A03 A;  1QAS A;  4CID A;  1KWO B;  2BKI B;  2E6W A;  1BR4 B;  3FWB A;  3TDZ A;  1ODB A;  4MN0 A;  2M49 B;  1KWO C;  1NPQ A;  2JXL A;  4ORA B;  4GNK B;  2LLT A;  1F55 A;  1S6C A;  5HYD A;  4N1G A;  1KSM A;  1QLS A;  2FCD A;  2AUC A;  1ZUZ A;  4XJK A;  2MA2 A;  2NCO A;  1BR1 B;  2BL0 B;  4PE7 A;  2PAL A;  3DVJ A;  1WLZ A;  1EJ3 A;  3CS1 A;  3PAT A;  1BMO A;  2O5G A;  2PMY A;  4Q04 A;  3SG3 A;  2BL0 C;  2Y4Q A;  2F33 A;  4C0J A;  1JF0 A;  3SIB A;  1ZOT B; 
#chains in the Genus database with same CATH topology
 1YR5 A;  1RJV A;  4PHK A;  1OOH A;  5CSI A;  2H61 A;  2QEO A;  4FQO A;  1YX8 A;  4GGF A;  4MZK A;  2CNP A;  1SY9 A;  1S5G Z;  2M9G A;  2OPO A;  3A8R A;  3D75 A;  4YI9 A;  1P28 A;  1CDN A;  1CFD A;  2JQ6 A;  2WCM A;  1K95 A;  1R2U A;  3BFB A;  3EG5 B;  1RFJ A;  1Y0V H;  1YVH A;  2M8U A;  3A4U B;  1K9P A;  3B87 A;  3BUO B;  1CM4 A;  1RTP 1;  3NSL A;  1WY9 A;  1JC2 A;  1J1D A;  3BFA A;  3EVR A;  1OMV A;  2KFG A;  1G8I A;  1SW8 A;  3AKA A;  3D74 A;  4WRI A;  3VRR A;  3BOW A;  3R1V A;  5B8I B;  1IH0 A;  1QLK A;  4I5N B;  1MUX A;  1SCM B;  2JTT A;  3BJH A;  2EC6 B;  3EVU A;  3N7H A;  2M97 A;  2WOR A;  3PLF B;  3SS4 A;  2NZ0 A;  1M39 A;  2I18 A;  4UPG A;  1KK8 B;  2PQL A;  1DF0 B;  1SR6 B;  1QX2 A;  4WQ3 A;  1MR8 A;  1SCM C;  3SG7 A;  3DVM A;  2EC6 C;  2K7D A;  1FW4 A;  2LLS A;  3B7A A;  2ERB A;  1DJI A;  3S0F A;  1B9A A;  4N1F A;  2LNK A;  1KK8 C;  4GAO A;  1SR6 C;  4OKH A;  4YGA A;  2HPS A;  3BXK A;  4OCI A;  3IQO A;  1F4Q A;  1QS7 A;  5TNC A;  1JWD A;  5HKZ A;  1C07 A;  1QVI Z;  1H8B A;  3AKB A;  1K96 A;  1YUU A;  1M63 B;  2MJW B;  2KOT A;  3CAB A;  4DIR A;  4MSP A;  2KYF A;  1TUZ A;  2WND A;  1R6P A;  3BYA A;  3PAL A;  1DVI A;  3SG5 A;  4C0L A;  1LVC D;  2MHH A;  1XFV O;  1NYA A;  4C0K A;  1JFJ A;  2JNF A;  2L4H A;  3I5F B;  1IIO A;  2K60 A;  4KYN A;  2ZND A;  1DT7 B;  4IJ7 A;  1DEK A;  1IGV A;  1MQ1 A;  4MBE A;  2ZNE A;  1LS8 A;  3B6X A;  4NDD A;  1SRA A;  1MWN A;  3IQQ A;  1Z2C B;  1D1O A;  3I5F C;  2GTE A;  1BG1 A;  2FCE A;  3BUN B;  2O60 A;  1LIN A;  4JKT A;  4FTG A;  1EL4 A;  4CFQ A;  2WCB A;  3VRO A;  2LP3 A;  4MLW A;  1AJ4 A;  2K7O A;  2PYQ A;  3VGO A;  1KK7 Y;  1XFW O;  1CFC A;  3CZ2 A;  4XYN A;  2JU0 A;  1OQP A;  2EGD A;  2F2P A;  2LHI A;  2QEH A;  3D76 A;  1XFY O;  1OZS A;  1UHH A;  3TDI A;  2WC6 A;  1QIV A;  3JVT B;  5I8N A;  1SYM A;  1KQM B;  1CDL A;  2ZN8 A;  1DEL A;  3R1O A;  4NDB A;  2K2F A;  2KSP A;  1UHJ A;  3JVT C;  4I5K A;  1KQM C;  4YGE B;  1S6J A;  5HL1 A;  3WHU B;  2ZKM X;  2Y1M A;  1N2D A;  1WDC B;  1DQE A;  2JT0 A;  2KGR A;  3JTD B;  5JOL A;  3EVV A;  2R2I A;  2L98 A;  4PHJ A;  4R1E A;  1CNP A;  3CZ0 A;  1WDC C;  3JTD C;  3ZWH A;  2KQ6 A;  2LVJ A;  3L47 A;  1OSA A;  1BJF A;  1F71 A;  2F3Z A;  3OB1 B;  4PT1 A;  3LCP C;  1TUJ A;  1DMO A;  3RLZ A;  4F7F A;  1M45 A;  1TCO B;  1YUT A;  3UO9 A;  4DRW A;  2LVK A;  4BY4 A;  1SK6 D;  2WCH A;  4OV2 A;  1LA0 A;  1OOI X;  2WOS A;  4JD9 A;  5D7F A;  1J7Q A;  3R72 A;  1NP8 A;  2COL B;  3FS7 A;  2LVV A;  1GGZ A;  2MLE C;  1CMG A;  3BUM B;  3FE8 A;  1TNW A;  2BKH B;  4PHM A;  2BBN A;  2M7L A;  3SJS A;  2JXC A;  1N0Y A;  1SL8 A;  3CZT X;  2BE4 A;  3EK4 A;  3KF9 A;  1NCY A;  1FI5 A;  3B88 A;  1CMF A;  2BAP A;  2KDH A;  1CFF A;  3NHT A;  1WRK A;  5HLO A;  5DKR A;  5AAN A;  2CCM A;  1MHO A;  3DD4 A;  1WRL A;  2H8V A;  2QPT A;  3OP0 A;  3PFV A;  5I2O A;  1KFX L;  4QJ3 B;  4YRU A;  3CR4 X;  4F0Z B;  2M0R A;  5ER4 X;  4INW A;  3S0E A;  2DOQ A;  1QWV A;  1W7J B;  2BEC A;  1B8L A;  4GUK A;  4PE0 A;  1CTR A;  1RK9 A;  2K61 A;  1J55 A;  2JPT A;  4GPL B;  2KPH A;  2EHB A;  3NSK A;  4QJ4 B;  1DGU A;  2FJY A;  4JWQ A;  1Y1A A;  3DVE A;  1DJG A;  1XFX O;  1V1G A;  2ZRS A;  1PSB A;  1LXF C;  5AXI A;  2SAS A;  3OB2 B;  3F45 A;  4FQT A;  3SG6 A;  4AOM A;  2GGM A;  1UP5 A;  1XO5 A;  1A75 B;  2WCF A;  1UHK A;  4NDC A;  5PAL A;  5FYX A;  3VB1 A;  3CLN A;  1HT9 A;  1B1G A;  5CPV A;  4USL A;  1MXE A;  2FJU B;  5JJG A;  4M2O A;  2L2C A;  1KFU S;  5CSJ A;  1G4Y R;  2MBX A;  1YTZ C;  3O2P A;  4DUQ A;  1C7W A;  2QEB A;  1SL9 A;  2I2R E;  2L51 A;  5GQQ C;  2BE6 A;  1C3Z A;  2L4I A;  1IQ3 A;  1OOJ A;  2M1K B;  2P6B B;  2M7N A;  5CSN A;  2H2K A;  2KI4 B;  4INX A;  1F54 A;  3PM8 A;  1DC1 A;  4DCK A;  3OX5 A;  5BPJ A;  1FPW A;  3H4S E;  1KK7 Z;  2KI4 C;  1NUB A;  1PK0 D;  2LMT A;  2V53 A;  2RGI A;  3L4L A;  4OR9 B;  2BNX A;  1KSO A;  3SS5 A;  1Y6W A;  2Q91 A;  4HRH A;  2KLE A;  2HQW A;  2CT9 A;  2LHL A;  4N5X A;  2JC2 A;  2LC5 A;  1PVA A;  5DKQ A;  3LK0 A;  1EXR A;  2WCK A;  3CR2 A;  1KFX S;  1XFR A;  3MSE B;  4CFR A;  5AEQ A;  2LUC A;  1YRT B;  2KAY A;  2YGU A;  5DKN A;  3DVK A;  1K93 D;  3NXA A;  2ZFD A;  5HKW A;  2F8P A;  1SNL A;  5KU1 A;  4QJ5 B;  2NLN A;  2B1U A;  1Q80 A;  3NSI A;  4GGN A;  3OHM B;  4PE1 A;  2BCX A;  4M2Q A;  5CSF A;  2QAC A;  3HX4 A;  1OMR A;  4PE4 A;  2GV5 A;  2OS8 C;  1JFK A;  2IS9 A;  1NCX A;  1UUR A;  5AFP A;  1PVB A;  2K0J A;  1A2X A;  1F4O A;  5I2Q A;  4ORB B;  1AK8 A;  1NX1 A;  3RZS A;  4ZCV A;  1NSH A;  3FIA A;  1B7T Y;  3EKH A;  1DJZ A;  3TS5 C;  1AHR A;  3O4X A;  1SBJ A;  1WLM A;  1C7V A;  1A75 A;  2KI6 C;  1K2H A;  5FI6 A;  3PM2 A;  5F6T A;  4CLN A;  2KNE A;  2L50 A;  3D78 A;  1F70 A;  1XYD A;  2NXQ A;  1EG4 A;  2JUL A;  2WC5 A;  4GFT A;  1GM0 A;  1DF0 A;  2F3Y A;  4MEW A;  3TDU A;  2FOT A;  1HQV A;  3UNW A;  1CLL A;  2SCP A;  3O4Y A;  1CDP A;  1OW4 A;  1ZMZ A;  1CLM A;  1M46 A;  3NSO A;  3CTN A;  1ZFS A;  3C1V A;  4YGB B;  4OVN F;  1TOP A;  1IWQ A;  1OOF A;  1PAL A;  1YRU B;  3O6B A;  3WNX B;  5KSZ A;  1CM1 A;  2KQY A;  1V1F A;  2H61 C;  3I5G B;  1M31 A;  3CYZ A;  1TWO A;  3CZ1 A;  3S0D A;  4D1E A;  2LMU A;  2JRF A;  3IF7 A;  2KAX A;  1J7P A;  2LP2 A;  3CWG A;  1YUS A;  3I5G C;  1U5I B;  2KLD A;  4YGD B;  1TCF A;  1ALV A;  2CTN A;  3DXL A;  3GK4 X;  1DGV A;  4HSZ A;  5ER5 A;  5I94 A;  3KEV A;  2Y5I A;  1OOG A;  3KO0 A;  2F2O A;  4L9M A;  1EG3 A;  2KFF A;  3GK2 A;  2P70 A;  1TNP A;  4I5J A;  4U8D A;  1SMG A;  1TN4 A;  5IBW A;  3L4A A;  4A4C A;  2WCL A;  4NQG A;  1AP4 A;  1BLQ A;  2ISD A;  3CGA A;  2MLF C;  5KTY A;  1S3P A;  1DJH A;  1REC A;  1BOC A;  2LE9 B;  2JWW A;  2PVB A;  1E8A A;  1S26 D;  3R1P A;  2ZRT A;  1XVJ A;  1IJ5 A;  2MRD A;  4IL1 A;  1CLB A;  5K89 A;  3VRN A;  1GQM A;  1CFP A;  1W7I B;  5D3O A;  1BF5 A;  1UWO A;  1VRK A;  1UUS A;  3ZNI A;  2JOJ A;  3E3R A;  1S6I A;  2LCP A;  4DS7 A;  1Z4H A;  2MAZ A;  1CB1 A;  1AJ5 A;  1B8R A;  1LKJ A;  2LAN A;  3D0Y B;  1K8U A;  4AQI A;  3VRQ A;  3DZT A;  1K90 D;  5HKY A;  1FF1 A;  2KFH A;  2WCE A;  2E30 A;  4YBH B;  3CR5 X;  3LK1 A;  3AAJ A;  1TRF A;  3BFH A;  1S36 A;  3EK7 A;  5AER A;  1IQ5 A;  1NX0 A;  1SKT A;  2KHN A;  2HET A;  2KI6 D;  1RRO A;  3PN7 B;  2JT8 A;  2KYC A;  3AAK A;  4JQ0 D;  1DJY A;  1C3Y A;  1K9K A;  3I5I B;  1QX5 B;  2Y1N A;  3OBV A;  2Q4U A;  1QX7 A;  1BU3 A;  1Y1X A;  2AMI A;  2K7C A;  3PN7 C;  2M3W A;  3DYE A;  1IG5 A;  1QIW A;  2M29 A;  3I5I C;  3K1E A;  3VRP A;  1EH2 A;  4OZD A;  1J7R A;  4ORC B;  1RWY A;  3S0A A;  3BUW B;  3GK1 A;  2KAV A;  1UHI A;  3HCM A;  1L7Z A;  2P71 A;  1NX2 A;  1B8C A;  1Y1U A;  3V2L A;  2VRG A;  3KHE A;  3Q8I A;  3BQ3 A;  2JT3 A;  1U5I A;  1S1E A;  1FI6 A;  4P5O E;  3SIA A;  4MZJ A;  3PJI A;  3M0W A;  1XK4 C;  2LLU A;  5G08 A;  5FI7 A;  1XA5 A;  1B4C A;  4WQ2 A;  2L2E A;  3OX6 A;  1NCZ A;  2QDI A;  4MRX A;  1ZAC A;  1A4P A;  1G33 A;  3OGN A;  2WC8 A;  1OMD A;  1QJT A;  2TN4 A;  1UHN A;  4M2P A;  1S5G Y;  4HRG A;  2LAP A;  4TNC A;  1XFU O;  2HQ8 A;  1DJX A;  2BCA A;  1WRZ A;  3O78 A;  4YGC B;  1B7T Z;  1SPY A;  2LVI A;  3K21 A;  3TUY B;  4GBA A;  3D73 A;  1T14 A;  2L0P A;  2I94 A;  2QEV A;  1ALW A;  1ORG A;  2LMV A;  2JTZ A;  1OZO A;  3DF0 B;  3QME A;  4PHN A;  5HLV A;  3TZ1 A;  2JNX A;  1GGW A;  3EK8 A;  2LM5 A;  2KBM A;  4ETO A;  3TUY C;  4PAL A;  2OS8 B;  3CDN A;  3S0G A;  4MVF A;  2OTG B;  3EKJ A;  3FE9 A;  4ICB A;  1QXP A;  1DTL A;  1TNQ A;  2K7B A;  3D0Y A;  3KPX A;  3GOF A;  4YI8 A;  1FBV A;  3TS5 B;  1QAT A;  2OTG C;  1QV1 A;  4P2Y B;  1KQV A;  5FI2 A;  1MF8 B;  3D77 A;  1OE9 B;  1NX3 A;  5J3X A;  3SG2 A;  2ZN9 A;  2NCP A;  4XJK B;  2PSR A;  1CKK A;  1KCY A;  1JSA A;  1JBA A;  2KGB C;  3DY9 A;  1AVS A;  1QVI Y;  4HRE E;  1CDM A;  3LL8 B;  1JF2 A;  1B47 A;  1SSE B;  4AQJ A;  1LA3 A;  1NWD A;  3QRX A;  3RM1 A;  3FWC A;  5I2L A;  4PDZ A;  1XFZ O;  4I5L B;  1AUI B;  2PRU A;  1PRW A;  2LV7 A;  2L5X B;  4MRY A;  4A4B A;  4ZCU A;  1TIZ A;  1J1E A;  1SL7 A;  2D8N A;  2CXJ A;  1X02 A;  1XK4 A;  4PCW A;  1H4B A;  1MXL C;  2A4J A;  3ICB A;  1GJY A;  2BBM A;  4CPV A;  1K94 A;  2CBL A;  1JUO A;  2PAS A;  1BT6 A;  4GGF C;  1YX7 A;  1L2O B;  1QTX A;  1YUR A;  3WXA A;  1TTX A;  1K9U A;  4JPZ B;  1IKU A;  2JZI A;  3BOW B;  3FE6 A;  2AAO A;  3I5H B;  1QV0 A;  1IRJ A;  1L2O C;  2KBI A;  2L5Y A;  4BY5 A;  4E68 A;  1PSR A;  1F8H A;  4MZL A;  1TNX A;  1IJ6 A;  3I5H C;  1N65 A;  3SG4 A;  3LLE A;  3S0B A;  2LUX A;  2I7A A;  2HF5 A;  2M1U A;  3BUX B;  1A29 A;  2K2A A;  3PSR A;  1PUL A;  1DJW A;  1BOD A;  3D10 A;  2G2B A;  3SS3 A;  3DF0 A;  3WHT B;  1SCV A;  1KFU L;  3NHI A;  1NIW A;  2GGZ A;  2K8M B;  2BCB A;  2G9B A;  5D69 A;  1J7O A;  1YVL A;  1A03 A;  1QAS A;  4CID A;  1W9Z A;  1KWO B;  3IVT A;  2BKI B;  2E6W A;  1BR4 B;  3FWB A;  3TDZ A;  1ODB A;  4MN0 A;  2M49 B;  1KWO C;  1NPQ A;  2JXL A;  5DIC A;  4ORA B;  4GNK B;  2LLT A;  3NGV A;  1F55 A;  1S6C A;  2WCJ A;  5HYD A;  4N1G A;  1KSM A;  2JPO A;  1QLS A;  2FCD A;  2AUC A;  1ZUZ A;  4XJK A;  2MA2 A;  2NCO A;  1BR1 B;  2BL0 B;  4PE7 A;  2PAL A;  3DVJ A;  5EL2 A;  1WLZ A;  1EJ3 A;  3CS1 A;  3PAT A;  1BMO A;  2O5G A;  2PMY A;  4Q04 A;  3SG3 A;  2BL0 C;  2Y4Q A;  2F33 A;  4C0J A;  1JF0 A;  3SIB A;  3B86 A;  1ZOT B; 
#chains in the Genus database with same CATH homology
 1YR5 A;  1RJV A;  4PHK A;  5CSI A;  2H61 A;  4FQO A;  1YX8 A;  4GGF A;  4MZK A;  2CNP A;  1SY9 A;  1S5G Z;  2M9G A;  2OPO A;  3A8R A;  4YI9 A;  1CDN A;  1CFD A;  2JQ6 A;  1K95 A;  1R2U A;  1RFJ A;  1Y0V H;  1YVH A;  2M8U A;  3A4U B;  1K9P A;  3BUO B;  3NSL A;  1CM4 A;  1RTP 1;  1WY9 A;  1JC2 A;  1J1D A;  3EVR A;  1OMV A;  2KFG A;  1G8I A;  1SW8 A;  3AKA A;  4WRI A;  1IH0 A;  3VRR A;  3BOW A;  5B8I B;  1QLK A;  4I5N B;  1MUX A;  1SCM B;  2JTT A;  2EC6 B;  3EVU A;  2M97 A;  2WOR A;  3PLF B;  2NZ0 A;  1M39 A;  2I18 A;  4UPG A;  1KK8 B;  1DF0 B;  1SR6 B;  1QX2 A;  4WQ3 A;  1MR8 A;  1SCM C;  3SG7 A;  3DVM A;  2EC6 C;  2K7D A;  1FW4 A;  2LLS A;  1DJI A;  1B9A A;  4N1F A;  2LNK A;  1KK8 C;  4GAO A;  1SR6 C;  4OKH A;  4YGA A;  2HPS A;  3BXK A;  4OCI A;  3IQO A;  1F4Q A;  1QS7 A;  5TNC A;  1JWD A;  5HKZ A;  1C07 A;  1QVI Z;  1H8B A;  3AKB A;  1K96 A;  1YUU A;  1M63 B;  2MJW B;  2KOT A;  4DIR A;  4MSP A;  2KYF A;  2WND A;  1R6P A;  3BYA A;  3PAL A;  1DVI A;  3SG5 A;  4C0L A;  1LVC D;  2MHH A;  1XFV O;  1NYA A;  4C0K A;  1JFJ A;  2JNF A;  2L4H A;  3I5F B;  1DT7 B;  2ZND A;  1MQ1 A;  1IGV A;  4MBE A;  2ZNE A;  4NDD A;  1SRA A;  1MWN A;  3IQQ A;  1D1O A;  3I5F C;  1BG1 A;  2FCE A;  3BUN B;  2O60 A;  1LIN A;  4FTG A;  1EL4 A;  2WCB A;  3VRO A;  2LP3 A;  4MLW A;  1AJ4 A;  2K7O A;  3VGO A;  1KK7 Y;  1XFW O;  1CFC A;  4XYN A;  2JU0 A;  1OQP A;  2EGD A;  2F2P A;  2LHI A;  1XFY O;  1OZS A;  1UHH A;  3TDI A;  1QIV A;  3JVT B;  5I8N A;  1SYM A;  1KQM B;  1CDL A;  2ZN8 A;  4NDB A;  2K2F A;  2KSP A;  1UHJ A;  3JVT C;  4I5K A;  1KQM C;  4YGE B;  1S6J A;  3WHU B;  2ZKM X;  2Y1M A;  1N2D A;  1WDC B;  3JTD B;  2JT0 A;  2KGR A;  5JOL A;  3EVV A;  2R2I A;  2L98 A;  4PHJ A;  4R1E A;  1CNP A;  3JTD C;  1WDC C;  3ZWH A;  2KQ6 A;  2LVJ A;  1OSA A;  1BJF A;  1F71 A;  2F3Z A;  3OB1 B;  3LCP C;  1DMO A;  3RLZ A;  1M45 A;  1TCO B;  1YUT A;  4DRW A;  2LVK A;  4BY4 A;  1SK6 D;  4OV2 A;  1LA0 A;  2WOS A;  5D7F A;  1J7Q A;  1NP8 A;  2COL B;  3FS7 A;  2LVV A;  1GGZ A;  2MLE C;  1CMG A;  3BUM B;  1TNW A;  2BKH B;  4PHM A;  2BBN A;  2M7L A;  3SJS A;  2JXC A;  1N0Y A;  1SL8 A;  3CZT X;  2BE4 A;  3EK4 A;  3KF9 A;  1NCY A;  1FI5 A;  1CMF A;  2KDH A;  1CFF A;  1WRK A;  5HLO A;  5DKR A;  5AAN A;  2CCM A;  1MHO A;  3DD4 A;  1WRL A;  2QPT A;  3OP0 A;  3PFV A;  5I2O A;  1KFX L;  4QJ3 B;  4YRU A;  3CR4 X;  4F0Z B;  2M0R A;  5ER4 X;  2DOQ A;  1W7J B;  2BEC A;  1B8L A;  4GUK A;  4PE0 A;  1CTR A;  1RK9 A;  2K61 A;  1J55 A;  2JPT A;  4GPL B;  3NSK A;  2EHB A;  4QJ4 B;  1DGU A;  4JWQ A;  1Y1A A;  3DVE A;  1DJG A;  1XFX O;  1V1G A;  2ZRS A;  1PSB A;  1LXF C;  5AXI A;  2SAS A;  3OB2 B;  3F45 A;  3SG6 A;  4AOM A;  2GGM A;  1UP5 A;  1XO5 A;  1A75 B;  2WCF A;  1UHK A;  4NDC A;  5PAL A;  5FYX A;  1B1G A;  3CLN A;  1HT9 A;  5CPV A;  4USL A;  1MXE A;  2FJU B;  5JJG A;  4M2O A;  1KFU S;  5CSJ A;  1G4Y R;  2MBX A;  1YTZ C;  3O2P A;  4DUQ A;  1C7W A;  1SL9 A;  2I2R E;  2L51 A;  5GQQ C;  2BE6 A;  2L4I A;  1IQ3 A;  1OOJ A;  2M1K B;  2P6B B;  2M7N A;  5CSN A;  2H2K A;  2KI4 B;  1F54 A;  3PM8 A;  4DCK A;  3OX5 A;  5BPJ A;  1FPW A;  3H4S E;  1KK7 Z;  2KI4 C;  1NUB A;  1PK0 D;  2LMT A;  2V53 A;  2RGI A;  4OR9 B;  1KSO A;  1Y6W A;  2Q91 A;  4HRH A;  2HQW A;  2CT9 A;  2LHL A;  4N5X A;  2JC2 A;  2LC5 A;  1PVA A;  5DKQ A;  3LK0 A;  1EXR A;  3CR2 A;  1KFX S;  3MSE B;  4CFR A;  5AEQ A;  2LUC A;  1YRT B;  2KAY A;  5DKN A;  3DVK A;  1K93 D;  3NXA A;  2ZFD A;  5HKW A;  2F8P A;  1SNL A;  5KU1 A;  4QJ5 B;  2NLN A;  2B1U A;  1Q80 A;  3NSI A;  4GGN A;  3OHM B;  4PE1 A;  2BCX A;  4M2Q A;  5CSF A;  2QAC A;  3HX4 A;  1OMR A;  4PE4 A;  2GV5 A;  2OS8 C;  1JFK A;  2IS9 A;  1NCX A;  1UUR A;  5AFP A;  1PVB A;  2K0J A;  1A2X A;  1F4O A;  5I2Q A;  4ORB B;  1AK8 A;  1NX1 A;  4ZCV A;  1NSH A;  3FIA A;  1B7T Y;  3EKH A;  1DJZ A;  3TS5 C;  1AHR A;  1SBJ A;  1WLM A;  1C7V A;  1A75 A;  2KI6 C;  1K2H A;  5F6T A;  4CLN A;  2KNE A;  2L50 A;  1F70 A;  1XYD A;  2NXQ A;  1EG4 A;  2JUL A;  4GFT A;  1DF0 A;  2F3Y A;  4MEW A;  3TDU A;  2FOT A;  1HQV A;  1CLL A;  2SCP A;  3O4Y A;  1CDP A;  1ZMZ A;  1CLM A;  1M46 A;  3NSO A;  3CTN A;  1ZFS A;  3C1V A;  4YGB B;  4OVN F;  1TOP A;  1IWQ A;  1YRU B;  1PAL A;  3WNX B;  3O6B A;  5KSZ A;  1CM1 A;  2KQY A;  1V1F A;  2H61 C;  3I5G B;  1M31 A;  4D1E A;  2LMU A;  2JRF A;  3IF7 A;  2KAX A;  1J7P A;  2LP2 A;  3CWG A;  1YUS A;  3I5G C;  1U5I B;  4YGD B;  1TCF A;  1ALV A;  2CTN A;  4HSZ A;  3GK4 X;  1DGV A;  5ER5 A;  3KEV A;  2Y5I A;  3KO0 A;  2F2O A;  4L9M A;  1EG3 A;  2KFF A;  3GK2 A;  1TNP A;  4I5J A;  4U8D A;  1SMG A;  1TN4 A;  5IBW A;  4A4C A;  1BLQ A;  4NQG A;  1AP4 A;  2ISD A;  3CGA A;  2MLF C;  5KTY A;  1S3P A;  1DJH A;  1REC A;  1BOC A;  2LE9 B;  2JWW A;  2PVB A;  1E8A A;  1S26 D;  2ZRT A;  1XVJ A;  1IJ5 A;  2MRD A;  4IL1 A;  1CLB A;  5K89 A;  3VRN A;  1GQM A;  1CFP A;  1W7I B;  1BF5 A;  1UWO A;  1VRK A;  1UUS A;  3ZNI A;  2JOJ A;  3E3R A;  1S6I A;  2LCP A;  4DS7 A;  2MAZ A;  1CB1 A;  1AJ5 A;  1B8R A;  1LKJ A;  2LAN A;  3D0Y B;  1K8U A;  4AQI A;  3VRQ A;  5HKY A;  1K90 D;  1FF1 A;  2KFH A;  2WCE A;  2E30 A;  4YBH B;  3CR5 X;  3LK1 A;  3AAJ A;  1TRF A;  3EK7 A;  1S36 A;  5AER A;  1IQ5 A;  1NX0 A;  1SKT A;  2KHN A;  2HET A;  2KI6 D;  1RRO A;  3PN7 B;  2JT8 A;  2KYC A;  3AAK A;  4JQ0 D;  1DJY A;  1K9K A;  3I5I B;  1QX5 B;  2Y1N A;  2Q4U A;  1QX7 A;  1BU3 A;  1Y1X A;  2AMI A;  2K7C A;  3PN7 C;  2M3W A;  1IG5 A;  1QIW A;  2M29 A;  3I5I C;  3VRP A;  1EH2 A;  1J7R A;  4ORC B;  1RWY A;  3BUW B;  3GK1 A;  2KAV A;  1UHI A;  3HCM A;  1L7Z A;  1NX2 A;  1B8C A;  1Y1U A;  2VRG A;  3KHE A;  3BQ3 A;  2JT3 A;  1U5I A;  1S1E A;  1FI6 A;  4P5O E;  3SIA A;  4MZJ A;  5G08 A;  3M0W A;  1XK4 C;  2LLU A;  1XA5 A;  1B4C A;  4WQ2 A;  2L2E A;  3OX6 A;  1NCZ A;  4MRX A;  1ZAC A;  1A4P A;  1G33 A;  2WC8 A;  1OMD A;  1QJT A;  2TN4 A;  1UHN A;  4M2P A;  1S5G Y;  4HRG A;  2LAP A;  4TNC A;  1XFU O;  2HQ8 A;  1DJX A;  2BCA A;  1WRZ A;  3O78 A;  4YGC B;  1B7T Z;  1SPY A;  2LVI A;  3K21 A;  3TUY B;  4GBA A;  2L0P A;  2I94 A;  1ALW A;  2LMV A;  3DF0 B;  2JTZ A;  1OZO A;  4PHN A;  5HLV A;  3TZ1 A;  4CFQ A;  2JNX A;  1GGW A;  3EK8 A;  2LM5 A;  2KBM A;  4ETO A;  3TUY C;  4PAL A;  2OS8 B;  4MVF A;  2OTG B;  3EKJ A;  4ICB A;  1QXP A;  1DTL A;  1TNQ A;  2K7B A;  3D0Y A;  3KPX A;  3GOF A;  4YI8 A;  1FBV A;  3TS5 B;  1QAT A;  2OTG C;  1QV1 A;  4P2Y B;  1KQV A;  1MF8 B;  3SG2 A;  1OE9 B;  1NX3 A;  5J3X A;  2ZN9 A;  2NCP A;  4XJK B;  2PSR A;  1CKK A;  1KCY A;  1JSA A;  1JBA A;  2KGB C;  1AVS A;  1QVI Y;  4HRE E;  1CDM A;  3LL8 B;  1JF2 A;  1B47 A;  4AQJ A;  1LA3 A;  1NWD A;  3QRX A;  3RM1 A;  3FWC A;  5I2L A;  4PDZ A;  1XFZ O;  4I5L B;  1AUI B;  2PRU A;  1PRW A;  2LV7 A;  2L5X B;  4MRY A;  4A4B A;  4ZCU A;  1TIZ A;  1J1E A;  1SL7 A;  2D8N A;  2CXJ A;  1X02 A;  1XK4 A;  4PCW A;  1H4B A;  1MXL C;  2A4J A;  3ICB A;  1GJY A;  2BBM A;  4CPV A;  1K94 A;  2CBL A;  1JUO A;  2PAS A;  1BT6 A;  4GGF C;  1YX7 A;  1L2O B;  1QTX A;  1YUR A;  3WXA A;  1TTX A;  1K9U A;  4JPZ B;  1IKU A;  2JZI A;  3BOW B;  2AAO A;  3I5H B;  1QV0 A;  1IRJ A;  1L2O C;  2KBI A;  4BY5 A;  4E68 A;  1PSR A;  1F8H A;  4MZL A;  1TNX A;  1IJ6 A;  3I5H C;  1N65 A;  3SG4 A;  3LLE A;  2LUX A;  2I7A A;  2HF5 A;  2M1U A;  3BUX B;  1A29 A;  2K2A A;  3PSR A;  1PUL A;  1DJW A;  1BOD A;  3D10 A;  2G2B A;  3DF0 A;  3WHT B;  1SCV A;  1KFU L;  1NIW A;  2GGZ A;  2K8M B;  2BCB A;  2G9B A;  5D69 A;  1J7O A;  1YVL A;  1A03 A;  1QAS A;  4CID A;  1KWO B;  2BKI B;  2E6W A;  1BR4 B;  3FWB A;  3TDZ A;  1ODB A;  4MN0 A;  2M49 B;  1KWO C;  1NPQ A;  2JXL A;  4ORA B;  4GNK B;  2LLT A;  1F55 A;  1S6C A;  5HYD A;  4N1G A;  1KSM A;  1QLS A;  2FCD A;  2AUC A;  1ZUZ A;  4XJK A;  2MA2 A;  2NCO A;  1BR1 B;  2BL0 B;  4PE7 A;  2PAL A;  3DVJ A;  1WLZ A;  1EJ3 A;  3CS1 A;  3PAT A;  1BMO A;  2O5G A;  2PMY A;  4Q04 A;  3SG3 A;  2BL0 C;  2Y4Q A;  2F33 A;  4C0J A;  1JF0 A;  3SIB A;  1ZOT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...