3BFAA

Crystal structure of a pheromone binding protein from apis mellifera in complex with the queen mandibular pheromone
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
total genus 40
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bfaA00
2P71A 3L47A 3S0GA 3CZ0A 2KPHA 3N7HA 2WC6A 3S0BA 1LS8A 3BJHA 1OOIX 3CZ1A 3D74A 3CABA 3PJIA 4INWA 3R1OA 3B7AA 3S0EA 5EL2A 2WC5A 3DZTA 1OOHA 1OOGA 1TUJA 3DYEA 2QEHA 3DXLA 3DY9A 3B88A 2QEVA 3QMEA 3R1PA 3B6XA 3VB1A 2ERBA 3D76A 3OGNA 3D77A 3S0FA 4PT1A 3L4AA 2GTEA 1QWVA 3S0DA 1P28A 3CDNA 1XFRA 1TWOA 1T14A 3D78A 4F7FA 2PQLA 3R1VA 3BFBA 2WCMA 2L2CA 4FQTA 2JPOA 2WCLA 3S0AA 4JD9A 3CYZA 3R72A 1OOFA 3FE6A 3NHTA 2QEOA 3NHIA 3K1EA 4INXA 1OW4A 2WCJA 2FJYA 1C3ZA 2QEBA 3FE8A 3V2LA 5DICA 3B87A 3BFHA 1C3YA 1ORGA 3CZ2A 3D75A 3RZSA 2QDIA 2WCKA 3BFAA 1DQEA 2WCHA 4OZDA 3B86A 2H8VA 3FE9A 2P70A 3Q8IA 3D73A 3L4LA 3NGVA 1GM0A
chains in the Genus database with same CATH superfamily
2K8MB 2F2OA 3PN7C 1CFFA 2FCEA 1K2HA 2M0RA 3CWGA 1EH2A 2M8UA 3BOWA 1DVIA 2M9GA 5I2QA 3TUYC 2KAVA 1YVHA 1PSBA 2Y4QA 3CZTX 3DD4A 3BJHA 4PHKA 1OOIX 3CZ1A 4JKTA 3AAKA 2A4JA 3WNXB 3PALA 1M39A 3FWCA 2LLTA 3I5HB 3IVTA 2Y1MA 1PRWA 1NUBA 4MBEA 2KNEA 3B7AA 3JTDB 1DF0A 1UP5A 1U5IB 2JNXA 4DRWA 3WHUB 2WC8A 3OX5A 2NLNA 1TN4A 5FYXA 1IWQA 1OE9B 1IRJA 1TCOB 2CBLA 2WC5A 1KFUS 1XA5A 2M7NA 3GOFA 4AOMA 1J7QA 2GGMA 2LVKA 1FI6A 3EK4A 2KQYA 2OS8C 1VRKA 3CLNA 1QX2A 2BE6A 5HLOA 3NSKA 2HF5A 3DY9A 1MF8B 2JTZA 3PM8A 1AK8A 2QEVA 3NSLA 1XFXO 2MLFC 3SS5A 1QX7A 3A4UB 3PLFB 3R1PA 1J1EA 1RWYA 2I7AA 2M97A 3DVMA 1CMFA 1UHJA 2ERBA 3KHEA 1KK8B 1C7WA 1LINA 1YX8A 3LL8B 1OOJA 2WOSA 3CTNA 4I5NB 4AQIA 3CGAA 2PVBA 3L4AA 1GQMA 2NCOA 2ZNEA 2PSRA 1KSMA 3BUXB 3O4XA 1TNPA 5CSFA 3D0YA 1DEKA 3NXAA 4R1EA 2ZRSA 4WQ2A 1YUUA 4YI9A 2AUCA 5K89A 5HKWA 5KSZA 2KBIA 3MSEB 1IH0A 1WRLA 2SASA 3R1VA 5D7FA 1SK6D 1H4BA 1B1GA 4PE1A 1WY9A 2KI4B 2L2CA 1LA0A 1B8RA 3OP0A 4MZLA 1L7ZA 2AMIA 1QATA 2JPOA 1A75B 2BNXA 3BUNB 2F8PA 5D69A 3I5GC 3S0AA 1CDPA 3CYZA 2LP2A 4PHMA 2K7OA 3WXAA 2F3YA 3AKAA 1ALWA 3R72A 1IJ6A 2JTTA 1OOFA 1IGVA 4C0JA 1IJ5A 2QEOA 2KOTA 1A2XA 2NCPA 4YGDB 1XFUO 1QTXA 1OW4A 2CNPA 1B9AA 1V1GA 3C1VA 4XJKB 1DJYA 1B8CA 1TNWA 1TCFA 1C3ZA 2FJYA 2L0PA 3ZWHA 4GGFA 3V2LA 1Y0VH 4NDDA 2G9BA 1YRTB 2OPOA 3JVTC 4HREE 1XYDA 1KFUL 4I5JA 4OCIA 3CR5X 5F6TA 2JULA 3B87A 1SCMB 3SS4A 1N0YA 1EXRA 1M63B 1DJXA 2LAPA 5CPVA 2H61A 4A4CA 1NPQA 4CFQA 1JC2A 3RZSA 4JQ0D 2BE4A 1Y1UA 1EJ3A 1DQEA 4PDZA 5TNCA 1CB1A 1SR6C 5KU1A 2BKHB 2NXQA 3B86A 2H8VA 1KK7Y 4FTGA 2BCAA 3L4LA 3AAJA 1XFWO 3NGVA 1NCYA 2KI6C 4USLA 5CSJA 3BYAA 4E68A 1KK7Z 3VRPA 4GGNA 2PYQA 2P71A 3DF0A 1V1FA 2E30A 4PCWA 3WHTB 1NIWA 3KO0A 1L2OB 2CT9A 4YGBB 2FJUB 3N7HA 1J55A 1QLKA 2LHLA 2LLUA 3DVEA 1CFDA 2YGUA 5AFPA 1UURA 3I5HC 2R2IA 1F8HA 1K9KA 1JBAA 1QASA 1SW8A 4DCKA 1JWDA 1BU3A 1GJYA 1IG5A 1RFJA 3JTDC 3R1OA 1SRAA 3SIBA 2KFFA 4QJ5B 2K7CA 4HRGA 1LXFC 1FI5A 1MXEA 1Y1XA 1QJTA 2F2PA 1Y6WA 2JXCA 2Y1NA 2K2FA 2KAXA 2F33A 1F55A 1RECA 1TUJA 2LMUA 2K2AA 2MHHA 2KAYA 3DYEA 1QX5B 1JFJA 1AJ4A 4YGCB 1OZSA 1SSEB 2HQWA 2LLSA 4AQJA 5AERA 1G33A 2CTNA 2WCFA 1SL9A 3D10A 1SKTA 3LCPC 1Y1AA 1YTZC 1C07A 1CFPA 4ZCUA 4WQ3A 2AAOA 5J3XA 1KK8C 2Q91A 3BOWB 2ZN9A 1DELA 2BKIB 3D76A 4UPGA 1FF1A 1NX3A 3CR4X 1JF0A 3S0FA 3DVKA 2DOQA 2QACA 1DT7B 2L4IA 3SG7A 3TDIA 2LMVA 3E3RA 1NYAA 1QWVA 1QXPA 4D1EA 1F71A 2QPTA 4MRYA 2KFHA 1P28A 1DJZA 1KQMB 2BCXA 2L5XB 2PASA 3BUOB 4HSZA 5DKQA 2JNFA 1A4PA 1ODBA 1UHKA 1XVJA 1YVLA 2M49B 2EHBA 1DF0B 2M3WA 2EGDA 2I94A 3I5IB 2JT0A 4F7FA 3EVUA 2PQLA 1TTXA 2KI4C 2KYFA 3BFBA 2WCMA 2CXJA 1K93D 4MZJA 4GBAA 1Q80A 1SL8A 2BBNA 4FQTA 2WCLA 4PE0A 3VRQA 2LUCA 4MN0A 4C0LA 1WLZA 4JD9A 1BT6A 1WDCB 2KDHA 4MSPA 4OKHA 1DJGA 3RLZA 2SCPA 2KLDA 4JWQA 3FE6A 1OSAA 3NHTA 1BG1A 1DJHA 1IIOA 1S3PA 1NSHA 1ALVA 2OTGB 4INXA 4NQGA 4IJ7A 4NDCA 3OB1B 4YI8A 3BUWB 2ZKMX 3EK7A 1AHRA 1F4OA 3FE8A 2MBXA 1SCMC 1XK4C 1B7TZ 1RROA 1YUSA 3BXKA 1SCVA 1BR4B 4L9MA 1OMRA 3ZNIA 4CLNA 5I2LA 5HL1A 1S26D 1SNLA 1PVBA 2QDIA 2WCKA 2HETA 4M2QA 1FBVA 3OB2B 1DC1A 1ZMZA 4BY4A 1BR1B 1K9UA 1W9ZA 4MLWA 3LK0A 1CLLA 1TUZA 4WRIA 2I2RE 4MZKA 1W7JB 1YUTA 1IKUA 2KGBC 1PULA 2HQ8A 2LHIA 1FW4A 3A8RA 3VGOA 4A4BA 1GM0A 3ICBA 1QIVA 1WRKA 3I5FB 3H4SE 3L47A 3TS5B 3S0GA 2BL0B 1L2OC 3K21A 1BMOA 2O5GA 2M1KB 3CZ0A 2JWWA 1K90D 2JOJA 2MLEC 2PMYA 2WC6A 5HLVA 1LS8A 4F0ZB 1SPYA 1NX0A 2FOTA 2WNDA 1DMOA 1YRUB 1SMGA 1ZFSA 5JJGA 1KFXS 3CABA 1OMDA 2ZFDA 1S6IA 1X02A 3PJIA 4INWA 1OMVA 1K96A 3BUMB 1CMGA 1B4CA 2E6WA 3S0EA 2M7LA 4XJKA 4N1GA 5EL2A 3O2PA 4I5KA 3FIAA 2JT8A 4TNCA 1B8LA 3DZTA 1G4YR 1OOGA 3O6BA 2ZNDA 1LKJA 1MQ1A 4PALA 1DTLA 1GGZA 3DXLA 5IBWA 1MXLC 1B47A 3B88A 3EG5B 3DF0B 1HT9A 3PSRA 2KFGA 2GGZA 4PHJA 4CPVA 3OGNA 3PFVA 4QJ3B 3SG2A 3SG3A 3HCMA 3SG5A 1NWDA 2KI6D 2GTEA 1XFZO 4ZCVA 4PHNA 1KQMC 1F54A 4IL1A 3S0DA 5B8IB 3SG6A 1M45A 3RM1A 3O4YA 3OBVA 1C7VA 1QV1A 1XFRA 5I2OA 1N65A 1QS7A 3I5IC 3LLEA 4DIRA 1MUXA 1M46A 1YX7A 1ZACA 2D8NA 5GQQC 1BLQA 1G8IA 1HQVA 2VRGA 3EK8A 1OZOA 1JUOA 2NZ0A 2RGIA 5D3OA 1RJVA 1DGVA 4YGAA 1K94A 1EG4A 4M2PA 2H2KA 4N1FA 1A29A 1PVAA 3BQ3A 3O78A 3LK1A 2Y5IA 1S6JA 1S5GZ 1WDCC 2K60A 2PALA 4PE4A 2K0JA 3VRNA 2LCPA 1CKKA 2F3ZA 4YBHB 4GAOA 1J7PA 1K9PA 1YURA 1QLSA 5PALA 2LP3A 1FPWA 1ZUZA 1AUIB 1AVSA 1CDMA 1KFXL 2L51A 2Q4UA 4YRUA 1CDLA 3NHIA 2KYCA 1CDNA 1D1OA 2OTGC 5I94A 1K8UA 1KWOB 2KGRA 4ORAB 2COLB 2P6BB 2BBMA 3GK1A 1BOCA 1Z4HA 2JC2A 2KBMA 1CM1A 2JU0A 1BODA 1MR8A 1F70A 2QEBA 3SJSA 1ZOTB 2BAPA 5ER4X 2MRDA 1GGWA 2ZRTA 1AJ5A 1CLMA 4N5XA 1PK0D 3BFHA 1TRFA 5HKYA 3D75A 2EC6B 3EVRA 2LVJA 3BFAA 1DJWA 1U5IA 1SBJA 1XFVO 4Q04A 2WCHA 1QIWA 5CSNA 5FI2A 3UO9A 1UHHA 4OZDA 1JFKA 2P70A 1H8BA 4C0KA 2WCBA 3D73A 3IF7A 5FI7A 3I5FC 1MWNA 4P2YB 3SIAA 4GFTA 1CNPA 3D0YB 3TS5C 2BL0C 3PN7B 2CCMA 1QV0A 1B7TY 3NSIA 1S6CA 4U8DA 3OHMB 5G08A 1CLBA 2WORA 1AP4A 1SL7A 4GGFC 2KPHA 4MVFA 4DUQA 3S0BA 3TUYB 2LANA 2M1UA 1CM4A 1JF2A 3D74A 2H61C 2HPSA 1TIZA 1BF5A 2L98A 1CTRA 5KTYA 2PRUA 2KLEA 3HX4A 3PATA 2MJWB 1LVCD 1E8AA 2WCEA 3AKBA 1KSOA 1CFCA 1NX2A 5ER5A 4MEWA 5HKZA 1LA3A 1OOHA 1UHNA 2JT3A 2LC5A 1K95A 3CR2A 5CSIA 1PALA 2OS8B 2QEHA 1EL4A 2G2BA 2B1UA 1A75A 1BJFA 1QVIY 2LVIA 4QJ4B 1JSAA 3QMEA 2M29A 3OX6A 5BPJA 3B6XA 3TDUA 3VB1A 4XYNA 5DKRA 1QVIZ 2GV5A 2JZIA 3D77A 2LE9B 2L4HA 3EKJA 4PT1A 4YGEB 1NP8A 3CS1A 3IQOA 4PE7A 2BECA 2LNKA 3QRXA 2JXLA 3CDNA 2ISDA 1DJIA 1RK9A 1WRZA 1IQ5A 3KEVA 3SG4A 3M0WA 5AEQA 1TWOA 1T14A 3F45A 3GK2A 2BCBA 3D78A 5HYDA 1XK4A 1N2DA 1UUSA 2MA2A 1OQPA 4OV2A 2JPTA 2O60A 1W7IB 4OR9B 3FWBA 5FI6A 1MHOA 2LUXA 4M2OA 2LVVA 4DS7A 4P5OE 1EG3A 2KQ6A 1TOPA 3VROA 1KCYA 4MRXA 1J7OA 2K61A 3TDZA 1UHIA 3I5GB 2KHNA 2JQ6A 3EVVA 1DGUA 1RTP1 3DVJA 5AANA 1Z2CB 1KWOC 2KSPA 3EKHA 3SS3A 1XFYO 2L5YA 3UNWA 3IQQA 1F4QA 4GNKB 3K1EA 3PM2A 1XO5A 4KYNA 1S36A 2K7BA 1M31A 2WCJA 1TNQA 1J7RA 2JRFA 1KQVA 4NDBA 5DKNA 5DICA 3VRRA 1J1DA 1NCXA 4CIDA 2LM5A 4ETOA 2L2EA 3KPXA 2FCDA 2V53A 4BY5A 3JVTB 2ZN8A 2IS9A 2K7DA 4ORCB 1R6PA 5JOLA 1C3YA 1R2UA 2EC6C 4FQOA 1ORGA 1S5GY 1TNXA 3CZ2A 5I8NA 1A03A 4HRHA 2TN4A 1YR5A 2L50A 2MAZA 3GK4X 4I5LB 4ICBA 2I18A 5AXIA 4JPZB 1S1EA 1PSRA 1SY9A 1IQ3A 3TZ1A 2LV7A 4GUKA 4GPLB 4ORBB 1UWOA 3NSOA 1SR6B 1WLMA 3KF9A 3FE9A 3Q8IA 1SYMA 2LMTA 1NCZA 4OVNF 3FS7A 1NX1A 4CFRA
chains in the Genus database with same CATH topology
2P71A 3L47A 3S0GA 3CZ0A 2KPHA 3N7HA 2WC6A 3S0BA 1LS8A 3BJHA 1OOIX 3CZ1A 3D74A 3CABA 3PJIA 4INWA 3R1OA 3B7AA 3S0EA 5EL2A 2WC5A 3DZTA 1OOHA 1OOGA 1TUJA 3DYEA 2QEHA 3DXLA 3DY9A 3B88A 2QEVA 3QMEA 3R1PA 3B6XA 3VB1A 2ERBA 3D76A 3OGNA 3D77A 3S0FA 4PT1A 3L4AA 2GTEA 1QWVA 3S0DA 1P28A 3CDNA 1XFRA 1TWOA 1T14A 3D78A 4F7FA 2PQLA 3R1VA 3BFBA 2WCMA 2L2CA 4FQTA 2JPOA 2WCLA 3S0AA 4JD9A 3CYZA 3R72A 1OOFA 3FE6A 3NHTA 2QEOA 3NHIA 3K1EA 4INXA 1OW4A 2WCJA 2FJYA 1C3ZA 2QEBA 3FE8A 3V2LA 5DICA 3B87A 3BFHA 1C3YA 1ORGA 3CZ2A 3D75A 3RZSA 2QDIA 2WCKA 3BFAA 1DQEA 2WCHA 4OZDA 3B86A 2H8VA 3FE9A 2P70A 3Q8IA 3D73A 3L4LA 3NGVA 1GM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P71 A;  3L47 A;  3S0G A;  3CZ0 A;  2KPH A;  3N7H A;  2WC6 A;  3S0B A;  1LS8 A;  3BJH A;  1OOI X;  3CZ1 A;  3D74 A;  3CAB A;  3PJI A;  4INW A;  3R1O A;  3B7A A;  3S0E A;  5EL2 A;  2WC5 A;  3DZT A;  1OOH A;  1OOG A;  1TUJ A;  3DYE A;  2QEH A;  3DXL A;  3DY9 A;  3B88 A;  2QEV A;  3QME A;  3R1P A;  3B6X A;  3VB1 A;  2ERB A;  3D76 A;  3OGN A;  3D77 A;  3S0F A;  4PT1 A;  3L4A A;  2GTE A;  1QWV A;  3S0D A;  1P28 A;  3CDN A;  1XFR A;  1TWO A;  1T14 A;  3D78 A;  4F7F A;  2PQL A;  3R1V A;  3BFB A;  2WCM A;  2L2C A;  4FQT A;  2JPO A;  2WCL A;  3S0A A;  4JD9 A;  3CYZ A;  3R72 A;  1OOF A;  3FE6 A;  3NHT A;  2QEO A;  3NHI A;  3K1E A;  4INX A;  1OW4 A;  2WCJ A;  2FJY A;  1C3Z A;  2QEB A;  3FE8 A;  3V2L A;  5DIC A;  3B87 A;  3BFH A;  1C3Y A;  1ORG A;  3CZ2 A;  3D75 A;  3RZS A;  2QDI A;  2WCK A;  3BFA A;  1DQE A;  2WCH A;  4OZD A;  3B86 A;  2H8V A;  3FE9 A;  2P70 A;  3Q8I A;  3D73 A;  3L4L A;  3NGV A;  1GM0 A; 
#chains in the Genus database with same CATH topology
 2K8M B;  2F2O A;  3PN7 C;  1CFF A;  2FCE A;  1K2H A;  2M0R A;  3CWG A;  1EH2 A;  2M8U A;  3BOW A;  1DVI A;  2M9G A;  5I2Q A;  3TUY C;  2KAV A;  1YVH A;  1PSB A;  2Y4Q A;  3CZT X;  3DD4 A;  3BJH A;  4PHK A;  1OOI X;  3CZ1 A;  4JKT A;  3AAK A;  2A4J A;  3WNX B;  3PAL A;  1M39 A;  3FWC A;  2LLT A;  3I5H B;  3IVT A;  2Y1M A;  1PRW A;  1NUB A;  4MBE A;  2KNE A;  3B7A A;  3JTD B;  1DF0 A;  1UP5 A;  1U5I B;  2JNX A;  4DRW A;  3WHU B;  2WC8 A;  3OX5 A;  2NLN A;  1TN4 A;  5FYX A;  1IWQ A;  1OE9 B;  1IRJ A;  1TCO B;  2CBL A;  2WC5 A;  1KFU S;  1XA5 A;  2M7N A;  3GOF A;  4AOM A;  1J7Q A;  2GGM A;  2LVK A;  1FI6 A;  3EK4 A;  2KQY A;  2OS8 C;  1VRK A;  3CLN A;  1QX2 A;  2BE6 A;  5HLO A;  3NSK A;  2HF5 A;  3DY9 A;  1MF8 B;  2JTZ A;  3PM8 A;  1AK8 A;  2QEV A;  3NSL A;  1XFX O;  2MLF C;  3SS5 A;  1QX7 A;  3A4U B;  3PLF B;  3R1P A;  1J1E A;  1RWY A;  2I7A A;  2M97 A;  3DVM A;  1CMF A;  1UHJ A;  2ERB A;  3KHE A;  1KK8 B;  1C7W A;  1LIN A;  1YX8 A;  3LL8 B;  1OOJ A;  2WOS A;  3CTN A;  4I5N B;  4AQI A;  3CGA A;  2PVB A;  3L4A A;  1GQM A;  2NCO A;  2ZNE A;  2PSR A;  1KSM A;  3BUX B;  3O4X A;  1TNP A;  5CSF A;  3D0Y A;  1DEK A;  3NXA A;  4R1E A;  2ZRS A;  4WQ2 A;  1YUU A;  4YI9 A;  2AUC A;  5K89 A;  5HKW A;  5KSZ A;  2KBI A;  3MSE B;  1IH0 A;  1WRL A;  2SAS A;  3R1V A;  5D7F A;  1SK6 D;  1H4B A;  1B1G A;  4PE1 A;  1WY9 A;  2KI4 B;  2L2C A;  1LA0 A;  1B8R A;  3OP0 A;  4MZL A;  1L7Z A;  2AMI A;  1QAT A;  2JPO A;  1A75 B;  2BNX A;  3BUN B;  2F8P A;  5D69 A;  3I5G C;  3S0A A;  1CDP A;  3CYZ A;  2LP2 A;  4PHM A;  2K7O A;  3WXA A;  2F3Y A;  3AKA A;  1ALW A;  3R72 A;  1IJ6 A;  2JTT A;  1OOF A;  1IGV A;  4C0J A;  1IJ5 A;  2QEO A;  2KOT A;  1A2X A;  2NCP A;  4YGD B;  1XFU O;  1QTX A;  1OW4 A;  2CNP A;  1B9A A;  1V1G A;  3C1V A;  4XJK B;  1DJY A;  1B8C A;  1TNW A;  1TCF A;  1C3Z A;  2FJY A;  2L0P A;  3ZWH A;  4GGF A;  3V2L A;  1Y0V H;  4NDD A;  2G9B A;  1YRT B;  2OPO A;  3JVT C;  4HRE E;  1XYD A;  1KFU L;  4I5J A;  4OCI A;  3CR5 X;  5F6T A;  2JUL A;  3B87 A;  1SCM B;  3SS4 A;  1N0Y A;  1EXR A;  1M63 B;  1DJX A;  2LAP A;  5CPV A;  2H61 A;  4A4C A;  1NPQ A;  4CFQ A;  1JC2 A;  3RZS A;  4JQ0 D;  2BE4 A;  1Y1U A;  1EJ3 A;  1DQE A;  4PDZ A;  5TNC A;  1CB1 A;  1SR6 C;  5KU1 A;  2BKH B;  2NXQ A;  3B86 A;  2H8V A;  1KK7 Y;  4FTG A;  2BCA A;  3L4L A;  3AAJ A;  1XFW O;  3NGV A;  1NCY A;  2KI6 C;  4USL A;  5CSJ A;  3BYA A;  4E68 A;  1KK7 Z;  3VRP A;  4GGN A;  2PYQ A;  2P71 A;  3DF0 A;  1V1F A;  2E30 A;  4PCW A;  3WHT B;  1NIW A;  3KO0 A;  1L2O B;  2CT9 A;  4YGB B;  2FJU B;  3N7H A;  1J55 A;  1QLK A;  2LHL A;  2LLU A;  3DVE A;  1CFD A;  2YGU A;  5AFP A;  1UUR A;  3I5H C;  2R2I A;  1F8H A;  1K9K A;  1JBA A;  1QAS A;  1SW8 A;  4DCK A;  1JWD A;  1BU3 A;  1GJY A;  1IG5 A;  1RFJ A;  3JTD C;  3R1O A;  1SRA A;  3SIB A;  2KFF A;  4QJ5 B;  2K7C A;  4HRG A;  1LXF C;  1FI5 A;  1MXE A;  1Y1X A;  1QJT A;  2F2P A;  1Y6W A;  2JXC A;  2Y1N A;  2K2F A;  2KAX A;  2F33 A;  1F55 A;  1REC A;  1TUJ A;  2LMU A;  2K2A A;  2MHH A;  2KAY A;  3DYE A;  1QX5 B;  1JFJ A;  1AJ4 A;  4YGC B;  1OZS A;  1SSE B;  2HQW A;  2LLS A;  4AQJ A;  5AER A;  1G33 A;  2CTN A;  2WCF A;  1SL9 A;  3D10 A;  1SKT A;  3LCP C;  1Y1A A;  1YTZ C;  1C07 A;  1CFP A;  4ZCU A;  4WQ3 A;  2AAO A;  5J3X A;  1KK8 C;  2Q91 A;  3BOW B;  2ZN9 A;  1DEL A;  2BKI B;  3D76 A;  4UPG A;  1FF1 A;  1NX3 A;  3CR4 X;  1JF0 A;  3S0F A;  3DVK A;  2DOQ A;  2QAC A;  1DT7 B;  2L4I A;  3SG7 A;  3TDI A;  2LMV A;  3E3R A;  1NYA A;  1QWV A;  1QXP A;  4D1E A;  1F71 A;  2QPT A;  4MRY A;  2KFH A;  1P28 A;  1DJZ A;  1KQM B;  2BCX A;  2L5X B;  2PAS A;  3BUO B;  4HSZ A;  5DKQ A;  2JNF A;  1A4P A;  1ODB A;  1UHK A;  1XVJ A;  1YVL A;  2M49 B;  2EHB A;  1DF0 B;  2M3W A;  2EGD A;  2I94 A;  3I5I B;  2JT0 A;  4F7F A;  3EVU A;  2PQL A;  1TTX A;  2KI4 C;  2KYF A;  3BFB A;  2WCM A;  2CXJ A;  1K93 D;  4MZJ A;  4GBA A;  1Q80 A;  1SL8 A;  2BBN A;  4FQT A;  2WCL A;  4PE0 A;  3VRQ A;  2LUC A;  4MN0 A;  4C0L A;  1WLZ A;  4JD9 A;  1BT6 A;  1WDC B;  2KDH A;  4MSP A;  4OKH A;  1DJG A;  3RLZ A;  2SCP A;  2KLD A;  4JWQ A;  3FE6 A;  1OSA A;  3NHT A;  1BG1 A;  1DJH A;  1IIO A;  1S3P A;  1NSH A;  1ALV A;  2OTG B;  4INX A;  4NQG A;  4IJ7 A;  4NDC A;  3OB1 B;  4YI8 A;  3BUW B;  2ZKM X;  3EK7 A;  1AHR A;  1F4O A;  3FE8 A;  2MBX A;  1SCM C;  1XK4 C;  1B7T Z;  1RRO A;  1YUS A;  3BXK A;  1SCV A;  1BR4 B;  4L9M A;  1OMR A;  3ZNI A;  4CLN A;  5I2L A;  5HL1 A;  1S26 D;  1SNL A;  1PVB A;  2QDI A;  2WCK A;  2HET A;  4M2Q A;  1FBV A;  3OB2 B;  1DC1 A;  1ZMZ A;  4BY4 A;  1BR1 B;  1K9U A;  1W9Z A;  4MLW A;  3LK0 A;  1CLL A;  1TUZ A;  4WRI A;  2I2R E;  4MZK A;  1W7J B;  1YUT A;  1IKU A;  2KGB C;  1PUL A;  2HQ8 A;  2LHI A;  1FW4 A;  3A8R A;  3VGO A;  4A4B A;  1GM0 A;  3ICB A;  1QIV A;  1WRK A;  3I5F B;  3H4S E;  3L47 A;  3TS5 B;  3S0G A;  2BL0 B;  1L2O C;  3K21 A;  1BMO A;  2O5G A;  2M1K B;  3CZ0 A;  2JWW A;  1K90 D;  2JOJ A;  2MLE C;  2PMY A;  2WC6 A;  5HLV A;  1LS8 A;  4F0Z B;  1SPY A;  1NX0 A;  2FOT A;  2WND A;  1DMO A;  1YRU B;  1SMG A;  1ZFS A;  5JJG A;  1KFX S;  3CAB A;  1OMD A;  2ZFD A;  1S6I A;  1X02 A;  3PJI A;  4INW A;  1OMV A;  1K96 A;  3BUM B;  1CMG A;  1B4C A;  2E6W A;  3S0E A;  2M7L A;  4XJK A;  4N1G A;  5EL2 A;  3O2P A;  4I5K A;  3FIA A;  2JT8 A;  4TNC A;  1B8L A;  3DZT A;  1G4Y R;  1OOG A;  3O6B A;  2ZND A;  1LKJ A;  1MQ1 A;  4PAL A;  1DTL A;  1GGZ A;  3DXL A;  5IBW A;  1MXL C;  1B47 A;  3B88 A;  3EG5 B;  3DF0 B;  1HT9 A;  3PSR A;  2KFG A;  2GGZ A;  4PHJ A;  4CPV A;  3OGN A;  3PFV A;  4QJ3 B;  3SG2 A;  3SG3 A;  3HCM A;  3SG5 A;  1NWD A;  2KI6 D;  2GTE A;  1XFZ O;  4ZCV A;  4PHN A;  1KQM C;  1F54 A;  4IL1 A;  3S0D A;  5B8I B;  3SG6 A;  1M45 A;  3RM1 A;  3O4Y A;  3OBV A;  1C7V A;  1QV1 A;  1XFR A;  5I2O A;  1N65 A;  1QS7 A;  3I5I C;  3LLE A;  4DIR A;  1MUX A;  1M46 A;  1YX7 A;  1ZAC A;  2D8N A;  5GQQ C;  1BLQ A;  1G8I A;  1HQV A;  2VRG A;  3EK8 A;  1OZO A;  1JUO A;  2NZ0 A;  2RGI A;  5D3O A;  1RJV A;  1DGV A;  4YGA A;  1K94 A;  1EG4 A;  4M2P A;  2H2K A;  4N1F A;  1A29 A;  1PVA A;  3BQ3 A;  3O78 A;  3LK1 A;  2Y5I A;  1S6J A;  1S5G Z;  1WDC C;  2K60 A;  2PAL A;  4PE4 A;  2K0J A;  3VRN A;  2LCP A;  1CKK A;  2F3Z A;  4YBH B;  4GAO A;  1J7P A;  1K9P A;  1YUR A;  1QLS A;  5PAL A;  2LP3 A;  1FPW A;  1ZUZ A;  1AUI B;  1AVS A;  1CDM A;  1KFX L;  2L51 A;  2Q4U A;  4YRU A;  1CDL A;  3NHI A;  2KYC A;  1CDN A;  1D1O A;  2OTG C;  5I94 A;  1K8U A;  1KWO B;  2KGR A;  4ORA B;  2COL B;  2P6B B;  2BBM A;  3GK1 A;  1BOC A;  1Z4H A;  2JC2 A;  2KBM A;  1CM1 A;  2JU0 A;  1BOD A;  1MR8 A;  1F70 A;  2QEB A;  3SJS A;  1ZOT B;  2BAP A;  5ER4 X;  2MRD A;  1GGW A;  2ZRT A;  1AJ5 A;  1CLM A;  4N5X A;  1PK0 D;  3BFH A;  1TRF A;  5HKY A;  3D75 A;  2EC6 B;  3EVR A;  2LVJ A;  3BFA A;  1DJW A;  1U5I A;  1SBJ A;  1XFV O;  4Q04 A;  2WCH A;  1QIW A;  5CSN A;  5FI2 A;  3UO9 A;  1UHH A;  4OZD A;  1JFK A;  2P70 A;  1H8B A;  4C0K A;  2WCB A;  3D73 A;  3IF7 A;  5FI7 A;  3I5F C;  1MWN A;  4P2Y B;  3SIA A;  4GFT A;  1CNP A;  3D0Y B;  3TS5 C;  2BL0 C;  3PN7 B;  2CCM A;  1QV0 A;  1B7T Y;  3NSI A;  1S6C A;  4U8D A;  3OHM B;  5G08 A;  1CLB A;  2WOR A;  1AP4 A;  1SL7 A;  4GGF C;  2KPH A;  4MVF A;  4DUQ A;  3S0B A;  3TUY B;  2LAN A;  2M1U A;  1CM4 A;  1JF2 A;  3D74 A;  2H61 C;  2HPS A;  1TIZ A;  1BF5 A;  2L98 A;  1CTR A;  5KTY A;  2PRU A;  2KLE A;  3HX4 A;  3PAT A;  2MJW B;  1LVC D;  1E8A A;  2WCE A;  3AKB A;  1KSO A;  1CFC A;  1NX2 A;  5ER5 A;  4MEW A;  5HKZ A;  1LA3 A;  1OOH A;  1UHN A;  2JT3 A;  2LC5 A;  1K95 A;  3CR2 A;  5CSI A;  1PAL A;  2OS8 B;  2QEH A;  1EL4 A;  2G2B A;  2B1U A;  1A75 A;  1BJF A;  1QVI Y;  2LVI A;  4QJ4 B;  1JSA A;  3QME A;  2M29 A;  3OX6 A;  5BPJ A;  3B6X A;  3TDU A;  3VB1 A;  4XYN A;  5DKR A;  1QVI Z;  2GV5 A;  2JZI A;  3D77 A;  2LE9 B;  2L4H A;  3EKJ A;  4PT1 A;  4YGE B;  1NP8 A;  3CS1 A;  3IQO A;  4PE7 A;  2BEC A;  2LNK A;  3QRX A;  2JXL A;  3CDN A;  2ISD A;  1DJI A;  1RK9 A;  1WRZ A;  1IQ5 A;  3KEV A;  3SG4 A;  3M0W A;  5AEQ A;  1TWO A;  1T14 A;  3F45 A;  3GK2 A;  2BCB A;  3D78 A;  5HYD A;  1XK4 A;  1N2D A;  1UUS A;  2MA2 A;  1OQP A;  4OV2 A;  2JPT A;  2O60 A;  1W7I B;  4OR9 B;  3FWB A;  5FI6 A;  1MHO A;  2LUX A;  4M2O A;  2LVV A;  4DS7 A;  4P5O E;  1EG3 A;  2KQ6 A;  1TOP A;  3VRO A;  1KCY A;  4MRX A;  1J7O A;  2K61 A;  3TDZ A;  1UHI A;  3I5G B;  2KHN A;  2JQ6 A;  3EVV A;  1DGU A;  1RTP 1;  3DVJ A;  5AAN A;  1Z2C B;  1KWO C;  2KSP A;  3EKH A;  3SS3 A;  1XFY O;  2L5Y A;  3UNW A;  3IQQ A;  1F4Q A;  4GNK B;  3K1E A;  3PM2 A;  1XO5 A;  4KYN A;  1S36 A;  2K7B A;  1M31 A;  2WCJ A;  1TNQ A;  1J7R A;  2JRF A;  1KQV A;  4NDB A;  5DKN A;  5DIC A;  3VRR A;  1J1D A;  1NCX A;  4CID A;  2LM5 A;  4ETO A;  2L2E A;  3KPX A;  2FCD A;  2V53 A;  4BY5 A;  3JVT B;  2ZN8 A;  2IS9 A;  2K7D A;  4ORC B;  1R6P A;  5JOL A;  1C3Y A;  1R2U A;  2EC6 C;  4FQO A;  1ORG A;  1S5G Y;  1TNX A;  3CZ2 A;  5I8N A;  1A03 A;  4HRH A;  2TN4 A;  1YR5 A;  2L50 A;  2MAZ A;  3GK4 X;  4I5L B;  4ICB A;  2I18 A;  5AXI A;  4JPZ B;  1S1E A;  1PSR A;  1SY9 A;  1IQ3 A;  3TZ1 A;  2LV7 A;  4GUK A;  4GPL B;  4ORB B;  1UWO A;  3NSO A;  1SR6 B;  1WLM A;  3KF9 A;  3FE9 A;  3Q8I A;  1SYM A;  2LMT A;  1NCZ A;  4OVN F;  3FS7 A;  1NX1 A;  4CFR A; 
#chains in the Genus database with same CATH homology
 2P71 A;  3L47 A;  3S0G A;  3CZ0 A;  2KPH A;  3N7H A;  2WC6 A;  3S0B A;  1LS8 A;  3BJH A;  1OOI X;  3CZ1 A;  3D74 A;  3CAB A;  3PJI A;  4INW A;  3R1O A;  3B7A A;  3S0E A;  5EL2 A;  2WC5 A;  3DZT A;  1OOH A;  1OOG A;  1TUJ A;  3DYE A;  2QEH A;  3DXL A;  3DY9 A;  3B88 A;  2QEV A;  3QME A;  3R1P A;  3B6X A;  3VB1 A;  2ERB A;  3D76 A;  3OGN A;  3D77 A;  3S0F A;  4PT1 A;  3L4A A;  2GTE A;  1QWV A;  3S0D A;  1P28 A;  3CDN A;  1XFR A;  1TWO A;  1T14 A;  3D78 A;  4F7F A;  2PQL A;  3R1V A;  3BFB A;  2WCM A;  2L2C A;  4FQT A;  2JPO A;  2WCL A;  3S0A A;  4JD9 A;  3CYZ A;  3R72 A;  1OOF A;  3FE6 A;  3NHT A;  2QEO A;  3NHI A;  3K1E A;  4INX A;  1OW4 A;  2WCJ A;  2FJY A;  1C3Z A;  2QEB A;  3FE8 A;  3V2L A;  5DIC A;  3B87 A;  3BFH A;  1C3Y A;  1ORG A;  3CZ2 A;  3D75 A;  3RZS A;  2QDI A;  2WCK A;  3BFA A;  1DQE A;  2WCH A;  4OZD A;  3B86 A;  2H8V A;  3FE9 A;  2P70 A;  3Q8I A;  3D73 A;  3L4L A;  3NGV A;  1GM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...